>gi|26553530|ref|NP_757464.1| pyruvate kinase [Mycoplasma penetrans HF-2] >gi|26453536|dbj|BAC43868.1| pyruvate kinase [Mycoplasma penetrans HF-2] (498 aa)
Score = 2394, Expect = 0.0e+00, Identities = 498/498 (100%), Positives = 498/498 (100%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVINDSIYKH 498
           MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVINDSIYKH
  S:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVINDSIYKH 498
>gi|31544683|ref|NP_853261.1| pyruvate kinase [Mycoplasma gallisepticum R] >gi|31541529|gb|AAP56829.1| PykF [Mycoplasma gallisepticum R] (508 aa)
Score = 1230, Expect = 4.7e-133, Identities = 260/469 (55%), Positives = 325/469 (69%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIAN 469
           +  +KKTKI AT GPSIT K+F+LAD   P  + +++ AK+NL  LF  GV+ VR NFSHG+ EEQ +R+ L R VA E  + IS MLDT GPEIR+ + SE +  +K D  V+IYT ++ +G + +FSV DS+  YNMAKDV  G+ + VDDGKL L+VI    +   I  IA+N   +   KRINLP++ YSIPF+S KD NDI F +KNK DYIAASFVN+ D++ EIK ILK++G EH+Q+I+K+ET   IK+LD+IID SD +MVARGDLGLE+PYY+VP +EKYIIK CR K K VIVATQMLDSLE  +QPTRAEVTDVFFAVERG D TMLSGETANGMYPI AVE M KI+  SE  FDY RAI  YF  T   K   G     IA  + P R I+N  F    +V F N+   I ALSN + AA +  VTD +   T  G++YGVF   VD++  A++N
  S:    10 LNFLKKTKIVATCGPSITYKLFSLADLEDPSKQEIVQKAKENLRQLFLNGVSTVRLNFSHGNQEEQAVRMILARSVANELNLPISIMLDTNGPEIRLNQISETDNTVKKDQIVKIYTNREIVGNATEFSVSDSSKKYNMAKDVSLGSIVLVDDGKLTLQVIEVAEDFSYIRAIAKNEHKIITKKRINLPNAKYSIPFLSQKDYNDITFGLKNKVDYIAASFVNSADDIYEIKAILKQYGMEHVQVIAKVETRHAIKNLDEIIDVSDGVMVARGDLGLEIPYYEVPYWEKYIIKACRFKNKRVIVATQMLDSLEKNVQPTRAEVTDVFFAVERGCDATMLSGETANGMYPIIAVETMKKINKQSELLFDYKRAITHYFPMTDVCKTAFGERVLDIAKKICPNREIENEDFSTHFLVHFTNNREEIFALSNAKLAASVIIVTDDQNVYTGHGVDYGVFTYKVDDLTKALSN 478
>gi|13508042|ref|NP_109991.1| pyruvate kinase [Mycoplasma pneumoniae M129] >gi|2497533|sp|P78031|KPYK_MYCPN Pyruvate kinase (PK) >gi|1674229|gb|AAB96181.1| pyruvate kinase [Mycoplasma pneumoniae M129] (508 aa)
Score = 1064, Expect = 9.3e-114, Identities = 220/465 (47%), Positives = 311/465 (66%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYF-----KETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIA 468
           +K+TKI AT GP++T K++TLA  + P    +   A  N+  +   GV V+R NFSHG++EEQ +R+ +VR+VAK+  + +S MLDT GPEIRV++T+ + ++I  DS+V I TT KE+  + +FSV D++GTYNM  DV+ G  I VDDGKL L V   + +   +  +A+N   +   KR+NLP+++YSIPF+S KD  DI F + ++ DYIAASFVNT +N+++++  L     +H+++I+KIE+   + ++D II  SD IMVARGDLGLE+PYY VP +++Y+IK CR   K VI ATQMLDSLE  IQPTRAEVTDV+FAV+RG D TMLSGETANG +P+NAV VM  ID  SE FFDY   ++ Y      + + F K+ V  LA       APKR + N  F Y  +V   N+   I ALSN R AA +  +T+  +  T  G++YG+F  ++D    +++
  S:     5 LKRTKIIATCGPALTKKLWTLAMLDDPAYAAMKAEAYANIENIIKNGVTVIRLNFSHGNHEEQAVRIKIVRDVAKKLNLPVSIMLDTNGPEIRVFETAPEGLKILKDSEVVINTTTKEVAKNNQFSVSDASGTYNMVNDVKVGQKILVDDGKLSLVVKRIDTKNNQVICVAQNDHTIFTKKRLNLPNADYSIPFLSAKDLRDIDFGLTHQIDYIAASFVNTTENIKQLRDYLASKNAKHVKLIAKIESNHALNNIDGIIKASDGIMVARGDLGLEIPYYKVPYWQRYMIKACRFFNKRVITATQMLDSLEKNIQPTRAEVTDVYFAVDRGNDATMLSGETANGAFPLNAVYVMKMIDKQSETFFDYQYNLNYYMANSKARHSEFWKQVVLPLAQK----TAPKRKLINSDFKYDFVVHATNNLNEIYALSNARLAAAVIILTNDPQVYTGHGVDYGIFPYLIDQKPQSLS 470
>gi|12045070|ref|NP_072881.1| pyruvate kinase [Mycoplasma genitalium G37] >gi|1346400|sp|P47458|KPYK_MYCGE Pyruvate kinase (PK) >gi|3844816|gb|AAC71435.1| pyruvate kinase [Mycoplasma genitalium G37] >gi|166078841|gb|ABY79459.1| pyruvate kinase [synthetic Mycoplasma genitalium JCVI-1.0] (508 aa)
Score = 1031, Expect = 5.9e-110, Identities = 223/492 (45%), Positives = 317/492 (64%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKV-GTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID----AIN-----SQLPEVKKTVVVINDSI 495
           +K+TKI AT GP++T  + +L   +  E   + + A  N+ A+  +GV+V+R NFSHG +EEQ +R+ +VR+VAK   + +S MLDT GPEIR+ +T ++ ++I  DS+V I T  K I +  +F+V D++G YNM  DV  G  I VDDGKL L V   + +   +  +A+N   +   KR+NLP++ YSIPF+S+KD  DI F +    DYIAASFVNT  ++++++  LK      ++II+KIE+   + ++D II  SD IMVARGDLGLE+PYY VP +++Y+IK CR   K  I ATQMLDSLE  IQPTRAEVTDV+FAV+RG D TMLSGETA+G+YP+NAV VM KID  SE FFDY   ++ Y K +   K +    +   +     PKR + N  F Y  IV   N+   I ALSN R AA +  +T+ K   T  G++YG+F  ++D   + +  K E+I+    AIN       L ++K+ + V N++I
  S:     5 LKRTKIIATCGPALTKSLVSLKMLDDNEYAAIKKVAYANIEAIIKSGVSVIRLNFSHGTHEEQQVRIKIVRDVAKAMNIPVSIMLDTNGPEIRIVETKKEGLKITKDSEVIINTMSKMIASDNQFAVSDASGKYNMVNDVNIGQKILVDDGKLTLVVTRVDKQHNQVICVAKNDHTVFTKKRLNLPNAQYSIPFLSEKDLKDIDFGLSQGIDYIAASFVNTVADIKQLRDYLKLKNASGVKIIAKIESNHALNNIDKIIKASDGIMVARGDLGLEIPYYQVPYWQRYMIKACRFFNKRSITATQMLDSLEKNIQPTRAEVTDVYFAVDRGNDATMLSGETASGLYPLNAVAVMQKIDKQSETFFDYQYNVNYYLKNSTANKSRFWHNVVLPLTKKTVPKRKLVNSAFKYDFIVYPTNNINRIYALSNARLAAAVIILTNNKRVYTGHGVDYGIFCYLIDKNPNQL-TKAELIELAWKAINHYQAYGDLEKLKQCLAVYNETI 505
>gi|71894658|ref|YP_278766.1| pyruvate kinase [Mycoplasma synoviae 53] (478 aa)
Score = 877, Expect = 3.9e-92, Identities = 216/494 (43%), Positives = 306/494 (61%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI----GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGT-LATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLP----EVKKTVVVINDSIYKH 498
           K+TK+ AT+GPS                        + L  L  AGV  VR NFSHG YEEQ  + NL ++V+KE  + +S MLDTKGPEIRV K  +    IK  + + I TT++      G SE+ SV     +Y+M+ D+Q  +++ +DDGKL  +V+   V +G+++   +N   L+ NKRINLP  ++S+PF+S KD  D+ F ++N   Y+AASFVN+ +NV++++K+L E+GGEHI+IISKIE+  GIK++D II+ SD IMVARGDLGLEVPYY+VP Y+K II+ CR  GK VIVATQMLDS+E    PTRAEVTDV+FAVE G D TMLSGE+ANG +P+ AV+ M KI   +E  F       V+ ++   +KEK+G+ L + IA  +A K      G +Y   +V     +L++ ++N R    I  + D ++    FG+   VF   +D+ E     K +   AI +  P    +  K +VV NDSI ++
  S:     8 KRTKLVATIGPS--------------------SDNYEMLKKLVQAGVTCVRANFSHGSYEEQKNKFNLAKQVSKELNLPLSLMLDTKGPEIRVGKMKDGVQLIKQGTMLDILTTEEAYKNLEGNSEQISV-----SYDMSLDLQVNDSVLLDDGKLSTKVV--KVSKGLVQVYVQNNHKLKTNKRINLPGVDFSLPFLSPKDVEDVKFGVQNGISYVAASFVNSAENVKQLRKVLVENGGEHIEIISKIESTLGIKNIDQIIEASDGIMVARGDLGLEVPYYEVPYYQKMIIRKCREAGKPVIVATQMLDSMENSPHPTRAEVTDVYFAVELGADSTMLSGESANGGFPLEAVQTMTKISKRAEREFYSKIYYPVHLEK---IKEKLGSDLRSLIAYEIAKK----TQGNEYKFAIVLSRTGKLLKKVANYRPNTTIVGILDDEKLTNSFGIYSSVFTS-LDSKELFSEIKKDHSKAILALKPFEYSKGDKFLVVENDSIKEY 475
>gi|144575213|gb|AAZ44055.2| pyruvate kinase [Mycoplasma synoviae 53] (477 aa)
Score = 877, Expect = 4.1e-92, Identities = 216/494 (43%), Positives = 306/494 (61%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI----GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGT-LATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLP----EVKKTVVVINDSIYKH 498
           K+TK+ AT+GPS                        + L  L  AGV  VR NFSHG YEEQ  + NL ++V+KE  + +S MLDTKGPEIRV K  +    IK  + + I TT++      G SE+ SV     +Y+M+ D+Q  +++ +DDGKL  +V+   V +G+++   +N   L+ NKRINLP  ++S+PF+S KD  D+ F ++N   Y+AASFVN+ +NV++++K+L E+GGEHI+IISKIE+  GIK++D II+ SD IMVARGDLGLEVPYY+VP Y+K II+ CR  GK VIVATQMLDS+E    PTRAEVTDV+FAVE G D TMLSGE+ANG +P+ AV+ M KI   +E  F       V+ ++   +KEK+G+ L + IA  +A K      G +Y   +V     +L++ ++N R    I  + D ++    FG+   VF   +D+ E     K +   AI +  P    +  K +VV NDSI ++
  S:     7 KRTKLVATIGPS--------------------SDNYEMLKKLVQAGVTCVRANFSHGSYEEQKNKFNLAKQVSKELNLPLSLMLDTKGPEIRVGKMKDGVQLIKQGTMLDILTTEEAYKNLEGNSEQISV-----SYDMSLDLQVNDSVLLDDGKLSTKVV--KVSKGLVQVYVQNNHKLKTNKRINLPGVDFSLPFLSPKDVEDVKFGVQNGISYVAASFVNSAENVKQLRKVLVENGGEHIEIISKIESTLGIKNIDQIIEASDGIMVARGDLGLEVPYYEVPYYQKMIIRKCREAGKPVIVATQMLDSMENSPHPTRAEVTDVYFAVELGADSTMLSGESANGGFPLEAVQTMTKISKRAEREFYSKIYYPVHLEK---IKEKLGSDLRSLIAYEIAKK----TQGNEYKFAIVLSRTGKLLKKVANYRPNTTIVGILDDEKLTNSFGIYSSVFTS-LDSKELFSEIKKDHSKAILALKPFEYSKGDKFLVVENDSIKEY 474
>gi|110004596|emb|CAK98933.1| pyruvate kinase protein [Spiroplasma citri] (478 aa)
Score = 849, Expect = 8.0e-89, Identities = 200/461 (43%), Positives = 277/461 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFD--YSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +K+TKI  T+GPS               + G IE        LF  G+  +R NFSHGD+ EQ  R+   REV+ + G  IS +LDTKGPEIR       + EI + + V IY+   E    E     + T +Y+M++D++ G+ + VDDGKL+L V  + ++ GIIET A N  I++ NKRINLP  ++++PF+++KD NDI F ++   DYIAASFVNT  N++EI+K+LKE   EH+QII+KIE+  GI ++D+II  +D IMVARGDLGLE+PYYDVP +EK II+ CR  GK VIVATQML+++     PTRAEVTDV+FA E G+D TMLSGE+ANG YP  AV  MA I+  +E+ F         + +  + K+    + +T        + + N   D  Y   VV  N   L++ +S  R    I  V+   E  T FG  + +F+  VDN E
  S:    10 MKRTKIITTIGPST-------------HSPGAIEE-------LFKTGMTTIRLNFSHGDHAEQGARIVWAREVSAKIGKPISVLLDTKGPEIRAGIMKGGKQEIVAGATVTIYSLPTEYQNREGTGT-EITVSYDMSQDLKVGDVVLVDDGKLQLNV--TGIKPGIIETKAFNHHIVKTNKRINLPGVDFTLPFLAEKDINDIKFGVEQGIDYIAASFVNTAGNIKEIRKLLKECKAEHVQIIAKIESQIGINNIDEIIAAADGIMVARGDLGLEIPYYDVPYWEKIIIRKCREAGKIVIVATQMLETMTENPSPTRAEVTDVYFATELGSDATMLSGESANGDYPFIAVHTMAMINKRAEHEF---------YSKLYYEKQLEDAMNSTTGPRADIAKKLANKCKDGKYEYAVVVSNTGELLKTISKFRPNVVILGVSPLPELYTAFGSWHSIFMNKVDNYE 440
>gi|15828711|ref|NP_326071.1| pyruvate kinase [Mycoplasma pulmonis UAB CTIP] >gi|14089653|emb|CAC13413.1| PYRUVATE KINASE (PK) [Mycoplasma pulmonis] (475 aa)
Score = 836, Expect = 2.3e-87, Identities = 204/494 (41%), Positives = 301/494 (60%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKE----IGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAI----NSQLPEVKKTVVVINDSIYKH 498
           KK+K+ AT+GPS              +N  V       L  L + GV  VR NFSHGDY+EQ  + +L ++V+ +    +S MLDTKGPEIR+ K  +   +I+++  ++I+ ++++    +GTSE  SV     +YNM++D++ GN + +DDGKL  + I   V    ++  A N+  L+ NKRINLP   +S+PF+S+KD+ DI F ++N  +Y+AASFVN+ +NV E++ ILK    EH+QIISKIE+  GI+++D+II+ SD IM+ARGDLGLE+PYY+VP ++K II+ CR+ GK VIVATQMLDS+E    PTRAEVTDV+FA E G D TMLSGETA G +P+ AV+VM+KI+  +E  F Y +   +Y+       E    LATT    +A +        D+   VV      L++ ++N R    I    + K+    FG+   VFV  +++V+     K   + AI    N       + ++V N+ I +H
  S:     6 KKSKLIATIGPS-------------SDNYEV-------LKELVENGVTCVRANFSHGDYQEQKRKFDLAKKVSHDLNTPLSLMLDTKGPEIRIGKMKDGVQKIEANQSLKIWVSEEKYKNLLGTSEDISV-----SYNMSQDLKKGNQVLLDDGKL--DTIVEKVTPEYVQVRALNSHNLKTNKRINLPGVAFSLPFLSEKDKKDIAFGVENDINYVAASFVNSKENVLELRAILKSLNAEHVQIISKIESTLGIENIDEIIEHSDGIMIARGDLGLEIPYYEVPYWQKTIIRKCRNVGKVVIVATQMLDSMEHNTNPTRAEVTDVYFATELGADTTMLSGETAQGSFPVEAVKVMSKINQRAEKEF-YSK---LYYNA---QLESNAKLATTKRAKIAYEVAKQTQSGDFKYTVVLSASGNLLKKVANFRPNTSIIGFVEDKKLINAFGIVSSVFVS-LESVQKYFELKNNPLAAISTLKNYDARPGDRFLIVHNEKITQH 472
>gi|83319452|ref|YP_424208.1| pyruvate kinase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283338|gb|ABC01270.1| pyruvate kinase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (478 aa)
Score = 823, Expect = 7.7e-86, Identities = 202/494 (40%), Positives = 292/494 (59%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFK-ETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF---VKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVINDSI 495
           K +K+TK+  T+GPS                      + + +  LF+ G+  +R NFSHG YEE   R+   ++++K     IS +LDTKGPEIR+ K  + + E+     + IYT        E     + T  Y+M+ D++PG+ I +DDGKL+L V S  VE  II+  A N  I++ NKR+NLP  ++S+PF+S+KD  DI+F  +   DYIAASFVNT +NVR+IK+IL +    HIQIISKIE+  G+ ++D+II+ESD IM+ARGDLGLE+PYYDVP +EK II+ CR KGK VIVATQML+++     PTRAEVTDV+FA E G D TMLSGE+A G YP   V  M+ I+  +E  F Y +   +Y++ +    +         IA L+A K        +Y   +V      L++ +S  R    I  V+  K+  T FG+ + +F   V  +DN+++ I   +EI  +  ++L E  K +VV + +I
  S:     8 KRMKRTKVITTIGPSTH--------------------SAEAIKELFNNGMTTIRLNFSHGSYEEHGYRIKAAKKISKALNKPISIILDTKGPEIRLGKFKDNKQEVVKGQSITIYTDNYSYLNKECVQG-EMTVAYDMSVDLKPGDMILIDDGKLELTVDS--VEPQIIKATAFNHHIVKTNKRVNLPGIDFSLPFLSEKDEKDILFGCEQGVDYIAASFVNTAENVRQIKEILTKANANHIQIISKIESQVGLDNIDEIIEESDGIMIARGDLGLEIPYYDVPYWEKIIIRKCREKGKIVIVATQMLETMTENPSPTRAEVTDVYFATELGADATMLSGESAAGDYPFLTVHTMSTINKRAEVEF-YNK---IYYQVQLDNARNSTSGPRAEIADLLATK----TKDGEYKYAIVLSKTGELLKTISKFRPNVTILGVSPDKKLWTSFGVWHSIFMNKVDTLDNLDNNIEKLSEIAKSWGAKLGE--KVLVVRSTAI 472
>gi|50364991|ref|YP_053416.1| pyruvate kinase [Mesoplasma florum L1] >gi|50363547|gb|AAT75532.1| pyruvate kinase [Mesoplasma florum L1] (478 aa)
Score = 818, Expect = 3.2e-85, Identities = 198/470 (42%), Positives = 280/470 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDN---VEHAIANKTEI 473
           +K+TKI  T GPS           N+PE           +  LF+ G+  +R NFSHGDYEEQ  R+   ++V +E G  +S +LDTKGPEIRV K  + + E+ ++  + IYT  +     E  S  + T  Y+M+ D++ G+TI +DDGKL++ V    V+ G+++ IA N  +++ NKR+NLP  ++S+PF++ KD NDI + ++   DYIAASFVN+ +NV+EI+ IL E  G  IQIISKIE+  GI ++D II+ SD IM+ARGDLGLE+PYYDVP +EK +I+ CR  GK VIVATQML+++     PTRAEVTDV+FA E G D TMLSGE+A G YP   V  MA I+  +E  F Y +A   Y  +    K         IA  +A +R  D     Y   VV      L++ +S  R    I  V++ +   T FG+ + +F+    N   +E  +A  +EI
  S:    10 VKRTKIITTTGPST----------NEPEQ----------IRELFENGMTTIRLNFSHGDYEEQGYRIAGAKKVREELGKPVSILLDTKGPEIRVGKFVDGKQEVTANQSITIYTDAESFKNKECLSG-EMTVAYDMSVDLKIGDTILIDDGKLEMTV--EEVKPGVVKAIAFNNHLVKTNKRVNLPGVDFSMPFLAQKDINDIKYGVEQGVDYIAASFVNSAENVKEIRDILAEANGSDIQIISKIESQVGIDNIDAIIEASDGIMIARGDLGLEIPYYDVPYWEKIMIRKCREAGKVVIVATQMLETMTENPAPTRAEVTDVYFATELGADATMLSGESAAGDYPFITVNTMATINKRAEIEF-YKKA--YYQTQLENAKNSTSGPRADIAMDLA-ERTRDGQ---YEFAVVLSRTGALLKTISKFRPNVTILGVSESERLWTAFGVWHSIFMNKTANLLELEENVAQISEI 452
>gi|42560809|ref|NP_975260.1| pyruvate kinase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492305|emb|CAE76902.1| pyruvate kinase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (478 aa)
Score = 811, Expect = 1.8e-84, Identities = 196/496 (39%), Positives = 287/496 (57%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFK-ETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVINDSIYK 497
           K +K+TK+  T+GPS                      + + +  LF+ G+  +R NFSHG YEE   R+   ++++K     IS MLDTKGPEIR+ K  + + E+     + IYT        E     + T  Y+M+ D++P + I +DDGKL+L V S  VE  II+  A N  I++ NKR+NLP  ++S+PF+S+KD  DI+F  +   DYIAASFVNT +NVR+IK+IL +    HIQIISKIE+  G+ ++D+II+ESD IM+ARGDLGLE+PYYDVP +EK II+ CR KGK VIVATQML+++     PTRAEVTDV++A E G D TMLSGE+A G YP   V  M+ I+  +E  F Y +   +Y++ +    +         IA L+A K        +Y   +V      L++ +S  R    I  V+  K+  T FG+ + +F+  VD +++   N  ++ +   S   +  + V+V+  +  K
  S:     8 KRMKRTKVITTIGPSTH--------------------SAEAIKELFNNGMTTIRLNFSHGSYEEHGYRIKAAKKISKALNKPISIMLDTKGPEIRLGKFKDNKQEVVKGQAITIYTDNYSYLNKECVQG-EMTVAYDMSVDLKPEDMILIDDGKLELTVDS--VEPQIIKATAFNHHIVKTNKRVNLPGIDFSLPFLSEKDEKDILFGCEQDVDYIAASFVNTAENVRQIKEILTKANANHIQIISKIESQVGLDNIDEIIEESDGIMIARGDLGLEIPYYDVPYWEKIIIRKCREKGKIVIVATQMLETMTENPSPTRAEVTDVYYATELGADATMLSGESAAGDYPFLTVHTMSTINKRAEVEF-YNK---IYYQVQLDNARNSTSGPRAEIADLLATK----TKDGEYKYAIVLSKTGELLKTISKFRPNVTILGVSPDKKLWTSFGVWHSIFMNKVDTLDNLDNNVEKLSEIAKSWGAKFGEKVLVVRSTAIK 473
>gi|47459156|ref|YP_016018.1| pyruvate kinase [Mycoplasma mobile 163K] >gi|47458485|gb|AAT27807.1| pyruvate kinase [Mycoplasma mobile 163K] (483 aa)
Score = 803, Expect = 1.8e-83, Identities = 200/455 (43%), Positives = 287/455 (63%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSE----KFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKV 459
           K++K+ AT+GPS              +NK +       L  +   G+  VR NFSHGD+ EQ  +  L +EVAKE  + +S MLDTKGPEIRV K  +   +I+    + + T +    T E    KF+V     ++ M KDV+ G+ I  DDGKL    I + V+ GI+E    N+ +L+ NKRIN+P +  S+ F+S KD+ DIIF IKN  +YIAASFVN+  +V +++K+LK++ GEHIQIISKIE++ GI+++D+II+ SD IM+ARGDLGLE+PY++VP YEK II+ CR+ GK VIVATQMLDS+E   QPTRAEV+DV++A E G D TMLSGE+ANG +P+ +VEVM+ I+  +E  F Y +       ET  ++  VG + + +A+ VA K V++    DY   V+     RL++ ++  R    I  V +  +    FG+ + VF+ V
  S:    15 KRSKMIATIGPS-------------SQNKEI-------LKQMMLKGMTTVRANFSHGDHAEQLNKFVLAKEVAKELNLPMSLMLDTKGPEIRVGKMKDGSQKIEVGKIITVLTDEVSYKTFEGIPTKFTV-----SHRMDKDVKVGSYILFDDGKLT--TIVTGVKSGIVEVKTINSHVLKSNKRINIPGAQLSLEFLSKKDKEDIIFGIKNDVNYIAASFVNSKQDVLDLRKLLKDNNGEHIQIISKIESVFGIENIDEIIEASDGIMIARGDLGLEIPYFEVPFYEKQIIRKCRNVGKPVIVATQMLDSMEKLPQPTRAEVSDVYWATELGADATMLSGESANGDFPVESVEVMSTINRRAEKEF-YNKLYYPAHLET-LIQNPVG-VHSKLASEVALK-VMNG---DYKFSVILSETGRLLKEIARFRPNTVIIGVINNDKLIHGFGITHSVFMSV 439
>gi|71893479|ref|YP_278925.1| pyruvate kinase [Mycoplasma hyopneumoniae J] >gi|72080466|ref|YP_287524.1| pyruvate kinase [Mycoplasma hyopneumoniae 7448] >gi|71851606|gb|AAZ44214.1| pyruvate kinase [Mycoplasma hyopneumoniae J] >gi|71913590|gb|AAZ53501.1| pyruvate kinase [Mycoplasma hyopneumoniae 7448] (475 aa)
Score = 796, Expect = 1.1e-82, Identities = 191/455 (41%), Positives = 282/455 (61%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI----GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD----YGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKV 459
           K+TKI AT+GPS         D+         E  KK    L  +GV+V+R NFSHG+Y+EQ  + +  R+++ E  + IS MLDTKGPEIR+ K  E   +I ++ ++ + T         GT++  +V     ++ + KD++ G+ I  DDGKL+  VI   +E G +    +N+ IL+ NKR+NLP   +S+PF+S KD +DI+F I    +YIAASFVN+G+NVRE++ +L ++GG HIQIISKIE+  G++++D+II+ SD IM+ARGDLGLEVPY +VP  +K II+ CR  GKTV+VATQMLDS+E   QPTRAEVTDV++A E G D TMLSGE+A G +PI +V+VMA I+  +E  F     Y + + V  + +  ++ K+   A  +A L   K +           VV     +L++ ++  R    +  V + ++    FG+   VFV +
  S:     7 KRTKIIATIGPSTQ-------DY---------EVLKK----LVLSGVSVIRANFSHGNYQEQKQKFDSARKLSNELKIPISIMLDTKGPEIRIGKILEGSQKILANQRLTVLTDSDSYQNFQGTAQIITV-----SHQIDKDLKIGDKILFDDGKLQSVVIE--IEPGKVVVRTKNSHILKSNKRLNLPGVAFSLPFLSQKDIDDILFGINENVNYIAASFVNSGENVRELRTLLDQNGGGHIQIISKIESRLGLENIDEIIELSDGIMIARGDLGLEVPYEEVPFQQKRIIRKCRFAGKTVVVATQMLDSMEKSSQPTRAEVTDVYWATELGADATMLSGESAQGQFPIESVQVMAVINKRAEKEFYNKLFYAKQLAVITENSRGLRAKI---AHKLAHLAYEKEI--------KYTVVLSRTGQLLREIAKFRPNTAVIGVINNEKLINGFGITSSVFVSI 431
>gi|54020111|ref|YP_115768.1| pyruvate kinase [Mycoplasma hyopneumoniae 232] >gi|53987284|gb|AAV27485.1| pyruvate kinase [Mycoplasma hyopneumoniae 232] (478 aa)
Score = 794, Expect = 1.8e-82, Identities = 190/455 (41%), Positives = 282/455 (61%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI----GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD----YGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKV 459
           K+TKI AT+GPS         D+         E  KK    L  +GV+V+R NFSHG+Y+EQ  + +  R+++ E  + IS MLDTKGPEIR+ K  E   +I ++ ++ + T         GT++  +V     ++ + KD++ G+ I  DDGKL+  VI   +E G +    +N+ +L+ NKR+NLP   +S+PF+S KD +DI+F I    +YIAASFVN+G+NVRE++ +L ++GG HIQIISKIE+  G++++D+II+ SD IM+ARGDLGLEVPY +VP  +K II+ CR  GKTV+VATQMLDS+E   QPTRAEVTDV++A E G D TMLSGE+A G +PI +V+VMA I+  +E  F     Y + + V  + +  ++ K+   A  +A L   K +           VV     +L++ ++  R    +  V + ++    FG+   VFV +
  S:    10 KRTKIIATIGPSTQ-------DY---------EVLKK----LVLSGVSVIRANFSHGNYQEQKQKFDSARKLSNELKIPISIMLDTKGPEIRIGKILEGSQKILANQRLTVLTDSDSYQNFQGTAQIITV-----SHQIDKDLKIGDKILFDDGKLQSVVIE--IEPGKVVVRTKNSHVLKSNKRLNLPGVAFSLPFLSQKDIDDILFGINENVNYIAASFVNSGENVRELRTLLDQNGGGHIQIISKIESRLGLENIDEIIELSDGIMIARGDLGLEVPYEEVPFQQKRIIRKCRFAGKTVVVATQMLDSMEKSSQPTRAEVTDVYWATELGADATMLSGESAQGQFPIESVQVMAVINKRAEKEFYNKLFYAKQLAVITENSRGLRAKI---AHKLAHLAYEKEI--------KYTVVLSRTGQLLREIAKFRPNTAVIGVINNEKLINGFGITSSVFVSI 434
>gi|148377411|ref|YP_001256287.1| pyruvate kinase [Mycoplasma agalactiae PG2] >gi|148291457|emb|CAL58842.1| Pyruvate kinase (PK) [Mycoplasma agalactiae PG2] (478 aa)
Score = 775, Expect = 2.9e-80, Identities = 192/491 (39%), Positives = 295/491 (60%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTK---KEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLP----EVKKTVVVINDSI 495
           K++K+ AT+GPS         ++N              + +L +AG   +R NFSHG +EE   +  + ++++++  + +S +LDTKGPEIRV K       I ++++++I+TT+   KE+ G +++ SV     +Y+M+KD+  G+ +  DDGKL    + + V +GI+     N+  L+ NKRINLP  ++S+PF+S+KD ND+ F I    +YIAASFVN+  NV +++K+L ++   HIQIISKIE+  GI ++D+II+ SD IMVARGDLGLE+PYYDVP +EK +++ CR  GK VI+ATQMLDS+ET   PTRAEVTDV++A+E G+D TMLSGETA+G +P+ AV  M+ I+  +EN F      DV  +E              IA  VA +     +G DY   VV     +L++ ++  R    I  +         FG+   V+   +D++E+    K     A+   +P    +  + +VV N+SI
  S:     6 KRSKLVATIGPSSD-------NYN-------------TMRSLIEAGATCIRVNFSHGSHEEHLNKFKIAKKISEDMHLPVSLILDTKGPEIRVGKMKGGAQFIPANTEIKIHTTEAKYKELEGDAKELSV-----SYDMSKDLNDGDYVLFDDGKL--SAVVTKVAKGIVVVKTLNSHNLKTNKRINLPGVDFSLPFLSEKDINDVKFGISQGVNYIAASFVNSAKNVNDLRKLLIDNNASHIQIISKIESHLGIDNIDEIIEASDGIMVARGDLGLEIPYYDVPYFEKLMVRKCREAGKPVIIATQMLDSMETNPHPTRAEVTDVYYAIELGSDATMLSGETASGAHPLEAVITMSNINKRAENEFYDNTYYDVQLEEVRRKSNLKENKRARIAYEVANRA---RYG-DYKFAVVLSRTGQLLKEVAKFRPNTIIIGILKDANMIGEFGITSSVWTS-LDSIEYFDLIKENSDKALEILMPYGINKGDRIIVVENESI 472
>gi|171920604|ref|ZP_02931855.1| pyruvate kinase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178743|ref|ZP_02964556.1| pyruvate kinase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024319|ref|ZP_02997000.1| pyruvate kinase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039662|ref|ZP_02998360.1| pyruvate kinase [Ureaplasma urealyticum serovar 8] >gi|188518529|ref|ZP_03003996.1| pyruvate kinase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524078|ref|ZP_03004165.1| pyruvate kinase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530836|ref|ZP_03005135.1| pyruvate kinase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568699|ref|ZP_03005461.1| pyruvate kinase [Ureaplasma urealyticum serovar 2] >gi|188592509|ref|ZP_03005841.1| pyruvate kinase [Ureaplasma urealyticum serovar 10] >gi|195867697|ref|ZP_03079698.1| pyruvate kinase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903314|gb|EDT49603.1| pyruvate kinase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209350|gb|EDU06393.1| pyruvate kinase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018998|gb|EDU57038.1| pyruvate kinase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997928|gb|EDU67025.1| pyruvate kinase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659880|gb|EDX53260.1| pyruvate kinase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660552|gb|EDX53808.1| pyruvate kinase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (474 aa)
Score = 764, Expect = 5.5e-79, Identities = 167/363 (46%), Positives = 233/363 (64%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           M  KT+I AT+GP+ T      A+FN  +N+   +    ++  L   GVN+ R N SHG+ E    R  L++E+A +  + +  + DTKGPEIRV + SE    I  DS+V I+  K+ IG   +FSV+D++  YNM  DV+  + I VDDGKL L V   +  + II TIA+N  +L+ NKR+NLPDSNYS+PF+S KD +DI  A   K  Y+A SFV+    + E+K +LK+      ++I+KIET   I +L++II  ++ +MVARGDLGLEVP+Y +P Y+  I++ C    K  I+ATQMLDSLE  + PTRAEVTDV++AV +  + TMLSGETA G+ PINAV VM  I + +EN
  S:     1 MFSKTRIIATVGPATTKSFSNWAEFNDLKNQNEAQQVNSHIKNLILNGVNIFRMNLSHGEQEIHIFRSQLIKEIAHDLKIKVEILFDTKGPEIRVCQMSEDNF-IAKDSEVIIHCQKQIIGKRNEFSVIDASKKYNMINDVKANDRILVDDGKLILVVKKIDSSKNIIYTIAKNNHVLKTNKRLNLPDSNYSLPFLSKKDIDDINLAANLKIPYLALSFVSNVKQINEVKALLKDQSFTP-KLIAKIETQEAIDNLEEIIKNTNGVMVARGDLGLEVPFYKIPIYQNKIVELCHKYNKYCIIATQMLDSLERNLLPTRAEVTDVYYAVNQKVNATMLSGETAAGIDPINAVSVMQSIILETEN 361
>gi|193216462|ref|YP_001999704.1| pyruvate kinase [Mycoplasma arthritidis 158L3-1] >gi|193001785|gb|ACF07000.1| pyruvate kinase [Mycoplasma arthritidis 158L3-1] (472 aa)
Score = 759, Expect = 1.9e-78, Identities = 186/452 (41%), Positives = 261/452 (57%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTT----KKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++TKI AT+GPS                          +  L +AGV  +R NFSHGD E  T   NL REV++E  V IS +LDTKGPEIR+ K  +    +K  S V I T     K  +G  +  +V     +Y M KD+  G  + +DDGKL    I   ++  II    +N  +L+ NKR+N+P  ++S+PFMS KDR DII+  K   D+IAASFVN+  NV EI++ILK+   EHIQI SKIE+ TGI ++D+II+ SDSIM+ARGDLGLE+PYY+VP +EK II  CR   K VIVATQMLDS+E    PTRAE++DV++A E G   TM SGETA+G YP+ A++ MA I+  +E  +    A     +  P  K ++G +A  +      K       F Y+  +    D +L++ ++  +    +  +    +  T FG+ +G+F
  S:     6 QRTKIVATIGPS--------------------SNTYDVMKQLVEAGVTTIRVNFSHGDEEIHTNVYNLAREVSRELNVPISLLLDTKGPEIRIGKMKDDACLLKKGSIVTIKTDENSYKNLVGDDKVITV-----SYRMDKDMHVGAKVLLDDGKLV--TIVKEIKPEIILVEVQNDHVLKTNKRVNIPGIDFSMPFMSPKDREDIIWGAKYGVDFIAASFVNSAKNVHEIREILKQANAEHIQICSKIESQTGIDNIDEIIEASDSIMIARGDLGLEIPYYEVPYWEKKIIAKCRKANKEVIVATQMLDSMEKTPLPTRAEISDVYWATELGASATMTSGETASGQYPVEAIKTMATINHRAEQEYFNEIATSCNCQCQP--KCELGHVAKEL------KEKTKTGDFPYT--IAISEDGKLLKKIAKYKPNTTVIALVSDPKIETAFGITFGIF 424
>gi|167972089|ref|ZP_02554366.1| pyruvate kinase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700736|gb|EDU19018.1| pyruvate kinase [Ureaplasma parvum serovar 6 str. ATCC 27818] (474 aa)
Score = 753, Expect = 9.1e-78, Identities = 167/357 (46%), Positives = 234/357 (65%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M  KT+I AT+GP+ T       +FN   N    +    N+  L  +GVN+ R N SHGD +    R  L++++A E  + +  + DTKGPEIRV + S+    IK +S+V I+  +K +G+  +FSV D+TG YNM  DV+  + I +DDGKL L V   +  + II T A+N++ L+ NKR+NLPD+NYS+PF+S KD +DI  A+K K  Y+A SF++    + E+KK+LKE      ++I+KIET   I +L++II  +D IMVARGDLGLEVP+Y +P Y+  I++ C    K  I+ATQMLDSLE  I PTRAEVTDV++AV++  + TMLSGETA G+ PINAV+VM  I
  S:     1 MFSKTRIIATVGPATTKLFSNWLEFNDLNNINDAQQVCINIKDLILSGVNIFRMNLSHGDQKIHLFRTQLIKKIADELKIKVEILFDTKGPEIRVCEMSDNNFIIK-NSEVIIHCKEKVLGSFNEFSVTDATGQYNMISDVRINHRILIDDGKLILIVKKIDFLKNIIYTTAKNSYSLKTNKRLNLPDANYSLPFLSKKDIDDINLAVKLKIPYLALSFISNIKQINEVKKLLKESSFIP-KLIAKIETQEAIDNLEEIIKNTDGIMVARGDLGLEVPFYKIPIYQNKIVELCHKYNKYCIIATQMLDSLERNIIPTRAEVTDVYYAVKQKVNATMLSGETAAGIDPINAVQVMKSI 355
>gi|168308447|ref|ZP_02691122.1| pyruvate kinase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902877|gb|EDT49166.1| pyruvate kinase [Ureaplasma parvum serovar 1 str. ATCC 27813] (474 aa)
Score = 750, Expect = 2.5e-77, Identities = 166/357 (46%), Positives = 235/357 (65%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M  KT+I AT+GP+ T       +FN   N    +    N+  L  +GVN+ R N SHGD +    R  L++++A E  + +  + DTKGPEIRV + S+    IK +S+V I+  +K +G+  +FSV D+TG YNM  DV+  + I +DDGKL L V   +  + II T A+N++ L++NKR+NLPD+NYS+PF+S KD +DI  A+K K  Y+A SF++    + E+KK+LK+      ++I+KIET   I +L++II  +D IMVARGDLGLEVP+Y +P Y+  I++ C    K  I+ATQMLDSLE  I PTRAEVTDV++AV++  + TMLSGETA G+ PINAV+VM  I
  S:     1 MFSKTRIIATVGPATTKLFSNWLEFNDLNNINDAQQVCINIKDLILSGVNIFRMNLSHGDQKIHLFRTQLIKKIADELKIKVEILFDTKGPEIRVCEMSDNNFIIK-NSEVIIHCKEKVLGSFNEFSVTDATGQYNMISDVKINHRILIDDGKLILIVKKIDFLKNIIYTTAKNSYSLKKNKRLNLPDANYSLPFLSKKDIDDINLAVKLKIPYLALSFISNIKQINEVKKLLKKSSFIP-KLIAKIETQEAIDNLEEIIKNTDGIMVARGDLGLEVPFYKIPIYQNKIVELCHKYNKYCIIATQMLDSLERNIIPTRAEVTDVYYAVKQKVNATMLSGETAAGIDPINAVQVMKSI 355
>gi|110802936|ref|YP_697671.1| pyruvate kinase [Clostridium perfringens SM101] >gi|110683437|gb|ABG86807.1| pyruvate kinase [Clostridium perfringens SM101] (467 aa)
Score = 746, Expect = 6.0e-77, Identities = 188/488 (38%), Positives = 276/488 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVI 491
           +++TK+  T+GP+              EN+ +       L  + +AG+N  R NFSHGD+EE   R+  VRE++K+ G  ++ +LDTKGPEIR  K    +VE+ + ++  IY   ++I G + K SV     TY  +AKDV+ G+TI +DDG + LEV+S  VE   ++ + RNT ++  +K +N+P  +  +P M+DKDR D+IF  +   + +AASF+   ++V+ I+++L  +GG  IQI SKIE   G+ ++D II+ SD IMVARGDLG+E+P  DVP+ +K II+ C + GK VI ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGE+ANG +P+ AVE M KI   SE    Y  A     K  P +   +   A   A           H    ++IV         + +S  R  API  VT  +  A +  L +GV+  V +N    + N  EI  A N+   +   T VV+
  S:     1 MRRTKLVCTIGPA-------------SENEEI-------LTKIIEAGMNASRHNFSHGDHEEHKGRMVKVREISKKLGKEVAILLDTKGPEIRTGKFEPSKVELTAGTEFTIYAGAEDIIGDTTKCSV-----TYAGLAKDVKAGDTILIDDGLVGLEVVS--VEGNAVKCVVRNTGLVGTHKGVNVPGVSIKLPAMTDKDRADLIFGCEMGVNMVAASFIRKAEDVKAIREVLVANGGADIQIFSKIENQEGVDNIDAIIEASDGIMVARGDLGVEIPMEDVPSVQKMIIEKCNNAGKPVITATQMLDSMMRNPRPTRAEVSDVTNAILDGTDAIMLSGESANGSWPVEAVETMVKIATKSEEMLSYELASSKAKKHIPAVPGVISRAACNAA-----------HELKSAAIVSLTQSGATAKRISQCRPDAPIVTVTPNERVAKKVALCFGVYPVVAENA--TMENAVEI--AKNAGFVKANDTAVVV 448
>gi|18309344|ref|NP_561278.1| pyruvate kinase [Clostridium perfringens str. 13] >gi|168209115|ref|ZP_02634740.1| pyruvate kinase [Clostridium perfringens B str. ATCC 3626] >gi|168212729|ref|ZP_02638354.1| pyruvate kinase [Clostridium perfringens CPE str. F4969] >gi|168216558|ref|ZP_02642183.1| pyruvate kinase [Clostridium perfringens NCTC 8239] >gi|182624529|ref|ZP_02952312.1| pyruvate kinase [Clostridium perfringens D str. JGS1721] >gi|18144020|dbj|BAB80068.1| pyruvate kinase [Clostridium perfringens str. 13] >gi|170712955|gb|EDT25137.1| pyruvate kinase [Clostridium perfringens B str. ATCC 3626] >gi|170715713|gb|EDT27895.1| pyruvate kinase [Clostridium perfringens CPE str. F4969] >gi|177910337|gb|EDT72718.1| pyruvate kinase [Clostridium perfringens D str. JGS1721] >gi|182381397|gb|EDT78876.1| pyruvate kinase [Clostridium perfringens NCTC 8239] (467 aa)
Score = 746, Expect = 6.0e-77, Identities = 188/488 (38%), Positives = 276/488 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKE-IGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVI 491
           +++TK+  T+GP+              EN+ +       L  + +AG+N  R NFSHGD+EE   R+  VRE++K+ G  ++ +LDTKGPEIR  K    +VE+ + ++  IY   ++ IG + K SV     TY  +AKDV+ G+TI +DDG + LEV+S  VE   ++ + RNT ++  +K +N+P  +  +P M+DKDR D+IF  +   + +AASF+   ++V+ I+++L  +GG  IQI SKIE   G+ ++D II+ SD IMVARGDLG+E+P  DVP+ +K II+ C + GK VI ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGE+ANG +P+ AVE M KI   SE    Y  A     K  P +   +   A   A           H    ++IV         + +S  R  API  VT  +  A +  L +GV+  V +N    + N  EI  A N+   +   T VV+
  S:     1 MRRTKLVCTIGPA-------------SENEEI-------LTKIIEAGMNASRHNFSHGDHEEHKGRMVKVREISKKLGKEVAILLDTKGPEIRTGKFEPSKVELTAGTEFTIYAGAEDVIGDTTKCSV-----TYAGLAKDVKAGDTILIDDGLVGLEVVS--VEGNAVKCVVRNTGLVGTHKGVNVPGVSIKLPAMTDKDRADLIFGCEMGVNMVAASFIRKAEDVKAIREVLVANGGADIQIFSKIENQEGVDNIDAIIEASDGIMVARGDLGVEIPMEDVPSVQKMIIEKCNNAGKPVITATQMLDSMMRNPRPTRAEVSDVTNAILDGTDAIMLSGESANGSWPVEAVETMVKIATKSEEMLSYELASSKAKKHIPAVPGVISRAACNAA-----------HELKSAAIVSLTQSGATAKRISQCRPDAPIVTVTPNERVAKKVALCFGVYPVVAENA--TMENAVEI--AKNAGFVKANDTAVVV 448
>gi|13357744|ref|NP_078018.1| pyruvate kinase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168282293|ref|ZP_02689960.1| pyruvate kinase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|170762456|ref|YP_001752268.1| pyruvate kinase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11357018|pir||B82923 pyruvate kinase UU186 [imported] - Ureaplasma urealyticum >gi|6899150|gb|AAF30593.1|AE002118_3 pyruvate kinase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828033|gb|ACA33295.1| pyruvate kinase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675828|gb|EDT87733.1| pyruvate kinase [Ureaplasma parvum serovar 14 str. ATCC 33697] (474 aa)
Score = 746, Expect = 6.3e-77, Identities = 165/357 (46%), Positives = 234/357 (65%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M  KT+I AT+GP+ T       +FN   N    +    N+  L  +GVN+ R N SHGD +    R  L++++A E  + +  + DTKGPEIRV + S+    IK +S+V I+  +K +G+  +FSV D+TG YNM  DV+  + I +DDGKL L V   +  + II T A+N++ L+ NKR+NLPD+NYS+PF+S KD +DI  A+K K  Y+A SF++    + E+K++LK+      ++I+KIET   I +L++II  +D IMVARGDLGLEVP+Y +P Y+  I++ C    K  I+ATQMLDSLE  I PTRAEVTDV++AV++  + TMLSGETA G+ PINAV+VM  I
  S:     1 MFSKTRIIATVGPATTKLFSNWLEFNDLNNINDAQQVCINIKDLILSGVNIFRMNLSHGDQKIHLFRTQLIKKIADELKIKVEILFDTKGPEIRVCEMSDNNFIIK-NSEVIIHCKEKVLGSFNEFSVTDATGQYNMISDVKINHRILIDDGKLILIVKKIDFLKNIIYTTAKNSYSLKTNKRLNLPDANYSLPFLSKKDIDDINLAVKLKIPYLALSFISNIKQINEVKQLLKKSSFIP-KLIAKIETQEAIDNLEEIIKNTDGIMVARGDLGLEVPFYKIPIYQNKIVELCHKYNKYCIIATQMLDSLERNIIPTRAEVTDVYYAVKQKVNATMLSGETAAGIDPINAVQVMKSI 355
>gi|110799327|ref|YP_694808.1| pyruvate kinase [Clostridium perfringens ATCC 13124] >gi|110673974|gb|ABG82961.1| pyruvate kinase [Clostridium perfringens ATCC 13124] (467 aa)
Score = 746, Expect = 6.7e-77, Identities = 188/488 (38%), Positives = 276/488 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKE-IGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVI 491
           +++TK+  T+GP+              EN+ +       L  + +AG+N  R NFSHGD+EE   R+  VRE++K+ G  ++ +LDTKGPEIR  K    +VE+ + ++  IY   ++ IG + K SV     TY  +AKDV+ G+TI +DDG + LEV+S  VE   ++ + RNT ++  +K +N+P  +  +P M+DKDR D+IF  +   + +AASF+   ++V+ I+++L  +GG  IQI SKIE   G+ ++D II+ SD IMVARGDLG+E+P  DVP+ +K II+ C + GK VI ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGE+ANG +P+ AVE M KI   SE    Y  A     K  P +   +   A   A           H    ++IV         + +S  R  API  VT  +  A +  L +GV+  V +N    + N  EI  A N+   +   T VV+
  S:     1 MRRTKLVCTIGPA-------------SENEEI-------LTKIIEAGMNASRHNFSHGDHEEHKGRMVKVREISKKLGKEVAILLDTKGPEIRTGKFEPSKVELTAGTEFTIYAGAEDVIGDTTKCSV-----TYAGLAKDVKAGDTILIDDGLVGLEVVS--VEGNAVKCVVRNTGLVGTHKGVNVPGVSIKLPAMTDKDRADLIFGCEMGVNMVAASFIRKAEDVKAIREVLIANGGADIQIFSKIENQEGVDNIDAIIEASDGIMVARGDLGVEIPMEDVPSVQKMIIEKCNNAGKPVITATQMLDSMMRNPRPTRAEVSDVTNAILDGTDAIMLSGESANGSWPVEAVETMVKIATKSEEMLSYELASSKAKKHIPAVPGVISRAACNAA-----------HELKSAAIVSLTQSGATAKRISQCRPDAPIVTVTPNERVAKKVALCFGVYPVVAENA--TMENAVEI--AKNAGFVKANDTAVVV 448
>gi|168204458|ref|ZP_02630463.1| pyruvate kinase [Clostridium perfringens E str. JGS1987] >gi|170664107|gb|EDT16790.1| pyruvate kinase [Clostridium perfringens E str. JGS1987] (467 aa)
Score = 744, Expect = 1.3e-76, Identities = 186/488 (38%), Positives = 275/488 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKE-IGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVI 491
           +++TK+  T+GP+              EN+ +       L  + +AG+N  R NFSHGD+EE   R+  VRE++K+ G  ++ +LDTKGPEIR  K    +VE+ + ++  IY   ++ IG + K SV  +     +AKDV+ G+TI +DDG + LEV+S  VE   ++ + RNT ++  +K +N+P  +  +P M+DKDR D+IF  +   + +AASF+   ++V+ I+++L  +GG  IQI SKIE   G+ ++D II+ SD IMVARGDLG+E+P  DVP+ +K II+ C + GK VI ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGE+ANG +P+ AVE M KI   SE    Y  A     K  P +   +   A   A           H    ++IV         + +S  R  API  VT  +  A +  L +GV+  V +N    + N  EI  A N+   +   T VV+
  S:     1 MRRTKLVCTIGPA-------------SENEEI-------LTKIIEAGMNASRHNFSHGDHEEHKGRMVKVREISKKLGKEVAILLDTKGPEIRTGKFEPSKVELTAGTEFTIYAGAEDVIGDTTKCSVKYA----GLAKDVKAGDTILIDDGLVGLEVVS--VEGNAVKCVVRNTGLVGTHKGVNVPGVSIKLPAMTDKDRADLIFGCEMGVNMVAASFIRKAEDVKAIREVLVANGGADIQIFSKIENQEGVDNIDAIIEASDGIMVARGDLGVEIPMEDVPSVQKMIIEKCNNAGKPVITATQMLDSMMRNPRPTRAEVSDVTNAILDGTDAIMLSGESANGSWPVEAVETMVKIATKSEEMLSYELASSKAKKHIPAVPGVISRAACNAA-----------HELKSAAIVSLTQSGATAKRISQCRPDAPIVTVTPNERVAKKVALCFGVYPVVAENA--TMENAVEI--AKNAGFVKANDTAVVV 448
>gi|47828|emb|CAA40994.1| pyruvate kinase [Geobacillus stearothermophilus] (494 aa)
Score = 736, Expect = 9.2e-76, Identities = 178/461 (38%), Positives = 261/461 (56%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           M +KTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE AK  G  ++ +LDTKGPEIR +      +E+K  SK+ I +  + +GT EK SV     TY ++  DV  G  I +DDG + LEV + + + G I T   N  +L+  K +N+P    ++P +++KDR DI+F I+   D+IAASFV    +V EI+++L+ H   HIQII+KIE   G+ ++D+I++ +D +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M +I + +E   ++    D+  + T   KE   T+   I   VA   +      D ++IV      +  Q ++  R  API  VT  +  + R  L +GV+ K   +V
  S:     1 MKRKTKIVCTIGPA--------------------SESVDKLVQLMEAGMNVARLNFSHGDHEEHGRRIANIREAAKRTGRTVAILLDTKGPEIRTHNMENGAIELKEGSKLVI-SMSEVLGTPEKISV-----TYPSLIDDVSVGAKILLDDGLISLEVNAVDKQAGEIVTTVLNGGVLKNKKGVNVPGVKVNLPGITEKDRADILFGIRQGIDFIAASFVRRASDVLEIRELLEAHDALHIQIIAKIENEEGVANIDEILEAADGLMVARGDLGVEIPAEEVPLIQKLLIKKCNMLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAVMLSGETAAGQYPVEAVKTMHQIALRTEQALEHR---DILSQRT---KESQTTITDAIGQSVAHTAL----NLDVAAIVTPTVSGKTPQMVAKYRPKAPIIAVTSNEAVSRRLALVWGVYTKEAPHV 426
>gi|585371|sp|Q02499|KPYK_BACST Pyruvate kinase (PK) >gi|285623|dbj|BAA02406.1| pyruvate kinase [Geobacillus stearothermophilus] (587 aa)
Score = 736, Expect = 1.0e-75, Identities = 178/461 (38%), Positives = 261/461 (56%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           M +KTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE AK  G  ++ +LDTKGPEIR +      +E+K  SK+ I +  + +GT EK SV     TY ++  DV  G  I +DDG + LEV + + + G I T   N  +L+  K +N+P    ++P +++KDR DI+F I+   D+IAASFV    +V EI+++L+ H   HIQII+KIE   G+ ++D+I++ +D +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M +I + +E   ++    D+  + T   KE   T+   I   VA   +      D ++IV      +  Q ++  R  API  VT  +  + R  L +GV+ K   +V
  S:     1 MKRKTKIVCTIGPA--------------------SESVDKLVQLMEAGMNVARLNFSHGDHEEHGRRIANIREAAKRTGRTVAILLDTKGPEIRTHNMENGAIELKEGSKLVI-SMSEVLGTPEKISV-----TYPSLIDDVSVGAKILLDDGLISLEVNAVDKQAGEIVTTVLNGGVLKNKKGVNVPGVKVNLPGITEKDRADILFGIRQGIDFIAASFVRRASDVLEIRELLEAHDALHIQIIAKIENEEGVANIDEILEAADGLMVARGDLGVEIPAEEVPLIQKLLIKKCNMLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAVMLSGETAAGQYPVEAVKTMHQIALRTEQALEHR---DILSQRT---KESQTTITDAIGQSVAHTAL----NLDVAAIVTPTVSGKTPQMVAKYRPKAPIIAVTSNEAVSRRLALVWGVYTKEAPHV 426
>gi|56421274|ref|YP_148592.1| pyruvate kinase [Geobacillus kaustophilus HTA426] >gi|56381116|dbj|BAD77024.1| pyruvate kinase [Geobacillus kaustophilus HTA426] (587 aa)
Score = 733, Expect = 2.0e-75, Identities = 177/461 (38%), Positives = 261/461 (56%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           M +KTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE A+  G  ++ +LDTKGPEIR +      VE+K  +K+ I +  + +GT EK SV     TY  +  DV  G+ I +DDG + LEV + + + G I T   NT +L+  K +N+P    ++P +++KDR DI+F I+   D+IAASFV    +V EI+++L+ +   HIQII+KIE   G+ ++D+I++ +D +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV  M +I + +E   ++    D+  + T   KE   T+   I   VA   +      D ++IV      +  Q ++  R  API  VT  +  + R  L +GV+ K   +V
  S:     1 MKRKTKIVCTIGPA--------------------SESVDKLVQLIEAGMNVARLNFSHGDHEEHGRRIANIREAARRTGQTVAILLDTKGPEIRTHNMENGAVELKEGAKL-IISMSEVLGTPEKISV-----TYPGLIDDVSVGSKILLDDGLIGLEVNAVDKQAGEIATTVLNTGVLKNKKGVNVPGVRVNLPGITEKDRADILFGIRQGIDFIAASFVRRASDVLEIRELLEANDALHIQIIAKIENEEGVANIDEILEAADGLMVARGDLGVEIPAEEVPLIQKMLIKKCNMLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAVMLSGETAAGQYPVEAVRTMHQIALRTEQALEHR---DILSQRT---KESRTTITDAIGQSVAHTAL----NLDVAAIVTPTVSGKTPQMVAKYRPKAPIIAVTSNEAVSRRLALIWGVYTKEAPHV 426
>gi|126651375|ref|ZP_01723582.1| pyruvate kinase [Bacillus sp. B14905] >gi|126591904|gb|EAZ85987.1| pyruvate kinase [Bacillus sp. B14905] (586 aa)
Score = 732, Expect = 3.1e-75, Identities = 173/452 (38%), Positives = 257/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R++L+REVA++    +  +LDTKGPEIR +     E+ + +   + I  T+ E GT   FSV     TY  + +DV+  + I +DDG ++L V++++VE+G+I TI  N  +L+  K +N+P  +  +P +++KD  DI+F I+   D+IAASFV    +V EI+++L+++GG HIQII KIE   G+ ++D+II  SD +MVARGDLG+E+P  +VP  +K +I  C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G+YP+ +V+ M KI   +EN  DY   +    +E    M E +       +  +  K V+        +    GN  R+I   +  R   PI  VT     A    L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESPETLEKLIEAGMNVARLNFSHGSHEEHAGRIHLIREVAQKLNKPVGILLDTKGPEIRTHNMKNGELHLSAGQVIDISMTEVE-GTETSFSV-----TYEQLVEDVEQNSIILLDDGLIQLRVLATDVEKGLIHTIVENAGVLKNKKGVNVPGVSVQLPGITEKDAQDILFGIEQGVDFIAASFVRRAKDVLEIRELLEQNGGGHIQIIPKIENQEGVDNIDEIILVSDGLMVARGDLGVEIPAEEVPLVQKKLILKCNQVGKPVITATQMLDSMQRNPRPTRAEASDVANAIIDGTDAIMLSGETAAGLYPVESVQTMNKIAQRTENSLDYKSIVSTRSREKEANMTEAISQAVAYTSINLGVKAVL--------APTESGNTARMI---AKYRPGVPIVAVTGSTNTAQTLTLVWGV 417
>gi|168143999|ref|ZP_02587228.1| pyruvate kinase [Bacillus cereus G9842] (585 aa)
Score = 731, Expect = 3.5e-75, Identities = 177/452 (39%), Positives = 264/452 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  +  +LDTKGPEIR +   + + E+ + ++V + +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+  ++  K +N+P+ +  +P +++KD  DIIF I+ K D+IAASFV    +V EI+++L+EHG ++IQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I V  E    Y    D++ K    +KE   T+   I+  VA   +      D ++IV         + +S  R  +PI  VT  ++   R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVGILLDTKGPEIRTHDFVDGQAELVTGAEV-VLSTEQVLGTAEKFSV-SYAGLYD---DVDPGSRILIDDGLIELEVIEK--ADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVKDIIFGIEQKVDFIAASFVRKASDVLEIRELLEEHGAQYIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYE---DMFKKR---IKEFTPTITDAISQSVAHTAL----ALDVAAIVAPTESGHTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGV 415
>gi|152976979|ref|YP_001376496.1| pyruvate kinase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025731|gb|ABS23501.1| pyruvate kinase [Bacillus cereus subsp. cytotoxis NVH 391-98] (585 aa)
Score = 727, Expect = 1.0e-74, Identities = 177/452 (39%), Positives = 263/452 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  ++ +LDTKGPEIR +   + + E+ + S+V I +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+ I++  K +N+P+ +  +P +++KD  DIIF I+   D+IAASFV    +V EI+++L+EH  +HIQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I    E    Y    D++ K    +KE   T+   I+  VA   +      D ++I+         + +S  R  +PI  VT  ++   R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVAILLDTKGPEIRTHDFVDGQAELTTGSEVVI-STEQVLGTAEKFSV-TYAGLYD---DVNPGSRILIDDGLIELEVIEK--VDGNIRTKVLNSGIVKNKKGVNVPNVSIKLPGITEKDVKDIIFGIEQNVDFIAASFVRKAADVLEIRELLEEHNAQHIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIATRVEKSLQYK---DIFKKR---IKELTPTITDAISQSVAHTAI----ALDVAAIIAPTESGYTAKMISKYRPKSPIVAVTSDEQVCRRLALVWGV 415
>gi|154687051|ref|YP_001422212.1| pyruvate kinase [Bacillus amyloliquefaciens FZB42] >gi|154352902|gb|ABS74981.1| Pyk [Bacillus amyloliquefaciens FZB42] (585 aa)
Score = 727, Expect = 1.1e-74, Identities = 175/453 (38%), Positives = 259/453 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVG-TLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KKTKI  T+GP+                      + + L  L +AG+NV R NFSHGD+EE   R+  +RE +K+ G N+  +LDTKGPEIR +      +E+++ +++ I +TK+ +GT  KFSV        +A DV  G+ I +DDG + LEV+ SN E+  I+T   N+  L+  K +N+P  + ++P +++KD  DI+F I+   D+IAASFV    +V EI+++L+EH    IQII KIE   G+ +LD I++ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M  I   +E   +Y   +          +++VG T+   I   VA   +        ++IV         + ++  R  API  VT  +  + + GL +GVF
  S:     1 MKKTKIVCTIGPA--------------------SESVEMLTKLMEAGMNVARLNFSHGDFEEHGARIKNIREASKKLGKNVGILLDTKGPEIRTHDMENGALELQAGNEI-IVSTKQVLGTLGKFSV----SYEGLADDVSAGSIILLDDGLIGLEVLESNPEKHEIKTKILNSGTLKNKKGVNVPGVSVNLPGITEKDAKDIVFGIEQGVDFIAASFVRRSTDVLEIRELLEEHNASDIQIIPKIENQEGVDNLDAILEVSDGLMVARGDLGVEIPAEEVPLVQKEMIKKCNALGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVQTMFNIATRTEESLNYKEILSK-------RRDQVGMTITDAIGQSVAHTAI----NLSAAAIVTPTESGHTARMIAKYRPQAPIVAVTVNESVSRKLGLVFGVF 418
>gi|168185624|ref|ZP_02620259.1| pyruvate kinase [Clostridium botulinum C str. Eklund] >gi|169296521|gb|EDS78654.1| pyruvate kinase [Clostridium botulinum C str. Eklund] (473 aa)
Score = 725, Expect = 2.0e-74, Identities = 175/453 (38%), Positives = 268/453 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +++TK+  T+GP+              ENK       + L  L  AG++  R NFSHGD+EE   R+  +RE+ KE    ++ +LDTKGPEIR  K  E +V++   SK  +Y T+  +G + K ++     TY ++ KDV+PGNTI +DDG + L V S  +E+  I  +  N  ++   K +N+P+ +  +P +++KD+ D+IF  + + D +AASF+   D+V+ I+K+L+EHGG HI+I SKIE   G+ ++D+I++ SD IMVARGD+G+E+P   VP  +K II  C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD TMLSGE+ANG YPI A + MAKI  ++E + D+  A++          EKV  +A  I +L A +  ++    + ++I+V        + ++  R A PI  VT + +   R  L+ GV+
  S:     1 MQRTKMVFTIGPA-------------SENK-------EYLRELILAGMSAARLNFSHGDFEEHGARIKTIRELRKELNKQVAIVLDTKGPEIRT-KEFEGKVQLVKGSKFTVYCTEDVMGDATKCTI-----TYADLYKDVKPGNTILIDDGLVALTVES--IEDTKIHCVVANDGVVSSKKGVNVPNVSIKLPAITEKDKGDLIFGCEQEVDMVAASFIRKADDVKAIRKVLEEHGGSHIRIFSKIENQEGVDNVDEILEASDGIMVARGDMGVEIPIEQVPIVQKMIINKCNKAGKPVITATQMLDSMIRNPRPTRAEASDVANAIFDGTDATMLSGESANGDYPIQAAQTMAKIAQTAEKYVDHKAALE------KRKAEKVTNVADAI-SLSACESAME---LNAAAIIVPTKSGNTAKMIAKYRPACPIIAVTPEDKITRRLSLSCGVY 416
>gi|118479744|ref|YP_896895.1| pyruvate kinase [Bacillus thuringiensis str. Al Hakam] >gi|118418969|gb|ABK87388.1| pyruvate kinase [Bacillus thuringiensis str. Al Hakam] (600 aa)
Score = 724, Expect = 2.1e-74, Identities = 176/452 (38%), Positives = 263/452 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  +  +LDTKGPEIR +   + + E+ + ++V + +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+  ++  K +N+P+ +  +P +++KD  DIIF I+ K D+IAASFV    +V EI+++L+EH  ++IQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I V  E    Y    D++ K    +KE   T+   I+  VA   +      D ++IV         + +S  R  +PI  VT  ++   R  L +GV
  S:    16 MRKTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVGILLDTKGPEIRTHDFVDGQAELVTGAEV-VLSTEQVLGTAEKFSV-SYAGLYD---DVDPGSRILIDDGLIELEVIEK--ADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVKDIIFGIEQKVDFIAASFVRKAADVLEIRELLEEHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYE---DMFKKR---IKEFTPTITDAISQSVAHTAL----ALDVAAIVAPTESGYTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGV 430
>gi|167013173|pdb|2E28|A Chain A, Crystal Structure Analysis Of Pyruvate Kinase From Bacillus Stearothermophilus (587 aa)
Score = 724, Expect = 2.2e-74, Identities = 177/461 (38%), Positives = 261/461 (56%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           M +KTKI +T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE AK  G  ++ +LDTKGPEIR +      +E+K  SK+ I +  + +GT EK SV     TY ++  DV  G  I +DDG + LEV + + + G I T   N  +L+  K +N+P    ++P +++KDR DI+F I+   D+IAASFV    +V EI+++L+ H   HIQII+KIE   G+ ++D+I++ +D +MVARGDLG+E+P  +VP  +K +IK     GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M +I + +E   ++    D+  + T   KE   T+   I   VA   +      D ++IV      +  Q ++  R  API  VT  +  + R  L +GV+ K   +V
  S:     1 MKRKTKIVSTIGPA--------------------SESVDKLVQLMEAGMNVARLNFSHGDHEEHGRRIANIREAAKRTGRTVAILLDTKGPEIRTHNMENGAIELKEGSKLVI-SMSEVLGTPEKISV-----TYPSLIDDVSVGAKILLDDGLISLEVNAVDKQAGEIVTTVLNGGVLKNKKGVNVPGVKVNLPGITEKDRADILFGIRQGIDFIAASFVRRASDVLEIRELLEAHDALHIQIIAKIENEEGVANIDEILEAADGLMVARGDLGVEIPAEEVPLIQKLLIKKSNMLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAVMLSGETAAGQYPVEAVKTMHQIALRTEQALEHR---DILSQRT---KESQTTITDAIGQSVAHTAL----NLDVAAIVTPTVSGKTPQMVAKYRPKAPIIAVTSNEAVSRRLALVWGVYTKEAPHV 426
>gi|14289139|gb|AAK57730.1| putative pyruvate kinase [Bacillus sphaericus] (438 aa)
Score = 723, Expect = 3.4e-74, Identities = 172/452 (38%), Positives = 256/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R++L+REVA++    +  +LDTKGPEIR +     E+ + +   + I  T+ E GT   FSV     TY  + +DV+  + I +DDG ++L V++++VE+G+I TI  N  +L+  K +N+P  +  +P +++KD  DI+F I+   D+IAASFV    +V EI+++L+++GG HIQII KIE   G+ ++D+II  SD +MVARGDLG+E+P  +VP  +K +I  C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGET  G+YP+ +V+ M KI   +EN  DY   +    +E    M E +       +  +  K V+        +    GN  R+I   +  R   PI  VT     A    L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESSETLEKLIEAGMNVARLNFSHGSHEEHAGRIHLIREVAQKLNKPVGILLDTKGPEIRTHNMKNGELHLTAGQVIDISMTEVE-GTETSFSV-----TYEQLVEDVEQNSIILLDDGLIQLRVLATDVEKGLIHTIVENAGVLKNKKGVNVPGVSVQLPGITEKDAQDILFGIEQGVDFIAASFVRRAKDVLEIRELLEQNGGGHIQIIPKIENQEGVDNIDEIILVSDGLMVARGDLGVEIPAEEVPLVQKKLILKCNQVGKPVITATQMLDSMQRNPRPTRAEASDVANAIIDGTDAIMLSGETGAGLYPVESVQTMNKIAQRTENSLDYKSIVSTRSREKEANMTEAISQAVAYTSINLGVKAVL--------APTESGNTARMI---AKYRPGVPIVAVTGSTNTAQTLTLVWGV 417
>gi|30022674|ref|NP_834305.1| pyruvate kinase [Bacillus cereus ATCC 14579] >gi|167934963|ref|ZP_02522038.1| pyruvate kinase [Bacillus cereus AH1134] >gi|168137867|ref|ZP_02581096.1| pyruvate kinase [Bacillus cereus B4264] >gi|29898233|gb|AAP11506.1| Pyruvate kinase [Bacillus cereus ATCC 14579] (585 aa)
Score = 722, Expect = 3.7e-74, Identities = 176/452 (38%), Positives = 263/452 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  +  +LDTKGPEIR +   + + E+ + ++V + +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+  ++  K +N+P+ +  +P +++KD  DIIF I+ K D+IAASFV    +V EI+++L+EH  ++IQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I V  E    Y    D++ K    +KE   T+   I+  VA   +      D ++IV         + +S  R  +PI  VT  ++   R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVGILLDTKGPEIRTHDFVDGQAELVTGAEV-VLSTEQVLGTAEKFSV-SYAGLYD---DVDPGSRILIDDGLIELEVIEK--ADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVKDIIFGIEQKVDFIAASFVRKASDVLEIRELLEEHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYE---DMFKKR---IKEFTPTITDAISQSVAHTAL----ALDVAAIVAPTESGYTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGV 415
>gi|30264669|ref|NP_847046.1| pyruvate kinase [Bacillus anthracis str. Ames] >gi|47530138|ref|YP_021487.1| pyruvate kinase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47565009|ref|ZP_00236052.1| pyruvate kinase [Bacillus cereus G9241] >gi|49187487|ref|YP_030740.1| pyruvate kinase [Bacillus anthracis str. Sterne] >gi|49481348|ref|YP_038642.1| pyruvate kinase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140912|ref|YP_085918.1| pyruvate kinase [Bacillus cereus E33L] >gi|65321965|ref|ZP_00394924.1| COG0469: Pyruvate kinase [Bacillus anthracis str. A2012] >gi|165869854|ref|ZP_02214512.1| pyruvate kinase [Bacillus anthracis str. A0488] >gi|166996284|ref|ZP_02262744.1| pyruvate kinase [Bacillus cereus AH820] >gi|167634010|ref|ZP_02392333.1| pyruvate kinase [Bacillus anthracis str. A0442] >gi|167638130|ref|ZP_02396408.1| pyruvate kinase [Bacillus anthracis str. A0193] >gi|170685727|ref|ZP_02876950.1| pyruvate kinase [Bacillus anthracis str. A0465] >gi|170705490|ref|ZP_02895954.1| pyruvate kinase [Bacillus anthracis str. A0389] >gi|177651343|ref|ZP_02934174.1| pyruvate kinase [Bacillus anthracis str. A0174] >gi|190569035|ref|ZP_03021935.1| pyruvate kinase [Bacillus anthracis Tsiankovskii-I] >gi|196033117|ref|ZP_03100530.1| pyruvate kinase [Bacillus cereus W] >gi|196040804|ref|ZP_03108102.1| pyruvate kinase [Bacillus cereus NVH0597-99] >gi|196047461|ref|ZP_03114672.1| pyruvate kinase [Bacillus cereus 03BB108] >gi|30259344|gb|AAP28532.1| pyruvate kinase [Bacillus anthracis str. Ames] >gi|47505286|gb|AAT33962.1| pyruvate kinase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47557795|gb|EAL16120.1| pyruvate kinase [Bacillus cereus G9241] >gi|49181414|gb|AAT56790.1| pyruvate kinase [Bacillus anthracis str. Sterne] >gi|49332904|gb|AAT63550.1| pyruvate kinase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974381|gb|AAU15931.1| pyruvate kinase [Bacillus cereus E33L] >gi|164714683|gb|EDR20202.1| pyruvate kinase [Bacillus anthracis str. A0488] >gi|167513947|gb|EDR89315.1| pyruvate kinase [Bacillus anthracis str. A0193] >gi|167530811|gb|EDR93513.1| pyruvate kinase [Bacillus anthracis str. A0442] >gi|170129615|gb|EDS98478.1| pyruvate kinase [Bacillus anthracis str. A0389] >gi|170670191|gb|EDT20931.1| pyruvate kinase [Bacillus anthracis str. A0465] >gi|172083169|gb|EDT68231.1| pyruvate kinase [Bacillus anthracis str. A0174] >gi|190559817|gb|EDV13802.1| pyruvate kinase [Bacillus anthracis Tsiankovskii-I] >gi|195994546|gb|EDX58501.1| pyruvate kinase [Bacillus cereus W] >gi|196021676|gb|EDX60372.1| pyruvate kinase [Bacillus cereus 03BB108] >gi|196028258|gb|EDX66867.1| pyruvate kinase [Bacillus cereus NVH0597-99] (585 aa)
Score = 722, Expect = 4.2e-74, Identities = 176/452 (38%), Positives = 263/452 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  +  +LDTKGPEIR +   + + E+ + ++V + +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+  ++  K +N+P+ +  +P +++KD  DIIF I+ K D+IAASFV    +V EI+++L+EH  ++IQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I V  E    Y    D++ K    +KE   T+   I+  VA   +      D ++IV         + +S  R  +PI  VT  ++   R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVGILLDTKGPEIRTHDFVDGQAELVTGAEV-VLSTEQVLGTAEKFSV-SYAGLYD---DVDPGSRILIDDGLIELEVIEK--ADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVKDIIFGIEQKVDFIAASFVRKAADVLEIRELLEEHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYE---DMFKKR---IKEFTPTITDAISQSVAHTAL----ALDVAAIVAPTESGYTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGV 415
>gi|138896300|ref|YP_001126753.1| pyruvate kinase [Geobacillus thermodenitrificans NG80-2] >gi|196249922|ref|ZP_03148617.1| pyruvate kinase [Geobacillus sp. G11MC16] >gi|134267813|gb|ABO68008.1| Pyruvate kinase [Geobacillus thermodenitrificans NG80-2] >gi|196210436|gb|EDY05200.1| pyruvate kinase [Geobacillus sp. G11MC16] (587 aa)
Score = 721, Expect = 5.4e-74, Identities = 172/461 (37%), Positives = 257/461 (55%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           M +KTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE A+  G  ++ +LDTKGPEIR +      +E++  +K+ I +  + +GT EK SV     TY  +  DV  G+ I +DDG + LEV + + + G I T   N  +L+  K +N+P    ++P +++KDR DI+F I+   D+IAASFV    +V EI+++L+ +   HIQII+KIE   G+ ++D+I++ +D +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV  M +I + +E   ++   +    KE+          ATTI   +           D ++IV      +  Q ++  R  API  VT  +  + R  L +GV+ K   +V
  S:     1 MKRKTKIVCTIGPA--------------------SESVDKLEQLIEAGMNVARLNFSHGDHEEHGRRIANIREAAQRTGKTVAILLDTKGPEIRTHNMENGAIELREGAKLVI-SMSEVLGTPEKISV-----TYPGLIDDVSVGSKILLDDGLIALEVNAVDKQAGEIITTVLNGGVLKNKKGVNVPGVRVNLPGITEKDRADILFGIRQGIDFIAASFVRRASDVLEIRELLEANDALHIQIIAKIENEEGVDNIDEILEAADGLMVARGDLGVEIPAEEVPLIQKLLIKKCNMLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAVMLSGETAAGQYPVEAVRTMHQIALRTEQALEHHDILSQRTKES----------ATTITDAIGQSVAHTALNLDVAAIVTPTVSGKTPQMVAKYRPKAPIIAVTSNEAVSRRLALVWGVYTKEARHV 426
>gi|42783775|ref|NP_981022.1| pyruvate kinase [Bacillus cereus ATCC 10987] >gi|168162596|ref|ZP_02597829.1| pyruvate kinase [Bacillus cereus H3081.97] >gi|42739705|gb|AAS43630.1| pyruvate kinase [Bacillus cereus ATCC 10987] (585 aa)
Score = 721, Expect = 6.0e-74, Identities = 177/452 (39%), Positives = 263/452 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  +  +LDTKGPEIR +   + + E+ + ++V I +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+  ++  K +N+P+ +  +P +++KD  DIIF I+ K D+IAASFV    +V EI+++L+EH  ++IQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I V  E    Y    D++ K    +KE   T+   I+  VA   +      D ++IV         + +S  R  +PI  VT  ++   R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVGILLDTKGPEIRTHDFVDGQAELVTGAEVVI-STEQVLGTAEKFSV-SYAGLYD---DVNPGSRILIDDGLIELEVIEK--ADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVKDIIFGIEQKVDFIAASFVRKAADVLEIRELLEEHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYE---DMFKKR---IKEFTPTITDAISQSVAHTAL----ALDVAAIVAPTESGYTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGV 415
>gi|166984077|ref|ZP_02255450.1| pyruvate kinase [Bacillus cereus AH187] (585 aa)
Score = 720, Expect = 6.4e-74, Identities = 177/452 (39%), Positives = 263/452 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  +  +LDTKGPEIR +   + + E+ + ++V I +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+  ++  K +N+P+ +  +P +++KD  DIIF I+ K D+IAASFV    +V EI+++L+EH  ++IQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I V  E    Y    D++ K    +KE   T+   I+  VA   +      D ++IV         + +S  R  +PI  VT  ++   R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVGILLDTKGPEIRTHDFVDGQAELVTGAEVVI-STEQVLGTAEKFSV-SYAGLYD---DVNPGSRILIDDGLIELEVIEK--ADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVKDIIFGIEQKVDFIAASFVRKAADVLEIRELLEEHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYE---DMFKKR---IKEFTPTITDAISQSVAHTAL----ALDVAAIVAPTESGYTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGV 415
>gi|34762727|ref|ZP_00143717.1| Pyruvate kinase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887626|gb|EAA24705.1| Pyruvate kinase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (475 aa)
Score = 719, Expect = 8.0e-74, Identities = 165/359 (45%), Positives = 224/359 (62%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M  +KKTKI  T+GP                    +  + + L  L + G+NV+R NFSHGDYEE  IR+   R+   E G+    +LDTKGPEIR     + K+V IK+  K    T +  +G +E+ +V     TY N AKD++ GN + VDDG L+L+V      E I   +ARN+  L + K INLP+ + ++P +S+KD  D+ F  +N  D++AASF+   D+VR+++K+LKE+GGE IQIISKIE+  G+ + D+I+ ESD IMVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AVEVM KI
  S:     1 MSSLKKTKIVCTIGP--------------------VTESVETLKELLNRGMNVMRLNFSHGDYEEHGIRIKNFRQAMSETGIRGGLLLDTKGPEIRTMTLKDGKDVSIKAGQKFTFTTDQSVVGDNERVAV-----TYENFAKDLKVGNMVLVDDGLLELDVTEIKGNEVI--CVARNSGDLGQKKGINLPNVSVNLPALSEKDIEDLKFGCQNNVDFVAASFIRKADDVRQVRKVLKENGGERIQIISKIESQEGLDNFDEILAESDGIMVARGDLGVEIPVEEVPCAQKMMIKKCNRAGKVVITATQMLDSMIKNPRPTRAEANDVANAIFDGTDAIMLSGETAKGKYPLAAVEVMNKI 334
>gi|1730065|sp|P51182|KPYK_BACPY Pyruvate kinase (PK) >gi|1041097|dbj|BAA06725.1| Pyruvate Kinase [Sporosarcina psychrophila] (586 aa)
Score = 719, Expect = 8.4e-74, Identities = 167/453 (36%), Positives = 263/453 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKET-PFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG++ E   R++ +R+VA+EKG  +  +LDTKGPEIR +     ++E+ +  K+ I  T+ E G ++ FSV     +Y+ + +DV  G+ I +DDG ++LEV   +V  G+I T+  N+  L  NK +N+P  +  +P M++KD  DI+F I+   D+IAASFV    +V EI+ +L+ + G ++QII KIE   G+ ++D+I++ SD +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G+YP+ +V+ M +I +++E   DY   +    +E    M E +G  A   A  +  K V+        +    G+  ++I   +  R   P+  VT  +  + +  L +GV+
  S:     1 MRKTKIVCTIGPA--------------------SESPELLEQLIEAGMNVARLNFSHGNHAEHKARIDSIRKVAREKGKVVGILLDTKGPEIRTHSMMNGKLELVTGQKIDISMTQVE-GNNDVFSV-----SYDKLIEDVNEGSVILLDDGLIQLEVTGKDVARGLIHTLIINSGSLSNNKGVNIPGVSVQLPGMTEKDAEDILFGIREGVDFIAASFVRRASDVMEIRALLENNNGSNLQIIPKIENQEGVDNIDEILNVSDGLMVARGDLGVEIPPEEVPLVQKNLIEKCNQAGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGIYPVESVQTMDRIALTTEAAIDYRSVVSTRRREKHGNMTEAIGQAAAYTAINLKVKAVL--------APTESGHTAKMI---AKYRPGCPVIAVTSSEMCSRKLSLIWGVY 418
>gi|163942331|ref|YP_001647215.1| pyruvate kinase [Bacillus weihenstephanensis KBAB4] >gi|163864528|gb|ABY45587.1| pyruvate kinase [Bacillus weihenstephanensis KBAB4] (585 aa)
Score = 718, Expect = 1.1e-73, Identities = 175/452 (38%), Positives = 262/452 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHG +EE   R+  +RE +K+ G  +  +LDTKGPEIR +   + + E+ + ++V I +T++ +GT+EKFSV    G Y+   DV PG+ I +DDG ++LEVI     +G I T   N+  ++  K +N+P+ +  +P +++KD  DI+F I+ K D+IAASFV    +V EI+++L+ H  ++IQI+ KIE   GI ++D I++ SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA I V  E    Y    D++ K    +KE   T+   I+  VA   +      D ++IV         + +S  R  +PI  VT  ++   R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLEQLMEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKTVGILLDTKGPEIRTHDFVDGQAELVTGAEV-ILSTEQVLGTAEKFSV-SYAGLYD---DVDPGSRILIDDGLIELEVIEK--ADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVQDIVFGIEQKVDFIAASFVRKASDVLEIRELLEGHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMVARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYE---DMFKKR---IKEFTPTITDAISQSVAHTAL----ALDVAAIVAPTESGHTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGV 415
>gi|19705084|ref|NP_602579.1| pyruvate kinase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713006|gb|AAL93878.1| Pyruvate kinase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (475 aa)
Score = 715, Expect = 2.4e-73, Identities = 163/359 (45%), Positives = 225/359 (62%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M+ +KKTKI  T+GP                    +  + + L  L + G+NV+R NFSHGDYEE  +R+   R+   E G+    +LDTKGPEIR     + K+V IK+  K    T +  +G +E+ +V     TY N AKD++ GN + VDDG L+L+V+     E I   IARN   L + K INLP+ + ++P +S+KD  D+ F  +N  D++AASF+   D+VR+++K+L+E+ GE IQIISKIE+  G+ + D+I+ ESD IMVARGDLG+E+P  +VP  +K +I+ C   GKTVI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AVEVM KI
  S:     1 MRSLKKTKIVCTIGP--------------------VTESVETLKELLNRGMNVMRLNFSHGDYEEHGMRMKNFRQAMSETGIRGGILLDTKGPEIRTMTLKDGKDVSIKAGQKFTFTTDQSVVGDNERVAV-----TYENFAKDLKVGNMVLVDDGLLELDVVEIKGNEVI--CIARNNGDLGQKKGINLPNVSVNLPALSEKDIEDLKFGCQNNVDFVAASFIRKADDVRQVRKVLRENDGERIQIISKIESQEGLDNFDEILAESDGIMVARGDLGVEIPVEEVPCAQKMMIRKCNRVGKTVITATQMLDSMIKNPRPTRAEANDVANAILDGTDAVMLSGETAKGKYPLAAVEVMNKI 334
>gi|148323729|gb|EDK88979.1| pyruvate kinase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (475 aa)
Score = 713, Expect = 4.3e-73, Identities = 162/359 (45%), Positives = 224/359 (62%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M+ +KKTKI  T+GP                    +  + + L  L + G+NV+R NFSHGDYEE  +R+   R+   E G+    +LDTKGPEIR     + K+V IK+  K    T +  +G +E+ +V     TY N AKD++ G+ + VDDG L+L+V      E I   IARN   L + K INLP+ + ++P +S+KD  D+ F  +N  D++AASF+   D+VR+++K+L+E+GGE IQIISKIE+  G+ + D+I+ ESD IMVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AVEVM KI
  S:     1 MRSLKKTKIVCTIGP--------------------VTESVETLKELLNRGMNVMRLNFSHGDYEEHGMRMKNFRQAMSETGIRGGILLDTKGPEIRTMTLKDGKDVSIKAGQKFTFTTDQSVVGDNERVAV-----TYENFAKDLKVGDIVLVDDGLLELDVTEIKGNEVI--CIARNNGDLGQKKGINLPNVSVNLPALSEKDIEDLKFGCQNNVDFVAASFIRKADDVRQVRKVLRENGGERIQIISKIESQEGLDNFDEILAESDGIMVARGDLGVEIPVEEVPCAQKMMIRKCNRAGKVVITATQMLDSMIKNPRPTRAEANDVANAILDGTDAVMLSGETAKGKYPLAAVEVMNKI 334
>gi|118443979|ref|YP_877381.1| pyruvate kinase [Clostridium novyi NT] >gi|118134435|gb|ABK61479.1| pyruvate kinase [Clostridium novyi NT] (473 aa)
Score = 710, Expect = 9.1e-73, Identities = 173/453 (38%), Positives = 267/453 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +++TK+  T+GP+              ENK       + L  L  AG++  R NFSHGD+EE   R+  +RE+ KE    ++ +LDTKGPEIR  K  + +V++   SK  +Y T+  +G + K S+     TY  + KDV+PGNTI +DDG + L V S  +E+  I  +  N  ++   K +N+P+ +  +P +++KD+ D+IF  + + D +AASF+   D+V+ I+K+L+E+GG HI+I SKIE   G+ ++D+I++ SD IMVARGD+G+E+P   VP  +K II  C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD TMLSGE+ANG YPI A + MA+I  ++E + D+  A++          EKV  +A  I +L A +  ++    + ++I+V        + ++  R A PI  VT + +   R  L+ GV+
  S:     1 MQRTKMVFTIGPA-------------SENK-------EYLRELILAGMSAARLNFSHGDFEEHGARIKTIRELRKELNKQVAIVLDTKGPEIRT-KEFDGKVQLVKGSKFTVYCTEDVMGDATKCSI-----TYTELYKDVKPGNTILIDDGLVALTVES--IEDTKIHCVVANDGVVSSKKGVNVPNVSIKLPAITEKDKGDLIFGCQEEVDMVAASFIRKADDVKAIRKVLEENGGSHIRIFSKIENQEGVDNVDEILEASDGIMVARGDMGVEIPIEQVPIVQKMIINKCNKAGKPVITATQMLDSMIRNPRPTRAEASDVANAIFDGTDATMLSGESANGDYPIQAAQTMARIAQTAEKYVDHKAALE------KRKAEKVTNVADAI-SLSACEAAME---LNAAAIIVPTKSGATARMIAKYRPACPIIAVTPEDKITRRLSLSSGVY 416
>gi|164510754|emb|CAJ98740.1| pyruvate kinase [Candidatus Phytoplasma solani] (448 aa)
Score = 709, Expect = 1.2e-72, Identities = 175/453 (38%), Positives = 257/453 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           + KTKI  TLGP+  GK                    + L  L   G+NV RFNFSH  YE     L  ++E+ +E    ++TMLDTKGPEIR +    K V+I+ +S+VRI  T+  +GT +KFS+        +  D++  + IF+DDG L LEVI  + +   + T A NT I++  + +N+P+    IP++S KD +DI+FA +  ++++A SFV    +V E++KILKE   E I+IISKIE   GI +L++II  SD IM+ARGDLG+EV    VP Y+  +I+DC + GK VIVATQML+S++   +PT+AE++DV+ AV  G   TMLSGE+A+G+YP  AV  MAKI+  SE + DY      Y  +T     +   LA ++  L   +++         ++VV  +D     A + +    P+F        AT   LN+  F
  S:     1 MNKTKIVCTLGPACQGK--------------------EALKQLIKNGLNVARFNFSHATYENSEKILREIKEINQELNTYVATMLDTKGPEIRTHNFV-KPVQIEKNSEVRIAFTEV-LGTEKKFSI----SYKELYNDIKVNDLIFIDDGYLTLEVIQKDEQNRELITKAHNTHIVKSRRGVNVPNIKLKIPYISPKDASDIVFACQKGYNFLALSFVRNASDVLEVRKILKEQQNEKIKIISKIENQEGIDNLEEIIKVSDGIMIARGDLGIEVAGELVPLYQTQMIQDCLYAGKPVIVATQMLESMQRNPRPTKAEISDVWNAVLEGATSTMLSGESASGLYPAQAVAFMAKINHQSEQYLDYEMIASFYNPKT-----RSEFLAFSVIQLALKEQI--------HAVVV--DDVSYAFAFAKMHSKVPVFVQVKDISQATSLALNFANF 412
>gi|182418112|ref|ZP_02949412.1| pyruvate kinase [Clostridium butyricum 5521] >gi|182377930|gb|EDT75470.1| pyruvate kinase [Clostridium butyricum 5521] (473 aa)
Score = 709, Expect = 1.3e-72, Identities = 186/487 (38%), Positives = 271/487 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD---NVEHAIANKTEIIDAINSQLPEVKKTVVV 490
           ++KTK+  T+GP+   +                ET KK + A    G+N  R NFSHGD+EE   R+  VRE+AKE G  ++ +LDTKGPEIR  K    +VE++  ++  +Y     + G + K +V     TY  +A DV PGNTI +DDG + L V S  +E   ++   +NT ++  +K +N+P  +  +P +++KD+ D+IF  +   + IAASF+   D+VR I+K+L E+GGE I I SKIE   G+ ++D+I+ ESD IMVARGDLG+E+P  +VP  +K IIK C   GK V+ ATQMLDS+    +PTRAEV+DV  A+  GTDC MLSGE+ANG YP+ AV  MAKI   +E   +Y  A+      TP +   +   A   A  +    VI +     ++           + +S  R   PI  VT     A +   ++GV+  V D   + +  +    EI  A NS+      TVV+
  S:     1 MRKTKMICTIGPASEDR----------------ETLKKVMLA----GMNASRHNFSHGDHEEHKGRIVKVREIAKELGREVAVILDTKGPEIRTGKFEPNKVELQKGTEFTVYAGDMSVVGDTTKCAV-----TYEGLANDVVPGNTILIDDGLVGLTVKS--IEGNAVKCEVQNTGLVGTHKGVNVPGVSIKLPALTEKDKGDLIFGCEMGVNMIAASFIRKADDVRAIRKLLNENGGERILICSKIENQEGVDNIDEILAESDLIMVARGDLGVEIPVQNVPAVQKMIIKKCNEAGKPVVTATQMLDSMIRNPRPTRAEVSDVANAILDGTDCIMLSGESANGDYPVEAVSTMAKIAEETEKTLEYKVAVSKAKSHTPAISGVISRAAANAANELNASAVITSTQTGATA-----------KRISQCRPECPIIAVTPDVIVARQLSFSWGVYPVVADKMASTDEMLEKSVEI--AKNSEFVAAGDTVVL 452
>gi|167465675|ref|ZP_02330764.1| pyruvate kinase [Paenibacillus larvae subsp. larvae BRL-230010] (584 aa)
Score = 709, Expect = 1.4e-72, Identities = 175/452 (38%), Positives = 254/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                   +E  KK    L +AG+NV R NFSHGDYEE   R+  +R+ ++E G N++ +LDTKGPEIR     E+ +E+   +K+ + TT++ +G + + S+     TY N+ KDVQ G TI +DDG + L V S N  E  IE    N   ++  K +N+P    ++P +++KD NDI F IK   D+IAASFV    +V EI+++L+ H   HIQII KIE   G+++LD+II+ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI AT MLDS++   +PTRAE +DV  AV  G+D  MLSGETA G YP+ AV+ MA+I   +E    Y R I ++         +   L  T+   ++          +  +I+         + +S  R  +PI  VT  +    R  L +GV
  S:     1 MRKTKIVCTIGPASES----------------LEILKK----LMNAGMNVARLNFSHGDYEEHGKRIQTIRQASQETGKNVAILLDTKGPEIRTGNLKEEPIELVQGNKITL-TTEEILGDANRISI-----TYQNLPKDVQVGFTILIDDGLIGLRVDSIN--ETDIECTIVNGGAIKSKKGVNVPGVKIALPGITEKDANDIRFGIKQDVDFIAASFVRKASDVLEIRELLEHHNATHIQIIPKIENQEGVENLDEIIEVSDGLMVARGDLGVEIPAEEVPIAQKEMIKKCNLAGKPVITATMMLDSMQRNPRPTRAESSDVANAVFDGSDAVMLSGETAAGKYPVEAVQTMARIAERTEQALQY-REIFLH---------RANALQVTVTEAISQAVANAALELEAKAIITATESGFTARMVSKYRPESPIIAVTKTERMMRRLSLVWGV 415
>gi|150391760|ref|YP_001321809.1| pyruvate kinase [Alkaliphilus metalliredigens QYMF] >gi|149951622|gb|ABR50150.1| pyruvate kinase [Alkaliphilus metalliredigens QYMF] (586 aa)
Score = 709, Expect = 1.5e-72, Identities = 174/473 (36%), Positives = 260/473 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDA 476
           +KKTKI  T+GP+                      +K+    L   G+NV R NFSHG++EE   R+ +++EV +E   +++ +LDTKGPEIR  K  + EV + ++ +V   TT+  +G     SV        +A+DV+PG+ I +DDG + L V    ++   +E I  N  I++ +K +N+P    ++P +++KD  DI+F I+   D+IAASFV    +V  IK+IL+E+  +HIQIISKIE   G+ +LD+II+ SD IMVARGDLG+E+P  DVP  +K +I  C   GK VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YPI +V+ MA+I + +E   DY             + +K      TI   ++            S+I++  +     + +S  +  API   T  +    +  L +G +  +VD  +    +  +IIDA
  S:     1 MKKTKIVCTIGPA--------------------SESKEVFTELVKQGLNVARLNFSHGNHEEHGERIKMIKEVRRELEQSVAILLDTKGPEIRTGKFKDPEV-LLAEGQVFTVTTRDVVGDQNMCSV----SYEGLARDVKPGDEILIDDGLVGLRV-QKIIQGTDVECIVENAGIVKNHKGVNVPGVQINLPAITEKDEGDIVFGIQMDIDFIAASFVRKASDVLAIKRILEENNADHIQIISKIENQEGMDNLDEIIEVSDGIMVARGDLGVEIPTEDVPLAQKEMILKCNKVGKPVITATQMLDSMMRNPRPTRAEVTDVANAIFDGTDAIMLSGETAAGKYPIESVKTMARIALRTEGAIDY----------RSLLNKKAQERELTITDAISHATCSTASDLQASAILIATSSGHTARMVSRFKPQAPIIAATTSERVMRKLSLTWGAYCLLVDEFQ----STDDIIDA 433
>gi|162447944|ref|YP_001621076.1| pyruvate kinase [Acholeplasma laidlawii PG-8A] >gi|161986051|gb|ABX81700.1| pyruvate kinase [Acholeplasma laidlawii PG-8A] (450 aa)
Score = 708, Expect = 1.6e-72, Identities = 180/453 (39%), Positives = 259/453 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  TLGP+              E+K V       +  L  AG+NV RFNFSHGDYEE   RL  ++ + +E G +++ +LDTKGPEIR ++   K VEI+ +S VRI  T   +G  E+FSV    G ++   D++ G  + VDDG L LEVI  + +   + T A NT  ++  + +N+P    ++PF+S+KD +DI FA    +D++AASFV  G++ + ++ IL  +GG+ +QII+KIE   G+ +LDDI+D  D IMVARGDLG+EV    VP Y+  +I  C   GK VIVATQML+S++   +PTRAEV+DVF AV  GT  TMLSGE+A G YPI +V+ MA ID  +E+  DY   +D YF         +  +A + A LV           +Y   VV      + ++ +     A    V    + A    L++GV+
  S:     1 MRKTKIVCTLGPA-------------SEDKAV-------MTQLVKAGMNVARFNFSHGDYEEHGNRLKTIQSINEELGTHVAYLLDTKGPEIRTHEFDGK-VEIQKNSIVRIGFTPV-LGNKERFSV-SYPGLFD---DMKVGEFVSVDDGYLTLEVIEKDTKNNELVTKALNTHTVKSRRGVNIPGVVLNMPFISEKDASDIKFAATMGYDFVAASFVRRGEDAQAVRDILDNNGGKDVQIIAKIENQEGMDNLDDILDVVDGIMVARGDLGIEVEGELVPMYQSEMIDKCLELGKVVIVATQMLESMQKNPRPTRAEVSDVFNAVREGTSATMLSGESAAGDYPIESVKKMASIDAKAESTLDYEVFLDGYF----MGDSNIDAIAQSAAKLV----------LEYEVDVVITTGVDVAKSFAAYHTQAINIAVVKNAKEARALALHFGVY 413
>gi|28212071|ref|NP_783015.1| pyruvate kinase [Clostridium tetani E88] >gi|28204514|gb|AAO36952.1| pyruvate kinase [Clostridium tetani E88] (584 aa)
Score = 707, Expect = 2.4e-72, Identities = 174/453 (38%), Positives = 261/453 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTK+  T+GP+                      +++ L+ L  AG++  R NFSHG +EE  IR++L+R+++ +   NI+ +LDTKGPEIR     +K V++K  +K  IY  ++ +G   K S+     TYN +  DV+ G++I +DDG + LEV    VE   +  + +N+  +  +K +N+P  + S+P +++KD++D+ F  K   D+IAASF+  G +V EI+K+L+E+GG  IQI SKIE   G++++D+II  SD IMVARGD+G+E+    VP  +K II+ C   GK VI ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGETA G YPI A + MAKI  ++E   DY    D  F      +      A +IAT      +      + S+I+         +A+S  R A PI  +T  K  A +  L++GVF
  S:     1 MQKTKMVFTIGPA--------------------SDSEEVLSELIKAGMSASRHNFSHGTHEEHKIRIDLIRKLSDKFNKNIAVILDTKGPEIRTGDFKDKTVQLKEGNKFTIYCGEEILGDETKCSI-----TYNDLHNDVKTGDSILIDDGLVGLEV--EEVEGSKVHCVVKNSGAVSNHKGVNVPGVDVSLPSLTEKDKSDLEFGCKVGVDFIAASFIRKGSDVLEIRKVLEENGGTDIQIFSKIENQQGVENIDEIIKFSDGIMVARGDMGVELQMEQVPIIQKMIIEKCNKAGKPVITATQMLDSMIRNPRPTRAEVSDVANAIFDGTDAVMLSGETAGGKYPIEAAKAMAKIARTAEETMDY----DEIFNRKREARVLSVANAISIATCTTASEL------NASAILTATQTGYTARAVSKYRPACPIIAITPSKNVARKLALSWGVF 417
>gi|192810503|ref|ZP_03039176.1| pyruvate kinase [Geobacillus sp. Y412MC10] >gi|192800795|gb|EDV77302.1| pyruvate kinase [Geobacillus sp. Y412MC10] (475 aa)
Score = 705, Expect = 3.7e-72, Identities = 169/452 (37%), Positives = 255/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GPS                      + +N   L  AG+NV R NFSHGD+EE   R+  +R+  +E    ++ +LDTKGPEIR  K   + +E+  D  + + TT++ +G   + S+     TY  + +DVQ G+TI +DDG + L V+     E  I     N   ++  K +N+P    S+P +++KD NDIIF I+   D+IAASFV    +V EI+++LK+H GEHIQIISKIE   G+ +LD+I++ SD +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ +V  M++I   +E+  +Y            F+K+++    T++   ++    I     +  +I+      +  + +S  R  API  VT ++    R  L +GV
  S:     1 MRKTKIVCTIGPS--------------------SESLENTKKLIMAGMNVARLNFSHGDFEEHGNRIKNIRQACEELNKTVAILLDTKGPEIRTGKLEVEPIELVQDEYITL-TTEEILGDKNRLSI-----TYKELPQDVQVGSTILIDDGLIGLTVVEIQGTE--IRCRIVNGGTIKSKKGVNVPGVAISLPGITEKDANDIIFGIEQGIDFIAASFVRKASDVLEIRELLKKHNGEHIQIISKIENQQGVDNLDEILEVSDGLMVARGDLGVEIPAEEVPLVQKRMIEKCNLAGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGKYPVESVLTMSRIAEKAESALNY---------RELFLKQRIAQ-ETSVTEAISQSVAISALDLNAKAIISSTESGQTARMVSKYRPQAPIVAVTTQERTLRRLALTWGV 415
>gi|23099626|ref|NP_693092.1| pyruvate kinase [Oceanobacillus iheyensis HTE831] >gi|22777856|dbj|BAC14127.1| pyruvate kinase [Oceanobacillus iheyensis HTE831] (586 aa)
Score = 702, Expect = 8.1e-72, Identities = 168/452 (37%), Positives = 255/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++ TKI  T+GP+                      + + L  L +AG+NV R NFSHGDY E   R+  +R+ AK K   ++ +LDTKGPEIR     E   ++   + V I   + E GT+EKFSV     TY  +  DV  G+ I +DDG ++LEV S +  +G IETIA N+  ++  K +N+P+ + ++P +++KD NDIIF I+   D+IAASFV    ++ EIK++L +H  ++I+II KIE   G+ ++D I++ SD +MVARGDLG+E+P  DVP  +K +IK C + GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ +V+ M+ I + +E+  D+ +           ++E+   +  TI   ++          +  +I+         + +S  R  A I  VT  +    +  L +GV
  S:     1 MRNTKIVCTIGPA--------------------SESIEKLEQLIEAGMNVARLNFSHGDYAEHGARIENIRKAAKNKNKTVAILLDTKGPEIRTGSFKEGRADLMQGNPVTIAMDEVE-GTAEKFSV-----TYQGLINDVHEGSKILLDDGLIELEVKSIDKSKGEIETIALNSGEIKNKKGVNVPNVSVNLPGITEKDTNDIIFGIEQGVDFIAASFVRRASDILEIKEVLDQHQAQYIKIIPKIENQEGVDNIDSILEVSDGLMVARGDLGVEIPAEDVPLVQKKLIKQCNNAGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGTYPVESVQTMSNIALKAESALDHKQ----------MLEERSQYVDMTITEAISQSVTHTASNLNVDTIITPTESGHTARMISKYRPKASILAVTFNEVVNRQLSLVWGV 417
>gi|171853538|emb|CAM11396.1| Pyruvate kinase [Candidatus Phytoplasma australiense] (451 aa)
Score = 701, Expect = 9.7e-72, Identities = 170/453 (37%), Positives = 259/453 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           + KTKI  TLGP+   K                    + L  L   G+NV RFNFSH DY+     L +++E+ +E    ++TMLDTKGPEIR +  + K VEIK +S+VRI  T+  +GT +KFS+        +  DV   + IF+DDG L LEV++ + +   + T A NT +++  + +N+P+    +P++S+KD  DI FA + K+D++A SFV    +V E++KILKE   + I+II+KIE   GI +L++I+   D IMVARGDLG+EVP   VP Y+  +I++C   GK VIVATQML+S++   +PT+AE++DV+ AV +GT  TMLSGE+A+G+YP  +V  MAKI+  +E + DY    + Y  +      +V  LA ++  +    ++           +V  +D     A +  R   P+F      + +T   LN+  F
  S:     1 MNKTKIVCTLGPACRDK--------------------ETLKQLVKNGLNVARFNFSHADYQNSEETLKMIQEINQELNTYVATMLDTKGPEIRTHNFA-KPVEIKQNSEVRIAFTEV-LGTEKKFSI----SYEQLYDDVTTSDLIFIDDGYLTLEVVAKDEQNKELITKANNTHLVKSRRGVNVPNIKLKMPYISEKDARDIAFACEKKYDFLALSFVRNASDVLEVRKILKEKQNDTIKIIAKIENQEGIDNLEEILLVVDGIMVARGDLGIEVPGELVPLYQTQMIQECLCAGKPVIVATQMLESMQRNPRPTKAEISDVWNAVLQGTTATMLSGESASGLYPEKSVSYMAKINHKAEEYLDYDLISNFYDPQN-----RVEYLAFSVIQMALKDQI---------HAIVIEDDLAYGYAFAKFRSKVPVFVKVKDLKSSTTLALNFSNF 413
>gi|149181140|ref|ZP_01859640.1| pyruvate kinase [Bacillus sp. SG-1] >gi|148851227|gb|EDL65377.1| pyruvate kinase [Bacillus sp. SG-1] (586 aa)
Score = 701, Expect = 1.2e-71, Identities = 169/453 (37%), Positives = 253/453 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHGD+EE   R+  +R  +++ G  +  +LDTKGPEIR        +E++  S+V I + K+ +GT EKFS+     TY ++  DV+ G+ I +DDG + LEV+S +   G I+T   N+  L+  K +N+P  + ++P +++KD  DIIF I+   D+IAASFV    +V EI ++L++H    IQII KIE   G+ ++D++++ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G+YP+ AV+ M  I   +E   DY   +    K+T   M + +G      A                ++IV         + +S  R  API  VT     + +  L +GV+
  S:     1 MRKTKIVCTIGPA--------------------SESVEKLTELIEAGMNVARLNFSHGDHEEHGARIQNIRTASEKTGKTVGILLDTKGPEIRTNNMENGSIELEKGSEV-IVSMKEVLGTQEKFSI-----TYESLIDDVEEGSKILLDDGLIGLEVLSLDKAAGEIKTKVLNSGTLKNKKGVNVPGVSVNLPGITEKDAKDIIFGIEQGVDFIAASFVRRASDVLEIHQLLEDHNAGDIQIIPKIENQEGVDNIDEVLEVSDGLMVARGDLGVEIPAEEVPLVQKALIKKCNALGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGVYPVEAVQTMHNIASRAETALDYKEILSNRSKDTGHNMTDAIGQSVAHTAI-----------NLSVNAIVAPTESGHTAKMISKYRPKAPIIAVTANDSVSRKLALAWGVY 418
>gi|157693319|ref|YP_001487781.1| pyruvate kinase [Bacillus pumilus SAFR-032] >gi|157682077|gb|ABV63221.1| pyruvate kinase [Bacillus pumilus SAFR-032] (586 aa)
Score = 699, Expect = 1.7e-71, Identities = 174/455 (38%), Positives = 258/455 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTKI  T+GP+                    ET +K L  L +AG+NV R NFSHGD+EE   R+  +R+  K  G +I+ +LDTKGPEIR        +E+ + + + I + +  +G +EK SV     TY ++  DV+ G+TI +DDG + LEV   N++E  I T   NT  L+  K +N+P  + ++P +++KD NDI+F I+   D+IAASFV    +V EI+++L+++    IQII KIE   G+ ++D+I++ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M  I   SE+  +Y +AI         +  +   +  +I   +           D ++IV         + +S  R  API  VT  +  A +  L +GVF K
  S:     1 MRKTKIVCTIGPAS-------------------ETIEK-LTELIEAGMNVARLNFSHGDFEEHGARIENIRKAGKTLGKDIAILLDTKGPEIRTRTVENGSIELVAGADL-IVSMEDIVGNTEKISV-----TYEDLIHDVEVGSTILLDDGLIGLEVKELNMDEKEIVTKVMNTGTLKNKKGVNVPGVSVNLPGITEKDANDILFGIEQGVDFIAASFVRRASDVLEIRELLEKNNAADIQIIPKIENQEGVDNIDEILEVSDGLMVARGDLGVEIPAEEVPLVQKMLIKKCNRLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGTYPVEAVQTMHNIASRSEDALNY-KAI---------LSRRSEEVDVSITDAIGQSVAHTAMKLDVAAIVTPTESGHTARMISKYRPKAPIVAVTANESVARKLSLVFGVFAK 420
>gi|148997017|ref|ZP_01824671.1| pyruvate kinase [Streptococcus pneumoniae SP11-BS70] >gi|168575557|ref|ZP_02721493.1| pyruvate kinase [Streptococcus pneumoniae MLV-016] >gi|169832591|ref|YP_001694352.1| pyruvate kinase [Streptococcus pneumoniae Hungary19A-6] >gi|147756717|gb|EDK63757.1| pyruvate kinase [Streptococcus pneumoniae SP11-BS70] >gi|168995093|gb|ACA35705.1| pyruvate kinase [Streptococcus pneumoniae Hungary19A-6] >gi|183578566|gb|EDT99094.1| pyruvate kinase [Streptococcus pneumoniae MLV-016] (501 aa)
Score = 698, Expect = 2.6e-71, Identities = 157/369 (42%), Positives = 233/369 (63%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F    +     K  +E + KN+A L +AG N  RFNFSHGD++EQ  R+  V+   K  G  +  +LDTKGPEIR  +++   KE   K+  K+R+  TK+ I ++ +   L+  G  ++  DV+ G  + VDDGKL L V++ + E    E    N  I+ + K +N+P++    P ++++D +DI F ++   ++IA SFV T  +V E++ I +E G  H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP Y+K IIK     GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKFGEDGYWG--EKLDVEASAKNIAKLIEAGANTFRFNFSHGDHQEQGERMATVKLAEKIAGKKVGFLLDTKGPEIRTELFEGEAKEYSYKTGEKIRV-ATKQGIKSTREVIALNVAGALDIYDDVEVGRQVLVDDGKLGLRVVAKDDETREFEVEVENDGIIAKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVNEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIIKKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQALLNEYGR 372
>gi|52786795|ref|YP_092624.1| pyruvate kinase [Bacillus licheniformis ATCC 14580] >gi|163119591|ref|YP_080210.2| pyruvate kinase [Bacillus licheniformis ATCC 14580] >gi|1730064|sp|P51181|KPYK_BACLI Pyruvate kinase (PK) >gi|1041099|dbj|BAA06727.1| Pyruvate Kinase [Bacillus licheniformis] >gi|52349297|gb|AAU41931.1| Pyk2 [Bacillus licheniformis DSM 13] >gi|145903101|gb|AAU24572.2| pyruvate kinase [Bacillus licheniformis ATCC 14580] (585 aa)
Score = 697, Expect = 2.8e-71, Identities = 172/453 (37%), Positives = 253/453 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHGD+EE   R+  +RE A + G +I  +LDTKGPEIR +      +E+ + S++ I +  + IGT +K SV     TY+ +  DV  G+TI +DDG + LEV   N ++  I T   N+  L+  K +N+P  + ++P +++KD NDI+F I+   D+IAASFV    +V EI+++L+EH    IQII KIE   G+ ++D I++ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M  I   SE   ++ + +    K+         ++   I   VA   +      D ++IV         + +S  R  API  VT     + +  L +GVF
  S:     1 MRKTKIVCTIGPA--------------------SESVEKLTQLMEAGMNVARLNFSHGDFEEHGARIKNIREAAGKLGKDIGILLDTKGPEIRTHTMENGSIELAAGSQL-IVSMDEVIGTPDKISV-----TYDGLIHDVSVGSTILLDDGLVGLEVTDINKDKREIVTKVMNSGTLKNKKGVNVPGVSVNLPGITEKDANDIVFGIEQGVDFIAASFVRRPSDVLEIRELLEEHNAADIQIIPKIENQEGVDNIDAILEVSDGLMVARGDLGVEIPAEEVPLVQKELIKKCNALGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGNYPVEAVQTMHNIASRSEEALNHKKILSARSKQVSM------SITDAIGQSVAHTAI----NLDVNAIVTPTESGHTARMISKYRPQAPIVAVTVNDAVSRKLSLVFGVF 418
>gi|163791500|ref|ZP_02185906.1| pyruvate kinase [Carnobacterium sp. AT7] >gi|159873223|gb|EDP67321.1| pyruvate kinase [Carnobacterium sp. AT7] (585 aa)
Score = 696, Expect = 3.7e-71, Identities = 157/361 (43%), Positives = 219/361 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +KKTKI  T+GP+                    ET ++ L  + DAG+NV R NFSHGD+EE   R+  +RE +K  G  ++ +LDTKGPE+R +   +  V+ ++   VRI  T+ E GT EKFS+        +  DV PG  I +DDG + LEV   +   G I  + +N   L+  K +N+P  + ++P ++DKD  DI F ++N  DYIAASFV    +V EI +IL+E    H+QII KIE   G+ ++D+I+  SD +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YPI AV+ MA+I V +E
  S:     1 MKKTKIVCTIGPAS-------------------ETVEQ-LVQMIDAGMNVARLNFSHGDFEEHGARIKNIREASKRTGKMVAILLDTKGPEMRTHNMKDGRVDFEAGDVVRISMTEVE-GTKEKFSI----SYPELINDVNPGTHILLDDGLVDLEVTELDHANGEIVVLVKNPGTLKNKKGVNVPGVSVNLPGITDKDAADIRFGLENDIDYIAASFVRRASDVLEITQILEEKNMTHVQIIPKIENQEGVDNIDEILKVSDGLMVARGDLGVEIPTEEVPIVQKALIRKCNQAGKPVITATQMLDSMQQNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPIEAVQTMARIAVRTE 336
>gi|168485844|ref|ZP_02710352.1| pyruvate kinase [Streptococcus pneumoniae CDC1087-00] >gi|183570976|gb|EDT91504.1| pyruvate kinase [Streptococcus pneumoniae CDC1087-00] (501 aa)
Score = 696, Expect = 4.2e-71, Identities = 157/369 (42%), Positives = 233/369 (63%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F    +     K  +E + KN+A L +AG N  RFNFSHGD++EQ  R+  V+   K  G  +  +LDTKGPEIR  +++   KE   K+  K+R+  TK+ I ++ +  VL+  G  ++  DV+ G  + VDDGKL L V++ +      E    N  I+ + K +N+P++    P ++++D +DI F ++   ++IA SFV T  +V E++ I +E G  H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP Y+K IIK     GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKFGEDGYWG--EKLDVEASAKNIAKLIEAGANTFRFNFSHGDHQEQGERMATVKLAEKIAGKKVGFLLDTKGPEIRTELFEGEAKEYSYKTGEKIRV-ATKQGIKSTREVIVLNVAGALDIYDDVEVGRQVLVDDGKLGLRVVAKDDATREFEVEVENDGIIAKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVNEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIIKKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQALLNEYGR 372
>gi|85057714|ref|YP_456630.1| pyruvate kinase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789819|gb|ABC65551.1| pyruvate kinase [Aster yellows witches'-broom phytoplasma AYWB] (446 aa)
Score = 695, Expect = 4.8e-71, Identities = 181/459 (39%), Positives = 259/459 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDN 462
           + KTKI  TLGP+                       K  L AL   G+NV RFNFSH  YE+  + +  ++ ++ +   +   MLDTKGPEIR +K  +  V I+ DS+VRI  T+  +G ++ FSV   T  YN   +++ G+ I +DDG L LEV+  +  +  + T A+NT  ++  + +N+P  N  + F+S KD  DI+FA +  FDYIAASFV    +V++I+KIL+E G  +IQIISKIE   G+ +L++II ESD IMVARGDLG+EV    VP Y+  II  C   GK V+VATQML+S++   +PT+AE +DVF AV+ GT  TMLSGE+A+G YP+ AV  M KI+  +E   +Y     VY  +    KE +   A  +A     K           +IVV+  D      +S    + P+  +   ++ A R  LN+GVF  V +N
  S:     1 MNKTKIICTLGPA--------------------SYEKNILQALIQTGLNVARFNFSHAQYEQTKLLMKTIKTISDKLDKHTGLMLDTKGPEIRTHKL-DGLVTIQKDSEVRISMTEV-LGNAKLFSV-SYTNLYN---ELKVGDMINIDDGYLSLEVVGKDESKQQLVTKAKNTHSIKSRRGVNVPKVNLEMDFISPKDYQDIVFAAQQDFDYIAASFVRKSQDVQDIRKILQEQGNSNIQIISKIENQEGVDNLEEIIQESDGIMVARGDLGIEVDGELVPLYQTRIINKCLEYGKPVVVATQMLESMQRNPRPTKAETSDVFNAVKEGTTFTMLSGESASGEYPVEAVTYMKKINYQAEKVVNYQALSQVY--QPKNFKENLLLSAVELAFRTFVK-----------AIVVY--DLEDAYNVSKFHPSVPVLALVKTEQEARRLLLNFGVFPFVSEN 418
>gi|29375625|ref|NP_814779.1| pyruvate kinase [Enterococcus faecalis V583] >gi|29343086|gb|AAO80849.1| pyruvate kinase [Enterococcus faecalis V583] (585 aa)
Score = 695, Expect = 5.0e-71, Identities = 177/458 (38%), Positives = 249/458 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI  T+GP+                      +   L  L +AG+NV R NFSHGDYEE   R+  +RE  K  G  ++ +LDTKGPEIR        + +K    VRI  T+  +GT+EKFS+     TY  +  DV  G+ I +DDG + LEV   + +   I T+ +N  +L+  K +N+P  + ++P +++KD NDI F I    D+IAASFV    +V EI KIL+E    HIQII KIE   GI ++D+I+  SD +MVARGD+G+E+P  DVP  +K +IK C   GK VI ATQMLDS++   +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV+ MA+I V +E       +  +       M E +G      A  +  + ++        +    G+  R+I   S  R  A I  +T  ++ A    L++GV+  V D
  S:     1 MKKTKIVCTIGPA--------------------SESVDMLVNLINAGMNVCRLNFSHGDYEEHGARIKNIREAVKITGKRVAILLDTKGPEIRTNDMENGAITMKIGDSVRISMTEV-LGTNEKFSI-----TYPELINDVNVGSHILLDDGLIDLEVTDIDRDANEIVTVVKNEGVLKNKKGVNVPGVSVNLPGITEKDANDIRFGIGQGIDFIAASFVRRASDVLEITKILEEENATHIQIIPKIENQEGIDNIDEILKVSDGLMVARGDMGVEIPTEDVPVVQKALIKKCNALGKPVITATQMLDSMQRNPRPTRAEANDVANAIYDGTDAVMLSGETAAGDYPLEAVQTMARIAVRTEETLVNQDSFALKLYSKTDMTEAIGQSVGHTARNLGIQTIV--------AATESGHTARMI---SKYRPKAHIVAITFSEQKARSLSLSWGVYATVAD 422
>gi|89100374|ref|ZP_01173238.1| pyruvate kinase [Bacillus sp. NRRL B-14911] >gi|89084893|gb|EAR64030.1| pyruvate kinase [Bacillus sp. NRRL B-14911] (586 aa)
Score = 694, Expect = 7.2e-71, Identities = 167/456 (36%), Positives = 254/456 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKV 459
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHGD+EE   R+  +RE +K  G  ++ +LDTKGPEIR        VE+++ + + I +  + +G ++KFSV     TY  +  DV  G+ I +DDG + LEV   +     I T   N+  L+  K +N+P  +  +P +++KD NDI+F I+   D+IAASFV    +V EI+++L+++   HIQII KIE   G+ ++D+I++ SD +MVARGDLG+E+P  +VP  +K +IK C  +GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M  I   +E+  D+   +      +   K+    +   I   VA   +      D ++I+         + +S  R  API  VT ++    R  L +GV+ +V
  S:     1 MRKTKIVCTIGPA--------------------SESIEKLTQLIEAGMNVSRLNFSHGDFEEHGARIKNIREASKSTGKTVAILLDTKGPEIRTNNMENGAVELEAGNNI-IVSMNEVLGNADKFSV-----TYAGLIDDVHTGSKILLDDGLIGLEVTKIDKANSEIHTKILNSGTLKNKKGVNVPGVSVKLPGITEKDANDILFGIEQGVDFIAASFVRRASDVLEIRQLLEDNNASHIQIIPKIENQEGVDNIDEILEVSDGLMVARGDLGVEIPAEEVPLVQKSLIKKCNIQGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGTYPVEAVQTMHNIASRAESALDHKEIL------SNRSKDNEHNITDAIGQSVAHTAL----NLDVNAIITPTESGHTARMISKYRPKAPIVAVTSQESVTRRLSLVWGVYPQV 421
>gi|56964483|ref|YP_176214.1| pyruvate kinase [Bacillus clausii KSM-K16] >gi|56910726|dbj|BAD65253.1| pyruvate kinase [Bacillus clausii KSM-K16] (584 aa)
Score = 693, Expect = 8.2e-71, Identities = 164/452 (36%), Positives = 251/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L AL +AG+NV R NFSHGD+EE   R+  +RE AK  G  ++ +LDTKGPEIR        +E++   ++ I +  +  GT EK S+     TY  + +DV+ G+TI +DDG + LEV    + +  + TI RN+ +L+  K +N+P+ + ++P M++KD  DI+F I+ K D+IAASFV    +V EI+++L++HG     II KIE   G+ ++D+I++ SD +MVARGDLG+E+P  +VP  +K +IK C    K VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ +V+ M  I   +E   +Y             ++ K   + T+I + +           + ++I+         +  S  R  +PI  VT  +    R  L +GV
  S:     1 MRKTKIVCTIGPA--------------------SESLEKLTALIEAGMNVARLNFSHGDFEEHGARIKNIREAAKRTGKTVAILLDTKGPEIRTQTVEGGAIELEKGQEL-ILSMNEVQGTKEKISI-----TYPGLCEDVEVGSTILLDDGLIGLEV--KEIRDTELVTIVRNSGVLKNKKGVNVPNVSVNLPGMTEKDAADIVFGIEQKVDFIAASFVRRASDVLEIRELLEKHGAADTAIIPKIENQEGVDNIDEILEVSDGLMVARGDLGVEIPAEEVPLVQKQLIKKCNELAKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVESVQTMHNIAERTEQALNYEN----------MLRRKSKEVKTSITSAIGQSVAYTASNLNAAAILTATESGYTARMTSRFRPKSPILAVTSNERAYRRMALVWGV 415
>gi|168482963|ref|ZP_02707915.1| pyruvate kinase [Streptococcus pneumoniae CDC1873-00] >gi|182683843|ref|YP_001835590.1| pyruvate kinase [Streptococcus pneumoniae CGSP14] >gi|172043480|gb|EDT51526.1| pyruvate kinase [Streptococcus pneumoniae CDC1873-00] >gi|182629177|gb|ACB90125.1| pyruvate kinase [Streptococcus pneumoniae CGSP14] (501 aa)
Score = 693, Expect = 9.2e-71, Identities = 156/369 (42%), Positives = 232/369 (62%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F    +     K  +E + KN+A L +AG N  RFNFSHGD++EQ  R+  V+   K  G  +  +LDTKGPEIR  +++   KE   K+  K+R+  TK+ I ++ +   L+  G  ++  DV+ G  + VDDGKL L V++ +      E    N  I+ + K +N+P++    P ++++D +DI F ++   ++IA SFV T  +V E++ I +E G  H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP Y+K IIK     GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKFGEDGYWG--EKLDVEASAKNIAKLIEAGANTFRFNFSHGDHQEQGERMATVKLAEKIAGKKVGFLLDTKGPEIRTELFEGEAKEYSYKTSEKIRV-ATKQGIKSTREVIALNVAGALDIYDDVEVGRQVLVDDGKLGLRVVAKDDATREFEVEVENDGIIAKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVNEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIIKKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQALLNEYGR 372
>gi|163763550|ref|ZP_02170611.1| Pyruvate kinase [Bacillus selenitireducens MLS10] >gi|160355870|gb|EDP82522.1| Pyruvate kinase [Bacillus selenitireducens MLS10] (536 aa)
Score = 692, Expect = 1.1e-70, Identities = 170/452 (37%), Positives = 260/452 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           I+KTKI  T+GP+                      + + L  L DAG+NV R NFSHGD++E   R+  +RE +++ G +++ +LDTKGPEIR         E++    VR+ + ++ +G +++ SV     TY  +  DV  G+T+ +DDG ++L V +   +E + E +  N+  L+  K +N+P+ + ++P +++KD NDI+F I+   D+IAASFV    +V EI+++L++HG EHIQII KIE   G+ ++++I++ SD +MVARGDLG+E+P  DVP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP  +V  MA I + +E+   Y    D+  K++   KE   T+   I+  V+    ++ H    S+IV         + +S  R  API  VT          L +GV
  S:     3 IRKTKIVCTIGPA--------------------SESPEKLTQLIDAGMNVARLNFSHGDFDEHGARIKSIREASEKAGKSVAILLDTKGPEIRTQTLEGGIAELEKGKTVRV-SMEEVVGNADRISV-----TYPGLVNDVHVGSTLLLDDGLIELRVTAIEDKELVTEVV--NSGTLKNKKGVNVPNVSVNLPGITEKDANDIVFGIEQDVDFIAASFVRRASDVHEIRELLEKHGAEHIQIIPKIENQEGVDNIEEILEVSDGLMVARGDLGVEIPAEDVPLVQKDLIKKCNQIGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPYESVTTMANIALKTESALKYR---DILRKKS---KEIENTVTDAISQSVS-HTALNLHA---SAIVTATQSGHTARMISKYRPEAPIVAVTSSSRVNRALALVWGV 417
>gi|15900780|ref|NP_345384.1| pyruvate kinase [Streptococcus pneumoniae TIGR4] >gi|15902841|ref|NP_358391.1| pyruvate kinase [Streptococcus pneumoniae R6] >gi|111657739|ref|ZP_01408462.1| hypothetical protein SpneT_02001069 [Streptococcus pneumoniae TIGR4] >gi|116516870|ref|YP_816275.1| pyruvate kinase [Streptococcus pneumoniae D39] >gi|148984633|ref|ZP_01817901.1| pyruvate kinase [Streptococcus pneumoniae SP3-BS71] >gi|148988326|ref|ZP_01819773.1| pyruvate kinase [Streptococcus pneumoniae SP6-BS73] >gi|148992975|ref|ZP_01822594.1| pyruvate kinase [Streptococcus pneumoniae SP9-BS68] >gi|149002440|ref|ZP_01827374.1| pyruvate kinase [Streptococcus pneumoniae SP14-BS69] >gi|149007156|ref|ZP_01830820.1| pyruvate kinase [Streptococcus pneumoniae SP18-BS74] >gi|149019481|ref|ZP_01834800.1| pyruvate kinase [Streptococcus pneumoniae SP23-BS72] >gi|168490332|ref|ZP_02714531.1| pyruvate kinase [Streptococcus pneumoniae SP195] >gi|168490984|ref|ZP_02715127.1| pyruvate kinase [Streptococcus pneumoniae CDC0288-04] >gi|168494321|ref|ZP_02718464.1| pyruvate kinase [Streptococcus pneumoniae CDC3059-06] >gi|14972372|gb|AAK75024.1| pyruvate kinase [Streptococcus pneumoniae TIGR4] >gi|15458396|gb|AAK99601.1| Pyruvate kinase I; fructose-stimulated [Streptococcus pneumoniae R6] >gi|116077446|gb|ABJ55166.1| pyruvate kinase [Streptococcus pneumoniae D39] >gi|147759377|gb|EDK66369.1| pyruvate kinase [Streptococcus pneumoniae SP14-BS69] >gi|147761194|gb|EDK68161.1| pyruvate kinase [Streptococcus pneumoniae SP18-BS74] >gi|147923024|gb|EDK74139.1| pyruvate kinase [Streptococcus pneumoniae SP3-BS71] >gi|147926007|gb|EDK77081.1| pyruvate kinase [Streptococcus pneumoniae SP6-BS73] >gi|147928427|gb|EDK79443.1| pyruvate kinase [Streptococcus pneumoniae SP9-BS68] >gi|147930856|gb|EDK81836.1| pyruvate kinase [Streptococcus pneumoniae SP23-BS72] >gi|183571332|gb|EDT91860.1| pyruvate kinase [Streptococcus pneumoniae SP195] >gi|183574597|gb|EDT95125.1| pyruvate kinase [Streptococcus pneumoniae CDC0288-04] >gi|183575624|gb|EDT96152.1| pyruvate kinase [Streptococcus pneumoniae CDC3059-06] (501 aa)
Score = 692, Expect = 1.1e-70, Identities = 156/369 (42%), Positives = 232/369 (62%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F    +     K  +E + KN+A L +AG N  RFNFSHGD++EQ  R+  V+   K  G  +  +LDTKGPEIR  +++   KE   K+  K+R+  TK+ I ++ +   L+  G  ++  DV+ G  + VDDGKL L V++ +      E    N  I+ + K +N+P++    P ++++D +DI F ++   ++IA SFV T  +V E++ I +E G  H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP Y+K IIK     GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKFGEDGYWG--EKLDVEASAKNIAKLIEAGANTFRFNFSHGDHQEQGERMATVKLAEKIAGKKVGFLLDTKGPEIRTELFEGEAKEYSYKTGEKIRV-ATKQGIKSTREVIALNVAGALDIYDDVEVGRQVLVDDGKLGLRVVAKDDATREFEVEVENDGIIAKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVNEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIIKKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQALLNEYGR 372
>gi|149010465|ref|ZP_01831836.1| pyruvate kinase [Streptococcus pneumoniae SP19-BS75] >gi|147764946|gb|EDK71875.1| pyruvate kinase [Streptococcus pneumoniae SP19-BS75] (501 aa)
Score = 692, Expect = 1.2e-70, Identities = 156/369 (42%), Positives = 232/369 (62%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F    +     K  +E + KN+A L +AG N  RFNFSHGD++EQ  R+  V+   K  G  +  +LDTKGPEIR  +++   KE   K+  K+R+  TK+ I ++ +   L+  G  ++  DV+ G  + VDDGKL L V++ +      E    N  I+ + K +N+P++    P ++++D +DI F ++   ++IA SFV T  +V E++ I +E G  H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP Y+K IIK     GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKFGEDGYWG--EKLDVEASAKNIAKLIEAGANTFRFNFSHGDHQEQGERMATVKLAEKIAGKKVGFLLDTKGPEIRTELFEGEAKEYSYKTGEKIRV-ATKQGIKSTREVIALNVAGALDIYDDVEVGRQVLVDDGKLGLRVVAKDDATREFEVEVENDGIIAKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVNEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIIKKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQALLNEYGR 372
>gi|15615725|ref|NP_244029.1| pyruvate kinase [Bacillus halodurans C-125] >gi|10175785|dbj|BAB06882.1| pyruvate kinase [Bacillus halodurans C-125] (584 aa)
Score = 691, Expect = 1.4e-70, Identities = 168/453 (37%), Positives = 255/453 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  T+GP+                      + + L  L +AG+NV R NFSHGD+EE   R+  +RE AK  G  ++ +LDTKGPEIR         E+K+  ++ I + K+ +GTSE+ SV     TY  +  DV PG  I +DDG + LEV+    +E  I T   N+  L+  K +N+P+ + ++P +++KD  DI F I+   D+IAASFV    +V EI+++L++HG EHI+II KIE   G+ ++++I++ SD +MVARGDLG+E+P  +VP  +K +IK C    K VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M++I   +E   +Y   +  + KE            TTI + ++          + S+I+         + ++  R  +PI  VT  +    +  L +GV+
  S:     1 MRKTKIVCTIGPA--------------------SESVEKLEQLMEAGMNVARLNFSHGDFEEHGARIKNIREAAKRIGKTVAILLDTKGPEIRTQTLEGGVAELKAGQELVI-SMKEVVGTSERISV-----TYPGLVHDVVPGAKILLDDGLIGLEVVEVRDQE--ILTKVLNSGTLKNKKGVNVPNVSVNLPGITEKDAADIKFGIEQGVDFIAASFVRRAQDVLEIRELLEQHGAEHIKIIPKIENQEGVDNIEEILEVSDGLMVARGDLGVEIPAEEVPLVQKSLIKKCNLVAKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVEAVQTMSRIAERAEQALNYQEILSKHTKEA----------RTTITSAISQSVGHTAFNLNASAILTATESGHTARVVAKYRPKSPIVAVTSNETVVRQLALVWGVY 416
>gi|194017255|ref|ZP_03055867.1| pyruvate kinase [Bacillus pumilus ATCC 7061] >gi|194011123|gb|EDW20693.1| pyruvate kinase [Bacillus pumilus ATCC 7061] (586 aa)
Score = 691, Expect = 1.5e-70, Identities = 172/455 (37%), Positives = 256/455 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTKI  T+GP+                    ET +K L  L +AG+NV R NFSHGD+EE   R+  +R+  K  G +I+ +LDTKGPEIR        +E+ + + + I + +  +G +EK SV     TY  +  DV+ G+TI +DDG + LEV   N++   I T   NT  L+  K +N+P  + ++P +++KD NDI+F ++   D+IAASFV    +V EI+++L+++    IQII KIE   G+ ++D+I++ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M  I   SE+  +Y +AI         +  +   +  +I   +           D ++IV         + +S  R  API  VT  +  A +  L +GVF K
  S:     1 MRKTKIVCTIGPAS-------------------ETIEK-LTELIEAGMNVARLNFSHGDFEEHGARIENIRKAGKTLGKDIAILLDTKGPEIRTRTVENGSIELVAGADL-IVSMEDIVGNTEKISV-----TYEELIHDVEVGSTILLDDGLIGLEVKEINMDRKEIVTKVMNTGTLKNKKGVNVPGVSVNLPGITEKDANDILFGVEQGVDFIAASFVRRASDVLEIRELLEKNNAADIQIIPKIENQEGVDNIDEILEVSDGLMVARGDLGVEIPAEEVPLVQKMLIKKCNRLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGTYPVEAVQTMHNIASRSEDALNY-KAI---------LSRRSEEVDVSITDAIGQSVAHTAMKLDVAAIVTPTESGHTARMISKYRPKAPIVAVTANESVARKLSLVFGVFAK 420
>gi|125717692|ref|YP_001034825.1| pyruvate kinase [Streptococcus sanguinis SK36] >gi|125497609|gb|ABN44275.1| Pyruvate kinase I, fructose-stimulated, putative [Streptococcus sanguinis SK36] (501 aa)
Score = 689, Expect = 2.7e-70, Identities = 155/369 (42%), Positives = 230/369 (62%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F   D      K  +E + +N+A L +AG N  RFNFSHGD+ EQ  R+  V+   +  G  +  +LDTKGPEIR  +++   KE   K+  K+R+  TK+ I ++     L+  G  ++  DV+ G+ + VDDGKL L V S +      E +  N  I+ + K +N+P++    P ++++D +DI F ++   ++IA SFV T  +V E++ I +E G  H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKF--GDDGYWGEKLDVEASAQNIAKLIEAGANTFRFNFSHGDHAEQGERMATVKRAEEIAGQKVGFLLDTKGPEIRTELFEGDAKEYSYKTGEKIRV-ATKQGIKSTRDVIALNVAGALDIYDDVEVGHQVLVDDGKLGLRVFSKDDATREFEVVVENDGIIAKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVDEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQTLLNEYGR 372
>gi|154500572|ref|ZP_02038610.1| hypothetical protein BACCAP_04245 [Bacteroides capillosus ATCC 29799] >gi|150270461|gb|EDM97770.1| hypothetical protein BACCAP_04245 [Bacteroides capillosus ATCC 29799] (478 aa)
Score = 688, Expect = 3.1e-70, Identities = 175/473 (36%), Positives = 260/473 (54%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-GRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV---FVKVVDNVEHAIANKTEI 473
           M  ++KTKI  TLGP++                     +++ +  L  AG+N  RFNFSHG +E    +L  ++ V  E G+ ++ +LDTKGPEIR+    +  +E+K D    + T + E GTSE+ SV     TY N+  +V PGN I VDDG + L V     +E  I  +  N   L  NK IN+P+ +  +P +++KD+ D+ FA +N FD+IAASFV    +V +I+  L E GG++I+IISKIE   G+ +L++II  SD +MVARGDLG+E+P  +VP  +K +IK     GK VI ATQMLDS+    +PTRAEV+DV  AV  GT C MLSGETA+G YPI AVE M     ++E+  +Y GR          F +  +    +TI   +     +     + ++I+         + +S  R A PI  V   ++   +  +++GV       VD+ +   +   E+
  S:     4 MSDMRKTKIICTLGPAVD--------------------SEEMIRKLILAGMNAARFNFSHGTHESHLAQLTKLKRVRDELGIPVAAILDTKGPEIRIKTFKDGRIELKKDDVFTLTTAECE-GTSERVSV-----TYANLHNEVAPGNHILVDDGLIDLLVQEIKGQE--IVCVVENGGPLSNNKSINIPNVHILLPSLTEKDKEDLKFAAENDFDFIAASFVRKASDVEDIRACLHEFGGDNIRIISKIENREGVDNLEEIIAASDGVMVARGDLGVEIPAQEVPILQKKMIKATTMAGKPVITATQMLDSMIRNPRPTRAEVSDVANAVFDGTSCVMLSGETASGKYPIEAVEAMVSTVKAAESAINYWGR----------FREHSLQPGVSTINDAITHTCCMTAMDLNATAILAPTESGYTAKVISRFRPACPIVAVCQNEKVRRQLAISWGVHSYLTGFVDSTDRLFSMSVEV 443
>gi|195978009|ref|YP_002123253.1| pyruvate kinase Pyk [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974714|gb|ACG62240.1| pyruvate kinase Pyk [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (500 aa)
Score = 688, Expect = 3.3e-70, Identities = 167/453 (36%), Positives = 257/453 (56%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI ATLGP++    GK +    +   +    +E + K +A L +AG NV RFNFSHGD++EQ  R+  VR   K     +  +LDTKGPE+R  ++    KE    +  ++R+  T + I ++     L+  G  ++  +V+ G+TI +DDGKL L+VI  ++ +        N  I+ + K +N+P++    P ++++D  DI F ++   ++IA SFV T  +V E+++I +E G EH+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP ++K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ AV  MA ID +++    +YGR     F  T     K   +A+ +            H  D   +V         +A+S  R  A I  VT  ++      +N+GV
  S:     1 MNKRVKIVATLGPAVEIRGGKKYGEDGYWAGQLD--VEQSAKKIAELIEAGANVFRFNFSHGDHKEQGDRMATVRLAEKLARQKVGFLLDTKGPEMRTELFADDAKEYSYVTGERIRV-ATAQGIQSTRDVIALNVAGALDIYDEVEVGHTILIDDGKLGLKVIEKDIAKREFIVEVENDGIIAKQKGVNIPNTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVREICRETGNEHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVFQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVEAVRTMATIDKNAQTLLNEYGRLDSSAFPRT----NKTDVIASAVKDA--------THSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRALMINWGV 444
>gi|39938773|ref|NP_950539.1| pyruvate kinase [Onion yellows phytoplasma OY-M] >gi|39721882|dbj|BAD04372.1| pyruvate kinase [Onion yellows phytoplasma OY-M] (446 aa)
Score = 687, Expect = 4.8e-70, Identities = 174/452 (38%), Positives = 255/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + KTKI  TLGP+                       K  L AL   G+NV RFNFSH  YE+  + +  ++ ++ +   N   MLDTKGPEIR ++  +  V I+ DS+V+I  T+  +G ++ FSV  S    N+  +++ G+ + +DDG L LEV+  +  +  + T A+NT  ++  + +N+P  N  + F+S KD  DI+FA +  FDYIAASFV    +V++I+KIL+E G  +IQIISKIE   G+ +L++II ESD IMVARGDLG+EV    VP Y+  +I  C   GK V+VATQML+S++   +PT+AE +DVF AV  GT  TMLSGE+A+G YP+ AV  M KI+  +E   +Y     VY  +    KE +   A  +A              D  +IVV+  D +    +S    + P+  +   ++ A R  LN+GV
  S:     1 MNKTKIICTLGPA--------------------SYDKNILQALIQTGLNVARFNFSHAQYEQTKLLMKTIKTISDKLDKNTGLMLDTKGPEIRTHEF-DGVVTIQKDSEVKISMTEV-LGNAKLFSVSYS----NLYNELKVGDMVNIDDGYLSLEVVGKDEAKQQLVTKAKNTHSIKSRRGVNVPKVNLEMDFISPKDYQDIVFAAQQDFDYIAASFVRRAQDVKDIRKILQEQGNSNIQIISKIENQEGVDNLEEIIQESDGIMVARGDLGIEVDGELVPLYQTRMITKCLEYGKPVVVATQMLESMQRNPRPTKAETSDVFNAVREGTTFTMLSGESASGEYPVEAVTYMKKINYQAEKVVNYQALSQVYQPKNS--KENLLLSAVELALRT-----------DVKAIVVY--DLKDAYNVSKFHPSVPVLALVKTEQEARRLVLNFGV 411
>gi|157150834|ref|YP_001450620.1| pyruvate kinase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075628|gb|ABV10311.1| pyruvate kinase [Streptococcus gordonii str. Challis substr. CH1] (501 aa)
Score = 687, Expect = 4.9e-70, Identities = 154/369 (41%), Positives = 231/369 (62%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F    +     K  +E + KN+A L +AG N  RFNFSHGD++EQ  R+  V+   +  G  +  +LDTKGPEIR  +++   KE   K+  K+R+  TK+ I ++     L+  G  ++  DV+ G+ + VDDGKL L V + +      E +  N  I+ + K +N+P++    P ++++D +DI F ++   ++IA SFV T  +V E++ I +E G  H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKFGEDGYWG--EKLDVEASAKNIAKLIEAGANTFRFNFSHGDHQEQGERMATVKLAEEIAGQKVGFLLDTKGPEIRTELFEGDAKEYSYKTGEKIRV-ATKQGIKSTRDVIALNVAGALDIYDDVEVGHQVLVDDGKLGLRVFAKDDATREFEVVVENDGIIAKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVDEVRAICEETGNGHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKVVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATIDKNAQTLLNEYGR 372
>gi|170783868|gb|ACB37409.1| pyruvate kinase [Spiroplasma mirum] (274 aa)
Score = 687, Expect = 5.1e-70, Identities = 141/273 (51%), Positives = 199/273 (72%)
  Q:    74 REVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANG 346
           ++V ++ G  IS +LDTKGPEIRV +  + + EIK+  KV IY+  ++  T +     + T +Y+M++D++ G+ + VDDGKL+L V  ++V+ G+I T A N  +++ NKRINLP  ++++PF++ KD NDI + I+   DYIAASFVNT  N++EI+++LKE   EHIQII+KIE+  GI ++D II+ +D IM+ARGDLGLE+PYYDVP +EK II+ CR  GK VIVATQML+++     PTRAEVTDV+FA E G D TMLSGE+A G
  S:     4 KQVREKIGKPISILLDTKGPEIRVGQMKDGKQEIKAGDKVIIYSMPEDYQTRQGTGT-EITVSYDMSQDLKVGDMVLVDDGKLQLNV--NDVKPGVITTTAFNHHLVKTNKRINLPGVDFTLPFLAKKDINDIKYGIEQGIDYIAASFVNTAANIQEIRQLLKEGNAEHIQIIAKIESQIGINNIDAIIEAADGIMIARGDLGLEIPYYDVPYWEKVIIRKCRAAGKIVIVATQMLETMTDNPHPTRAEVTDVYFATELGADATMLSGESAMG 273
>gi|50914321|ref|YP_060293.1| pyruvate kinase [Streptococcus pyogenes MGAS10394] >gi|50903395|gb|AAT87110.1| Pyruvate kinase [Streptococcus pyogenes MGAS10394] (500 aa)
Score = 686, Expect = 5.9e-70, Identities = 169/453 (37%), Positives = 263/453 (58%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVR---EVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI ATLGP++    GK +    +   +    +E + K +A L +AG NV RFNFSHGD++EQ  R+  VR   E+A++K   +  +LDTKGPE+R  ++    KE    +  K+R+ TT+  I ++     L+  G+ ++  +V+ G+TI +DDGKL L+VI  ++          N  I+ + K +N+P++    P ++++D  DI F ++   ++IA SFV T  +V E+++I +E G +H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP ++K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR     F  T     K   +A+ +            H  D   +V         +A+S  R  A I  VT  ++      +N+GV
  S:     1 MNKRVKIVATLGPAVEIRGGKKYGEDGYWAGQLD--VEESAKKIAELIEAGANVFRFNFSHGDHKEQGDRMATVRLAEEIARQK---VGFLLDTKGPEMRTELFADDAKEFSYVTGEKIRVATTQG-IQSTRDVIALNVAGSLDIYDEVEVGHTILIDDGKLGLKVIDKDIATRQFIVEVENDGIIAKQKGVNIPNTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVREICRETGNDHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVFQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIDRNAQTLLNEYGRLDSSAFPRT----NKTDVIASAVKDA--------THSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRALMINWGV 444
>gi|152002533|dbj|BAF73557.1| pyruvate kinase [Onion yellows phytoplasma OY-W] (446 aa)
Score = 686, Expect = 6.6e-70, Identities = 174/452 (38%), Positives = 255/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + KTKI  TLGP+                       K  L AL   G+NV RFNFSH  YE+  + +  ++ ++ +   +   MLDTKGPEIR ++  +  V IK DS+V+I  T+  +G ++ FSV  S    N+  +++ G+ + +DDG L LEV+  +  +  + T A+NT  ++  + +N+P  N  + F+S KD  DI+FA +  FDYIAASFV    +V++I+KIL+E G  +IQIISKIE   G+ +L++II ESD IMVARGDLG+EV    VP Y+  +I  C   GK V+VATQML+S++   +PT+AE +DVF AV  GT  TMLSGE+A+G YP+ AV  M KI+  +E   +Y     VY  +    KE +   A  +A              D  +IVV+  D +    +S    + P+  +   ++ A R  LN+GV
  S:     1 MNKTKIICTLGPA--------------------SYDKNILQALIQTGLNVARFNFSHAQYEQTKLLMKTIKTISDKLDKHTGLMLDTKGPEIRTHEF-DGVVTIKKDSEVKISMTEV-LGNAKLFSVSYS----NLYNELKVGDMVNIDDGYLSLEVVGKDEAKQQLVTKAKNTHFIKSRRGVNVPKVNLEMDFISPKDYQDIVFAAQQDFDYIAASFVRRAQDVKDIRKILQEQGNSNIQIISKIENQEGVDNLEEIIQESDGIMVARGDLGIEVDGELVPLYQTRMITKCLEYGKPVVVATQMLESMQRNPRPTKAETSDVFNAVREGTTFTMLSGESASGEYPVEAVTYMKKINYQAEKVVNYQTLSKVYQPKNS--KENLLLSAVELALRT-----------DVKAIVVY--DLKDAYNVSKFHPSVPVLALVKTEQEARRLVLNFGV 411
>gi|15675235|ref|NP_269409.1| pyruvate kinase [Streptococcus pyogenes M1 GAS] >gi|19746205|ref|NP_607341.1| pyruvate kinase [Streptococcus pyogenes MGAS8232] >gi|71910801|ref|YP_282351.1| pyruvate kinase [Streptococcus pyogenes MGAS5005] >gi|94988722|ref|YP_596823.1| pyruvate kinase [Streptococcus pyogenes MGAS9429] >gi|94990611|ref|YP_598711.1| pyruvate kinase [Streptococcus pyogenes MGAS10270] >gi|94992545|ref|YP_600644.1| pyruvate kinase [Streptococcus pyogenes MGAS2096] >gi|94994534|ref|YP_602632.1| pyruvate kinase [Streptococcus pyogenes MGAS10750] >gi|139473656|ref|YP_001128372.1| pyruvate kinase [Streptococcus pyogenes str. Manfredo] >gi|13622405|gb|AAK34130.1| putative pyruvate kinase [Streptococcus pyogenes M1 GAS] >gi|19748388|gb|AAL97840.1| putative pyruvate kinase [Streptococcus pyogenes MGAS8232] >gi|71853583|gb|AAZ51606.1| pyruvate kinase [Streptococcus pyogenes MGAS5005] >gi|94542230|gb|ABF32279.1| pyruvate kinase [Streptococcus pyogenes MGAS9429] >gi|94544119|gb|ABF34167.1| Pyruvate kinase [Streptococcus pyogenes MGAS10270] >gi|94546053|gb|ABF36100.1| Pyruvate kinase [Streptococcus pyogenes MGAS2096] >gi|94548042|gb|ABF38088.1| Pyruvate kinase [Streptococcus pyogenes MGAS10750] >gi|134271903|emb|CAM30141.1| putative pyruvate kinase [Streptococcus pyogenes str. Manfredo] (500 aa)
Score = 685, Expect = 7.7e-70, Identities = 169/453 (37%), Positives = 263/453 (58%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVR---EVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI ATLGP++    GK +    +   +    +E + K +A L +AG NV RFNFSHGD++EQ  R+  VR   E+A++K   +  +LDTKGPE+R  ++    KE    +  K+R+ TT+  I ++     L+  G+ ++  +V+ G+TI +DDGKL L+VI  ++          N  I+ + K +N+P++    P ++++D  DI F ++   ++IA SFV T  +V E+++I +E G +H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP ++K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR     F  T     K   +A+ +            H  D   +V         +A+S  R  A I  VT  ++      +N+GV
  S:     1 MNKRVKIVATLGPAVEIRGGKKYGEDGYWAGQLD--VEESAKKIAELIEAGANVFRFNFSHGDHKEQGDRMATVRLAEEIARQK---VGFLLDTKGPEMRTELFADDAKEFSYVTGEKIRVATTQG-IQSTRDVIALNVAGSLDIYDEVEVGHTILIDDGKLGLKVIDKDIATRQFIVEVENDGIIAKQKGVNIPNTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVREICRETGNDHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVFQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIDRNAQTLLNEYGRLDSSAFPRT----NKTDVIASAVKDA--------THSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRALMINWGV 444
>gi|16800673|ref|NP_470941.1| pyruvate kinase [Listeria innocua Clip11262] >gi|16414092|emb|CAC96836.1| pykA [Listeria innocua] (585 aa)
Score = 683, Expect = 1.4e-69, Identities = 173/472 (36%), Positives = 254/472 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID 475
           +KKTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE +K+ G  ++ +LDTKGPEIR       ++E ++   VR+  T  E GT EKFSV     TY  +  DV+ G++I +DDG + LEVI  +     + T   N  +L+  K +N+P+ + ++P +++KD  DI F ++   D+IAASFV    +V EI KIL+EH   H+QII KIE   G+ ++D+I+  S  +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV++MAKI V +E          +   E   M E +G      A              +  +IV         + +S  R  + I  VT  +       L++GV+ ++       ++N  E+ D
  S:     1 MKKTKIVCTIGPA--------------------SESVDTLVQLIEAGMNVARLNFSHGDFEEHGARIVNIREASKKTGKQVAILLDTKGPEIRTNDMVGGKLEFQTGDVVRVSMTPVE-GTKEKFSV-----TYGELYDDVEIGSSILLDDGLIGLEVIEKDEANRELVTKVLNPGVLKNKKGVNVPNVSINLPGITEKDAADIRFGLEQGIDFIAASFVRRATDVLEITKILEEHNATHVQIIPKIENQEGVDNIDEILQVSQGLMVARGDLGVEIPAEEVPIVQKELIRKCNKLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVEAVKMMAKIAVRTEEVLVAQDKFALKLHENTDMTEAIGQAVGHTAK-----------NLNVQTIVAATQSGHTARMISKYRPKSHIVAVTFNEHVYRGLALSWGVYPRLAT----PVSNTDEMFD 432
>gi|46907801|ref|YP_014190.1| pyruvate kinase [Listeria monocytogenes str. 4b F2365] >gi|153167017|ref|ZP_01927439.1| pyruvate kinase [Listeria monocytogenes FSL N1-017] >gi|153202490|ref|ZP_01944026.1| pyruvate kinase [Listeria monocytogenes HPB2262] >gi|167014787|ref|ZP_02277320.1| pyruvate kinase [Listeria monocytogenes FSL J1-194] >gi|168266030|ref|ZP_02687995.1| pyruvate kinase [Listeria monocytogenes FSL J2-071] >gi|46881070|gb|AAT04367.1| pyruvate kinase [Listeria monocytogenes str. 4b F2365] >gi|133727208|gb|EBA28906.1| pyruvate kinase [Listeria monocytogenes FSL N1-017] >gi|133735265|gb|EBA36963.1| pyruvate kinase [Listeria monocytogenes HPB2262] (585 aa)
Score = 682, Expect = 1.6e-69, Identities = 173/472 (36%), Positives = 254/472 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID 475
           +KKTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE +K+ G  ++ +LDTKGPEIR       ++E ++   VR+  T  E GT EKFSV     TY  +  DV+ G++I +DDG + LEVI  +     + T   N  +L+  K +N+P+ + ++P +++KD  DI F ++   D+IAASFV    +V EI KIL+EH   H+QII KIE   G+ ++D+I+  S  +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV++MAKI V +E          +   E   M E +G      A              +  +IV         + +S  R  + I  VT  +       L++GV+ ++       ++N  E+ D
  S:     1 MKKTKIVCTIGPA--------------------SESVDTLVQLIEAGMNVARLNFSHGDFEEHGARIVNIREASKKTGKQVAILLDTKGPEIRTNDMVGGKLEFQTGDVVRVSMTPVE-GTKEKFSV-----TYGELYDDVEIGSSILLDDGLIGLEVIEKDEANRELVTKVLNPGVLKNKKGVNVPNVSINLPGITEKDAADIRFGLEQGIDFIAASFVRRATDVLEITKILEEHNATHVQIIPKIENQEGVDNIDEILQVSQGLMVARGDLGVEIPAEEVPIVQKELIRKCNKLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVEAVKMMAKIAVRTEEVLVAQDKFALKLHENTDMTEAIGQAVGHTAK-----------NLNVQTIVAATQSGHTARMISKYRPKSHIVAVTFNEHVYRGLALSWGVYPRLAT----PVSNTDEMFD 432
>gi|71903625|ref|YP_280428.1| pyruvate kinase [Streptococcus pyogenes MGAS6180] >gi|71802720|gb|AAX72073.1| pyruvate kinase [Streptococcus pyogenes MGAS6180] (500 aa)
Score = 682, Expect = 1.8e-69, Identities = 169/453 (37%), Positives = 262/453 (57%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVR---EVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI ATLGP++    GK +    +   +    +E + K +A L +AG NV RFNFSHGD++EQ  R+  VR   E+A++K   +  +LDTKGPE+R  ++    KE    +  K+R+ TT+  I ++     L+  G+ ++  +V+ G+TI +DDGKL L+VI  ++          N  I+ + K +N+P++    P ++++D  DI F ++   ++IA SFV T  +V E+++I  E G +H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP ++K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR     F  T     K   +A+ +            H  D   +V         +A+S  R  A I  VT  ++      +N+GV
  S:     1 MNKRVKIVATLGPAVEIRGGKKYGEDGYWAGQLD--VEESAKKIAELIEAGANVFRFNFSHGDHKEQGDRMATVRLAEEIARQK---VGFLLDTKGPEMRTELFADDAKEFSYVTGEKIRVATTQG-IQSTRDVIALNVAGSLDIYDEVEVGHTILIDDGKLGLKVIDKDIATRQFIVEVENDGIIAKQKGVNIPNTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVREICCETGNDHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVFQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIDRNAQTLLNEYGRLDSSAFPRT----NKTDVIASAVKDA--------THSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRALMINWGV 444
>gi|16803610|ref|NP_465095.1| pyruvate kinase [Listeria monocytogenes EGD-e] >gi|153174730|ref|ZP_01930199.1| pyruvate kinase [Listeria monocytogenes FSL N3-165] >gi|153179602|ref|ZP_01932821.1| pyruvate kinase [Listeria monocytogenes F6900] >gi|153183921|ref|ZP_01934738.1| pyruvate kinase [Listeria monocytogenes J0161] >gi|153191007|ref|ZP_01938318.1| pyruvate kinase [Listeria monocytogenes J2818] >gi|153196794|ref|ZP_01941121.1| pyruvate kinase [Listeria monocytogenes 10403S] >gi|16410999|emb|CAC99648.1| pykA [Listeria monocytogenes] >gi|126943573|gb|EBA21294.1| pyruvate kinase [Listeria monocytogenes J0161] >gi|127633677|gb|EBA23085.1| pyruvate kinase [Listeria monocytogenes 10403S] >gi|127765575|gb|EBA25923.1| pyruvate kinase [Listeria monocytogenes J2818] >gi|133729961|gb|EBA31659.1| pyruvate kinase [Listeria monocytogenes FSL N3-165] >gi|133733087|gb|EBA34785.1| pyruvate kinase [Listeria monocytogenes F6900] (585 aa)
Score = 682, Expect = 1.9e-69, Identities = 173/472 (36%), Positives = 254/472 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID 475
           +KKTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE +K+ G  ++ +LDTKGPEIR       ++E ++   VR+  T  E GT EKFSV     TY  +  DV+ G++I +DDG + LEVI  +     + T   N  +L+  K +N+P+ + ++P +++KD  DI F ++   D+IAASFV    +V EI KIL+EH   H+QII KIE   G+ ++D+I+  S  +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV++MAKI V +E          +   E   M E +G      A              +  +IV         + +S  R  + I  VT  +       L++GV+ ++       ++N  E+ D
  S:     1 MKKTKIVCTIGPA--------------------SESVDTLVQLIEAGMNVARLNFSHGDFEEHGARIVNIREASKKTGKQVAILLDTKGPEIRTNDMVGGKLEFQTGDVVRVSMTPVE-GTKEKFSV-----TYGELYDDVEIGSSILLDDGLIGLEVIEKDEANRELVTKVLNPGVLKNKKGVNVPNVSINLPGITEKDAADIRFGLEQGIDFIAASFVRRATDVLEITKILEEHNATHVQIIPKIENQEGVDNIDEILQVSQGLMVARGDLGVEIPAEEVPIVQKELIRKCNKLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVEAVKMMAKIAVRTEEVLVAQDKFALKLHENTDMTEAIGQAVGHTAK-----------NLNVQTIVAATQSGHTARMISKYRPKSHIVAVTFNEHVYRGLALSWGVYPRLAT----PVSNTDEMFD 432
>gi|170783870|gb|ACB37410.1| pyruvate kinase [Spiroplasma sp. CRAB] >gi|170783872|gb|ACB37411.1| pyruvate kinase [Spiroplasma sp. CRAYFISH] >gi|170783874|gb|ACB37412.1| pyruvate kinase [Spiroplasma sp. SHRIMP] (273 aa)
Score = 681, Expect = 2.0e-69, Identities = 139/271 (51%), Positives = 200/271 (73%)
  Q:    74 REVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETA 344
           ++V ++ G  IS +LDTKGPEIRV +  + + EIK+  KV IY+  ++   + + +  + T +Y+M++D++ G+ + VDDGKL+L V  ++V+ G+I T A N  +++ NKRINLP  ++++PF+++KD NDI + I+   DYIAASFVNT  N++EI+++LKE   EHIQII+KIE+  GI ++D II+ +D IM+ARGDLGLE+PYYDVP +EK II+ CR  GK VIVATQML+++     PTRAEVTDV+FA E G D TMLSGE+A
  S:     5 KQVREKIGKPISILLDTKGPEIRVGQMKDGKQEIKAGDKVTIYSMPEDY-QARQGTGTEITVSYDMSQDLKIGDMVLVDDGKLQLNV--NDVKPGVITTTAFNHHLVKTNKRINLPGVDFTLPFLAEKDINDIKYGIEQGIDYIAASFVNTAANIQEIRQLLKEGNAEHIQIIAKIESQIGINNIDAIIEAADGIMIARGDLGLEIPYYDVPYWEKVIIRKCRAAGKIVIVATQMLETMTDNPHPTRAEVTDVYFATELGADATMLSGESA 272
>gi|16079970|ref|NP_390796.1| pyruvate kinase [Bacillus subtilis subsp. subtilis str. 168] >gi|3183541|sp|P80885|KPYK_BACSU Pyruvate kinase (PK) (Vegetative protein 17) (VEG17) >gi|2293265|gb|AAC00343.1| pyruvate kinase [Bacillus subtilis] >gi|2635383|emb|CAB14878.1| pyruvate kinase [Bacillus subtilis subsp. subtilis str. 168] (585 aa)
Score = 681, Expect = 2.2e-69, Identities = 167/459 (36%), Positives = 257/459 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVG-TLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDN 462
           ++KTKI  T+GP+                      + + L  L ++G+NV R NFSHGD+EE   R+  +RE +K+ G N+  +LDTKGPEIR +      +E+++  ++ I +  + +GT++K SV     TY  +  DV+ G+TI +DDG + LEV+  +  +  I+T   N   L+  K +N+P  + ++P +++KD  DI+F I+   D+IA SF+    +V EI+++L+EH  + IQII KIE   G+ ++D I++ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M  I   SE   +Y   +          +++VG T+   I   VA   +      + ++IV         + ++  R  API  VT     + +  L  GVF +   N
  S:     1 MRKTKIVCTIGPA--------------------SESIEMLTKLMESGMNVARLNFSHGDFEEHGARIKNIREASKKLGKNVGILLDTKGPEIRTHTMENGGIELETGKEL-IISMDEVVGTTDKISV-----TYEGLVHDVEQGSTILLDDGLIGLEVLDVDAAKREIKTKVLNNGTLKNKKGVNVPGVSVNLPGITEKDARDIVFGIEQGVDFIAPSFIRRSTDVLEIRELLEEHNAQDIQIIPKIENQEGVDNIDAILEVSDGLMVARGDLGVEIPAEEVPLVQKELIKKCNALGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGSYPVEAVQTMHNIASRSEEALNYKEILSK-------RRDQVGMTITDAIGQSVAHTAI----NLNAAAIVTPTESGHTARMIAKYRPQAPIVAVTVNDSISRKLALVSGVFAESGQN 424
>gi|116872999|ref|YP_849780.1| pyruvate kinase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741877|emb|CAK21001.1| pykA [Listeria welshimeri serovar 6b str. SLCC5334] (585 aa)
Score = 679, Expect = 3.5e-69, Identities = 172/472 (36%), Positives = 254/472 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID 475
           +KKTKI  T+GP+                      +   L  L +AG+NV R NFSHGD+EE   R+  +RE +K+ G  ++ +LDTKGPEIR       ++E ++   VR+  T  E GT EKFSV     TY  +  DV+ G++I +DDG + LEVI  +     + T   N  +L+  K +N+P+ + ++P +++KD  DI F ++   D+IAASFV    +V EI KIL+EH   H+QII KIE   G+ ++D+I+  S  +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV++MAKI + +E          +   E   M E +G      A              +  +IV         + +S  R  + I  VT  +       L++GV+ ++       ++N  E+ D
  S:     1 MKKTKIVCTIGPA--------------------SESVDTLVQLIEAGMNVARLNFSHGDFEEHGARIVNIREASKKTGKQVAILLDTKGPEIRTNDMVGGKLEFQTGDVVRVSMTPVE-GTKEKFSV-----TYGELYDDVEIGSSILLDDGLIGLEVIEKDEANRELVTKVLNPGVLKNKKGVNVPNVSINLPGITEKDAADIRFGLEQGIDFIAASFVRRATDVLEITKILEEHNATHVQIIPKIENQEGVDNIDEILQVSQGLMVARGDLGVEIPAEEVPIVQKELIRKCNKLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVEAVKMMAKIAIRTEEVLVAQDKFALKLHENTDMTEAIGQAVGHTAK-----------NLNVQTIVAATQSGHTARMISKYRPKSHIVAVTFNEHVYRGLALSWGVYPRLAT----PVSNTDEMFD 432
>gi|21910448|ref|NP_664716.1| pyruvate kinase [Streptococcus pyogenes MGAS315] >gi|28896023|ref|NP_802373.1| pyruvate kinase [Streptococcus pyogenes SSI-1] >gi|21904647|gb|AAM79519.1| putative pyruvate kinase [Streptococcus pyogenes MGAS315] >gi|28811273|dbj|BAC64206.1| putative pyruvate kinase [Streptococcus pyogenes SSI-1] (500 aa)
Score = 679, Expect = 3.9e-69, Identities = 168/453 (37%), Positives = 262/453 (57%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVR---EVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI ATLGP++    GK +    +   +    +E + K +A L +AG NV RFNFSHGD++EQ  R+  VR   E+A++K   +  +LDTKGPE+R  ++    KE    +  K+R+ TT+  I ++     L+  G+ ++  +V+ G+TI +DDGKL L+VI  ++          N  I+ + K +N+P++    P ++++D  DI F ++   ++IA SFV T  +V E+++I +E G +H+Q+ +KIE   GI +LD+II+ +D IM+ARGD+G+EVP+  VP ++K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR     F  T     K   +A+ +            H  D   +V         +A+S  R  A I  VT  ++      +N+ V
  S:     1 MNKRVKIVATLGPAVEIRGGKKYGEDGYWAGQLD--VEESAKKIAELIEAGANVFRFNFSHGDHKEQGDRMATVRLAEEIARQK---VGFLLDTKGPEMRTELFADDAKEFSYVTGEKIRVATTQG-IQSTRDVIALNVAGSLDIYDEVEVGHTILIDDGKLGLKVIDKDIATRQFIVEVENDGIIAKQKGVNIPNTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVREICRETGNDHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVFQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIDRNAQTLLNEYGRLDSSAFPRT----NKTDVIASAVKDA--------THSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRALMINWAV 444
>gi|24379618|ref|NP_721573.1| pyruvate kinase [Streptococcus mutans UA159] >gi|24377568|gb|AAN58879.1|AE014955_9 pyruvate kinase [Streptococcus mutans UA159] (500 aa)
Score = 678, Expect = 5.1e-69, Identities = 182/489 (37%), Positives = 274/489 (56%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID--AINSQLPEVKKTVVVI 491
           M K+ KI ATLGP++    GK F    +     K  +E +   +A L   G NV RFNFSHGD+ EQ  R+  VR   +     +  +LDTKGPE+R  ++    KE E K+  K+RI  TK+ I +++    L+  G  ++  DV  G TI +DDGKL L V + ++     E    N  I+ + K +N+P++    P ++++D  DI F ++   ++IA SFV T  +V E+++I KE G EH+++ +KIE   GI ++D+IID +D IM+ARGD+G+EVP+  VP Y+K II      GK+ I AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ AV  MA ID +++    +YGR        T   K +V   A   AT     +++        +I   GN  RLI   S  R  A I  +T  ++      +N+GV + ++     +  +  EI +  A+ S L E    +V++
  S:     1 MNKRVKIVATLGPAVEIRGGKKFGEDGYWG--EKLDVEASAAKIAELITEGANVFRFNFSHGDHAEQGERMATVRRAEELARQKVGFLLDTKGPEMRTELFADGVKEYEYKTGDKLRI-ATKQGIESTKDVIALNVAGGLDIYDDVAVGQTILIDDGKLGLTVTAKDITTREFEVTVENDGIIAKQKGVNIPNTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVNEVRQICKETGNEHVKLFAKIENQQGIDNIDEIIDAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKSAITATNMLETMTDKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVEAVRTMATIDKNAQTLLNEYGRLNSDNLPRTN--KTEVVASAVKDATKSMDIKLV-------VTITESGNTARLI---SKYRPDADILALTFDEKVQKSLMINWGV-IPILTEKPASTDDMFEIAEKAALKSGLVESGDNIVIV 481
>gi|188585189|ref|YP_001916734.1| pyruvate kinase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349876|gb|ACB84146.1| pyruvate kinase [Natranaerobius thermophilus JW/NM-WN-LF] (580 aa)
Score = 678, Expect = 5.3e-69, Identities = 169/462 (36%), Positives = 265/462 (57%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           M++KTKI AT+GP+              ENK       ++LA +   G++V R NFSHG+++E   R+NL+REV +E     + +LDT+GPEIR+      EV+++   +  + T + E G + +  V        +  D+ PG+ + +DDG +  E++ + V E  ++T+  N   +++NK +NLP    S+P M+DKD+ DI+F I+N+ D+IAASF+   ++V EI+K L+EHG + I +ISKIE   G+++L+ I++ SD +MVARGDLG+++P  +VP  +K +I  C  +GK VI ATQML+S+    +PTRAE +DV  A+  GTD  MLSGETA G YP+ +V  MA I  S+E      +  +V  K+T  M E +G     IA  +    ++      Y++ +V           +  +  API  VT  ++ A R  L++GV+    D  E
  S:     1 MLRKTKIVATIGPAC-------------ENK-------ESLARMAQNGMDVCRLNFSHGEHQEHLDRINLIREVYQELKFPPAILLDTRGPEIRLGTFENGEVDLEKGQEFTLSTEEIE-GDTTRVHV----NYPQVTSDISPGDKVLLDDGLI--ELLVNEVTETEVKTVVNNDGTIKDNKGVNLPGVTLSLPAMTDKDQQDILFGIENQVDFIAASFIRKPEDVLEIRKFLEEHGSD-IPVISKIENKEGVENLERILEVSDGLMVARGDLGVDIPPEEVPLVQKRMINRCNDEGKPVITATQMLESMTENPRPTRAEASDVANAIIDGTDAVMLSGETAAGAYPVESVSTMANIAKSTERELSR-KPQEVTAKDTG-MTEAIGYSTCQIAGQLEANAILTATQSGYTARMV-----------AKYKPKAPIVAVTPIEKVARRLSLSWGVYPITCDPSE 421
>gi|158319637|ref|YP_001512144.1| pyruvate kinase [Alkaliphilus oremlandii OhILAs] >gi|158139836|gb|ABW18148.1| pyruvate kinase [Alkaliphilus oremlandii OhILAs] (584 aa)
Score = 678, Expect = 5.3e-69, Identities = 170/460 (36%), Positives = 256/460 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +K+TKI  T+GP+                      +K+    L   G+NV R NFSHG +EE   R+ +++EV +E    ++ +LDTKGPEIR  K  + EVE+    +  I TT+  +G +     + +     +A+DV+ G++I +DDG + L+V  + V +  I+ I  N  I++ NK +N+P    ++P +++KD +DI F I+   D+IAASFV    +V  I+KIL+++ G HIQIISKIE   G+ +LD+II+ SD +MVARGDLG+E+P  ++P  +K +I+ C   GK VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP  AVEVM+ I   +E   DY             +K K   + T++   ++          D S+IV   +     + +S  R +API   T  +    R  L +GV+  + + +
  S:     1 MKRTKIVCTIGPA--------------------SESKEVFRKLVMRGLNVARLNFSHGSHEEHGERIRVIKEVREELNEPVAILLDTKGPEIRTGKFKDTEVELLEGQEFTI-TTRDVLGDN----TICNVSYEGLARDVKVGDSILIDDGLVGLKV-QNIVGDTDIQCIVENAGIVKNNKGVNVPGVKINLPAITEKDESDIKFGIEMDIDFIAASFVRKAADVLAIRKILEDNNGSHIQIISKIENQEGMDNLDEIIEVSDGLMVARGDLGVEIPTEEIPLAQKEMIRKCNRAGKPVITATQMLDSMIRNPRPTRAEVTDVANAIFDGTDAIMLSGETAAGKYPAEAVEVMSNIAKRAEAAIDY----------RGLLKTKAIEMETSVTDAISHATCTTAADLDASAIVTATSSGYTTRMVSKFRPSAPIIATTTSESVRRRLSLIWGVYSVITEQL 424
>gi|15893809|ref|NP_347158.1| pyruvate kinase (pykA) [Clostridium acetobutylicum ATCC 824] >gi|18266735|sp|O08309|KPYK_CLOAB Pyruvate kinase (PK) >gi|15023381|gb|AAK78498.1|AE007566_8 Pyruvate kinase (pykA) [Clostridium acetobutylicum ATCC 824] (473 aa)
Score = 677, Expect = 5.8e-69, Identities = 167/458 (36%), Positives = 259/458 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEG--IIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           ++KTK+  T+GP+                       ++ + A   AG+N  R NFSHGD+ E   R+ LV++V  +    ++  LDTKGPEIR    +  ++E++  SK  I   ++ +G + K S+       ++ KDV+PGNTI +DDG + L V      EG  +I T+A NT ++  +K +N+P+ +  +P M++KD++D+IF  K + D ++ASF+   ++V  I+K+L E+GGE+IQI SKIE   G+ ++D II+ SD IMVARGD+G+E+P   VP  +K IIK C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGE+ANG YPI AV  MAKI   +EN  +Y +          F+ E+ G      + +++          + S+I+         + +S  R  AP+  VT  ++ A +  +++GV   + D
  S:     1 MQKTKMIFTVGPA--------------------SETEEIVTAFIKAGMNASRHNFSHGDHAEHGGRIALVKKVRAKLNKPVAICLDTKGPEIRTGDFNPSKLELQKGSKFTIVCGEEIVGDATKCSI----SYKDLYKDVKPGNTILIDDGLVGLTV---EAIEGTNVICTVA-NTGLVGSHKGVNVPNVSIQLPAMTEKDKSDLIFGCKEEIDMVSASFIRKPEDVLAIRKVLNENGGENIQIFSKIENQEGVDNIDAIIEVSDGIMVARGDMGVEIPIQRVPLIQKMIIKKCNAVGKPVITATQMLDSMMRNPRPTRAEASDIANAIFDGTDAIMLSGESANGSYPIEAVTTMAKIAQEAENEINYDK----------FLAERKGNEKKNTSDVISLGTCTAAADLEASAIITATQTGSTARTVSKYRPKAPVIAVTPSEKVARKLAMSWGVHPIISD 422
>gi|167754588|ref|ZP_02426715.1| hypothetical protein CLORAM_00090 [Clostridium ramosum DSM 1402] >gi|167705420|gb|EDS19999.1| hypothetical protein CLORAM_00090 [Clostridium ramosum DSM 1402] (478 aa)
Score = 677, Expect = 6.8e-69, Identities = 171/451 (37%), Positives = 252/451 (55%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           KKT++  T+GP+              EN+       K L  L  AG+NV+R NFSHGD+EE   R+  VR+++KE   NI+ +LDTKGPEIR       + E K   +  + TT+   GTS++F++     TY  + KDV+PG  I V+DG+++L V   +VE   I  +  N  +++  + IN+P       ++S KD  DI F  +   ++IAASFV    +V ++KK+L E+G   IQII+KIE   G++++D+I+  +D IMVARGDLG+EVP  DVP  +K +IK CR  GK VI ATQMLDS++   +PTRAEV+DV  A+  GTD  MLSGE+A G YP  AV  M KI + +E   DY   +    +  P  ++    +  ++A + +         F  S+IVV+       + +S  R  + +   T  +       LN+GV
  S:    10 KKTRVVCTIGPA-------------SENE-------KMLRKLILAGMNVMRLNFSHGDFEEHGGRIVTVRKLSKELNKNIAILLDTKGPEIRTGDFVGGKTEFKK-GQTTVITTEDIEGTSDRFTI-----TYKELYKDVKPGGFILVNDGQVELLV--DHVEGEDIVCVCANDGVVKNKRGINVPGIKLGFDYLSPKDTADITFGCEQGVNFIAASFVRRAQDVLDVKKLLIENGHPEIQIIAKIENSEGVENMDEILKVADGIMVARGDLGVEVPAEDVPLIQKQLIKKCRAAGKVVITATQMLDSMQENPRPTRAEVSDVANAIYDGTDAIMLSGESAQGKYPEEAVMTMTKIALKTEETLDYASLLRKAIRTAP--EDPSEAICMSVAEIASK--------FKVSAIVVYTESGSTAKRVSRYRPESMVIAATPYEPVTRSLALNWGV 423
>gi|160893554|ref|ZP_02074338.1| hypothetical protein CLOL250_01108 [Clostridium sp. L2-50] >gi|156864539|gb|EDO57970.1| hypothetical protein CLOL250_01108 [Clostridium sp. L2-50] (578 aa)
Score = 677, Expect = 7.3e-69, Identities = 178/452 (39%), Positives = 252/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  TLGPS         D +    + +IE            G+NV RFNFSHGD+ +    +  + +   E  + ++T+LDTKGPEIRV      ++E+K      +  T  E+   EK   + S    N+  DV+PGNTI +DDG +++ V    V E  I     N   +  +K +N+P  N S+P++SD+DR+DIIF I+N FD+IAASFV T D+V EI+KIL EHG ++I IISKIE M G++++D+II  SD IMVARGD+G+E+P  DVP  +K IIK   +  K V+ ATQMLDS+    +PTRAE TDV  A+  GT   MLSGETA G YP+ A+  M KI   +E   DY +     F E   ++    T A + AT       ID      ++IV      +  + +S  R   PI   +  ++   +  L++GV
  S:     1 MRKTKIICTLGPS--------TDDDDILRRLMIE------------GMNVARFNFSHGDHAQHKRNMERIMKFRTELNLPVATLLDTKGPEIRVKDFKNGKIELKPGQTFTL--TTDEVEGDEK---MVSITYKNLVNDVKPGNTILIDDGLIEMTV--EQVSESKIVCRVVNGGPVSNHKGVNVPRVNLSMPYISDQDRSDIIFGIENDFDFIAASFVRTADDVLEIRKILDEHGCDNINIISKIENMQGVENIDEIIRVSDGIMVARGDMGVEIPLEDVPVIQKMIIKKVYNADKQVVTATQMLDSMIKNPRPTRAEATDVANAIYDGTSAIMLSGETAAGKYPVEALHTMIKIAERAEEDIDYTKR----FYERGNIQNPDITSAISHATCTT---AID---LGAAAIVTVTKSGKTARMISKYRPKCPIIGCSPVEKVCRQLNLSWGV 415
>gi|6691650|dbj|BAA89378.1| unnamed protein product [Moritella marina] (470 aa)
Score = 676, Expect = 9.0e-69, Identities = 159/405 (39%), Positives = 233/405 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHG 408
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHG++ E ++R+  +R+V++     I+ +LDTKGPEIR  K    +  + +  +   +TT   +  ++    +   G    AKD+ PG  I VDDG +++EV+++   E  ++    NT  L ENK +NLP+ +  +P +S+KD+ D+ F  + + D++AASF+   D+VREI++IL  +GGE+IQIISKIE   G+ + D+I+ ESD IMVARGDLG+E+P  +V   +K +IK C   GK VI ATQMLDS+ +  +PTRAE  DV  AV  GTD  MLSGETA G YP+ AV +MA I   ++N        ++  K     +        T   L AP  V+   G
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGNFAEHSVRIQNIRQVSENLNKKIAVLLDTKGPEIRTIKLENGDDVMLTAGQSFTFTTDINVVGNKDCVAVTYAG---FAKDLNPGAIILVDDGLIEMEVVATTDTE--VKCTVLNTGALGENKGVNLPNISVGLPALSEKDKADLAFGCEQEVDFVAASFIRKADDVREIREILFNNGGENIQIISKIENQEGVDNFDEILAESDGIMVARGDLGVEIPVEEVIMAQKMMIKKCNKAGKVVITATQMLDSMISNPRPTRAEAGDVANAVLDGTDAVMLSGETAKGKYPVEAVSIMANICERTDNSMSSDLGANIVAKSMRITEAVCKGAVETTEKLCAPLIVVATRG 380
>gi|169188059|ref|ZP_02848216.1| pyruvate kinase [Paenibacillus sp. JDR-2] >gi|169005083|gb|EDS51937.1| pyruvate kinase [Paenibacillus sp. JDR-2] (584 aa)
Score = 675, Expect = 1.0e-68, Identities = 166/452 (36%), Positives = 252/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++K KI  T+GPS                      + +N   L  AG+NV R NFSHGD+EE   R+  +    KE G +++ +LDTKGPEIR+ K  E+ +E+ +  +V + TT++ +G   +  +     TY N+  DV  G+TI +DDG + L V      E I      N+  ++  K +N+P    S+P +++KD NDIIF I+   D++AASFV    +V EI+++L+ H   HIQIISKIE   G+ +LD+I++ SD +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV  M++I   +E   +Y    +++ K+    K       T++   ++    +     + ++IV         + +S  R  API  VT+ ++   R  L +GV
  S:     1 MRKAKIVCTIGPS--------------------SESLENTKKLIKAGMNVARLNFSHGDFEEHGNRIKNIGIANKELGTSVAILLDTKGPEIRLGKLKEEPIELVAGERVAL-TTEEILGDINRVPI-----TYDNLPNDVSVGSTILIDDGLIGLTVEEVQGTEIICRI--NNSGQIKSKKGVNVPGVAISLPGITEKDANDIIFGIEMGIDFVAASFVRKASDVLEIRELLERHNASHIQIISKIENQQGVDNLDEILEVSDGLMVARGDLGVEIPAEEVPLVQKTMIEKCNRAGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGKYPVEAVTTMSRIAERAEAALEYR---EIFTKQANAQK-------TSVTEAISQAVAVSALDLNAAAIVTSTQSGFTARMVSKYRPKAPIIAVTNDEKVMRRLALIWGV 415
>gi|171779319|ref|ZP_02920283.1| hypothetical protein STRINF_01164 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281936|gb|EDT47367.1| hypothetical protein STRINF_01164 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (500 aa)
Score = 674, Expect = 1.3e-68, Identities = 178/459 (38%), Positives = 266/459 (57%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSN--VEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           M K+ KI ATLGP++    GK F   D    E+  V  +A+K +A L   G NV RFNFSHGD+ EQ  R+  VR   +  G  +  +LDTKGPEIR  +++   KE   K+  ++R+  TK+ I ++ +   L+  G+ ++  DV+ G  + VDDGKL L V++ +    E ++E    N  I+ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V E++ I +E G  H+++ +KIE   GI+++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+S+  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ AV  MA ID +++    +YGR     F  T   K +V   A   AT     +++        ++   GN  RLI   S  R  A I  VT  ++      +N+GV   V +
  S:     1 MNKRVKIVATLGPAVEIRGGKKFG-EDGYWGESLDVEASAQK-IAQLIKEGANVFRFNFSHGDHAEQGERMATVRRAEEIAGQKVGFLLDTKGPEIRTELFEGEAKEYSYKTGEQIRV-ATKQGIKSTREVIALNVAGSLDIYDDVEVGKQVLVDDGKLGLRVVAKDDATREFVVEV--ENDGIIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVRAICEETGNGHVRLFAKIENQQGIENIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKAVITATNMLESMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVEAVRAMATIDKNAQALLNEYGRLDSSSFARTS--KTEVVASAVKDATSSMDIKLV-------VALTESGNTARLI---SKYRPDADILAVTFDEKTQKSLMINWGVIPVVTE 450
>gi|146134271|dbj|BAF57225.1| pyruvate kinase [Streptococcus bovis] (500 aa)
Score = 674, Expect = 1.5e-68, Identities = 178/459 (38%), Positives = 265/459 (57%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSN--VEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           M K+ KI ATLGP++    GK F   D    E+  V  +A+K +A L   G NV RFNFSHGD+ EQ  R+  VR   +  G  +  +LDTKGPEIR  +++   KE   K+  ++R+  TK+ I ++ +   L+  G  ++  DV+ G  + VDDGKL L V++ +    E ++E    N  I+ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V E++ I +E G  H+++ +KIE   GI+++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+S+  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ AV  MA ID +++    +YGR     F  T   K +V   A   AT     +++        ++   GN  RLI   S  R  A I  VT  ++      +N+GV   V +
  S:     1 MNKRVKIVATLGPAVEIRGGKKFG-EDGYWGESLDVEASAQK-IAQLIKEGANVFRFNFSHGDHAEQGERMATVRRAEEIAGQKVGFLLDTKGPEIRTELFEGEAKEYSYKTGEQIRV-ATKQGIKSTREVIALNVAGALDIYDDVEVGKQVLVDDGKLGLRVVAKDDATREFVVEV--ENDGIIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEEVRAICEETGNGHVRLFAKIENQQGIENIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKAVITATNMLESMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVEAVRAMATIDKNAQTLLNEYGRLDSSSFARTS--KTEVVASAVKDATSSMDIKLV-------VALTESGNTARLI---SKYRPDADILAVTFDEKTQKSLMINWGVIPVVTE 450
>gi|150019659|ref|YP_001311913.1| pyruvate kinase [Clostridium beijerinckii NCIMB 8052] >gi|149906124|gb|ABR36957.1| pyruvate kinase [Clostridium beijerinckii NCIMB 8052] (473 aa)
Score = 673, Expect = 1.8e-68, Identities = 174/461 (37%), Positives = 257/461 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           ++KTK+  T+GP+              E+  ++E        +  +G+N  R NFSHGD+EE   R+  V+E++K+    I+ +LDTKGPEIR  K   K+VE+   S+  +Y    +I G + K SV     TY  +A DV+PGNTI +DDG + L V S  VE   I+   +NT  +  +K +N+P  +  +P +++KD++D+IF  +     IAASF+    +V+ I++IL  +GGE I I SKIE   G+ +LD+I++ SD IMVARGDLG+E+P   VP  +K IIK C+  GK V+ ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGE+ANG YP+ AV  MAKI   +E   +Y  A+       P +   +   A+  A  +    VI +     ++           + +S  R   PI  VT     A +   ++GV+  V D +E
  S:     1 MRKTKMICTIGPA-------------SEDMEILEK-------VVLSGMNASRHNFSHGDHEEHGGRIKKVKELSKKLNREIAIILDTKGPEIRTGKFEPKKVELAKGSEFTVYAGDMDIVGDTTKCSV-----TYAGLANDVKPGNTILIDDGLVGLTVKS--VEGNAIKCEVQNTGFVGTHKGVNVPGVSIQLPALTEKDKSDLIFGCEVGVTMIAASFIRKASDVKTIREILDANGGERILICSKIENQEGVDNLDEILEASDLIMVARGDLGVEIPIEQVPAVQKMIIKKCKAAGKPVVTATQMLDSMMRNPRPTRAEVSDVANAILDGTDAIMLSGESANGDYPVEAVATMAKIAEETEKSLEYKVAVSQAKTHIPAIAGVISRAASNAANELEAAAVITSTQTGATA-----------KRISQCRPECPIIAVTPDPIVARQLAFSWGVYPVVADKME 425
>gi|169348430|ref|ZP_02866368.1| hypothetical protein CLOSPI_00145 [Clostridium spiroforme DSM 1552] >gi|169293899|gb|EDS76032.1| hypothetical protein CLOSPI_00145 [Clostridium spiroforme DSM 1552] (478 aa)
Score = 673, Expect = 2.1e-68, Identities = 170/451 (37%), Positives = 247/451 (54%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           KKT++  T+GP+                       +K L  L  AG+NV+R NFSHGD+EE   R+  VR+++KE   NI+ +LDTKGPEIR       + E K    V I     E GTS++F++     TY  + KDV+PG  I V+DG++  E++  +VE   I  +  N  I++  + IN+P       ++S KD  DI F  +   ++IAASFV    +V ++KK+L E+G   IQII+KIE   G+ ++D+I+  +D IMVARGDLG+EVP  DVP  +K +IK CR  GK VI ATQMLDS++   +PTRAEV+DV  A+  GTD  MLSGE+A G YP  +V  M KI + +E   DY   +    +  P  ++    +  ++A + +         F  S+IVV+       + +S  R  + I   T  +       LN+GV
  S:    10 KKTRVVCTIGPA--------------------SEDEKMLRKLILAGMNVMRLNFSHGDFEEHGGRIKTVRKLSKELNKNIAILLDTKGPEIRTGDFVGGKTEFKKGQVVTICQEDIE-GTSDRFTI-----TYKELYKDVKPGGFILVNDGQV--ELLVDHVEGTDIVCVCANDGIVKNKRGINVPGVKLGFDYLSPKDTADITFGCEQGVNFIAASFVRRAQDVLDVKKLLIENGHPEIQIIAKIENNEGVDNMDEILKVADGIMVARGDLGVEVPAEDVPLIQKKLIKKCRAAGKVVITATQMLDSMQENPRPTRAEVSDVANAIYDGTDAIMLSGESAQGKYPEESVMTMTKIALKTEETLDYASLLRKAIRTAP--EDPSEAICMSVAEIASK--------FKVSAIVVYTESGSTAKRVSRYRPESMIIAATPYEPVTRSLALNWGV 423
>gi|139438680|ref|ZP_01772164.1| Hypothetical protein COLAER_01165 [Collinsella aerofaciens ATCC 25986] >gi|133775760|gb|EBA39580.1| Hypothetical protein COLAER_01165 [Collinsella aerofaciens ATCC 25986] (486 aa)
Score = 672, Expect = 2.6e-68, Identities = 155/399 (38%), Positives = 236/399 (59%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIY---TTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKE--TPFMKEKVGTLATTIATLVAPK 401
           M K+TKI  T+GP+                      + + +  +  AG+NV RFNFSHG Y+E   R+  VR ++KE G+ +  +LDTKGPE+R       K+V +K+  K+ +    T++   GT+E  S LD      +  +V+ G+ I +DDG + LEV S + ++  +  + +N  ++ E K +N+P+ N S+P ++++DR DI+F +    DYIAASF+  G++VR I+++ +E+GGEH+ I  KIE   G+++ D+I++ SD IMVARGDLG+E+    VP  +K II  C    K VI ATQMLDS++   +PTRAEV DV  A+  GTD  MLSGE+A G YP+ AV++ A I + +E +      ++V      T  +   VG  A  +AT V  K
  S:     1 MYKRTKIVCTMGPACD--------------------SDETIREMIKAGMNVARFNFSHGSYDEHHGRIERVRRISKELGLPVGILLDTKGPEVRTGLLVDGKKVAVKTGDKIVVTAQPTSEDFHGTAEHIS-LDYLA---LPSEVEKGSLILIDDGLVALEVESVDGQD--MTCVVKNDGLIGERKGVNMPNVNISLPAITERDRQDILFGLTENIDYIAASFIRDGESVRGIRELCRENGGEHVTIFPKIECALGVENFDEILEASDGIMVARGDLGIEIKPELVPHIQKEIIAKCNAAYKPVITATQMLDSMQQNPRPTRAEVADVANAIYDGTDAVMLSGESAAGKYPVEAVKMQASIALETEKYLPAHAPLEVPADAHGTRVVNNVVGMSAVNMATTVGAK 379
>gi|160947427|ref|ZP_02094594.1| hypothetical protein PEPMIC_01361 [Peptostreptococcus micros ATCC 33270] >gi|158446561|gb|EDP23556.1| hypothetical protein PEPMIC_01361 [Peptostreptococcus micros ATCC 33270] (583 aa)
Score = 672, Expect = 2.8e-68, Identities = 163/370 (44%), Positives = 235/370 (63%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNM-AKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAI 373
           +KKTKI  T+GP+                      + ++L  L   G+NV R NFSHG  EE  +R++ +++  +E  + I+ MLDTKGPEIR+ K S  EV +K+      +TT++ +G  E  SV     +Y +   DV+ G TI VDDG +++EV+S   +E  I+   +N  I++ NK +N+P+   ++P +++KD++DI+FAIKN  D+IAASFV   ++V EI+KIL E+  E I+IISKIE   G++++D II+ SD IMVARGDLG+E+    +P  +K II+ C   GK VI ATQMLDS+    +PTRAEVTDV  A+  G+DC MLSGETA G YP  AV+VM  I +++EN FD+  +I
  S:     1 MKKTKIICTIGPA--------------------SDSVESLKELMLCGMNVCRLNFSHGSKEEHQVRIDNIKKAREELDLPIAIMLDTKGPEIRLGKFSVDEVALKA-GDTYTFTTEEILGNQEICSV-----SYKLLPSDVKIGGTILVDDGLVEMEVVSKTDKE--IKCFVKNNGIIKSNKGVNIPNEIINLPSITEKDKSDILFAIKNDLDFIAASFVRKPEDVYEIRKILDENNSE-IKIISKIENQEGVENIDKIIEASDGIMVARGDLGVEIKAEFIPKIQKEIIRKCNLIGKPVITATQMLDSMIRNPRPTRAEVTDVANAIIDGSDCVMLSGETAAGKYPKEAVKVMNNIAITTENSFDFQNSI 342
>gi|58264908|ref|XP_569610.1| pyruvate kinase [Cryptococcus neoformans var. neoformans JEC21] >gi|134109615|ref|XP_776923.1| hypothetical protein CNBC4130 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50259603|gb|EAL22276.1| hypothetical protein CNBC4130 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57225842|gb|AAW42303.1| pyruvate kinase, putative [Cryptococcus neoformans var. neoformans JEC21] (572 aa)
Score = 672, Expect = 2.8e-68, Identities = 178/455 (39%), Positives = 249/455 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK--GVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           K ++KT I AT+GP                    +ET    L  L DAG+N+VR NFSHG YE     ++  R  A +   G  I+  LDTKGPEIR      + +V I +  +  + T K   E GT+E   + D T   N+ K   PG  I+VDDG L L+VIS   E+  I   + N+ +L   K +NLP +   +P +S+KD++D+ F +KN  D I ASF+ + ++V+EI+K+L   G + I+II KIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YPI AV++MA+    +E+   Y    D     TP   E   TLA     L A    I+    D  +I+V        + +S  R A PI  VT  ++ A +  L+ GV+
  S:    70 KFLRKTSIIATIGPKTNN----------------VET----LVQLADAGMNIVRMNFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEIRTGLMKDDTDVPISAGHEFWVTTDKAYAEAGTAEHIYI-DYT---NIVKVTAPGKLIYVDDGILSLQVISIQGEK--IRVKSLNSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGVDMIFASFIRSANDVKEIRKVLGPEGAD-IKIIVKIENEQGVMNFDEILRETDGVMVARGDLGIEIPASQVFMAQKMMIAKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVIDGADCIMLSGETAKGKYPIEAVKMMAETAFLAESSIAYPPLFDQLRALTPRPTETAETLA-----LSAVAAAIEQ---DAGAIIVLSTSGVSARLISKYRPACPIICVTRNEQTARQLHLSRGVY 494
>gi|167769177|ref|ZP_02441230.1| hypothetical protein ANACOL_00500 [Anaerotruncus colihominis DSM 17241] >gi|167668817|gb|EDS12947.1| hypothetical protein ANACOL_00500 [Anaerotruncus colihominis DSM 17241] (590 aa)
Score = 670, Expect = 4.0e-68, Identities = 160/452 (35%), Positives = 245/452 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  TLGP+                      +++ +A L  AG+NV RFNFSHG +E        +  +  + GV ++T+LDTKGPEIR+      + ++ + S+  + T     G  E  S   S     +A DV+ G+TI ++DG ++L V  + V EG IE    N  ++ ++K +N+P  + S+P++S++DR DI+F  +  FD+IAASFV   D++ +I++IL+  G E I+II+KIE   G+ ++DDI+  SD IMVARGD+G+EVP+ +VP  +K +I  C + GK VI ATQML+S+    +PTRAE  DV  A+  GT   MLSGETA G YPI AV  MA+I   +E         D+ +++  F +   G     I   ++       +    ++I+         + LS  R   PI   T       +  L++GV
  S:     1 MRKTKIVCTLGPA--------------------SDSEERIAQLISAGMNVARFNFSHGTHESHRATFERICRLRDQMGVPVATLLDTKGPEIRLGLFKGGKAQLDAGSRFTLCT-----GECEGDSSHASITFPGLAADVKAGSTILLNDGAIELRV--AGVREGAIECDVVNGGVISDHKGVNVPGIHLSMPYVSERDRADIMFGAEMGFDFIAASFVRCADDILQIRQILERQGNEKIRIIAKIENAEGVGNIDDILRVSDGIMVARGDMGVEVPFEEVPILQKMLISKCYNTGKMVITATQMLESMIHNPRPTRAEAADVANAIYDGTSAIMLSGETAAGDYPIEAVSTMAQIAERTER--------DINYQKRFFARS--GERVPDITNAISHATCTTAYDLGAAAIITVTWSGTTARMLSKFRPDIPIIACTHMPHTYHQLALSWGV 415
>gi|146318198|ref|YP_001197910.1| pyruvate kinase [Streptococcus suis 05ZYH33] >gi|145689004|gb|ABP89510.1| Pyruvate kinase [Streptococcus suis 05ZYH33] (501 aa)
Score = 670, Expect = 4.3e-68, Identities = 169/460 (36%), Positives = 257/460 (55%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDN 462
           M K+ KI ATLGP++    GK F   D      K  +E++ + +AAL   G NV RFNFSHGD++EQ  R+  VR   +  G  +  +LDTKGPEIR  +++   KE    +  K+R+  TK+ I ++++   L+  G  ++  DV+ G  I VDDGKL L V+  +        +  N  ++ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V  ++ I KE G +H+Q+ +KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA I  +++    +YGR     F        K   +A+ +            H  D   +V         +++S  R  A I  VT  ++      LN+GV + +V N
  S:     1 MNKRVKIVATLGPAVEIRGGKKF--GDDGYWGEKLDVESSAQKIAALITEGANVFRFNFSHGDHQEQGDRMATVRRAEEIAGKKVGFLLDTKGPEIRTELFEDDAKEYAYTTGDKLRV-ATKQGIKSTKEVIALNVAGGLDVFDDVEVGKQILVDDGKLGLTVVEKDAVNREFVVLVENDGVIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEVVRNICKETGNDHVQLFAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIAKNAQTLLNEYGRLNSDQFNRA----SKTEVIASAVKDAC--------HSMDIKLVVTVTETGYSARSISKYRPDADILAVTFTEKVQKSLMLNWGV-IPIVTN 450
>gi|89894354|ref|YP_517841.1| pyruvate kinase [Desulfitobacterium hafniense Y51] >gi|109644742|ref|ZP_01368662.1| pyruvate kinase [Desulfitobacterium hafniense DCB-2] >gi|89333802|dbj|BAE83397.1| pyruvate kinase [Desulfitobacterium hafniense Y51] >gi|109642691|gb|EAT52244.1| pyruvate kinase [Desulfitobacterium hafniense DCB-2] (577 aa)
Score = 669, Expect = 5.2e-68, Identities = 148/371 (39%), Positives = 226/371 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAID 374
           +++TKI  T+GPS                      + + +  L  AG+NV R NFSHG + E   R+  +RE A++ GV++  +LDTKGPEIR     E+ V++ S     + T    +G++E+  +     TY  + ++V  G  I +DDG + LEVI+S  EEG I T  +N  +L+  K +N+P     +P +++KDR+DIIF ++   D+IAASF     ++  ++++++E G  +++II+KIE   GI+ LD+I++ +D +MVARGDLG+EVP  +VP ++K +I+ C H GK VIVATQMLDS+    +PTRAE +DV  A+  GTD  MLSGETA G YP+ AVE+M KI +  E  ++  +  D
  S:     1 MRRTKIVCTIGPS--------------------SESNEKIRQLLKAGMNVARLNFSHGTHGEHGKRIRTLREEAQKLGVHLGVLLDTKGPEIRTGTVPEEGVQLNSGDTFILDTDLSTLGSAERVGI-----TYLQLWQEVHQGTHILLDDGLIDLEVIAS--EEGKIITKIQNGGVLKSKKGVNVPGVPIQLPAITEKDRDDIIFGLREGIDFIAASFARKAADILAVRRLVEEEGA-NVKIIAKIENREGIEHLDEILEVADGLMVARGDLGVEVPVEEVPIHQKDMIEKCHHLGKPVIVATQMLDSMIRNPRPTRAEASDVANAILDGTDAIMLSGETAAGQYPVEAVEMMNKIALQIEKHYEPRKIYD 344
>gi|116627931|ref|YP_820550.1| pyruvate kinase [Streptococcus thermophilus LMD-9] >gi|116101208|gb|ABJ66354.1| pyruvate kinase [Streptococcus thermophilus LMD-9] (500 aa)
Score = 669, Expect = 6.0e-68, Identities = 180/489 (36%), Positives = 275/489 (56%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVF---GNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID--AINSQLPEVKKTVVVI 491
           M K+ KI ATLGP++    GK F   +      K   + + KN+A L + G NV RFNFSHG++ EQ  R+++VR      G  +  +LDTKGPEIR  +++   KE   K+  ++RI  TK+ + ++     L+  G  ++  DV+ G  + VDDGKL L V+  + E+        N  I+ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V+E++ I +E G  H+++++KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK V+ AT ML+++  K + TRAEV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA I+ +++    +YGR     F  +   K +V   A   AT          +  D   IV     GN  RLI   S  R  A I  VT  +       LN+GV + +V     +  +  E+ +  A+ S L E    +V++
  S:     1 MNKRVKIVATLGPAVEIRGGKKF--GEDGYWSEKLDPDASAKNIAQLIEEGANVFRFNFSHGNHAEQGERMDVVRMAESIAGQKVGFLLDTKGPEIRTELFEGDAKEYAYKTGEQIRI-ATKQGLKSTRDVIALNVAGALDIFDDVEVGKQVLVDDGKLGLRVVDKDAEKREFIVEVENDGIIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGINFIAISFVRTAKDVQEVRAICEETGNGHVKLLAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKFVVTATNMLETMTEKPRATRAEVSDVFNAVIDGTDATMLSGESANGKYPVESVHTMATINKNAQALLKEYGRLDPSTFDRSS--KTEVVASAVKEAT----------NSMDIKLIVALTESGNTARLI---SKYRPEADILAVTFDELTQKSLMLNWGV-IPIVTETPSSTDDMFEVAERVALESGLVESGDNIVIV 481
>gi|6729356|dbj|BAA89788.1| pyruvate kinase [Selenomonas ruminantium] (470 aa)
Score = 669, Expect = 6.1e-68, Identities = 159/367 (43%), Positives = 223/367 (60%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           M+KKTKI  T GPS              E  GVI+       AL   G+N  RFNFSHGD+EE   R+N+VRE AK+ G  IS +LDTKGPE+R+ +  + +V ++  +K  + T   E G     SV +  G Y    +V+PG+T+ + DG + L+V    ++   I T  +N+  +   KR+  P     +P +S++D  DIIF  +   D++AASF+   D+V  I+K+++EH G H++I+ KIE + G+K+ D I++ SD IMVARGDLG+EVP  DVP  +K II+ C   GK VIVATQMLDS+E   +PTRAEV+DV  A+  GTD  MLSGETA+G YP+ AV  M +I    E+  +Y
  S:     1 MLKKTKIVCTQGPST-------------EKPGVID-------ALIANGMNCARFNFSHGDHEEHLGRINMVREAAKKAGKVISLILDTKGPEMRLGEFKDGKVMLEKGNKFTL-TYDDEPGDETHVSV-NHKGLYT---EVKPGDTLLLSDGLVALKV--DEIKGKDIVTTIQNSGKMSTRKRVAAPGVPLGLPPISEQDAKDIIFGCEQDMDFVAASFIQRPDDVIAIRKLIEEHNG-HMEILPKIENLEGVKNFDAILEVSDGIMVARGDLGVEVPAEDVPLIQKEIIRKCNAAGKPVIVATQMLDSMERNPRPTRAEVSDVGNAILDGTDAIMLSGETASGDYPVEAVATMNRIAQRMESSLEY 339
>gi|3041863|gb|AAC12962.1| pyruvate kinase I [Bacillus subtilis] (584 aa)
Score = 668, Expect = 6.8e-68, Identities = 170/459 (37%), Positives = 251/459 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVG-TLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDN 462
           ++KTKI  T+GP+                      + + L  L ++G+NV R NFSHGD++E   R+  +RE A++ G N+  +LDTKGPEIR +      +E+ + SK+ I  T+  IGT +K SV     TY  +  DV  G+TI +DDG + LEV+  +  +  I+T   N   L+  K +N+P        +++KD  DI+F I+   D+IA SF+    +V EI+++L+EH  + IQII KIE   G+ ++D I++ SD +MVARGDLG+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV+ M  I   SE   +Y   +          +++VG T+   I   VA   +  N     ++IV         + ++  R  API  VT     + +  L  GVF +   N
  S:     1 MRKTKIVCTIGPA--------------------SESIEMLTKLMESGMNVARLNFSHGDFQEHGARIKNIREAAEKLGKNVGILLDTKGPEIRTHTMENGSIELNAGSKLVISMTEV-IGTPDKISV-----TYEGLVHDVNKGSTILLDDGLIGLEVLDVDAVKREIKTKVLNNGTLKNKKGVNVPGRKCQSSGITEKDARDIVFGIEQGVDFIAPSFIRRSTDVLEIRELLEEHNAQDIQIIPKIENQEGVDNIDAILEVSDGLMVARGDLGVEIPAEEVPLVQKELIKKCNALGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGSYPVEAVQTMHNIASRSEEALNYKEILSK-------RRDQVGMTITDAIGQSVAHTAINLN-----AAIVTPTESGHTARMIAKYRPQAPIVAVTVNDSISRKLALVSGVFAESGQN 423
>gi|160914232|ref|ZP_02076453.1| hypothetical protein EUBDOL_00242 [Eubacterium dolichum DSM 3991] >gi|158433859|gb|EDP12148.1| hypothetical protein EUBDOL_00242 [Eubacterium dolichum DSM 3991] (473 aa)
Score = 668, Expect = 7.3e-68, Identities = 181/491 (36%), Positives = 256/491 (52%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV--FVKVVDNVEHAIANKTEIIDAINSQLP-EVKKTVVVI 491
           M  +KKTKI  T+GP+                      +K+ +  L DAG+N++R NFSHGD+EE   R+  +REV +E G +IS +LDTKGPE+R+   +      ++   V I   +K +GT EKF +        +  DV    TI +DDGK +L V+     EG +     N  +L+  K  NLP    ++PF+S KD  DI F  +   DYIAASF    D+V  I++ILKE G E IQII KIE   G  +L++I++ +D +MVARGDLG++V    VP Y+K IIK     GK VI AT ML+S++   +PTRAE +DV  A+  GTD  MLSGE+A G YP+ AV+ M KI  + E    Y             +K  + T   T    +A          D ++I+ F       + +S  R  API  VT  K+      LN+GV  +     N E   +   E+   I  ++  EV KT++V+
  S:     1 MLEVKKTKIICTIGPA--------------------SESKEMMHKLVDAGMNIIRLNFSHGDFEEHGNRIKNIREVVEETGKSISILLDTKGPEVRLGDFANGSEAFEAGDVVTI-VREKVLGTHEKFHI----QCPEIFDDVDVNGTILIDDGKCRLTVLEK--REGELVCRVENPHVLKSRKGCNLPGVKLTMPFISPKDEADIRFGCQMGIDYIAASFTRRKDDVLAIRQILKEEGREDIQIIPKIENQEGFDNLEEILEVADGVMVARGDLGVDVSLELVPIYQKKIIKVANELGKPVITATHMLESMQGNPRPTRAEASDVANAILDGTDAIMLSGESAAGDYPVEAVQTMVKIAKAMEPTLPYHDR----------LKRSIKTCQRTKNDAIAISVADTAMALDIAAIIAFTQSGTTARRISKFRPEAPIVAVTFDKKTQRSLALNWGVNTYFSETKNEE---STDVEMAREIAKKMGVEVGKTIIVV 454
>gi|58264910|ref|XP_569611.1| pyruvate kinase [Cryptococcus neoformans var. neoformans JEC21] >gi|134109617|ref|XP_776922.1| hypothetical protein CNBC4130 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50259602|gb|EAL22275.1| hypothetical protein CNBC4130 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57225843|gb|AAW42304.1| pyruvate kinase, putative [Cryptococcus neoformans var. neoformans JEC21] (529 aa)
Score = 668, Expect = 8.2e-68, Identities = 178/455 (39%), Positives = 249/455 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK--GVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           K ++KT I AT+GP                    +ET    L  L DAG+N+VR NFSHG YE     ++  R  A +   G  I+  LDTKGPEIR      + +V I +  +  + T K   E GT+E   + D T   N+ K   PG  I+VDDG L L+VIS   E+  I   + N+ +L   K +NLP +   +P +S+KD++D+ F +KN  D I ASF+ + ++V+EI+K+L   G + I+II KIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YPI AV++MA+    +E+   Y    D     TP   E   TLA     L A    I+    D  +I+V        + +S  R A PI  VT  ++ A +  L+ GV+
  S:    27 KFLRKTSIIATIGPKTNN----------------VET----LVQLADAGMNIVRMNFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEIRTGLMKDDTDVPISAGHEFWVTTDKAYAEAGTAEHIYI-DYT---NIVKVTAPGKLIYVDDGILSLQVISIQGEK--IRVKSLNSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGVDMIFASFIRSANDVKEIRKVLGPEGAD-IKIIVKIENEQGVMNFDEILRETDGVMVARGDLGIEIPASQVFMAQKMMIAKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVIDGADCIMLSGETAKGKYPIEAVKMMAETAFLAESSIAYPPLFDQLRALTPRPTETAETLA-----LSAVAAAIEQ---DAGAIIVLSTSGVSARLISKYRPACPIICVTRNEQTARQLHLSRGVY 451
>gi|149909579|ref|ZP_01898232.1| pyruvate kinase [Moritella sp. PE36] >gi|149807283|gb|EDM67236.1| pyruvate kinase [Moritella sp. PE36] (470 aa)
Score = 667, Expect = 8.6e-68, Identities = 163/405 (40%), Positives = 232/405 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTK-KEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHG 408
           +KKTKI  T+GP                     E+ +K L  L  AG+NV+R NFSHG++ E ++R+  +REV++     I+ +LDTKGPEIR  K    E  I +  ++  +TT    +G  +  +V     TY   AKD+  G  I VDDG ++++V+ +   E  ++    NT  L ENK +NLP+ +  +P +S+KD+ D+ F  + + D++AASF+   D+VREI++IL  +GGE+IQIISKIE   G+ + D+I+ ESD IMVARGDLG+E+P  +V   +K +IK C   GK VI ATQMLDS+    +PTRAE  DV  AV  GTD  MLSGETA G YP+ AV +MA I   ++N        ++  K     +        T   L AP  V+   G
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVKAGMNVMRLNFSHGNFAEHSVRIQNIREVSENLNEKIAVLLDTKGPEIRTIKLENGEDVILTAGQLFTFTTDINVVGNKDSVAV-----TYPGFAKDLSAGAIILVDDGLIEMKVVETTDTE--VKCTVLNTGALGENKGVNLPNISVGLPALSEKDKADLAFGCEQEVDFVAASFIRKADDVREIREILFNNGGENIQIISKIENQEGVDNFDEILAESDGIMVARGDLGVEIPVEEVIMAQKMMIKKCNKAGKVVITATQMLDSMINNPRPTRAEAGDVANAVLDGTDAVMLSGETAKGKYPVEAVSIMANICERTDNSMSSDLGANIVAKSMRITEAVCKGAVETTEKLCAPLIVVATRG 380
>gi|25010985|ref|NP_735380.1| pyruvate kinase [Streptococcus agalactiae NEM316] >gi|23095385|emb|CAD46590.1| Unknown [Streptococcus agalactiae NEM316] (500 aa)
Score = 666, Expect = 1.2e-67, Identities = 164/459 (35%), Positives = 254/459 (55%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           M K+ KI ATLGP++    GK F  + +        +E + + +A L   G NV RFNFSHGD+ EQ  R+  VR+  +  G  +  +LDTKGPEIR  +++         + +K+R+  TK+ I ++ +   L+  G  ++  DV+ G  I VDDGKL L V + + +    E +  N  ++ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V E++ I +E G  H+++ +KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR     F        K   +A+ +            H  D   +V         +A+S  R  A I  VT  ++      +N+GV   + D
  S:     1 MNKRVKIVATLGPAVEFRGGKKFGESGYWGESLD--VEASAEKIAQLIKEGANVFRFNFSHGDHAEQGARMATVRKAEEIAGQKVGFLLDTKGPEIRTELFEDGSDFHSYTTGTKLRV-ATKQGIKSTPEVIALNVAGGLDIFDDVEVGKQILVDDGKLGLTVFAKDKDTREFEVVVENDGLIGKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVNEVRAICEETGNGHVKLFAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKAVITATNMLETMTDKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIDKNAQTLLNEYGRLDSSAFPRN----NKTDVIASAVKDA--------THSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRSLMINWGVIPVLAD 450
>gi|161611285|ref|YP_139647.2| pyruvate kinase [Streptococcus thermophilus LMG 18311] >gi|161936368|ref|YP_141556.2| pyruvate kinase [Streptococcus thermophilus CNRZ1066] (500 aa)
Score = 666, Expect = 1.2e-67, Identities = 177/489 (36%), Positives = 276/489 (56%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID--AINSQLPEVKKTVVVI 491
           M K+ KI ATLGP++    GK F   +      K   + + KN+A L + G NV RFNFSHG++ EQ  R+++VR      G  +  +LDTKGPEIR  +++   KE   K+  ++RI  TK+ + ++     L+  G  ++  DV+ G  + VDDGKL L V+  + E+        N  I+ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V+E++ I +E G  H+++++KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK V+ AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA I+ +++    +YGR     F  +   K +V   A   AT     ++I        ++   GN  RLI   S  R  A I  +T  +       LN+GV + VV     +  +  E+ +  A+ S L E    +V++
  S:     1 MNKRVKIVATLGPAVEIRGGKKF--GEDGYWSEKLDPDASAKNIAQLIEEGANVFRFNFSHGNHAEQGERMDVVRMAESIAGQKVGFLLDTKGPEIRTELFEGDAKEYAYKTGEQIRI-ATKQGLKSTRDVIALNVAGALDIFDDVEVGKQVLVDDGKLGLRVVDKDAEKREFIVEVENDGIIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGINFIAISFVRTAKDVQEVRAICEETGNGHVKLLAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKIVVTATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATINKNAQTLLKEYGRLNSSTFDRSS--KTEVVASAVKDATNSMNIKLI-------VALTESGNTARLI---SKYRPEADILAITFDELTQKSLMLNWGV-IPVVTETPSSTDDMFEVAERVALESGLVESGDNIVIV 481
>gi|55737190|gb|AAV60832.1| pyruvate kinase [Streptococcus thermophilus LMG 18311] >gi|55739100|gb|AAV62741.1| pyruvate kinase [Streptococcus thermophilus CNRZ1066] (517 aa)
Score = 666, Expect = 1.2e-67, Identities = 177/489 (36%), Positives = 276/489 (56%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID--AINSQLPEVKKTVVVI 491
           M K+ KI ATLGP++    GK F   +      K   + + KN+A L + G NV RFNFSHG++ EQ  R+++VR      G  +  +LDTKGPEIR  +++   KE   K+  ++RI  TK+ + ++     L+  G  ++  DV+ G  + VDDGKL L V+  + E+        N  I+ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V+E++ I +E G  H+++++KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK V+ AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA I+ +++    +YGR     F  +   K +V   A   AT     ++I        ++   GN  RLI   S  R  A I  +T  +       LN+GV + VV     +  +  E+ +  A+ S L E    +V++
  S:    18 MNKRVKIVATLGPAVEIRGGKKF--GEDGYWSEKLDPDASAKNIAQLIEEGANVFRFNFSHGNHAEQGERMDVVRMAESIAGQKVGFLLDTKGPEIRTELFEGDAKEYAYKTGEQIRI-ATKQGLKSTRDVIALNVAGALDIFDDVEVGKQVLVDDGKLGLRVVDKDAEKREFIVEVENDGIIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGINFIAISFVRTAKDVQEVRAICEETGNGHVKLLAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKIVVTATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATINKNAQTLLKEYGRLNSSTFDRSS--KTEVVASAVKDATNSMNIKLI-------VALTESGNTARLI---SKYRPEADILAITFDELTQKSLMLNWGV-IPVVTETPSSTDDMFEVAERVALESGLVESGDNIVIV 498
>gi|169335577|ref|ZP_02862770.1| hypothetical protein ANASTE_01992 [Anaerofustis stercorihominis DSM 17244] >gi|169258315|gb|EDS72281.1| hypothetical protein ANASTE_01992 [Anaerofustis stercorihominis DSM 17244] (575 aa)
Score = 666, Expect = 1.3e-67, Identities = 172/458 (37%), Positives = 261/458 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI  T+GP+                       KK L  L  +G+NV R NFSHGDYEE   R++ ++E+ ++    I+ +LDTKGPEIR  K  +  V +K  S   + T   E+G   K S      TY+ +A++++ G+ + +DDG +KL V     ++ I+     N   ++ +K IN+P  N  +P +++KD ND++F IKN  D++AASF+ + ++V  I+++L  +GGE I IISKIE   G+ ++D+II+ SD IMVARGDLG+E+P  +VP  +K IIK C + GK VI ATQMLDS+    + TRAEVTDVF A+  GTD  MLSGETA G YPI AV+ M  I  S+E     G+    +   + ++ ++  T A +++T+    ++ D+   +  +I+   +     + +S  R    I   TDK+    R  L +GV    +D
  S:     1 MKKTKIVCTIGPA--------------------SEDKKVLTHLIASGMNVARLNFSHGDYEEHQGRIDTIKEIRQKLNQPIAILLDTKGPEIRTKKFKDGGVFLKEGSMFTL-TVGDELGDENKCST-----TYDHLAEELKKGDVVLIDDGLIKLTVREIKGKDVILRV--DNGGPVKNHKSINIPGVNIKLPALTEKDTNDLLFGIKNDVDFVAASFIRSKEDVFAIREVLNNNGGEDIHIISKIENRQGVDNIDEIIEASDGIMVARGDLGVEIPAEEVPIVQKDIIKKCNYVGKPVITATQMLDSMINNPRATRAEVTDVFNAIFDGTDAIMLSGETAAGKYPIEAVQTMGIIAESAE-----GKLASDFRTRSKYINDQSMTSAVSLSTV----QIADS--LNAKAILTPTSSGYTARRISKYRPNCDIVAYTDKEYVQRRLSLVWGVEAYKID 420
>gi|188533949|ref|YP_001907746.1| Pyruvate kinase I [Erwinia tasmaniensis] >gi|188028991|emb|CAO96859.1| Pyruvate kinase I [Erwinia tasmaniensis] (470 aa)
Score = 666, Expect = 1.4e-67, Identities = 151/356 (42%), Positives = 212/356 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L DAG+NV+R NFSHGDY+E   R+  +R V  + G   + +LDTKGPEIR  K    ++  +K+       T +  +G ++  +V     TY   A D+Q GNT+ VDDG + +EV+   V +  +     N   L ENK +NLP  +  +P +++KD++D+IF  +   D++AASF+    +V EI++ LK HGGEHIQIISKIE   G+ + D+I+D SD IMVARGDLG+E+P  +V   +K +IK C H  K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTNLLDAGMNVMRLNFSHGDYQEHGQRITNLRNVMSKSGHQAAILLDTKGPEIRTMKLEGGQDAALKAGQTFTFTTDQSVVGNAQTVAV-----TYPGFATDLQVGNTVLVDDGLIGMEVLE--VTDSTVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKHDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGEHIQIISKIENQEGLNNFDEILDASDGIMVARGDLGVEIPVEEVIFAQKMMIKKCNHARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVRIMATI 331
>gi|22537102|ref|NP_687953.1| pyruvate kinase [Streptococcus agalactiae 2603V/R] >gi|76787355|ref|YP_329658.1| pyruvate kinase [Streptococcus agalactiae A909] >gi|22533962|gb|AAM99825.1|AE014234_15 pyruvate kinase [Streptococcus agalactiae 2603V/R] >gi|76562412|gb|ABA44996.1| pyruvate kinase [Streptococcus agalactiae A909] (500 aa)
Score = 665, Expect = 1.4e-67, Identities = 164/459 (35%), Positives = 254/459 (55%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           M K+ KI ATLGP++    GK F  + +        +E + + +A L   G NV RFNFSHGD+ EQ  R+  VR+  +  G  +  +LDTKGPEIR  +++         + +K+R+  TK+ I ++ +   L+  G  ++  DV+ G  I VDDGKL L V + + +    E +  N  ++ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V E++ I +E G  H+++ +KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA ID +++    +YGR     F        K   +A+ +            H  D   +V         +A+S  R  A I  VT  ++      +N+GV   + D
  S:     1 MNKRVKIVATLGPAVEFRGGKKFGESGYWGESLD--VEASAEKIAQLIKEGANVFRFNFSHGDHAEQGARMATVRKAEEIAGQKVGFLLDTKGPEIRTELFEDGADFHSYTTGTKLRV-ATKQGIKSTPEVIALNVAGGLDIFDDVEVGKQILVDDGKLGLTVFAKDKDTREFEVVVENDGLIGKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVNEVRAICEETGNGHVKLFAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKAVITATNMLETMTDKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIDKNAQTLLNEYGRLDSSAFPRN----NKTDVIASAVKDA--------THSMDIKLVVTITETGNTARAISKFRPDADILAVTFDEKVQRSLMINWGVIPVLAD 450
>gi|153813696|ref|ZP_01966364.1| hypothetical protein RUMOBE_04127 [Ruminococcus obeum ATCC 29174] >gi|149830204|gb|EDM85297.1| hypothetical protein RUMOBE_04127 [Ruminococcus obeum ATCC 29174] (474 aa)
Score = 665, Expect = 1.5e-67, Identities = 157/376 (41%), Positives = 228/376 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKE 379
           ++KTKI  TLGPS              +  GV+E        L   G+NV RFNFSHG ++EQ  R++ ++E+       ++ +LDTKGPEIR+ +    +V +K   +  + TT++ +G  +  SV     TY ++ KDV+PGN+I +DDG + LEV     +  I + +  N  +L   K +NLP    ++PF+S KD +DI+F IK  +D+IAASF  T  +V+EI+ IL+++GG  I+II+KIE   G+ ++D II+ +D IM+ARGD+G+E+P  DVP  +K II    + GK VI ATQMLDS+    +PTRAE TDV  A+ +GT   MLSGETA G YPI A++ M KI V +E   DY +      K+
  S:     1 MRKTKIICTLGPST-------------DKDGVLEE-------LVKEGMNVARFNFSHGLHDEQKGRIDKLKEIRTRLNKPVAALLDTKGPEIRIREFENGKVTLKEGQEFTL-TTEEIVGNEKIVSV-----TYKDLYKDVKPGNSILIDDGLIGLEVKKIKGQNIICKVV--NGGVLGNKKGVNLPGVEVNMPFISPKDHDDILFGIKEGYDFIAASFTRTAADVKEIRDILEKNGGHDIKIIAKIENQQGVDNIDSIIEAADGIMIARGDMGVEIPLEDVPVIQKDIIAKVYNAGKQVITATQMLDSMIKNPRPTRAETTDVANAIYQGTSAIMLSGETAAGKYPIEALKTMVKIAVRTEADVDYNKQFSTSSKD 349
>gi|85059416|ref|YP_455118.1| pyruvate kinase [Sodalis glossinidius str. 'morsitans'] >gi|84779936|dbj|BAE74713.1| pyruvate kinase I [Sodalis glossinidius str. 'morsitans'] (470 aa)
Score = 663, Expect = 2.8e-67, Identities = 154/356 (43%), Positives = 215/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP             K E++ V       L++L DAG+NV+R NFSHGDYEE   R+  +R V K      + +LDTKGPEIR  K  +  +V +++       T +  IG SE+ +V     TY    +D+  GNTI VDDG L + V S   ++ + + +  N   L ENK +NLP  +  +P +++KD+ D+IF  +   D+IAASF+    +V EI++ L++HGG HIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGP-------------KTESEEV-------LSSLLDAGMNVMRLNFSHGDYEEHGQRIKNLRAVLKRTDQQAAILLDTKGPEIRTMKLVNGADVSLRAGQTFTFTTDQSIIGNSERVAV-----TYPGFTQDLAVGNTILVDDGLLGMTVTSVTQDQVVCKVL--NNGDLGENKGVNLPGVSIPLPALAEKDKRDLIFGCEQGVDFIAASFIRKRSDVLEIREYLEQHGGSHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATI 331
>gi|153956155|ref|YP_001396920.1| Pyk [Clostridium kluyveri DSM 555] >gi|146349013|gb|EDK35549.1| Pyk [Clostridium kluyveri DSM 555] (585 aa)
Score = 663, Expect = 3.1e-67, Identities = 167/470 (35%), Positives = 259/470 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAI----DVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF---VKVVDNVEHAIANKTEI 473
           ++KTK+  T+GP+                      +++ L+ L +AG+NV R NFSHGDY     R+N V+++ ++    I+ MLDTKGPEIR       + ++K   K  IY     IG + + S+     TY+ ++ D++ G++I +DDG + LEV   ++E   I  I +N   +  +K +N+P  + S+P +++KD+ D+IF  K   D +AASF+    ++  I+K+L+ +GG+ IQI SKIE   G+ ++D+II  SD IMVARGD+G+E+    VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGETANG YP+ A   M++I  ++E   DY   +    +V+ +  P         A ++AT      +        S+I+         + +S  R    I  VT   + A R  LN+GVF    K VD+ +  I +  +I
  S:     1 MQKTKMIFTIGPT--------------------SDSEEVLSKLIEAGMNVTRHNFSHGDYPSHEKRINTVKKLREKYSKPIAIMLDTKGPEIRTGNFENDKAQLKEGDKFTIYCRDNIIGDNTRCSI-----TYDGLSSDLKKGDSILIDDGLVALEV--DDIENNKIYCIVKNNGTISNHKGVNVPGVSTSLPALTEKDKGDLIFGCKIGVDMVAASFIRKAADILTIRKVLEANGGQDIQIFSKIENQEGVDNIDEIIKFSDGIMVARGDMGVEILIEQVPLIQKTIIQKCNKAGKPVITATQMLDSMIRNPRPTRAEASDIANAIFDGTDAIMLSGETANGKYPVEAARTMSRIAQAAEEKIDYDSLLKKRREVHIQNVPN--------AISLATCSTASEL------KASAIITATQSGHTARMVSKYRPQCHIIAVTPSGKVARRLALNWGVFPILTKRVDSTDELIEDSVKI 437
>gi|167037105|ref|YP_001664683.1| pyruvate kinase., pyruvate, water dikinase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855939|gb|ABY94347.1| Pyruvate kinase., Pyruvate, water dikinase [Thermoanaerobacter pseudethanolicus ATCC 33223] (583 aa)
Score = 663, Expect = 3.1e-67, Identities = 175/478 (36%), Positives = 260/478 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQL 481
           +++TKI  T+GP+         D+N              L  L + G+NV R NFSHGD+EE   R++ ++++ +E G+ ++ +LDTKGPEIR  K     VE+K + +  + TT+  +G       + S     + +DV+ G+ I +DDG + L+V     E+  I  I  N+  ++++K +N+P    ++P ++ KD +DI F IK   D IAASFV    +V  I+++L+E+  EHI II+KIE   G++++D+II  SD IMVARGDLG+E+P  ++P  +K II+ C   GK VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YPI A E MAKI   +E +  Y   ID        +   +     T A  +    +I      Y++ +V           S  R  API   T  +  A +  + +GV+  V + V    +   E+ID AI S L
  S:     1 MRRTKIVCTIGPASE-------DYNI-------------LRKLIEKGMNVARLNFSHGDFEEHGARIDNIKKIREEFGLPVAILLDTKGPEIRTGKFKNGGVELK-EGQTFVITTRDVLGDE----TICSVSYKGLPQDVERGSRILIDDGLISLKVTDVKGED--IVCIVENSGPVKDHKGVNVPGVKLNLPALTQKDVDDIEFGIKKGIDIIAASFVRKAADVLAIRRLLEENKAEHILIIAKIENREGVENIDEIIKVSDGIMVARGDLGVEIPLEEIPIVQKMIIQKCNKAGKPVITATQMLDSMMRNPRPTRAEVTDVANAILDGTDAIMLSGETAQGKYPIEAFETMAKIAEKTEAYVGYRDIIDRNIDTNVSITNAISHATCTTARDIGAAAIITCTKSGYTARMV-----------SRYRPQAPIIATTPSESVARKLSIVWGVYPLVTEEV----STTDEMIDVAIQSAL 437
>gi|153814494|ref|ZP_01967162.1| hypothetical protein RUMTOR_00708 [Ruminococcus torques ATCC 27756] >gi|145847988|gb|EDK24906.1| hypothetical protein RUMTOR_00708 [Ruminococcus torques ATCC 27756] (478 aa)
Score = 662, Expect = 3.6e-67, Identities = 167/452 (36%), Positives = 252/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +KKTK+  T+GP+   +                E  KK    L + G++V RFNFSHGD+EEQ  R++L++E+ +E   N + +LDTKGPEIR       K + +K+  +  + T + E G   K S+     TY  + +DV  G  I +DDG ++L+V+  + +E   E I  N   L E K +N+P+    +P +++KD++DI F ++   D+IAASFV   + V EIK  LKE G  ++ II+K+E   GIK++D+II  +D +MVARGDLG+E+P  +VP  +K II+ C    KTVI ATQMLDS+    +PTRAEVTDV  AV  GTD  MLSGETA G YP+ A+++M  I  ++E   DY             +++  G L + +++ +    V+     +   I+         + +SN+R    I  VT  +    R  + +GV
  S:     1 MKKTKVVCTMGPNTNDR----------------ELLKK----LIENGMDVARFNFSHGDHEEQKSRMDLLKELRQELNTNTAILLDTKGPEIRTGVLKGGKRIMLKAGEQFTLTTEEIE-GDESKVSI-----TYEGLVQDVDAGRVILIDDGLIELKVVGKSEKEIFCEVI--NGGELGERKGVNVPNVAVRLPAITEKDKDDIRFGVEQGIDFIAASFVRNAECVLEIKAYLKELGAPYVPIIAKVENAEGIKNIDEIIRAADGVMVARGDLGVEIPAEEVPYLQKMIIQKCNMNFKTVITATQMLDSMMRNPRPTRAEVTDVANAVYDGTDAVMLSGETAQGKYPLEALQMMVHIIQNTEQHLDY----------EGMLEKTGGHLKSGVSSAIGYSSVLAASNLNAKCIITPSVSGATARVVSNLRPRQVILGVTPNERTLRRMSIYWGV 416
>gi|81428643|ref|YP_395643.1| pyruvate kinase [Lactobacillus sakei subsp. sakei 23K] >gi|52631967|gb|AAU85378.1| pyruvate kinase [Lactobacillus sakei] >gi|78610285|emb|CAI55334.1| Pyruvate kinase [Lactobacillus sakei subsp. sakei 23K] (586 aa)
Score = 662, Expect = 3.8e-67, Identities = 169/453 (37%), Positives = 245/453 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KKTKI +TLGP+                      + + +  L +AG NV RFNFSHGD+EE   R+N+VRE  K  G  +  MLDTKG EIR      K+ E+ +   VRI       GT EK +V    G Y+   D   G  + +DDG + L++I  +     + T  +N  ++   K +N P  + ++P +++KD +DI F + N  ++IAASFV    +V +I+++L+E   EH+QI  KIE+  GI ++DDI+  SD +M+ARGD+G+E+P+ +VP  +K +IK C   GK VI ATQMLDS++   +PTRAEV DV  AV  GTD TMLSGE+ANG YP+ AV  MA+ID  +E       A  +       + E +G      A  +  K ++        +    G+  R+I   S  R  A I  VT  +       +NYGV+
  S:     1 MKKTKIVSTLGPA--------------------SNSVEIITKLIEAGANVFRFNFSHGDHEEHLSRMNMVREAEKATGKTVGIMLDTKGAEIRTTVQQGKKFELHTGEVVRISMDDTLEGTPEKIAV-TYPGLYD---DTHVGGHVLIDDGLVDLKIIEKDEANKELVTEVQNDGMVGSRKGVNAPGVSINLPGITEKDASDIRFGLDNDINFIAASFVRKPQDVLDIRELLEEKHMEHVQIFPKIESQEGIDNIDDIMKVSDGLMIARGDMGVEIPFENVPFVQKNLIKKCNAIGKPVITATQMLDSMQENPRPTRAEVNDVANAVIDGTDATMLSGESANGDYPVEAVATMARIDERTEKSLTDRDAYALKAYSKTNLTESIGQAVAHTARNLGIKTIV--------AATESGSTARMI---SKYRPQADILAVTFDERTRRGLTVNYGVY 418
>gi|20808232|ref|NP_623403.1| pyruvate kinase [Thermoanaerobacter tengcongensis MB4] >gi|20516829|gb|AAM25007.1| Pyruvate kinase [Thermoanaerobacter tengcongensis MB4] (583 aa)
Score = 661, Expect = 5.0e-67, Identities = 173/478 (36%), Positives = 258/478 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQL 481
           +++TKI  T+GP+         D+N              L  L + G+NV R NFSHGD+EE   R++ ++++ +E G+ ++ +LDTKGPEIR  K     VE+K + +    TT+  IG     SV        + +DV  G  I +DDG + L V+    E+  I  +  N+  L ++K +N+P    ++P ++ KD  DI F IK   D IAASFV    +V  I+++L+++  +HIQII+KIE   G++++D+II  SD IMVARGDLG+E+P  ++P  +K IIK C   GK VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ A E MA+I   +E +  Y   + V  +    +   +     T A  +    +I      Y++ +V           S  R ++PI   T  ++ A +  + +GV+  V   V    +   E+ID AI S L
  S:     1 MRRTKIVCTIGPASE-------DYNI-------------LRKLIEKGMNVARLNFSHGDFEEHGARIDNIKKIREELGLPVAILLDTKGPEIRTGKFKNGGVELK-EGQTFTLTTRDVIGDETVVSV----SYKGLPQDVSRGTQILIDDGLISLRVVDVKGED--IICVVENSGFLGDHKGVNVPGVKLNLPALTQKDIEDIEFGIKKGIDMIAASFVRKAADVLAIRRLLEDNKADHIQIIAKIENREGVENIDEIIRVSDGIMVARGDLGVEIPLEEIPIVQKMIIKKCNEAGKPVITATQMLDSMMRNPRPTRAEVTDVANAILDGTDAIMLSGETAQGKYPVEAFETMARIAEKTEVYVQYRDIVGVGTERNVSITNAISHATCTTARDIGASAIITCTKSGYTARMV-----------SRYRPSSPIIATTPSEQVARKLSIVWGVYPLVTKEV----STTDEMIDVAIESAL 437
>gi|121728930|ref|ZP_01681936.1| pyruvate kinase I [Vibrio cholerae V52] >gi|121628778|gb|EAX61242.1| pyruvate kinase I [Vibrio cholerae V52] (501 aa)
Score = 660, Expect = 5.5e-67, Identities = 172/465 (36%), Positives = 257/465 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT----IATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIA 468
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T  K +G  E+ +V  S      AKD+  GN I VDDG +++EV+++   E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+  G +V+EI+++L  HGG++IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV++MA+I   ++                P +K ++G+   +    I   V    V          I+V     +  +++      A I  VT  K+ A +  L+ GV   VVD +++  A
  S:    32 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYVEHGTRITNFRKVMEVTGKQLAILLDTKGPEIRTIKLENGDDVDLVAGQEFTFTTDTKVVGNKERVAVTYS----GFAKDLNVGNRILVDDGLIEMEVLATTDTE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKGSDVKEIREVLASHGGQNIQIISKIENQEGLDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVKIMAQIAERTD----------------PVLKAELGSRLDSPRLRITEAVCKGAVDTAEKLAAPLIIVATEAGKSARSVRKYFPTANIIAVTTNKKTAAQLVLSKGVTPVVVDAIDNTDA 459
>gi|116617886|ref|YP_818257.1| pyruvate kinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096733|gb|ABJ61884.1| pyruvate kinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (473 aa)
Score = 660, Expect = 5.7e-67, Identities = 179/458 (39%), Positives = 250/458 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE-NFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI +TLGPS +                 +ET  K    L  AG NV RFNFSHGD+EE   R+N V E  K  G  +  +LDTKG EIR  K ++ ++E  +   +RI   +   GT EK +V     TY  +  DV+ G  +  DDG L   VI  +     +     N  IL   K +N P  + ++P +++KD +DI F + ++ +YIAASFV   ++V EI+ +LKE   EH+QII KIE+  GI +LD I++ SD++MV RGD+G+E+P  +VP  +K +I+     G  VI ATQMLDS+E   +PTRAE +DV  AV  GTD TMLSGE+ANG YP+ +V  MA ID  +E +  + GR  D++F ET           +T A   +  R+  N   +  ++VV  N     + +S  R    I  VT  +       LNYGV   V D
  S:     1 MKKTKIVSTLGPSSSD----------------VETIVK----LIQAGANVFRFNFSHGDHEEHLGRMNAVHEAEKITGKTVGILLDTKGAEIRTTKQADGKIEFHTGDTLRIAMDENLEGTKEKIAV-----TYAGLFDDVKEGGQVLFDDGLLGTTVIEKDSATRELVVRVDNDGILGSRKGVNAPGVSINLPGITEKDADDIRFGLDHEINYIAASFVRKPEDVLEIRGLLKEKNMEHVQIIPKIESQEGIDNLDAILEVSDALMVPRGDMGVEIPAENVPLVQKDMIRKMNKAGLPVITATQMLDSMEENPRPTRAEASDVANAVFDGTDATMLSGESANGDYPVESVATMAAIDEKAETSLRENGRHEDIFFDETD----------STEAVAASVARIARN--VNAKAVVVSTNSGYTARMVSKHRPDVNILAVTYSERVQRGLTLNYGVVPVVYD 423
>gi|167039840|ref|YP_001662825.1| pyruvate kinase., pyruvate, water dikinase [Thermoanaerobacter sp. X514] >gi|166854080|gb|ABY92489.1| Pyruvate kinase., Pyruvate, water dikinase [Thermoanaerobacter sp. X514] (583 aa)
Score = 660, Expect = 6.6e-67, Identities = 173/478 (36%), Positives = 260/478 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQL 481
           +++TKI  T+GP+         D+N              L  L + G+NV R NFSHGD+EE   R++ ++++ +E G+ ++ +LDTKGPEIR  K     VE+K + +  + TT+  +G       + S     + +DV+ G+ I +DDG + L+V     E+  I  I  N+  ++++K +N+P    ++P ++ KD +DI F I+   D IAASFV    +V  I+++L+E+  EHI II+KIE   G++++D+II  SD IMVARGDLG+E+P  ++P  +K II+ C   GK VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YPI A E MAKI   +E +  Y   ID        +   +     T A  +    +I      Y++ +V           S  R  API   T  +  A +  + +GV+  + + V    +   E+ID AI S L
  S:     1 MRRTKIVCTIGPASE-------DYNI-------------LRKLIEKGMNVARLNFSHGDFEEHGARIDNIKKIREEFGLPVAILLDTKGPEIRTGKFKNGGVELK-EGQTFVITTRDVLGDE----TICSVSYKGLPQDVERGSRILIDDGLISLKVTDVKGED--IVCIVENSGPVKDHKGVNVPGVKLNLPALTQKDVDDIEFGIQKGIDIIAASFVRKAADVLAIRRLLEENKAEHILIIAKIENREGVENIDEIIKVSDGIMVARGDLGVEIPLEEIPIVQKMIIQKCNKAGKPVITATQMLDSMMRNPRPTRAEVTDVANAILDGTDAIMLSGETAQGKYPIEAFETMAKIAEKTEAYVGYRDIIDRNIDTNVSITNAISHATCTTARDIGAAAIITCTKSGYTARMV-----------SRYRPQAPIIATTPSESVARKLSIVWGVYPLITEEV----STTDEMIDVAIQSAL 437
>gi|55977032|gb|AAV68349.1| putative pyruvate kinase [Leuconostoc mesenteroides] (473 aa)
Score = 659, Expect = 8.0e-67, Identities = 179/458 (39%), Positives = 250/458 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE-NFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI +TLGPS +                 +ET  K    L  AG NV RFNFSHGD+EE   R+N V E  K  G  +  +LDTKG EIR  K ++ ++E  +   +RI   +   GT EK +V     TY  +  DV+ G  +  DDG L   VI  +     +     N  IL   K +N P  + ++P +++KD +DI F + ++ +YIAASFV   ++V EI+ +LKE   EH+QII KIE+  GI +LD I++ SD++ VARGD+G+E+P  +VP  +K +I+     G  VI ATQMLDS+E   +PTRAE +DV  AV  GTD TMLSGE+ANG YP+ +V  MA ID  +E +  + GR  D++F ET           +T A   +  R+  N   +  ++VV  N     + +S  R    I  VT  +       LNYGV   V D
  S:     1 MKKTKIVSTLGPSSSD----------------VETIVK----LIQAGANVFRFNFSHGDHEEHLGRMNAVHEAEKITGKTVGILLDTKGAEIRTTKQADGKIEFHTGDTLRIAMDENLEGTKEKIAV-----TYAGLFDDVKEGGQVLFDDGLLGTTVIEKDSATRELVVRVDNDGILGSRKGVNAPGVSINLPGITEKDADDIRFGLDHEINYIAASFVRKPEDVLEIRGLLKEKNMEHVQIIPKIESQEGIDNLDAILEVSDALTVARGDMGVEIPAENVPLVQKDMIRKMNKAGLPVITATQMLDSMEENPRPTRAEASDVANAVFDGTDATMLSGESANGDYPVESVATMAAIDEKAETSLRENGRHEDIFFDETD----------STEAVAASVARIARN--VNAKAVVVSTNSGYTARMVSKHRPDVNILAVTYSERVQRGLTLNYGVVPVVYD 423
>gi|116512172|ref|YP_809388.1| pyruvate kinase [Lactococcus lactis subsp. cremoris SK11] >gi|116107826|gb|ABJ72966.1| pyruvate kinase [Lactococcus lactis subsp. cremoris SK11] (502 aa)
Score = 659, Expect = 8.5e-67, Identities = 165/453 (36%), Positives = 259/453 (57%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNK--FDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVF---GNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI +TLGP++    GK F  + +        +E + KN+AAL + G NV RFNFSHGD+ EQ  R+  V    +  G  +  +LDTKGPE+R  ++      + + +  K R+  TK+ + ++ +   L+  G  ++  DV+ G TI +DDGKL L +   +      E  A+N  ++ + K +N+P++    P ++++D  DI F +      ++IA SFV T ++V+E+++I +E G  H+Q+++KIE   GI++LD+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK V+ AT ML+S+    + TR+E++DVF AV  GTD TMLSGE+ANG YP  +V  MA ++ +++    +YGR         P   +K     +T+  +VA          D   IV     GN  RLI   S  R  A I  +T  ++      +N+GV
  S:     1 MNKRVKIVSTLGPAVEIRGGKKFGESGYWGESLD--VEASAKNIAALIEEGANVFRFNFSHGDHPEQGARMATVHRAEEIAGHKVGFLLDTKGPEMRTELFTDGADSISVVTGDKFRV-ATKQGLKSTPELIALNVAGGLDIFDDVEIGQTILIDDGKLGLSLTGKDAATREFEVEAQNDGVIGKQKGVNIPNTKIPFPALAERDDADIRFGLSQPGGINFIAISFVRTANDVKEVRRICEETGNPHVQLLAKIENQQGIENLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKLIISKVNKAGKIVVTATNMLESMTYNPRATRSEISDVFNAVIDGTDATMLSGESANGKYPRESVRTMATVNKNAQTMLKEYGRL-------HPERYDK-----STVTEVVAASVKNAAEAMDVKLIVALTESGNTARLI---SKHRPDADILAITFDEKVERGLMINWGV 446
>gi|125623950|ref|YP_001032433.1| pyruvate kinase [Lactococcus lactis subsp. cremoris MG1363] >gi|308858|gb|AAA99895.1| ATP:pyruvate 2-O-phosphotransferase >gi|124492758|emb|CAL97713.1| Pyk protein [Lactococcus lactis subsp. cremoris MG1363] (502 aa)
Score = 659, Expect = 8.8e-67, Identities = 165/453 (36%), Positives = 259/453 (57%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNK--FDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVF---GNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI +TLGP++    GK F  + +        +E + KN+AAL + G NV RFNFSHGD+ EQ  R+  V    +  G  +  +LDTKGPE+R  ++      + + +  K R+  TK+ + ++ +   L+  G  ++  DV+ G TI +DDGKL L +   +      E  A+N  ++ + K +N+P++    P ++++D  DI F +      ++IA SFV T ++V+E+++I +E G  H+Q+++KIE   GI++LD+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK V+ AT ML+S+    + TR+E++DVF AV  GTD TMLSGE+ANG YP  +V  MA ++ +++    +YGR         P   +K     +T+  +VA          D   IV     GN  RLI   S  R  A I  +T  ++      +N+GV
  S:     1 MNKRVKIVSTLGPAVEIRGGKKFGESGYWGESLD--VEASAKNIAALIEEGANVFRFNFSHGDHPEQGARMATVHRAEEIAGHKVGFLLDTKGPEMRTELFTDGADSISVVTGDKFRV-ATKQGLKSTPELIALNVAGGLDIFDDVEIGQTILIDDGKLGLSLTGKDAATREFEVEAQNDGVIGKQKGVNIPNTKIPFPALAERDDADIRFGLSQPGGINFIAISFVRTANDVKEVRRICEETGNPHVQLLAKIENQQGIENLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKLIISKVNKAGKIVVTATNMLESMTYNPRATRSEISDVFNAVIDGTDATMLSGESANGKYPRESVRTMATVNKNAQTMLKEYGRL-------HPERYDK-----STVTEVVAASVKNAAEAMDVKLIVALTESGNTARLI---SKHRPDADILAITFDEKVERGLMINWGV 446
>gi|164686691|ref|ZP_02210719.1| hypothetical protein CLOBAR_00286 [Clostridium bartlettii DSM 16795] >gi|164604081|gb|EDQ97546.1| hypothetical protein CLOBAR_00286 [Clostridium bartlettii DSM 16795] (586 aa)
Score = 658, Expect = 1.0e-66, Identities = 166/456 (36%), Positives = 252/456 (55%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +K  KKTKI  TLGP+                      +++ L  L + G+NV RFNFSHGD+ EQ +R++  ++V ++  V ++ +LDTKGPEIR  K ++ EV ++   +  I T  + +GT EK +V        +  DV+ G+TI +DDG + L +  + ++   I     N+ I++ +K +NLP    ++P ++ KD +DI F I+   D+IAASFV    +V  I++IL+ +   HIQIISKIE   G+++LD+I+  SD +MVARGDLG+EVP  ++P  +K +I+ C   GK VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ AV+VMA I    E   +Y   +     +   + + +     T A  +    ++ +    Y++ +V           S  R   PI   TD      +  L++GV+
  S:     2 LKNAKKTKIVCTLGPA--------------------SDSEEVLTQLVENGLNVCRFNFSHGDHAEQKVRMDTAKKVREKLNVPVALLLDTKGPEIRTGKFADPEVLLEQGQQF-IVTMDEALGTKEKCTV----SYKELVNDVKVGDTILIDDGLVGLRI--NEIKGNDIICTVENSGIVKNHKGVNLPGVKINLPALTPKDISDIEFGIEQDIDFIAASFVRKASDVLAIREILENNNATHIQIISKIENQEGVENLDEILQVSDGLMVARGDLGVEVPTEEMPIIQKDMIRKCNELGKPVITATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAAGKYPVEAVKVMASIAKRIEETLNYEEILKERNLKGSTVTDAISYATCTTAVELNASAIVSSTSSGYTARMV-----------SKFRPKTPIIAATDSDRTRRQLALSWGVY 419
>gi|156934256|ref|YP_001438172.1| pyruvate kinase [Enterobacter sakazakii ATCC BAA-894] >gi|156532510|gb|ABU77336.1| hypothetical protein ESA_02086 [Enterobacter sakazakii ATCC BAA-894] (502 aa)
Score = 658, Expect = 1.0e-66, Identities = 153/357 (42%), Positives = 212/357 (59%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           ++KKTKI  T+GP                       +++ L  + DAG+NV+R NFSHGDYEE   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G SE  +V     TY    KD+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGEHIQIISKIE   G+ + DDI++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:    32 VMKKTKIVCTIGPKTE--------------------SEEMLTKMLDAGMNVMRLNFSHGDYEEHGQRIKNLRNVLAKTGKQAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVVGNSEIVAV-----TYEGFTKDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKKDLIFGCEQGVDFVAASFIRKRSDVEEIRQHLKAHGGEHIQIISKIENQEGLNNFDDILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATI 363
>gi|114567551|ref|YP_754705.1| pyruvate kinase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338486|gb|ABI69334.1| pyruvate kinase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (582 aa)
Score = 658, Expect = 1.0e-66, Identities = 166/453 (36%), Positives = 256/453 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  T+GP+                        +NL  + +AG+N+ R NFSHG YEE   R+  +RE  K+ GV ++ MLDTKGPEIR       +V++++  +  + TT++  G      V     TY+ + ++V+ GN+I + DG + L+V+ ++  + I E +  N   L E K IN+P +  ++PF+S+KD+ DI F I+ + D+IAASFV T D+V EI+++L+    + I II+KIE+  G+++L+DII  +D IMVARGDLG+E+P  +VP  +K II+ C  +GK VI+ATQMLDS+    +PTRAEV+DV  A+  G D  MLSGETA G YP+  V+ MA+I   +E    Y        +E    +   G L+ T A   A      N   + S+I+         + ++  R  A +  VT ++    +  L +GV+
  S:     1 MRKTKIICTIGPA--------------------SEQIENLLLMIEAGMNITRLNFSHGSYEEHQKRIANIREARKKAGVPVAIMLDTKGPEIRTGLLKAGKVKLEAGQRF-VLTTRQVEGDENLVQV-----TYDRLPQEVEKGNSILLADGLINLQVLETSDTDIICEVV--NGGELGERKGINVPGARINMPFLSEKDKEDINFGIEQEVDFIAASFVRTADDVLEIRRLLERRDAD-IDIIAKIESQQGVENLEDIIKVADGIMVARGDLGVEIPAEEVPLVQKNIIEKCSPRGKMVIIATQMLDSMIVNPRPTRAEVSDVANAIFDGADAIMLSGETAAGKYPVEVVKTMARIAGRAEEVLPY--------QEILRQRRLQGELSITDAISFATCATALN--LNASAIITPTVTGLTAKMVAKYRPQASVVAVTTEERILNKLALVWGVY 415
>gi|15673314|ref|NP_267488.1| pyruvate kinase [Lactococcus lactis subsp. lactis Il1403] >gi|13432190|sp|Q07637|KPYK_LACLA Pyruvate kinase (PK) >gi|12724313|gb|AAK05430.1|AE006365_6 pyruvate kinase (EC 2.7.1.40) [Lactococcus lactis subsp. lactis Il1403] (502 aa)
Score = 658, Expect = 1.1e-66, Identities = 165/453 (36%), Positives = 259/453 (57%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNK--FDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVF---GNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M K+ KI +TLGP++    GK F  + +        +E + KN+AAL + G NV RFNFSHGD+ EQ  R+  V    +  G  +  +LDTKGPE+R  ++      + + +  K R+  TK+ + ++ +   L+  G  ++  DV+ G TI +DDGKL L +   +      E  A+N  ++ + K +N+P++    P ++++D  DI F +      ++IA SFV T ++V+E+++I +E G  H+Q+++KIE   GI++LD+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK V+ AT ML+S+    + TR+E++DVF AV  GTD TMLSGE+ANG YP  +V  MA ++ +++    +YGR         P   +K     +T+  +VA          D   IV     GN  RLI   S  R  A I  +T  ++      +N+GV
  S:     1 MNKRVKIVSTLGPAVEIRGGKKFGESGYWGESLD--VEASAKNIAALIEEGANVFRFNFSHGDHPEQGARMATVHRAEEIAGHKVGFLLDTKGPEMRTELFADGADAISVVTGDKFRV-ATKQGLKSTPELIALNVAGGLDIFDDVEIGQTILIDDGKLGLSLTGKDAATREFEVEAQNDGVIGKQKGVNIPNTKIPFPALAERDDADIRFGLSQPGGINFIAISFVRTANDVKEVRRICEETGNPHVQLLAKIENQQGIENLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKLIISKVNKAGKIVVTATNMLESMTYNPRATRSEISDVFNAVIDGTDATMLSGESANGKYPRESVRTMATVNKNAQTMLKEYGRL-------HPERYDK-----STVTEVVAASVKNAAEAMDIKLIVALTESGNTARLI---SKHRPNADILAITFDEKVERGLMINWGV 446
>gi|167454157|ref|ZP_02320380.1| pyruvate kinase [Listeria monocytogenes FSL J2-064] (485 aa)
Score = 658, Expect = 1.1e-66, Identities = 162/425 (38%), Positives = 237/425 (55%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID 475
           +NV R NFSHGD+EE   R+  +RE +K+ G  ++ +LDTKGPEIR       ++E ++   VR+  T  E GT EKFSV     TY  +  DV+ G++I +DDG + LEVI  +     + T   N  +L+  K +N+P+ + ++P +++KD  DI F ++   D+IAASFV    +V EI KIL+EH   H+QII KIE   G+ ++D+I+  S  +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV++MAKI V +E          +   E   M E +G      A              +  +IV         + +S  R  + I  VT  +       L++GV+ ++   V    +N  E+ D
  S:     1 MNVARLNFSHGDFEEHGARIVNIREASKKTGKQVAILLDTKGPEIRTNDMVGGKLEFQTGDVVRVSMTPVE-GTKEKFSV-----TYGELYDDVEIGSSILLDDGLIGLEVIEKDEANRELVTKVLNPGVLKNKKGVNVPNVSINLPGITEKDAADIRFGLEQGIDFIAASFVRRATDVLEITKILEEHNATHVQIIPKIENQEGVDNIDEILQVSQGLMVARGDLGVEIPAEEVPIVQKELIRKCNKLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVEAVKMMAKIAVRTEEVLVAQDKFALKLHENTDMTEAIGQAVGHTAK-----------NLNVQTIVAATQSGHTARMISKYRPKSHIVAVTFNEHVYRGLALSWGVYPRLATPV----SNTDEMFD 405
>gi|42528035|ref|NP_973133.1| pyruvate kinase [Treponema denticola ATCC 35405] >gi|41819080|gb|AAS13052.1| pyruvate kinase [Treponema denticola ATCC 35405] (471 aa)
Score = 658, Expect = 1.2e-66, Identities = 171/488 (35%), Positives = 270/488 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVI 491
           +KKTKI  T+GP+                      +++ LA +F AG+NV R NFSHG +EE  ++++ ++++ +E  + I+ +LDTKGPEIR+    EK VEI    +  I TT+  IGT++  S+       N+A +++P + I ++DG L+L+VI   + +  IE +A N+  L   K +N+P    ++P+MS+KD +DI F I+N  D+IAASF    D++ +I+K+L++H    I +I+KIE   G+ ++D+I+ E+D IMVARGD+G+E+    +P  +K +IK     GK VI ATQML+S+   ++PTRAEVTDV  A+  GT   MLSGETA G YP+  V +M  I  S E   DY +     F E   + E      TTI   +A          D ++I+         +ALS  +   PI  +T+  +   +  L++ V+  + D ++ +  N  ++   I      VKK  + I
  S:     1 MKKTKIVCTIGPA--------------------SDSERVLAEMFKAGLNVCRLNFSHGSHEEHKVKIDRIKKIREELKMPIALLLDTKGPEIRL-GLFEKPVEIVQGQEF-IITTRDVIGTNQICSI----SYKNIAAEIKPKSRILINDGLLELQVIDI-LNDTDIECVAVNSGTLSSRKGVNIPGLRVNLPYMSEKDISDIEFGIENDVDFIAASFTQRADDIIQIRKLLEKHKST-IAVIAKIENQEGLDNIDEILAEADGIMVARGDMGVEIEPEKIPHLQKQLIKKANLAGKPVITATQMLESMTHNLRPTRAEVTDVANAILDGTSAVMLSGETAAGEYPVETVAMMTSIANSIEETLDYEK----LFAENASLHE------TTITNAIARATCSTALALDANAIITASASGITPRALSKFKPRVPIIAITESPQVMRKMALDWDVYPVLADPIK-STDNMFDVCSQIAKDTGHVKKGDIAI 449
>gi|6708108|gb|AAF25804.1|AF172173_2 pyruvate kinase [Streptococcus thermophilus] (500 aa)
Score = 657, Expect = 1.6e-66, Identities = 148/369 (40%), Positives = 228/369 (61%)
  Q:     3 MIKKTKITATLGPSIT---GKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGR 371
           M K+ KI ATLGP++    GK F   +      K   + + KN+A L + G NV RFNFSHG++ EQ  R+++VR      G  +  +LDTKGPEIR  +++   KE   K+  ++RI  TK+ + ++     L+  G  ++  DV+ G  + VDDGKL L V+  + E+        N  I+ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V+E++ I +E G  H+++++KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK V+ AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA I  +++    +YGR
  S:     1 MNKRVKIVATLGPAVEIRGGKKF--GEDGYWSEKLDPDASAKNIAQLIEEGANVFRFNFSHGNHAEQGERMDVVRMAESIAGQKVGFLLDTKGPEIRTELFEGDAKEYAYKTGEQIRI-ATKQGLKSTRDVIALNVAGALDIFDDVEVGKQVLVDDGKLGLRVVDKDAEKREFIVEVENDGIIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGINFIAISFVRTAKDVQEVRAICEETGNGHVKLLAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKIVVTATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGPYPVESVRTMATIHKNAQTLLKEYGR 372
>gi|169189376|ref|ZP_02849377.1| pyruvate kinase [Paenibacillus sp. JDR-2] >gi|169003957|gb|EDS50820.1| pyruvate kinase [Paenibacillus sp. JDR-2] (473 aa)
Score = 656, Expect = 1.7e-66, Identities = 164/452 (36%), Positives = 251/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      + + L  + +AG+NV R N +HG+ E+   R+  +RE A      ++ +LD KGPE+R+ K  E    +K   K+ + TT++ IG  E+  V        +   V PGN I +DDG +++EV+S N  E  IE +  N  +++  K +NLP    ++P ++++D   I F I+ + D IA SFV   +++ +I+++L + G  HIQIISKIE   G+ +LD II+ SD IMVARGDLG+EVP +DVP  ++ +I  C   GK VIVATQMLDS++   +P+RAEV+DV  AV +GTD  MLSGETA G YP+ +V +MA I V +E+  D       YF E    +++ G   TTI  +++   V  +   +  +IV         + +S  R  +PI  V   ++   R  + +GV
  S:     1 MRKTKIVCTMGPACE--------------------STEVLIDMINAGMNVARLNMAHGELEDHAARIARIREAAAATNSIVAILLDIKGPEVRIGKLEEASYLLKVGEKLTL-TTEEIIGNGERIHV----NYAELPLVVNPGNKILLDDGLIEMEVVSVNGTE--IECVILNGGVIKARKGVNLPGIRTTLPGVTERDIRHIQFGIEQQIDIIAPSFVRRAEDILQIRELLHDGGAGHIQIISKIENEEGVNNLDSIIEASDGIMVARGDLGVEVPAWDVPMIQREMISKCNTAGKVVIVATQMLDSMQVNPRPSRAEVSDVANAVLQGTDAIMLSGETAAGKYPVESVSMMASIAVKAESMMD-------YFDE---FQQRRGAQPTTITEVISQAVVSSSLELNAKAIVTPTESGFTARMVSKYRPKSPIIAVASDEKVLPRLAVMWGV 415
>gi|15640512|ref|NP_230139.1| pyruvate kinase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591097|ref|ZP_01678407.1| pyruvate kinase I [Vibrio cholerae 2740-80] >gi|147674848|ref|YP_001216011.1| pyruvate kinase [Vibrio cholerae O395] >gi|153223760|ref|ZP_01954047.1| pyruvate kinase I [Vibrio cholerae MAK 757] >gi|153801475|ref|ZP_01956061.1| pyruvate kinase I [Vibrio cholerae MZO-3] >gi|153819440|ref|ZP_01972107.1| pyruvate kinase I [Vibrio cholerae NCTC 8457] >gi|153823429|ref|ZP_01976096.1| pyruvate kinase I [Vibrio cholerae B33] >gi|153826559|ref|ZP_01979226.1| pyruvate kinase I [Vibrio cholerae MZO-2] >gi|153828414|ref|ZP_01981081.1| pyruvate kinase I [Vibrio cholerae 623-39] >gi|194531149|ref|YP_002066663.1| pyruvate kinase I [Vibrio cholerae MO10] >gi|194535538|ref|YP_002070711.1| pyruvate kinase I [Vibrio cholerae RC385] >gi|9654913|gb|AAF93658.1| pyruvate kinase I [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547044|gb|EAX57183.1| pyruvate kinase I [Vibrio cholerae 2740-80] >gi|124118018|gb|EAY36761.1| pyruvate kinase I [Vibrio cholerae MAK 757] >gi|124122966|gb|EAY41709.1| pyruvate kinase I [Vibrio cholerae MZO-3] >gi|125618163|gb|EAZ46707.1| pyruvate kinase I [Vibrio cholerae MO10] >gi|125621160|gb|EAZ49503.1| pyruvate kinase I [Vibrio cholerae V51] >gi|126510011|gb|EAZ72605.1| pyruvate kinase I [Vibrio cholerae NCTC 8457] >gi|126519062|gb|EAZ76285.1| pyruvate kinase I [Vibrio cholerae B33] >gi|146316731|gb|ABQ21270.1| pyruvate kinase I [Vibrio cholerae O395] >gi|148876123|gb|EDL74258.1| pyruvate kinase I [Vibrio cholerae 623-39] >gi|149739651|gb|EDM53865.1| pyruvate kinase I [Vibrio cholerae MZO-2] >gi|150420332|gb|EDN12629.1| pyruvate kinase I [Vibrio cholerae RC385] >gi|150422890|gb|EDN14841.1| pyruvate kinase I [Vibrio cholerae AM-19226] (470 aa)
Score = 656, Expect = 1.9e-66, Identities = 172/465 (36%), Positives = 257/465 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT----IATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIA 468
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T  K +G  E+ +V  S      AKD+  GN I VDDG +++EV+++   E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+  G +V+EI+++L  HGG++IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV++MA+I   ++                P +K ++G+   +    I   V    V          I+V     +  +++      A I  VT  K+ A +  L+ GV   VVD +++  A
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYVEHGTRITNFRKVMEVTGKQLAILLDTKGPEIRTIKLENGDDVDLVAGQEFTFTTDTKVVGNKERVAVTYS----GFAKDLNVGNRILVDDGLIEMEVLATTDTE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKGSDVKEIREVLASHGGQNIQIISKIENQEGLDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVKIMAQIAERTD----------------PVLKAELGSRLDSPRLRITEAVCKGAVDTAEKLAAPLIIVATEAGKSARSVRKYFPTANIIAVTTNKKTAAQLVLSKGVTPVVVDAIDNTDA 428
>gi|47093107|ref|ZP_00230884.1| pyruvate kinase [Listeria monocytogenes str. 4b H7858] >gi|47018547|gb|EAL09303.1| pyruvate kinase [Listeria monocytogenes str. 4b H7858] (558 aa)
Score = 655, Expect = 2.1e-66, Identities = 161/425 (37%), Positives = 237/425 (55%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID 475
           +NV R NFSHGD+EE   R+  +RE +K+ G  ++ +LDTKGPEIR       ++E ++   VR+  T  E GT EKFSV     TY  +  DV+ G++I +DDG + LEVI  +     + T   N  +L+  K +N+P+ + ++P +++KD  DI F ++   D+IAASFV    +V EI KIL+EH   H+QII KIE   G+ ++D+I+  S  +MVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV++MAKI V +E          +   E   M E +G      A              +  +IV         + +S  R  + I  VT  +       L++GV+ ++       ++N  E+ D
  S:     1 MNVARLNFSHGDFEEHGARIVNIREASKKTGKQVAILLDTKGPEIRTNDMVGGKLEFQTGDVVRVSMTPVE-GTKEKFSV-----TYGELYDDVEIGSSILLDDGLIGLEVIEKDEANRELVTKVLNPGVLKNKKGVNVPNVSINLPGITEKDAADIRFGLEQGIDFIAASFVRRATDVLEITKILEEHNATHVQIIPKIENQEGVDNIDEILQVSQGLMVARGDLGVEIPAEEVPIVQKELIRKCNKLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGDYPVEAVKMMAKIAVRTEEVLVAQDKFALKLHENTDMTEAIGQAVGHTAK-----------NLNVQTIVAATQSGHTARMISKYRPKSHIVAVTFNEHVYRGLALSWGVYPRLAT----PVSNTDEMFD 405
>gi|160942086|ref|ZP_02089401.1| hypothetical protein CLOBOL_06974 [Clostridium bolteae ATCC BAA-613] >gi|158434977|gb|EDP12744.1| hypothetical protein CLOBOL_06974 [Clostridium bolteae ATCC BAA-613] (478 aa)
Score = 654, Expect = 2.8e-66, Identities = 154/367 (41%), Positives = 220/367 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN---MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYG 370
           +KKTKI  T+GP+ +             +K ++    +N       G++V RFNFSHGDY E   RL L++EV KE  + ++ +LDTKGPEIR  +  + +     + +    TT++ +G        D+ G  N   + +DV  GN I +DDG ++LEV      + + E I  N   L E K +N+P+    +P ++DKD+ DI F I+  FD+IAASFV T D ++EIK +L E G   +++I+KIE   GI++LD II+ +D IMVARGD+G+E+P   VP  +K II+ C    K VI ATQMLDS+    +PTRAEVTDV  AV  GTD  MLSGETA G YP++A+++M  I + +E   DY 
  S:     1 MKKTKIICTMGPNTS-------------DKNIMMELARN-------GMDVARFNFSHGDYNEHQGRLELLKEVRKELDIPVAALLDTKGPEIRTGQLKDGKKVTLKEGQTYTLTTRELVGD-------DTIGYINYSGLNEDVAAGNRILIDDGLIELEVRQVKDTDIVCEVI--NGGELGEKKGVNVPNVKIKLPALTDKDKEDIRFGIRQGFDFIAASFVRTADCIKEIKAMLDEQGSS-MKVIAKIENAEGIENLDAIIEAADGIMVARGDMGVEIPAEKVPHIQKKIIRKCNEACKIVITATQMLDSMIRNPRPTRAEVTDVANAVYDGTDAVMLSGETAMGKYPVDALKMMVSIALETEMHLDYA 340
>gi|168035650|ref|XP_001770322.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162678353|gb|EDQ64812.1| predicted protein [Physcomitrella patens subsp. patens] (529 aa)
Score = 654, Expect = 2.9e-66, Identities = 155/390 (39%), Positives = 218/390 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           I KTKI  TLGP             K     V+E        L  AG+NV RFNFSHG +E Q   L+ +R+         + +LDTKGPEIR  +  S K +++  D ++ I T    +G     ++        +A D+QPGN I   DG + + V+  +VE+G+++    NT +L E K +NLP     +P +++KD +DI+ + + NK D+IAASFV  G +V  IKK+L E   + I IISK+E   G+ + DDI+ E+D +MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETANG YP  AV VM+ I   +E   D+        K  P     + +LA++
  S:    22 IAKTKIICTLGP-------------KSREVPVLEK-------LLKAGMNVARFNFSHGTHEYQQYTLDNLRQACLNTQTMCAVLLDTKGPEIRTGQLASGKPIQLVRDKEIWITTDYTHLGDENMIAM----SYKKLATDLQPGNIILCSDGSITMTVLECDVEKGMVKCRCENTAMLGEKKNVNLPGVVVDLPTITEKDIDDIMTWGVPNKIDFIAASFVRKGSDVLAIKKLLGE-ASKSIHIISKVENQEGLVNFDDILKETDGVMVARGDLGMEIPTEKIFLAQKMMIYKCNSAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETANGSYPELAVAVMSHICQEAEAALDHESIFKEIMKSVPLPMSPLESLASS 388
>gi|167751448|ref|ZP_02423575.1| hypothetical protein EUBSIR_02444 [Eubacterium siraeum DSM 15702] >gi|167655694|gb|EDR99823.1| hypothetical protein EUBSIR_02444 [Eubacterium siraeum DSM 15702] (600 aa)
Score = 654, Expect = 3.2e-66, Identities = 167/452 (36%), Positives = 252/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKN-LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEG--IIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +KKTKI  TLGP+                     T   N L  L  +G++  RFNFSHG +E+   R   V  + KE  + I  +LDTKGPE+R+     +K VE+K+ S+  + TT+  IG  ++ ++       N+A D++ G TI +DDG L+L+V   + +E    I     +  +L+ NK  N P  + S+P++S++D++D++F IK  FD +AASFV   +++ +I+K+L E+GG+ I II+KIE   G+ ++DDI+  +D IMVARGD+G+E+P+ ++P  +K +I    + GK VI ATQMLDS+    +PTRAE TDV  A+  GT   MLSGETA G YPI+AV+ M  I V +E   DY +          F +E  G    T A  +A   V  +     ++I+      R  + LS  R   PI   T  +    +  L++GV
  S:    15 MKKTKIVCTLGPA---------------------TDDDNVLRELIKSGMDCARFNFSHGTHEDHKKRYEQVERIRKELRLPIPAILDTKGPEVRIKSFKDDKPVELKTGSEYTL-TTEDVIGDEKRAAI----NYPNLASDIETGVTILIDDGLLELKVTEIDRKESGDDIRCKVIHGGMLKPNKSCNFPGIHLSMPYLSERDKSDLLFGIKTGFDIVAASFVTRDEDIIQIRKLLDENGGKDISIIAKIENQDGVDNIDDILRVADGIMVARGDMGVEIPFVEIPRIQKELIHKGYNAGKQVITATQMLDSMIKNPRPTRAETTDVANAIYDGTSAIMLSGETAAGAYPIDAVKTMKAIAVKTEQDIDYRKRF--------FTRENEGVPNVTNA--IAHATVTTSIDLGATAILTVTKGGRTARTLSKFRPTCPIIAATTSERAQRQLNLSWGV 434
>gi|168029184|ref|XP_001767106.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162681602|gb|EDQ68027.1| predicted protein [Physcomitrella patens subsp. patens] (526 aa)
Score = 654, Expect = 3.4e-66, Identities = 154/390 (39%), Positives = 218/390 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           I KTKI  TLGP             K     V+E        L  AG+NV RFNFSHG +E     L+ +R+         + +LDTKGPEIR     S K +++K   ++ I T    +G     ++        +  DV+PGNTI   DG + L V+  + E+G+++    NT +L E K +NLP     +P ++ KDR+DI+ + + NK D+IAASFV  G ++ +IK++L E   ++I IISK+E   G+ + DDI+ ESD +MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTD  MLSGETANG+YP  AV VM++I   +E   DY        K  P     + +LA++
  S:    22 IAKTKIICTLGP-------------KSREVPVLEK-------LLRAGMNVARFNFSHGTHEYHQYTLDSLRQACINTQTMCAVLLDTKGPEIRTGNLASGKPIQLKRGEEILITTDYSHLGDENMIAM----SYQRLPVDVKPGNTILCSDGTIALSVLECDAEKGVVKCRCENTAMLGEKKNVNLPGVIVDLPTITPKDRDDILNWGVPNKIDFIAASFVRKGSDLIQIKQLLGE-ASKNIHIISKVENQEGLVNFDDILRESDGVMVARGDLGMEIPTEKIFLAQKMMIYKCNSAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDAVMLSGETANGLYPELAVAVMSQICQEAEASLDYASIFKETMKSVPLPMSPLESLASS 388
>gi|168181977|ref|ZP_02616641.1| pyruvate kinase [Clostridium botulinum Bf] >gi|182674859|gb|EDT86820.1| pyruvate kinase [Clostridium botulinum Bf] (585 aa)
Score = 652, Expect = 5.3e-66, Identities = 172/480 (35%), Positives = 269/480 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMK--EKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPE 483
           ++KTK+  T+GP+                     + ++ ++ L +AG++V R NFSHG + E   R+ +++++ ++   +I+ MLDTKGPEIR    S  +VE+K  ++  IY  +  IG   K S+     TY+ + KDV  GN I +DDG ++LEV S  VE+  I T+ +N+  +  +K +N+P  + S+P +++KD  D+ F  +   D I+ASF+    +V  I+KIL+E+GG  IQIISKIE   G+ ++D+II  SD IMVARGD+G+E+P  +VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGE+ANG YP+ A   M++I  ++E   +Y  AI    +E+  +     +   A T A+             + ++I+         + +S  R   PI  VT  +  A +  LN+G    VV  +     +  E+ID ++N  L E
  S:     1 MQKTKMIFTIGPA--------------------SSTEEIVSKLIEAGMSVSRHNFSHGSHPEHKERMMMIKKLREKHNKHIAIMLDTKGPEIRTGNFSVDKVELKEGAEFTIYCREDIIGDETKCSI-----TYDELYKDVVKGNKILIDDGLVELEVQS--VEDNKIHTVVKNSGTVSNHKGVNVPGVSVSLPAVTEKDIEDLKFGCEVGVDLISASFIRKASDVLAIRKILEENGGNEIQIISKIENQEGVDNIDEIIKFSDGIMVARGDMGVEIPIEEVPIVQKRIIEKCNKAGKPVITATQMLDSMMRNPRPTRAEASDIANAIFDGTDAIMLSGESANGKYPVEAARTMSRIAKTAEAKLNYD-AILNKMRESHILNVPNAISLSACTTAS-----------ELNATAIITATQSGHTAKMVSKYRPQCPIIAVTPNEIVARKLALNWG----VVPLLTETFNSTDELIDKSVNKSLEE 441
>gi|73662378|ref|YP_301159.1| pyruvate kinase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123642805|sp|Q49YC7|KPYK_STAS1 Pyruvate kinase (PK) >gi|72494893|dbj|BAE18214.1| pyruvate kinase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (586 aa)
Score = 652, Expect = 5.3e-66, Identities = 166/453 (36%), Positives = 248/453 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  T+GP+                      +++ L  L  AG+NV R NFSHGD  E   R++ +R+V+K  G  ++ +LDTKGPEIR +   +  +E++  S+V +  T+ E GT EKFSV     TY N+  DV+ G+ I +DDG ++L+V S +   G +     NT  L+  K +NLP    S+P ++DKD +DI F I    D+IAASFV    +V +I+K+L+    ++I II KIE   GI ++ +I++ SD +MVARGD+G+E+P   VP  +K +I+ C   GK VI ATQMLDS++   + TRAE +DV  A+  GTD  MLSGETA G YP  AV+ M  I VS+E   DY +           + ++   + T++   +           +  +IV         + +S  R  + I  VT   E A +  L +G+F
  S:     1 MRKTKIVCTIGPA--------------------SESEEMLEKLIKAGMNVARLNFSHGDQAEHKARIDTIRKVSKRLGKTVAILLDTKGPEIRTHNMKDGLIELEKGSEVTVSMTEVE-GTPEKFSV-----TYENLINDVEEGSYILLDDGLIELQVKSIDKANGEVLCDVLNTGELKNKKGVNLPGVKVSLPGITDKDADDINFGISEGVDFIAASFVRRPSDVLDIRKLLEAKQNKNISIIPKIENQEGIDNIKEILEVSDGLMVARGDMGVEIPPESVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANAIYDGTDAVMLSGETAAGQYPEEAVKTMRNIAVSAEAAQDYKK----------LLSDRTKLVETSLVNAIGVSVAHTALNLNVKAIVAATESGSTARTISKYRPQSDIIAVTPNAETARQCALVWGIF 418
>gi|170758717|ref|YP_001788701.1| pyruvate kinase [Clostridium botulinum A3 str. Loch Maree] >gi|169405706|gb|ACA54117.1| pyruvate kinase [Clostridium botulinum A3 str. Loch Maree] (585 aa)
Score = 651, Expect = 6.8e-66, Identities = 170/480 (35%), Positives = 268/480 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMK--EKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPE 483
           ++KTK+  T+GP+                     + ++ ++ L +AG++V R NFSHG + E   R+ +++++ ++   +I+ MLDTKGPEIR    S  +VE+K  ++  IY  +  +G   K S+     TY+ + KDV  GN I +DDG ++LEV    VE+  I T+ +N+  +  +K +N+P  + S+P +++KD  D+ F  +   D I+ASF+    +V  I+KIL+E+GG  IQIISKIE   G+ ++D+II  SD IMVARGD+G+E+P  +VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGE+ANG YP+ A   M++I  ++E   +Y  AI    +E+  +     +   A T A+             + ++I+         + +S  R   PI  VT  +  A +  LN+G    VV  +     +  E+ID ++N  L E
  S:     1 MQKTKMIFTIGPA--------------------SSTEEIVSKLIEAGMSVSRHNFSHGSHPEHKERMMMIKKLREKHNKHIAIMLDTKGPEIRTGNFSVDKVELKEGAEFTIYCREDIVGDETKCSI-----TYDELYKDVVKGNKILIDDGLVELEV--QTVEDNKIHTVVKNSGTVSNHKGVNVPGVSVSLPAVTEKDIEDLKFGCEVGVDLISASFIRKASDVLAIRKILEENGGNEIQIISKIENQEGVDNIDEIIKFSDGIMVARGDMGVEIPIEEVPIVQKRIIEKCNKAGKPVITATQMLDSMMRNPRPTRAEASDIANAIFDGTDAIMLSGESANGKYPVEAARTMSRIAKTAEAKLNYD-AILNKMRESHILNVPNAISLSACTTAS-----------ELNATAIITATQSGHTAKMVSKYRPQCPIIAVTPNEIVARKLALNWG----VVPLLTETFNSTDELIDKSVNKSLEE 441
>gi|91227129|ref|ZP_01261613.1| pyruvate kinase [Vibrio alginolyticus 12G01] >gi|91188781|gb|EAS75068.1| pyruvate kinase [Vibrio alginolyticus 12G01] (470 aa)
Score = 650, Expect = 8.0e-66, Identities = 180/461 (39%), Positives = 257/461 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF--DYGRAIDVYFKETPFMK--EKVGTLAT-TIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDYEE   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T    +G  +K +V     TY   A D+  GNTI VDDG +++EVIS    E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+    +V+EI+++L  +GGE+I IISKIE   G+ + D+I+D SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  AV  GTD  MLSGETA G YP+ AV +MA+I   +++    + G  +D     +P ++  E V   A  T   L AP  V+   G         G   R ++        A I  +T  K+ A +  L  GV   VVD++E
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYEEHGTRIANFRKVMEATGKPLAILLDTKGPEIRTIKLEGGNDVDLVAGQEFTFTTDTSVVGNKDKVAV-----TYAGFAADLNVGNTILVDDGLIEMEVISKTETE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVQEIREVLAANGGENIHIISKIENQEGVDNFDEILDLSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMINNPRPTRAEAGDVANAVMDGTDAVMLSGETAKGKYPVEAVTIMAQIANRTDSALKAELGSRLD-----SPRLRITEAVCKGAVDTAEKLAAPLIVVATEG---------GKSARSVRKYFP---TANILALTTNKKTAAQLVLTKGVTPVVVDSIE 424
>gi|169824698|ref|YP_001692309.1| pyruvate kinase [Finegoldia magna ATCC 29328] >gi|167831503|dbj|BAG08419.1| pyruvate kinase [Finegoldia magna ATCC 29328] (585 aa)
Score = 650, Expect = 9.3e-66, Identities = 175/473 (36%), Positives = 262/473 (55%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID 475
           M+KKTKI  T+GP+                      + + L  L   G+NV R NFSHG +EE   R+  +++  +E  + ++ MLDTKGPEIR+     ++V++    +  + TT+  IG     SV        +  D+  G  + +DDG ++LEVI  ++++  I     N  +L+  K +N+P+S   +P +++KD +DIIF IKN  DYIAASF+    +V +I+KIL+E+ G  I+IISKIE+  G+ +LD+II+ SD IMVARGDLG+E+    +P  +K IIK     GK VI ATQMLDS+    +PTRAEVTDV  A+  G+D  MLSGETA G YP+NAV+VM  I +++EN  +        FKE    + +   + TT A  +A + + +  G +  +IVV        + +S  R  +PI   T  +    +  L +GV   + +  E    N  E+ID
  S:     1 MLKKTKIVCTIGPA--------------------SDSVETLKTLMQIGMNVCRLNFSHGSHEEHLQRIKNIKQAREELDLPVAIMLDTKGPEIRLGDFGVEQVQLSIGDQFTL-TTRDVIGDQNICSV----SYKGLPDDLSIGKKVLIDDGLVELEVI--DIKDTDIICKVNNYGVLKSKKGVNIPNSKVKLPAITEKDISDIIFGIKNGIDYIAASFIRKSQDVLDIRKILEENNGNDIKIISKIESQEGVDNLDEIINTSDGIMVARGDLGVEIQTEIMPMVQKEIIKKTSLAGKPVITATQMLDSMIRNPRPTRAEVTDVANAILDGSDAVMLSGETAAGNYPVNAVKVMNDIAINTENSEE--------FKEAANKRLQWLDITTTNAISIATRSISEQLGAN--AIVVATTSGSTARNVSKYRPLSPIVAATTSEGVMRKLSLIWGVHPVLSELSE----NTDEVID 432
>gi|126701017|ref|YP_001089914.1| pyruvate kinase [Clostridium difficile 630] >gi|115252454|emb|CAJ70297.1| pyruvate kinase [Clostridium difficile 630] (586 aa)
Score = 650, Expect = 9.8e-66, Identities = 166/453 (36%), Positives = 250/453 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KKTKI  TLGP+                      +++ L  L   G+NV RFNFSHG +EE   R+++ ++V ++    ++ +LDTKGPEIR     + EV ++   K  I T K  +GT E  +V        +A+DV+ G++I +DDG + L V   N E+  I  +  N+ I++ +K +N+P    ++P ++ KD +DI F I    DYIAASFV    +V  I+++L+ +    IQIISKIE   G+++LD+I+  SD IMVARGDLG+E+P  ++P  +K +IK C    K V+ ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ AV++MA I   +E   DY R           +KE  GT   T+   ++          + S+I+   +     + +S  R  +PI   T+ ++   +  L +GV+
  S:     5 VKKTKIVCTLGPA--------------------SQSEEVLTQLMQNGLNVCRFNFSHGSHEEHKERIDMAKKVREKLNKPVAILLDTKGPEIRTGNFEDPEVFLEEGQKFTI-TMKDIMGTKEMCTV----SYKGLAEDVKSGDSILIDDGLVGLRVKEINGED--IVCVVENSGIVKNHKGVNVPGVKINLPAITPKDISDIEFGISQGIDYIAASFVRKASDVLAIREVLENNNATDIQIISKIENQEGVENLDEILKVSDGIMVARGDLGVEIPTEEMPIVQKMMIKKCNELAKPVVTATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAAGKYPVEAVKMMATIAKRTEETLDYDR----------LLKEN-GTNNVTVTDAISHATCTTAVDLNASAIITSTSSGYTARMVSKFRPKSPIIATTNNEKTMNKLALTWGVY 419
>gi|167754551|ref|ZP_02426678.1| hypothetical protein CLORAM_00053 [Clostridium ramosum DSM 1402] >gi|167705383|gb|EDS19962.1| hypothetical protein CLORAM_00053 [Clostridium ramosum DSM 1402] (476 aa)
Score = 650, Expect = 1.0e-65, Identities = 161/454 (35%), Positives = 251/454 (55%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +++ KTKI  T+GP+                       K+ L  L  AG+NV+R NFSHG + E   +++L+ E+ KE   +++ +LDTKGPEIR     +   E K    V I   +  +GTS++F++     TY  + KDV+PG  I V+DG++  E++  +VE   I  +  N  I++  + IN+P       ++S KD +D+ +     F+Y+AASFV    +V ++KK+L E+G   IQII+KIE   G++++D+I+  +D IMVARGDLG+EVP  DVP  +K +I  C+  GK VI ATQML+S++   +PTRAEV+DV  A+  GTD  MLSGE+A+G+YP  AV  M+KI + +EN  DY        +  P  ++    +  ++A + +         F  ++I+ F       + +S  R  A I   T +        +N+GV
  S:     5 EVMSKTKIVCTIGPA--------------------SDNKEMLTKLVKAGMNVMRLNFSHGTHPEHQAKIDLITEINKELDTSVAILLDTKGPEIRTGDFIDGSTEFKKGQVVTI-CQEDIVGTSDRFTI-----TYKELYKDVKPGGFILVNDGQV--ELLVDHVEGTDIVCVCANNGIVKNKRGINVPGIKLGFDYLSPKDIDDLTYGCTQPFNYVAASFVRRAQDVFDVKKLLVENGRPDIQIIAKIENSEGVENIDEILKIADGIMVARGDLGVEVPAEDVPLIQKEVITKCKDMGKLVITATQMLESMQQNPRPTRAEVSDVANAIFDGTDAIMLSGESASGLYPQEAVMTMSKIALKTENSLDYDALHRQAVRTAP--QDTSEAICMSVAEIASK--------FQVAAIIAFTESGFTARKMSRYRPEARIIAATPEVATTRALAINWGV 421
>gi|168715071|ref|ZP_02747348.1| pyruvate kinase [Clostridium difficile QCD-63q42] (586 aa)
Score = 649, Expect = 1.1e-65, Identities = 166/453 (36%), Positives = 250/453 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KKTKI  TLGP+                      +++ L  L   G+NV RFNFSHG +EE   R+++ ++V ++    ++ +LDTKGPEIR     + EV ++   K  I T K  +GT E  +V        +A+DV+ G++I +DDG + L V   N E+  I  +  N+ I++ +K +N+P    ++P ++ KD +DI F I    DYIAASFV    +V  I+++L+ +    IQIISKIE   G+++LD+I+  SD IMVARGDLG+E+P  ++P  +K +IK C    K V+ ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ AV++MA I   +E   DY R           +KE  GT   T+   ++          + S+I+   +     + +S  R  +PI   T+ ++   +  L +GV+
  S:     5 VKKTKIVCTLGPA--------------------SQSEEVLTQLMQNGLNVCRFNFSHGSHEEHKERIDMAKKVREKLNKPVAILLDTKGPEIRTGNFEDPEVFLEEGQKFTI-TMKDIMGTKEMCTV----SYKGLAEDVKSGDSILIDDGLVGLRVKEINGED--IVCVVENSGIVKNHKGVNVPGVKINLPAITPKDISDIEFGISQGIDYIAASFVRKASDVLAIREVLENNNATDIQIISKIENQEGVENLDEILKVSDGIMVARGDLGVEIPTEEMPIVQKMMIKKCNELAKPVVTATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAAGKYPVEAVKMMATIAKRTEETLDYDR----------LLKEN-GTNNVTVTDAISHATCTTAVDLNASAIITSTSSGYTARMVSKFRPKSPIIATTNNEKTMNKLALTWGVY 419
>gi|167760768|ref|ZP_02432895.1| hypothetical protein CLOSCI_03153 [Clostridium scindens ATCC 35704] >gi|167661655|gb|EDS05785.1| hypothetical protein CLOSCI_03153 [Clostridium scindens ATCC 35704] (473 aa)
Score = 649, Expect = 1.1e-65, Identities = 143/366 (39%), Positives = 220/366 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           ++KTKI  TLGP+               ++G +      L  L   G++V RFNFSHG +EEQ  RL+ ++E+  +    I+ MLDTKGPEIR+    E E  +  + ++    ++   GT +  S+     TY  + KDV PG+TI +DDG +++EV   + E+  I  + RN   L + K +N+P +  ++ F+S KDR D++F I+  FD++AASF  T +++RE++ +L E+GG  I II+KIE   G+  +D+II+ +D IM+ARGD+G+E+P   VP  ++ II+     GK VI ATQMLDS+    +PTRAE +D+  A+ +GT   MLSGETA G YP+ A++ M ++    E   +Y
  S:     1 MRKTKIVCTLGPAT--------------DEGNV------LEQLIQEGMDVARFNFSHGTHEEQKARLDRLKELRTKYDRPIAAMLDTKGPEIRIGCFKEGEA-VLEEGQIFTLVSRNVEGTRDYVSI-----TYKELYKDVSPGDTILIDDGLIEMEVKEISGED--IACLVRNGGRLSDQKGVNIPGTELNMEFLSKKDRADLLFGIQEDFDFVAASFTRTAEDIREMRLLLDENGGRDINIIAKIENQQGVDHIDEIIEAADGIMIARGDMGVEIPLERVPVIQQTIIRKVYCAGKQVITATQMLDSMMEHPRPTRAETSDIANAIYQGTSAIMLSGETAAGKYPVRALQTMVRVASYMEQNINY 339
>gi|153214953|ref|ZP_01949736.1| pyruvate kinase I [Vibrio cholerae 1587] >gi|124115026|gb|EAY33846.1| pyruvate kinase I [Vibrio cholerae 1587] (470 aa)
Score = 649, Expect = 1.1e-65, Identities = 171/465 (36%), Positives = 256/465 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT----IATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIA 468
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T  K +G  E+ +V  S      AKD+  GN I VDDG +++EV+++   E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+  G +V+EI+++L  H G++IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV++MA+I   ++                P +K ++G+   +    I   V    V          I+V     +  +++      A I  VT  K+ A +  L+ GV   VVD +++  A
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYVEHGTRITNFRKVMEVTGKQLAILLDTKGPEIRTIKLENGDDVDLVAGQEFTFTTDTKVVGNKERVAVTYS----GFAKDLNVGNRILVDDGLIEMEVLATTDTE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKGSDVKEIREVLASHSGQNIQIISKIENQEGLDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVKIMAQIAERTD----------------PVLKAELGSRLDSPRLRITEAVCKGAVDTAEKLAAPLIIVATEAGKSARSVRKYFPTANIIAVTTNKKTAAQLVLSKGVTPVVVDAIDNTDA 428
>gi|145952543|ref|ZP_01801552.1| hypothetical protein CdifQ_04003916 [Clostridium difficile QCD-32g58] >gi|168697461|ref|ZP_02729738.1| pyruvate kinase [Clostridium difficile QCD-37x79] >gi|168724318|ref|ZP_02756595.1| pyruvate kinase [Clostridium difficile QCD-76w55] >gi|168731660|ref|ZP_02763937.1| pyruvate kinase [Clostridium difficile QCD-97b34] >gi|196159538|ref|ZP_03120099.1| pyruvate kinase [Clostridium difficile CIP 107932] (586 aa)
Score = 649, Expect = 1.1e-65, Identities = 166/453 (36%), Positives = 250/453 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KKTKI  TLGP+                      +++ L  L   G+NV RFNFSHG +EE   R+++ ++V ++    ++ +LDTKGPEIR     + EV ++   K  I T K  +GT E  +V        +A+DV+ G++I +DDG + L V   N E+  I  +  N+ I++ +K +N+P    ++P ++ KD +DI F I    DYIAASFV    +V  I+++L+ +    IQIISKIE   G+++LD+I+  SD IMVARGDLG+E+P  ++P  +K +IK C    K V+ ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ AV++MA I   +E   DY R           +KE  GT   T+   ++          + S+I+   +     + +S  R  +PI   T+ ++   +  L +GV+
  S:     5 VKKTKIVCTLGPA--------------------SQSEEILTQLMQNGLNVCRFNFSHGSHEEHKERIDMAKKVREKLNKPVAILLDTKGPEIRTGNFEDPEVFLEEGQKFTI-TMKDIMGTKEMCTV----SYKGLAEDVKSGDSILIDDGLVGLRVKEINGED--IVCVVENSGIVKNHKGVNVPGVKINLPAITPKDISDIEFGISQGIDYIAASFVRKASDVLAIREVLENNNATDIQIISKIENQEGVENLDEILKVSDGIMVARGDLGVEIPTEEMPIVQKMMIKKCNELAKPVVTATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAAGKYPVEAVKMMATIAKRTEETLDYDR----------LLKEN-GTNNVTVTDAISHATCTTAVDLNASAIITSTSSGYTARMVSKFRPKSPIIATTNNEKTMNKLALTWGVY 419
>gi|149192483|ref|ZP_01870671.1| pyruvate kinase [Vibrio shilonii AK1] >gi|148833684|gb|EDL50733.1| pyruvate kinase [Vibrio shilonii AK1] (470 aa)
Score = 649, Expect = 1.3e-65, Identities = 153/356 (42%), Positives = 214/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDYEE   R+   REV    G  ++ +LDTKGPEIR  K     +V++ +  +    T    +G  +  +V     TY   A+D+  GNTI VDDG +++EVIS+   E  ++    N   L ENK +NLP  +  +P +S+KD+ND+ F  +   D++AASF+    +V+EI+ +L  +GGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    KTVI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYEEHGTRIANFREVMANVGKQLAILLDTKGPEIRTIKLEGGNDVDLVAGQEFTFTTDISVVGNKDTVAV-----TYAGFAQDLSAGNTILVDDGLIEMEVISTTETE--VKCKVLNNGALGENKGVNLPGVSVQLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVKEIRDVLNANGGENIHIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKTVITATQMLDSMINNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVTIMAQI 331
>gi|121534277|ref|ZP_01666101.1| pyruvate kinase [Thermosinus carboxydivorans Nor1] >gi|121307047|gb|EAX47965.1| pyruvate kinase [Thermosinus carboxydivorans Nor1] (584 aa)
Score = 649, Expect = 1.3e-65, Identities = 168/454 (37%), Positives = 252/454 (55%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           M KKTKI  T+GPS           ++P   GV+E        +  AG+NV RFNFSHG + E   R+ +VR  A +    ++ MLDTKGPE+R+      +V++ +  +  I T++   GT+E+ SV        + ++V+PG+TI + DG + L V    VE   I T  +N+  +   KR+  P  N  +P +S++D  DI+F ++ K D+IAASFV    +V  I+K+++E GG+ I II+KIE   G+K++D+I+  +D IMVARGDLG+E+P  +VP  +K IIK C   GK VI ATQML+S+    +PTRAE +D+  A+  G+D  MLSGETA+G YP+ AV  MAKI   +E    Y    D+   +   + ++  T A + AT+         H  + ++I+         + +S  R  A I  VT       R  L +GV+
  S:     1 MFKKTKIVCTVGPST----------DRP---GVLEQ-------MLVAGMNVARFNFSHGTHAEHAKRIEMVRAAAAKVNRPVALMLDTKGPEMRLGAFPAGKVKLTAGQRF-ILTSQDVPGTAERASVNHKL----LPEEVRPGDTILIADGLISLHV--DAVEGTEIITTVQNSGEIGSMKRVAAPGVNVHLPPLSEQDVRDILFGLEQKMDFIAASFVQRAADVLAIRKVVEEAGGQ-IDIIAKIENAEGVKNIDEILKVADGIMVARGDLGVEIPAEEVPLVQKTIIKKCNKAGKPVITATQMLESMIANPRPTRAEASDIANAILDGSDAIMLSGETASGQYPVEAVNTMAKIAARTEAALGY---TDILMGKG-LLPQRTTTDAISHATVQVA------HELNAAAIITATESGYTARMVSKYRPQAAIIAVTPHARTVRRMLLLWGVY 416
>gi|196124899|ref|ZP_03116648.1| pyruvate kinase [Clostridium difficile ATCC 43255] (586 aa)
Score = 648, Expect = 1.4e-65, Identities = 166/453 (36%), Positives = 250/453 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KKTKI  TLGP+                      +++ L  L   G+NV RFNFSHG +EE   R+++ ++V ++    ++ +LDTKGPEIR     + EV ++   K  I T K  +GT E  +V        +A+DV+ G++I +DDG + L V   N E+  I  +  N+ I++ +K +N+P    ++P ++ KD +DI F I    DYIAASFV    +V  I+++L+ +    IQIISKIE   G+++LD+I+  SD IMVARGDLG+E+P  ++P  +K +IK C    K V+ ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ AV++MA I   +E   DY R           +KE  GT   T+   ++          + S+I+   +     + +S  R  +PI   T+ ++   +  L +GV+
  S:     5 VKKTKIVCTLGPA--------------------SQSEEVLTQLMQNGLNVCRFNFSHGSHEEHKERIDMAKKVREKLNKPVAILLDTKGPEIRTGNFEDPEVFLEEGQKF-IITMKDIMGTKEMCTV----SYKGLAEDVKSGDSILIDDGLVGLRVKEINGED--IVCVVENSGIVKNHKGVNVPGVKINLPAITPKDISDIEFGISQGIDYIAASFVRKASDVLAIREVLENNNATDIQIISKIENQEGVENLDEILKVSDGIMVARGDLGVEIPTEEMPIVQKMMIKKCNELAKPVVTATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAAGKYPVEAVKMMATIAKRTEETLDYDR----------LLKEN-GTNNVTVTDAISHATCTTAVDLNASAIITSTSSGYTARMVSKFRPKSPIIATTNNEKTMNKLALTWGVY 419
>gi|196165015|ref|ZP_03125546.1| pyruvate kinase [Clostridium difficile QCD-23m63] (586 aa)
Score = 648, Expect = 1.7e-65, Identities = 166/453 (36%), Positives = 250/453 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KKTKI  TLGP+                      +++ L  L   G+NV RFNFSHG +EE   R+++ ++V ++    ++ +LDTKGPEIR     + EV ++   K  I T K  +GT E  +V        +A+DV+ G++I +DDG + L V   N E+  I  +  N+ I++ +K +N+P    ++P ++ KD +DI F I    DYIAASFV    +V  I+++L+ +    IQIISKIE   G+++LD+I+  SD IMVARGDLG+E+P  ++P  +K +IK C    K V+ ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ AV++MA I   +E   DY R           +KE  GT   T+   ++          + S+I+   +     + +S  R  +PI   T+ ++   +  L +GV+
  S:     5 VKKTKIVCTLGPA--------------------SQSEEVLTQLMQNGLNVCRFNFSHGSHEEHKERIDMAKKVREKLNKPVAILLDTKGPEIRTGNFEDPEVFLEEGQKFTI-TMKDIMGTKEMCTV----SYKGLAEDVKSGDSILIDDGLVGLRVKEINGED--IICVVENSGIVKNHKGVNVPGVKINLPAITPKDISDIEFGISQGIDYIAASFVRKASDVLAIREVLENNNATDIQIISKIENQEGVENLDEILKVSDGIMVARGDLGVEIPTEEMPIVQKMMIKKCNELAKPVVTATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAAGKYPVEAVKMMATIAKRTEETLDYDR----------LLKEN-GTNNVTVTDAISHATCTTAVDLNASAIITSTSSGYTARMVSKFRPKSPIIATTNNEKTMNKLALTWGVY 419
>gi|153939990|ref|YP_001392728.1| pyruvate kinase [Clostridium botulinum F str. Langeland] >gi|168178946|ref|ZP_02613610.1| pyruvate kinase [Clostridium botulinum NCTC 2916] >gi|152935886|gb|ABS41384.1| pyruvate kinase [Clostridium botulinum F str. Langeland] >gi|182669960|gb|EDT81936.1| pyruvate kinase [Clostridium botulinum NCTC 2916] (585 aa)
Score = 648, Expect = 1.7e-65, Identities = 171/480 (35%), Positives = 268/480 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMK--EKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPE 483
           ++KTK+  T+GP+                     + ++ ++ L +AG++V R NFSHG + E   R+ +++++ ++   +I+ MLDTKGPEIR    S  +VE+K  ++  IY  +  +G   K S+     TY+ + KDV  GN I +DDG ++LEV S  VE+  I T+ +N+  +  +K +N+P  + S+P +++KD  D+ F  +   D I+ASF+    +V  I+KIL+E+GG  IQIISKIE   G+ ++D+II  SD IMVARGD+G+E+P  +VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGE+ANG YP+ A   M++I  ++E   +Y  AI    +E+  +     +   A T A+             + ++I+         + +S  R   PI  VT  +  A +  LN G    VV  +     +  E+ID ++N  L E
  S:     1 MQKTKMIFTIGPA--------------------SSTEEIVSKLIEAGMSVSRHNFSHGSHPEHKERMMMIKKLREKHNKHIAIMLDTKGPEIRTGNFSVDKVELKEGAEFTIYCREDIVGDETKCSI-----TYDELYKDVVKGNKILIDDGLVELEVQS--VEDNKIHTVVKNSGTVSNHKGVNVPGVSVSLPAVTEKDIEDLKFGCEVGVDLISASFIRKASDVLAIRKILEENGGNEIQIISKIENQEGVDNIDEIIKFSDGIMVARGDMGVEIPIEEVPIVQKRIIEKCNKAGKPVITATQMLDSMMRNPRPTRAEASDIANAIFDGTDAIMLSGESANGKYPVEAARTMSRIAKTAEAKLNYD-AILNKMRESHILNVPNAISLSACTTAS-----------ELNATAIITATQSGHTAKMVSKYRPQCPIIAVTPNEIVARKLALNCG----VVPLLTETFNSTDELIDKSVNKSLEE 441
>gi|187776691|ref|ZP_02993164.1| hypothetical protein CLOSPO_00206 [Clostridium sporogenes ATCC 15579] >gi|187775350|gb|EDU39152.1| hypothetical protein CLOSPO_00206 [Clostridium sporogenes ATCC 15579] (585 aa)
Score = 647, Expect = 2.0e-65, Identities = 172/480 (35%), Positives = 269/480 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMK--EKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPE 483
           ++KTK+  T+GP+                     + ++ ++ L +AG++V R NFSHG + E   R+ +++++ ++   +I+ MLDTKGPEIR    S  +VE+K  ++  IY  +  IG   K S+     TY+ + KDV  GN I +DDG ++LEV S  V++  I TI +N+  +  +K +N+P  + S+P +++KD  D+ F  +   D I+ASF+    +V  I+KIL+E+GG  IQIISKIE   G+ ++D+II  SD IMVARGD+G+E+P  +VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGE+ANG YP+ A   M++I  ++E   +Y  AI    +E+  +     +   A T A+             + ++I+         + +S  R   PI  VT  +  A +  LN+G    VV  +     +  E+ID ++N  L E
  S:     1 MQKTKMIFTIGPA--------------------SSTEEVVSKLIEAGMSVSRHNFSHGSHPEHKERMMMIKKLREKHNKHIAIMLDTKGPEIRTGNFSVDKVELKEGAEFIIYCGEDIIGDETKCSI-----TYDELHKDVVKGNKILIDDGLVELEVES--VKDNKIHTIVKNSGTVSNHKGVNVPGVSVSLPAVTEKDIEDLKFGCEVGVDLISASFIRKASDVLAIRKILEENGGNEIQIISKIENQEGVDNIDEIIKFSDGIMVARGDMGVEIPIEEVPIVQKRIIEKCNKAGKPVITATQMLDSMIRNPRPTRAEASDIANAIFDGTDAIMLSGESANGKYPVEAATTMSRIAKTAEAKLNYD-AILSKMRESHILNVPNAISLSACTTAS-----------ELNATAIITATQSGHTAKMVSKYRPQCPIIAVTPNEVVARKLALNWG----VVPLLTETFNSTDELIDKSVNKSLEE 441
>gi|148381313|ref|YP_001255854.1| pyruvate kinase [Clostridium botulinum A str. ATCC 3502] >gi|153933332|ref|YP_001385689.1| pyruvate kinase [Clostridium botulinum A str. ATCC 19397] >gi|153936639|ref|YP_001389095.1| pyruvate kinase [Clostridium botulinum A str. Hall] >gi|148290797|emb|CAL84931.1| pyruvate kinase [Clostridium botulinum A str. ATCC 3502] >gi|152929376|gb|ABS34876.1| pyruvate kinase [Clostridium botulinum A str. ATCC 19397] >gi|152932553|gb|ABS38052.1| pyruvate kinase [Clostridium botulinum A str. Hall] (585 aa)
Score = 646, Expect = 2.3e-65, Identities = 171/480 (35%), Positives = 268/480 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMK--EKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPE 483
           ++KTK+  T+GP+                     + ++ ++ L +AG++V R NFSHG + E   R+ +++++ ++   +I+ MLDTKGPEIR    S  +VE+K  ++  IY  +  +G   K S+     TY+ + KDV  GN I +DDG ++LEV S  VE+  I T+ +N+  +  +K +N+P  + S+P +++KD  D+ F  +   D I+ASF+    +V  I+KIL+E+GG  IQIISKIE   G+ ++D+II  SD IMVARGD+G+E+P  +VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGE+ANG YP+ A   M++I  ++E   +Y  AI    +E+  +     +   A T A+             + ++I+         + +S  R   PI  VT  +  A +  LN G    VV  +     +  E+ID ++N  L E
  S:     1 MQKTKMIFTIGPA--------------------SSTEEIVSKLIEAGMSVSRHNFSHGSHPEHKERMMMIKKLREKHNKHIAIMLDTKGPEIRTGNFSVDKVELKEGAEFTIYCREDIVGDETKCSI-----TYDELYKDVVKGNKILIDDGLVELEVQS--VEDNKIHTVVKNSGTVSNHKGVNVPGVSVSLPAVTEKDIEDLKFGCEVGVDLISASFIRKASDVLAIRKILEENGGNEIQIISKIENQEGVDNIDEIIKFSDGIMVARGDMGVEIPIEEVPIVQKRIIEKCNKAGKPVITATQMLDSMMRNPRPTRAEASDIANAIFDGTDAIMLSGESANGKYPVEAARTMSRIAKTAEAKLNYD-AILNKMRESHILNVPNAISLSACTTAS-----------ELNATAIITATQSGHTAKMVSKYRPQCPIIAVTPNEIVARKLALNCG----VVPLLTETFNSTDELIDKSVNKSLEE 441
>gi|28897130|ref|NP_796735.1| pyruvate kinase [Vibrio parahaemolyticus RIMD 2210633] >gi|153839383|ref|ZP_01992050.1| pyruvate kinase [Vibrio parahaemolyticus AQ3810] >gi|28805339|dbj|BAC58619.1| pyruvate kinase I [Vibrio parahaemolyticus RIMD 2210633] >gi|149747105|gb|EDM58093.1| pyruvate kinase [Vibrio parahaemolyticus AQ3810] (470 aa)
Score = 646, Expect = 2.4e-65, Identities = 178/461 (38%), Positives = 257/461 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF--DYGRAIDVYFKETPFMK--EKVGTLAT-TIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDYEE   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T    +G  +K +V     TY   A D+  GNTI VDDG +++EVI++   E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+    +V+EI+++L  +GGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  AV  GTD  MLSGETA G YP+ AV +MA+I   +++    + G  +D     +P ++  E V   A  T   L AP  V+   G         G   R ++        A I  +T  K+ A +  L  GV   VVD +E
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYEEHGTRIANFRKVMEATGKQLAILLDTKGPEIRTIKLEGGNDVDLVAGQEFTFTTDTSVVGNKDKVAV-----TYAGFAADLNVGNTILVDDGLIEMEVIATTDTE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVQEIREVLAANGGENIHIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMINNPRPTRAEAGDVANAVMDGTDAVMLSGETAKGKYPVEAVTIMAQIAKRTDSVLKAELGSRLD-----SPRLRITEAVCKGAVDTAEKLAAPLIVVATEG---------GKSARSVRKYFP---TANILALTTNKKTAAQLVLTKGVTPVVVDAIE 424
>gi|170757030|ref|YP_001783009.1| pyruvate kinase [Clostridium botulinum B1 str. Okra] >gi|169122242|gb|ACA46078.1| pyruvate kinase [Clostridium botulinum B1 str. Okra] (585 aa)
Score = 646, Expect = 2.6e-65, Identities = 171/480 (35%), Positives = 268/480 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMK--EKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPE 483
           ++KTK+  T+GP+                     + ++ ++ L +AG++V R NFSHG + E   R+ +++++ ++   +I+ MLDTKGPEIR    S  +VE+K  ++  IY  +  +G   K S+     TY+ + KDV  GN I +DDG ++LEV S  VE+  I T+ +N+  +  +K +N+P  + S+P +++KD  D+ F  +   D I+ASF+    +V  I+KIL+E+GG  IQIISKIE   G+ ++D+II  SD IMVARGD+G+E+P  +VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +D+  A+  GTD  MLSGE+ANG YP+ A   M++I  ++E   +Y  AI    +E+  +     +   A T A+             + ++I+         + +S  R   PI  VT  +  A +  LN G    VV  +     +  E+ID ++N  L E
  S:     1 MQKTKMIFTIGPA--------------------SSTEEIVSKLIEAGMSVSRHNFSHGSHPEHKERMMMIKKLREKHNKHIAIMLDTKGPEIRTGNFSVDKVELKEGAEFTIYCREDIVGDETKCSI-----TYDELYKDVVKGNKILIDDGLVELEVQS--VEDNKIHTVVKNSGTVSNHKGVNVPGVSVSLPAVTEKDIEDLKFGCEVGVDLISASFIRKASDVLAIRKILEENGGNEIQIISKIENQEGVDNIDEIIKFSDGIMVARGDMGVEIPIEEVPIVQKRIIEKCNKAGKPVITATQMLDSMMRNPRPTRAEASDIANAIFDGTDAIMLSGESANGKYPVEAARTMSRIAKTAEAKLNYD-AILNKMRESHILNVPNAISLSACTTAS-----------ELNATAIITATQSGHTAKMVSKYRPQCPIIAVTPNEIVARKLALNCG----VVPLLTETFNSTDELIDKSVNKSLEE 441
>gi|159469714|ref|XP_001693008.1| pyruvate kinase [Chlamydomonas reinhardtii] >gi|158277810|gb|EDP03577.1| pyruvate kinase [Chlamydomonas reinhardtii] (508 aa)
Score = 646, Expect = 2.9e-65, Identities = 164/436 (37%), Positives = 239/436 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV 439
           I KTK+  TLGP             K  +  V+E        L  AG++V RFNFSHG ++     L+ +R+      V  + MLDTKGPEIR     + K V++ +  +V I TT   +   EK   +       +A+DV+PG+ I   DG + LEV+S++   G +     N+ +L E K +NLP     +P ++DKD +D+I +A+ N  D+IAASFV  G ++  I+++L E G   I+IISK+E   GI++ DDI+ ++DS+MVARGDLG+E+P   +   +K +I+ C + GK VI ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G +P+ AV+VM KI   +E   DY        K+ P     + +LA++         V   H    S IVV   +    + ++  R   P+  V
  S:    17 ICKTKVVCTLGP-------------KSRSVEVLEE-------LLRAGMSVARFNFSHGSHDYHQETLDNLRQAMANTKVMCAAMLDTKGPEIRTGTLKDGKPVQLTAGQEVTI-TTDYALPGDEKTIAMSYK---KLAQDVKPGSQILCADGSIVLEVVSTDPAAGTVRARCMNSAMLGERKNVNLPGVVVDLPTLTDKDVDDLINWALPNDIDFIAASFVRKGSDIDTIRQVLGERG-RSIKIISKVENQEGIQNFDDILAKTDSVMVARGDLGMEIPTEKIFLAQKMMIQKCNYAGKPVITATQMLESMIKNPRPTRAEATDVANAVLDGTDCVMLSGETAAGNFPVEAVKVMTKICREAEASLDYYAMFKNILKQAPMPMSPLESLASSA--------VRTAHKVHASLIVVLTREGSTARLVAKYRPLVPVLTV 421
>gi|163802682|ref|ZP_02196573.1| pyruvate kinase [Vibrio campbellii AND4] >gi|159173570|gb|EDP58390.1| pyruvate kinase [Vibrio campbellii AND4] (470 aa)
Score = 645, Expect = 3.9e-65, Identities = 152/356 (42%), Positives = 217/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K  +  +V++ +  +    T    +G  +K +V     TY   AKD+  GNTI VDDG +++EV++++  E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+    +V+EI+ IL  +GGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  AV  GTD  MLSGETA G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYAEHGTRITNFRKVMEATGKQLAILLDTKGPEIRTIKLEDGNDVDLVAGQEFTFTTDISVVGNKDKVAV-----TYAGFAKDLNVGNTILVDDGLIEMEVLATSETE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVQEIRDILTANGGENIHIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMINNPRPTRAEAGDVANAVMDGTDAVMLSGETAKGKYPVEAVTIMAQI 331
>gi|37526504|ref|NP_929848.1| pyruvate kinase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36785935|emb|CAE14987.1| pyruvate kinase I (PK-1) [Photorhabdus luminescens subsp. laumondii TTO1] (469 aa)
Score = 643, Expect = 6.0e-65, Identities = 150/356 (42%), Positives = 207/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA L +AG+NV+R NFSHGDYEE   R+  +  V  + G   + +LDTKGPEIR  K     +V + +       T    IG  ++ +V     TY     D+ PGNT+ VDDG + + V      E I + +  N   L ENK +NLP  + S+P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YPI AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEKLAELLNAGMNVMRLNFSHGDYEEHGQRIQNIHSVMTKTGKQAAILLDTKGPEIRTMKLEGGNDVSLTAGQTFTFTTDTSVIGNKDRVAV-----TYRGFPADLAPGNTVLVDDGLIGMTVKEVTKSEVICQVL--NNGDLGENKGVNLPGISISLPALAEKDKQDLIFGCQQGVDFVAASFIRKRSDVLEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIQKCNIARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPIEAVTIMATI 331
>gi|84394595|ref|ZP_00993298.1| pyruvate kinase [Vibrio splendidus 12B01] >gi|84374786|gb|EAP91730.1| pyruvate kinase [Vibrio splendidus 12B01] (458 aa)
Score = 643, Expect = 6.4e-65, Identities = 151/356 (42%), Positives = 215/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L DAG+NV+R NFSHGD+ E   R+   R V + KG  ++ +LDTKGPEIR  K  +  +V++ +  +    T    +G  +  +V     TY   AKD+  GNTI VDDG +++EVI++   E  ++    N   L ENK +NLP  +  +P +S+KD+ D+ F  +   D++AASF+   D+V+EI+++L  +GGE+I IISKIE   G+ + D I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+ +  +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVDAGMNVMRLNFSHGDFAEHGTRIANFRTVMENKGEQLAILLDTKGPEIRTIKLEDGNDVDLVAGQEFTFTTDATVVGNKDVVAV-----TYLGFAKDLTAGNTILVDDGLIEMEVIATTETE--VKCKVLNNGALGENKGVNLPGVSVQLPALSEKDKADLKFGCEQGVDFVAASFIRKEDDVKEIRELLNANGGENIHIISKIENQEGVDNFDSILEASDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMISNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVTIMAQI 331
>gi|157370427|ref|YP_001478416.1| pyruvate kinase [Serratia proteamaculans 568] >gi|157322191|gb|ABV41288.1| pyruvate kinase [Serratia proteamaculans 568] (470 aa)
Score = 641, Expect = 8.8e-65, Identities = 150/356 (42%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L +AG+NV+R NFSHGDYEE   R+  +R V  + G N   +LDTKGPEIR  K    K+  + +       T +  IG +E+ +V     TY   + D++ GNT+ VDDG + +EV  +NV E  +     N+  L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGG  IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTNLLNAGMNVMRLNFSHGDYEEHGNRIKNMRAVMAKTGQNAGILLDTKGPEIRTMKLEGGKDAALVAGQTFTFTTDQSVIGNNERVAV-----TYAGFSADLKIGNTVLVDDGLIGMEV--TNVTESEVICKVLNSGDLGENKGVNLPGVSIQLPALAEKDKRDLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGSQIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATI 331
>gi|145299979|ref|YP_001142820.1| pyruvate kinase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852751|gb|ABO91072.1| pyruvate kinase I [Aeromonas salmonicida subsp. salmonicida A449] (470 aa)
Score = 641, Expect = 9.2e-65, Identities = 176/460 (38%), Positives = 249/460 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI----------DVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +KKTKI  T+GP                       +K+ LA + DAG+NV+R NFSHGDY E   R+N +R V  E G + + +LDTKGPEIR  K     +V + +       T +  IG  +K +V     TY   A D++ GN I VDDG + ++VI     E I + +  N+  L ENK INLP  +  +P +++KD+ D+IF  +   D++AASF+   ++V EI++ L+ HGGE+IQIISKIE   G+ + D+I+  SD IMVARGD+G+E+P  +V   +K II  C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I          ++S+ N  +  R  +   K      EK+G          AP  V+   G             +  +A+      A I  +T  K+ A +  L  GV   VVD++
  S:     1 MKKTKIVCTIGPKTE--------------------SKEMLAKMLDAGMNVMRLNFSHGDYAEHGGRINNLRAVMAETGKHAAILLDTKGPEIRTIKLEGGNDVALVAGQTFTFTTDQTVIGNKDKVAV-----TYAGFANDLRVGNRILVDDGLIGMDVIEITEREVICKVL--NSGDLGENKGINLPGVSIKLPALAEKDKRDLIFGCEQGVDFVAASFIRKKEDVLEIREHLRAHGGENIQIISKIENQEGLDNFDEILAVSDGIMVARGDMGVEIPVEEVIFAQKMIITKCNKARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATICERTDAVMPSNLSAANDSNKLRITEAVCKGAVETSEKLG----------APLIVVATEG------------GKSAKAIRKYFPQAWILAITTNKKTAAQLVLTKGVVTHVVDSI 423
>gi|15894323|ref|NP_347672.1| pyruvate kinase [Clostridium acetobutylicum ATCC 824] >gi|15023948|gb|AAK79012.1|AE007619_4 Pyruvate kinase [Clostridium acetobutylicum ATCC 824] (472 aa)
Score = 641, Expect = 1.0e-64, Identities = 162/452 (35%), Positives = 259/452 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTK+  T+GPS                      +++ L  L +AG+N  R NFSHG +E+   ++++++++ KE   N++ ++D KGP+IR +     + EIK      +    + +G SEK SV       ++ KDV+ G  + VDDG L+ E+  ++V++  I   A+N  I+  +K +N+P  +  +P +++KD  D+ FA K + D +AASF+   ++V  ++K+LKE+GGE I++ISKIET  G+ ++D I++ SD IMVARGD+G+E+P  DVP+ +K II+ C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A+G+YPI A E MAKI   +E+  DY +A++          E+ G + T I+  ++            ++I+         + +S  R   PI  VT   + A R  LN+G+
  S:     1 MQKTKMIFTIGPS--------------------SDSEEKLKELMNAGMNAARLNFSHGTHEDHKEKIDIIKKLRKELNKNVAIVVDIKGPKIRTHNFENDKAEIKKGQTFTVMCGSEILGNSEKCSV----SYDDLYKDVKKGGLLLVDDGLLEFEI--TDVQDKNIICKAKNNGIISNHKGVNVPGVSIGLPAVTEKDVLDLKFACKMQADLVAASFIRKAEDVSVVRKVLKENGGEDIRVISKIETQEGVDNIDKILELSDGIMVARGDMGVEIPIEDVPSIQKMIIRKCNDAGKIVITATQMLDSMIRNPRPTRAEASDVANAIYDGTDAIMLSGESASGLYPIEAAETMAKIAQKTESQIDYTKALN----------ERKGEIITKISDAISLAACSTAAELKAAAIITATQSGITARMVSKFRPTCPIIAVTPHDDVARRLALNFGI 416
>gi|147276|gb|AAA24392.1| pyruvate kinase I (EC 2.7.1.40) (462 aa)
Score = 641, Expect = 1.1e-64, Identities = 150/356 (42%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|81097400|ref|ZP_00875686.1| Pyruvate kinase [Streptococcus suis 89/1591] >gi|80976546|gb|EAP40143.1| Pyruvate kinase [Streptococcus suis 89/1591] (466 aa)
Score = 641, Expect = 1.1e-64, Identities = 155/426 (36%), Positives = 239/426 (56%)
  Q:    37 ETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDN 462
           E++ + +AAL   G NV RFNFSHGD++EQ  R+  VR   +  G  +  +LDTKGPEIR  +++   KE    +  K+R+  TK+ I ++++   L+  G  ++  DV+ G  I VDDGKL L V+  +        +  N  ++ + K +N+P +    P ++++D  DI F ++   ++IA SFV T  +V  ++ I KE G +H+Q+ +KIE   GI ++D+II+ +D IM+ARGD+G+EVP+  VP Y+K II      GK VI AT ML+++  K + TR+EV+DVF AV  GTD TMLSGE+ANG YP+ +V  MA I  +++    +YGR     F        K   +A+ +            H  D   +V         +++S  R  A I  VT  ++      LN+GV + +V N
  S:     1 ESSAQKIAALITEGANVFRFNFSHGDHQEQGDRMATVRRAEEIAGKKVGFLLDTKGPEIRTELFEDDAKEYAYTTGDKLRV-ATKQGIKSTKEVIALNVAGGLDVFDDVEVGKQILVDDGKLGLTVVEKDAVNREFVVLVENDGVIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFVRTAKDVEVVRNICKETGNDHVQLFAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPVESVRTMATIAKNAQTLLNEYGRLNSDQFNRA----SKTEVIASAVKDAC--------HSMDIKLVVTVTETGYSARSISKYRPDADILAVTFTEKVQKSLMLNWGV-IPIVTN 415
>gi|77975293|ref|ZP_00830829.1| COG0469: Pyruvate kinase [Yersinia frederiksenii ATCC 33641] (470 aa)
Score = 641, Expect = 1.1e-64, Identities = 151/356 (42%), Positives = 208/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +K+ L  L +AG+NV+R NFSHGDYEE   R+  +R V  E G+    +LDTKGPEIR  K    K+  + +       T +  IG +   +V     TY   A D++ GNT+ VDDG + +EV  + V E  +     N   L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGEHIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SKEMLTKLLNAGMNVMRLNFSHGDYEEHGQRIKNIRAVMAETGLKAGILLDTKGPEIRTMKLDGGKDAALVAGQTFTFTTDQSVIGNNTIVAV-----TYPGFAADLKIGNTVLVDDGLIGMEV--TEVTENTVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKADLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGEHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVTIMATI 331
>gi|69247355|ref|ZP_00604319.1| Pyruvate kinase [Enterococcus faecium DO] >gi|68194878|gb|EAN09350.1| Pyruvate kinase [Enterococcus faecium DO] (594 aa)
Score = 640, Expect = 1.3e-64, Identities = 175/458 (38%), Positives = 252/458 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKE------VEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI +TLGP+                      + + ++ L ++G NV RFNFSHGD+EEQ  R+ +VRE  K+ G ++  +LDTKG EIR  V  T+E +      ++ +   + RI    + +G+ EK +V     TY  +  DV  G  I  DDG + +++I  +     +    +N  +L   K +N P  + S+P ++ KD +DI F + N  D+IAASFV    +V +I++IL+E    H+QI  KIE+  GI ++D+II  SD +M+ARGD+G+E+P   VP  +K IIK C   G  VI ATQML+S++   +PTRAE +DV  AV  GTD TMLSGE+ANG YP+ AV  MA+ID  +EN   + G      F+   F K  V     TI   VA  R   N G    +IV         + +S  R  A I  VT  +       LN+GV+  V +
  S:     1 MKKTKIVSTLGPA--------------------SNSVEIISQLIESGANVFRFNFSHGDHEEQLSRMTMVREAVKKTGKDVGILLDTKGAEIRTTVQGTTEADFGRAGYIKFEVGDQTRISMDPEHVGSKEKIAV-----TYPGLFDDVHVGGHILFDDGLIDMQIIEKDEANRELVVEVKNAGMLGSRKGVNAPGVSISLPGITPKDADDIRFGLDNDIDFIAASFVRKAQDVLDIREILEEKDMTHVQIFPKIESQEGIDNIDEIIKVSDGVMIARGDMGVEIPAELVPMVQKRIIKKCNAAGIPVITATQMLESMQENPRPTRAEASDVANAVFDGTDATMLSGESANGDYPVEAVSTMARIDQEAENALSELGT-----FQLNEFDKTDV---TETIGLSVA--RAAKNLGV--KTIVAATESGYTAKMISKYRPDADILAVTFDERTKRGLMLNWGVYPTVAE 431
>gi|168029152|ref|XP_001767090.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162681586|gb|EDQ68011.1| predicted protein [Physcomitrella patens subsp. patens] (517 aa)
Score = 640, Expect = 1.3e-64, Identities = 154/390 (39%), Positives = 217/390 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV--YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           + KTKI  TLGP             K     ++E        L  AG+NV RFNFSHG +E     L+ +R+     G+  + +LDTKGPEIR   +KT  K +++    ++ I T    +G      +     +Y  +A+ V PG  I   DG +   V+  +V  G++     NT +L E K +NLP     +P ++ KD +DI+ + I NK D+IAASFV  G++V++I+ +L  H  + IQIISK+E   G+ + DDI+ E+D IMVARGDLG+E+P   +   +K +I  C   GK VI ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETANG YP  AV VM++I   +E   DY        K  P     + +LA++
  S:    18 VSKTKIVCTLGP-------------KSREVPILEK-------LLRAGMNVARFNFSHGTFEYHQYTLDNLRQAQLNTGIMCAVLLDTKGPEIRTGQHKTG-KPMKLIRGKEIWITTDYSHLGDEHMICM-----SYPKLAEHVSPGTEILCSDGTITFTVLECDVARGMVRCRCENTTMLGEKKNVNLPGVVVDLPTITTKDTDDIVQWGIPNKIDFIAASFVRKGEDVKKIRALLGSHA-KTIQIISKVENQEGLVNFDDILRETDGIMVARGDLGMEIPTEKIFLAQKMMIYKCNSAGKPVITATQMLESMIKYPRPTRAEATDVANAVLDGTDCVMLSGETANGSYPDLAVAVMSRICQEAEASLDYSAIFKEIMKSVPLPMSPLESLASS 384
>gi|156973150|ref|YP_001444057.1| pyruvate kinase [Vibrio harveyi ATCC BAA-1116] >gi|156524744|gb|ABU69830.1| hypothetical protein VIBHAR_00829 [Vibrio harveyi ATCC BAA-1116] (470 aa)
Score = 640, Expect = 1.5e-64, Identities = 149/356 (41%), Positives = 217/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K  +  +V++ +  +    T    +G  +K +V     TY   A D+  GNTI VDDG +++EV++++  E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+    +V+EI+++L  +GGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYAEHGTRIANFRQVMEATGKQLAILLDTKGPEIRTIKLDDGNDVDLVAGQEFTFTTDISVVGNKDKVAV-----TYAGFANDLNVGNTILVDDGLIEMEVLATSETE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVQEIREVLAANGGENIHIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMINNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVTIMAQI 331
>gi|86148100|ref|ZP_01066400.1| pyruvate kinase [Vibrio sp. MED222] >gi|85834087|gb|EAQ52245.1| pyruvate kinase [Vibrio sp. MED222] (470 aa)
Score = 639, Expect = 1.6e-64, Identities = 150/356 (42%), Positives = 215/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L DAG+NV+R NFSHGD+ E   R+   R+V +  G  ++ +LDTKGPEIR  K  +  +V++ +  +    T    +G  +  +V     TY   AKD+  GNTI VDDG +++EVI++   E  ++    N   L ENK +NLP  +  +P +S+KD+ D+ F  +   D++AASF+   D+V+EI+++L  +GGE+I IISKIE   G+ + D I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+ +  +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVDAGMNVMRLNFSHGDFAEHGTRIANFRKVMENNGEQLAILLDTKGPEIRTIKLEDGNDVDLVAGQEFTFTTDATVVGNKDVVAV-----TYLGFAKDLTAGNTILVDDGLIEMEVIATTETE--VKCKVLNNGALGENKGVNLPGVSVQLPALSEKDKADLKFGCEQGVDFVAASFIRKEDDVKEIRELLNANGGENIHIISKIENQEGVDNFDSILEASDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMISNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVTIMAQI 331
>gi|28378548|ref|NP_785440.1| pyruvate kinase [Lactobacillus plantarum WCFS1] >gi|28271384|emb|CAD64289.1| pyruvate kinase [Lactobacillus plantarum WCFS1] (586 aa)
Score = 639, Expect = 1.7e-64, Identities = 150/362 (41%), Positives = 211/362 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           +KKTKI +TLGP+                     T    +  L +AG N+ RFNFSHGD+EE   RLN V E  K  G  +  MLDTKG EIR    +  + E K   KVRI        T +K +V     TY N+  DV  G  +  DDG L +++   +     + T  +N  +L   K +N P  + ++P +++KD +DI F + ++ +YIAASFV    +V +I+++L+E   EH+QI  KIE+  GI + D+I+   D +MVARGD+G+E+P  +VP  +K +IK C   G  VI ATQMLDS++   +PTRAE +DV  AV  GTD TMLSGE+ANG+YP+ +V +MAKID  +EN
  S:     1 MKKTKIVSTLGPA--------------------STDTDTIVKLIEAGANIFRFNFSHGDHEEHLDRLNKVHEAEKITGKTVGIMLDTKGAEIRTTVQANGKSEYKIGDKVRITMDDSLDTTHDKIAV-----TYKNLYDDVHVGGHVLFDDGLLDMKIDEKDEANRELVTTVQNAGVLGSRKGVNAPGVSINLPGITEKDSSDIRFGLDHEINYIAASFVRKPQDVLDIRELLEEKHMEHVQIFPKIESQEGIDNADEILKVCDGLMVARGDMGVEIPAENVPLVQKSLIKKCNALGMPVITATQMLDSMQENPRPTRAEASDVANAVFDGTDATMLSGESANGLYPVESVAMMAKIDEKAEN 338
>gi|104773900|ref|YP_618880.1| pyruvate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513906|ref|YP_812812.1| pyruvate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|1346399|sp|P34038|KPYK_LACDE Pyruvate kinase (PK) >gi|1154865|emb|CAA50527.1| pyruvate kinase [Lactobacillus delbrueckii] >gi|103422981|emb|CAI97661.1| pyruvate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093221|gb|ABJ58374.1| pyruvate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (589 aa)
Score = 638, Expect = 2.0e-64, Identities = 146/365 (40%), Positives = 215/365 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD 368
           +KKTKI +TLGP+                   IET  K    L +AG NV RFNFSHG++EE   R+N+VREV K+ G  +   LDTKG EIR       +  I +  ++R+     + G  +   V     TY  +  D   G T+ +DDG + L + + + E+  +   A+NT ++   K +N P     +P +++KD +DI F +K+  ++I ASFV    +V +I+ + +E    +++I  KIE+  GI ++D+I+  SD +MVARGD+G+E+P+ +VP  +K +IK C   GK VI ATQMLDS++   +PTRAEVTDV  AV  GTD TMLSGE+ANG+YP+ +V+ M  IDV +E   D
  S:     1 MKKTKIVSTLGPA----------------SDDIETITK----LAEAGANVFRFNFSHGNHEEHLARMNMVREVEKKTGKLLGIALDTKGAEIRTTDQEGGKFTINTGDEIRVSMDATKAGNKDMIHV-----TYPGLFDDTHVGGTVLIDDGAVGLTIKAKDEEKRELVCEAQNTGVIGSKKGVNAPGVEIRLPGITEKDTDDIRFGLKHGINFIFASFVRKAQDVLDIRALCEEANASYVKIFPKIESQEGIDNIDEILQVSDGLMVARGDMGVEIPFINVPFVQKTLIKKCNALGKPVITATQMLDSMQENPRPTRAEVTDVANAVLDGTDATMLSGESANGLYPVQSVQAMHDIDVRTEKELD 341
>gi|153834223|ref|ZP_01986890.1| pyruvate kinase [Vibrio harveyi HY01] >gi|148869411|gb|EDL68417.1| pyruvate kinase [Vibrio harveyi HY01] (470 aa)
Score = 638, Expect = 2.0e-64, Identities = 150/356 (42%), Positives = 216/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T    +G  +K +V     TY   A D+  GNTI VDDG +++EV++++  E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+    +V+EI+++L  +GGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  AV  GTD  MLSGETA G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNAGMNVMRLNFSHGDYAEHGTRIANFRQVMEATGKQLAILLDTKGPEIRTIKLEGGNDVDLVAGQEFTFTTDISVVGNKDKVAV-----TYAGFANDLNVGNTILVDDGLIEMEVLATSETE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVQEIREVLAANGGENIHIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMINNPRPTRAEAGDVANAVMDGTDAVMLSGETAKGKYPVEAVTIMAQI 331
>gi|82777153|ref|YP_403502.1| pyruvate kinase [Shigella dysenteriae Sd197] >gi|81241301|gb|ABB62011.1| pyruvate kinase I, fructose stimulated [Shigella dysenteriae Sd197] (470 aa)
Score = 638, Expect = 2.3e-64, Identities = 150/356 (42%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|26247926|ref|NP_753966.1| pyruvate kinase [Escherichia coli CFT073] >gi|26108329|gb|AAN80531.1|AE016761_106 Pyruvate kinase I [Escherichia coli CFT073] (542 aa)
Score = 638, Expect = 2.3e-64, Identities = 142/321 (44%), Positives = 199/321 (61%)
  Q:    39 AKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:    88 SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQSFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 403
>gi|15802088|ref|NP_288110.1| pyruvate kinase [Escherichia coli O157:H7 EDL933] >gi|15831637|ref|NP_310410.1| pyruvate kinase [Escherichia coli O157:H7 str. Sakai] >gi|16129632|ref|NP_416191.1| pyruvate kinase I [Escherichia coli str. K-12 substr. MG1655] >gi|74311999|ref|YP_310418.1| pyruvate kinase [Shigella sonnei Ss046] >gi|82543954|ref|YP_407901.1| pyruvate kinase [Shigella boydii Sb227] >gi|89108516|ref|AP_002296.1| pyruvate kinase I [Escherichia coli W3110] >gi|157157921|ref|YP_001462970.1| pyruvate kinase [Escherichia coli E24377A] >gi|157161141|ref|YP_001458459.1| pyruvate kinase [Escherichia coli HS] >gi|168710504|ref|ZP_02742781.1| pyruvate kinase [Escherichia coli O157:H7 str. EC4045] >gi|168736173|ref|ZP_02768450.1| pyruvate kinase [Escherichia coli O157:H7 str. EC4115] >gi|168752363|ref|ZP_02777385.1| pyruvate kinase I [Escherichia coli O157:H7 str. EC4113] >gi|168778030|ref|ZP_02803037.1| pyruvate kinase I [Escherichia coli O157:H7 str. EC4196] >gi|168783950|ref|ZP_02808957.1| pyruvate kinase I [Escherichia coli O157:H7 str. EC4076] >gi|170019974|ref|YP_001724928.1| pyruvate kinase [Escherichia coli ATCC 8739] >gi|170081336|ref|YP_001730656.1| pyruvate kinase I [Escherichia coli str. K12 substr. DH10B] >gi|170683460|ref|YP_001743578.1| pyruvate kinase I [Escherichia coli SMS-3-5] >gi|187734242|ref|YP_001880437.1| pyruvate kinase I [Shigella boydii CDC 3083-94] >gi|188493716|ref|ZP_03000986.1| pyruvate kinase [Escherichia coli 53638] >gi|191173472|ref|ZP_03035000.1| pyruvate kinase I [Escherichia coli F11] >gi|194440078|ref|ZP_03072133.1| pyruvate kinase I [Escherichia coli 101-1] >gi|83286931|sp|P0AD61|KPYK1_ECOLI Pyruvate kinase I (PK-1) >gi|83286930|sp|P0AD62|KPYK1_ECO57 Pyruvate kinase I (PK-1) >gi|12515675|gb|AAG56663.1|AE005390_10 pyruvate kinase I (formerly F), fructose stimulated [Escherichia coli O157:H7 EDL933] >gi|1549287|gb|AAB47952.1| pyruvate kinase [Escherichia coli] >gi|1787965|gb|AAC74746.1| pyruvate kinase I [Escherichia coli str. K-12 substr. MG1655] >gi|13361850|dbj|BAB35806.1| pyruvate kinase I [Escherichia coli O157:H7 str. Sakai] >gi|61676795|gb|AAX51880.1| pyruvate kinase I [Escherichia coli] >gi|73855476|gb|AAZ88183.1| pyruvate kinase I [Shigella sonnei Ss046] >gi|81245365|gb|ABB66073.1| pyruvate kinase I [Shigella boydii Sb227] >gi|85675072|dbj|BAA15445.2| pyruvate kinase I [Escherichia coli W3110] >gi|157066821|gb|ABV06076.1| pyruvate kinase I [Escherichia coli HS] >gi|157079951|gb|ABV19659.1| pyruvate kinase I [Escherichia coli E24377A] >gi|169754902|gb|ACA77601.1| pyruvate kinase [Escherichia coli ATCC 8739] >gi|169889171|gb|ACB02878.1| pyruvate kinase I [Escherichia coli str. K12 substr. DH10B] >gi|170521178|gb|ACB19356.1| pyruvate kinase I [Escherichia coli SMS-3-5] >gi|187431234|gb|ACD10508.1| pyruvate kinase I [Shigella boydii CDC 3083-94] >gi|187766874|gb|EDU30718.1| pyruvate kinase I [Escherichia coli O157:H7 str. EC4196] >gi|188013782|gb|EDU51904.1| pyruvate kinase I [Escherichia coli O157:H7 str. EC4113] >gi|188488915|gb|EDU64018.1| pyruvate kinase [Escherichia coli 53638] >gi|188998802|gb|EDU67788.1| pyruvate kinase I [Escherichia coli O157:H7 str. EC4076] >gi|190906314|gb|EDV65925.1| pyruvate kinase I [Escherichia coli F11] >gi|194421000|gb|EDX37032.1| pyruvate kinase I [Escherichia coli 101-1] (470 aa)
Score = 638, Expect = 2.3e-64, Identities = 150/356 (42%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|168064424|ref|XP_001784162.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162664296|gb|EDQ51021.1| predicted protein [Physcomitrella patens subsp. patens] (520 aa)
Score = 638, Expect = 2.5e-64, Identities = 151/390 (38%), Positives = 217/390 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           I KTKI  TLGP             K     V+E        L  AG+NV RFNFSHG +E     L+ +R+         + +LDTKGPEIR    +  K +++K ++++ I T    +G     ++        +A D++PGNTI   DG + + V+  + E+G+++    NT +L E K +NLP     +P ++ KD +DI+ + + NK D+IAASFV  G +V  IKK+L E   + I +ISK+E   G+ + DDI+ E+D +MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTD  MLSGETANG YP  AV VM++I   +E   DY        K  P     + +LA++
  S:    24 ISKTKIVCTLGP-------------KSREVHVLEK-------LLRAGMNVARFNFSHGTHEYHQYTLDSLRQAMANTQTMCAVLLDTKGPEIRTGSLAAGKPIQLKRNNEIWITTDYSHLGDENMIAM----SYAKLAVDLEPGNTILCSDGTITMTVLDCHPEKGMVKARCENTAMLGEKKNVNLPGIVVDLPTITQKDIDDIMQWGVPNKIDFIAASFVRKGSDVVTIKKLLGE-ASDSIHVISKVENQEGLVNFDDILKETDGVMVARGDLGMEIPTEKIFLAQKMMIYKCNSAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDAVMLSGETANGSYPELAVAVMSQICQEAEAALDYASIFKEIMKSVPLPMSPLESLASS 390
>gi|170017065|ref|YP_001727984.1| pyruvate kinase [Leuconostoc citreum KM20] >gi|169803922|gb|ACA82540.1| Pyruvate kinase [Leuconostoc citreum KM20] (473 aa)
Score = 638, Expect = 2.5e-64, Identities = 177/458 (38%), Positives = 247/458 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE-NFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI +TLGPS +                 +ET  K    L +AG NV RFNFSHGD+EE   R+N V E  K  G  +  +LDTKG EIR  K  + ++E  +   +RI       GT EK +V     TY  +  DV     +  DDG L   V+  +     +     N  IL   K +N P  + ++P +++KD +DI F + ++ +YIAASFV   ++V EI+++LKE   EH+QII KIE+  GI +LD I++ SD++MV RGD+G+E+P  +VP  +K +I+     G  VI ATQMLDS+E   +PTRAE +DV  AV  GTD TMLSGE+ANG YP+ +V  MA ID  +E +  + GR  ++ F E+    E V +  T IA  V  K           ++VV  N     + +S  R    +  VT  +       LNYGV   V D
  S:     1 MKKTKIVSTLGPSSSD----------------VETIVK----LIEAGANVFRFNFSHGDHEEHLGRMNAVHEAEKITGKTVGILLDTKGAEIRTTKQVDGKIEFHTGDTLRISMDDNIEGTKEKIAV-----TYAGLFDDVNVNGQVLFDDGLLGTTVLEKDDANRELVVRIDNDGILGSRKGVNAPGVSINLPGITEKDADDIRFGLDHEINYIAASFVRKPEDVLEIRELLKEKNMEHVQIIPKIESQEGIDNLDAILEVSDALMVPRGDMGVEIPAENVPLVQKDMIRKMNKIGLPVITATQMLDSMEENPRPTRAEASDVANAVFDGTDATMLSGESANGDYPVESVATMAAIDEKAETSLRENGRHEEIVFDESD-STEAVASAVTRIARSVNAK-----------AVVVSTNSGYTARMVSKHRPDVNVLAVTYSERVQRGLTLNYGVLPVVYD 423
>gi|167629682|ref|YP_001680181.1| pyruvate kinase [Heliobacterium modesticaldum Ice1] >gi|167592422|gb|ABZ84170.1| pyruvate kinase [Heliobacterium modesticaldum Ice1] (578 aa)
Score = 637, Expect = 2.5e-64, Identities = 168/452 (37%), Positives = 247/452 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +++TKI  T+GP+                          L  +  +G+NV R NFSHG +EE   R+  +R +A E G N++ +LDTKGPEIR    +   + +++  +  + TT   +G + + SV     TY ++ KDV PG  I VDDG ++LEV +    + I   +  N   +   K +N+P  + ++P +++KD  DI F I+ K D+IAASFV    +V  I+KIL+E GG  I+IISKIE+   + +LD+II  SD IMVARGDLG+E+P  +VP  +K II +C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGETANG YP+ AV+ M +I   +E+     R   V+  +T  + + +G      AT +    +I      Y++           + ++  R  API  VT + E   R  L +GV
  S:     1 MRRTKIVCTIGPA--------------------SEHPDTLREIIRSGMNVARLNFSHGSHEEHGRRIENIRRIAAELGANVAILLDTKGPEIRTGDFAAPPIFLEAGQRFTL-TTDPILGDASRVSV-----TYADLPKDVSPGVRILVDDGLIELEVEAVEGNDVICRVL--NGGKVSNKKGVNVPGISINLPSVTEKDIADIRFGIEQKVDFIAASFVRKAADVLAIRKILEE-GGADIEIISKIESSEAVDNLDEIIQASDGIMVARGDLGVEIPAEEVPILQKSIIAECNRLGKPVITATQMLDSMMNNPRPTRAEASDVANAIFDGTDAIMLSGETANGKYPVVAVQTMDRIARRAESSLQ--RNQPVHNGKTS-VTDAIGQAVCVTATQLGAAAIITATASGYTA-----------RMIARYRPQAPIVAVTPRPEVLRRLALLWGV 410
>gi|117621509|ref|YP_857554.1| pyruvate kinase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117562916|gb|ABK39864.1| pyruvate kinase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (482 aa)
Score = 637, Expect = 2.6e-64, Identities = 175/460 (38%), Positives = 242/460 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +KKTKI  T+GP                       +K+ LA + DAG+NV+R NFSHGDY E   R++ +R V  E G + + +LDTKGPEIR  K     +V + +       T +  +G  +K +V     TY   A D++ GN I VDDG + L+VI     E I + +  N   L ENK INLP  +  +P +++KD+ D+IF  +   D++AASF+   ++V EI++ LK HGGE+IQIISKIE   G+ + D+I+  SD IMVARGD+G+E+P  +V   +K II+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I              D               L  T A  V    V  +   D   IVV     +  +A+      A I  +T  K+ A +  L  GV   VVD++
  S:    13 MKKTKIVCTIGPKTE--------------------SKEMLAKMLDAGMNVMRLNFSHGDYAEHGGRISNLRAVMAETGKHAAILLDTKGPEIRTIKLEGGNDVALVAGQTFTFTTDQTVVGNKDKVAV-----TYAGFANDLRVGNRILVDDGLIGLDVIEITEREVICKVL--NNGDLGENKGINLPGVSIKLPALAEKDKRDLIFGCEQGVDFVAASFIRKKEDVLEIREHLKAHGGENIQIISKIENQEGLDNFDEILAVSDGIMVARGDMGVEIPVEEVIFAQKMIIEKCNKARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATI----------CERTDAVMPSNLSAANDSNKLRITEA--VCKGAVETSEKLDAPLIVVATEGGKSAKAIRKYFPKAWILAITTNKKTAAQLVLTKGVVAHVVDSI 435
>gi|91210889|ref|YP_540875.1| pyruvate kinase [Escherichia coli UTI89] >gi|110641797|ref|YP_669527.1| pyruvate kinase [Escherichia coli 536] >gi|117623856|ref|YP_852769.1| pyruvate kinase [Escherichia coli APEC O1] >gi|91072463|gb|ABE07344.1| pyruvate kinase I [Escherichia coli UTI89] >gi|110343389|gb|ABG69626.1| pyruvate kinase I [Escherichia coli 536] >gi|115512980|gb|ABJ01055.1| pyruvate kinase I [Escherichia coli APEC O1] (542 aa)
Score = 637, Expect = 2.6e-64, Identities = 142/321 (44%), Positives = 199/321 (61%)
  Q:    39 AKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:    88 SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 403
>gi|192809827|ref|ZP_03038501.1| pyruvate kinase [Geobacillus sp. Y412MC10] >gi|192801256|gb|EDV77762.1| pyruvate kinase [Geobacillus sp. Y412MC10] (471 aa)
Score = 637, Expect = 2.9e-64, Identities = 163/450 (36%), Positives = 245/450 (54%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           KTKI  T+GP+                   IE  K     +   G+ V R N +HG+ E+   R+  VR+ A E    +  M+D KGPE+R+ K  E    +K   ++ I TT++ +G +++ SV  +    N+   V+PG+ I +DDG + L VI  +  + + + ++    +L+  K +NLP    ++P ++++D   I F ++N  + IAASFV  GDN+REI+ ILKE G EH+QIISKIE   G+++LDDII+ SD IMVARGDLG+EVP  +VP  +K +I  C   GK VIVAT ML+S++   +PTR+EV+DV  AV +G D  MLSGE+A G YP+ +V  MA +   +E   DY       FK     +++V  +   I+       ++ N      +I+         + +S  R  API  VT  +E   +  L  GV
  S:     3 KTKIICTMGPACDS----------------IELLKN----MIQEGMTVARLNMAHGEPEDHVARIRNVRQAASELNTYVPIMMDIKGPEVRIGKLKEASCLLKPGEEL-ILTTEEILGDAQRISV--NYAELNLV--VKPGDRILIDDGLVDLNVIRVDGPDILCKIVSGG--VLKPRKGVNLPGIKTTLPGVTERDVMHIGFGLENNIEIIAASFVRHGDNIREIRSILKERGAEHVQIISKIENGEGMENLDDIIEASDGIMVARGDLGVEVPIEEVPMMQKEMIDKCNLAGKPVIVATHMLESMQVNPRPTRSEVSDVANAVIQGADVVMLSGESAAGKYPVESVRTMAAVARRAETMIDYKDQF--AFKS----RQQVADITEVISQGAVSSSLVLNA----KAIITSTESGFTARMISKYRPEAPIIAVTQHEEVLAKICLLSGV 415
>gi|25005270|emb|CAD56497.1| pyruvate kinase [Lactobacillus delbrueckii subsp. lactis] (589 aa)
Score = 637, Expect = 2.9e-64, Identities = 146/365 (40%), Positives = 215/365 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD 368
           +KKTKI +TLGP+                   IET  K    L +AG NV RFNFSHGD+EE   R+N+VREV K+ G  +   LDTKG EIR       +  I +  ++R+     + G  +   V     TY  +  D   G T+ +DDG + L + + + E+  +   A+NT ++   K +N P     +P +++KD +DI F +K+  ++I ASFV    +V +I+ + +E    +++I  KIE+  GI ++D+I+  SD +MVARGD+G+E+P+ +VP  +K +IK C   GK VI ATQMLDS++   +PTRAEVTDV  AV  GTD TMLSGE+ANG+YP+ +V+ M  I+V +E   D
  S:     1 MKKTKIVSTLGPASND----------------IETITK----LAEAGANVFRFNFSHGDHEEHLARMNMVREVEKKTGKLLGIALDTKGAEIRTTDQEGGKFTINTGDEIRVSMDATKAGNKDMIHV-----TYPGLFDDTHVGGTVLIDDGAVGLTIKAKDEEKRELICEAQNTGVIGSKKGVNAPGVEIRLPGITEKDTDDIRFGLKHGINFIFASFVRKAQDVLDIRALCEEANAPYVKIFPKIESQEGIDNIDEILQVSDGLMVARGDMGVEIPFINVPFVQKTLIKKCNALGKPVITATQMLDSMQENPRPTRAEVTDVANAVLDGTDATMLSGESANGLYPVESVQAMHDINVRTEKEMD 341
>gi|194430706|ref|ZP_03063136.1| pyruvate kinase I [Escherichia coli B171] >gi|194411249|gb|EDX27641.1| pyruvate kinase I [Escherichia coli B171] (470 aa)
Score = 637, Expect = 3.1e-64, Identities = 150/356 (42%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|67601724|ref|XP_666420.1| pyruvate kinase [Cryptosporidium hominis TU502] >gi|54657406|gb|EAL36184.1| pyruvate kinase [Cryptosporidium hominis] (526 aa)
Score = 637, Expect = 3.2e-64, Identities = 172/462 (37%), Positives = 246/462 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGG------EHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYG---RAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHA 466
           +KT+I  T+GPS                        ++L  L D G++V R NFSHGD+E     L  +RE AK +    +  MLDTKGPEIR       K +E+K+   ++I T    +G SE  S   S     + K VQ G+T+ + DG L  +V+   + +  I     N+  + E K +NLP     +P + DKDR+DI+ FA+K+  D+IA SFV  G +V+  ++I+ E+          I+IISKIE + G+ + D I  ESD IMVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE+TDV  AV  G+DC MLSGETANG +P +AV VM+++   +E   DY     AI     +   + E +   A   A  V  K +I        +I   GN  RLI   S  R +  I   T K E A    +  GV   V++++ H+
  S:    44 RKTQIICTIGPSCNNV--------------------ESLIGLIDKGMSVARLNFSHGDHESHFKTLQNIREAAKARPHSTVGIMLDTKGPEIRTGMLEGGKPIELKAGQTLKITTDYSMLGNSECISCSYSL----LPKSVQIGSTVLIADGSLSTQVLE--IGDDFIVCKVLNSVTIGERKNMNLPGCKVHLPIIGDKDRHDIVDFALKHNLDFIALSFVQNGADVQLCRQIISENTQYSNGIPSSIKIISKIENLEGVINFDSICSESDGIMVARGDLGMEIPPEKIFVAQKCMISKCNVAGKPVVTATQMLESMIKSNRPTRAEMTDVANAVLDGSDCVMLSGETANGAFPFDAVNVMSRVCAQAETCIDYPVLYHAIHSSVPKPVAVPEAIACSAVESAHDVNAKLII--------TITETGNTARLI---SKYRPSQTIIACTAKPEVARGLKIARGVKTYVLNSIHHS 480
>gi|30063190|ref|NP_837361.1| pyruvate kinase [Shigella flexneri 2a str. 2457T] >gi|56479951|ref|NP_707575.2| pyruvate kinase [Shigella flexneri 2a str. 301] >gi|30041442|gb|AAP17170.1| pyruvate kinase I [Shigella flexneri 2a str. 2457T] >gi|56383502|gb|AAN43282.2| pyruvate kinase I [Shigella flexneri 2a str. 301] (470 aa)
Score = 637, Expect = 3.3e-64, Identities = 150/356 (42%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEKGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|163816070|ref|ZP_02207440.1| hypothetical protein COPEUT_02250 [Coprococcus eutactus ATCC 27759] >gi|158448880|gb|EDP25875.1| hypothetical protein COPEUT_02250 [Coprococcus eutactus ATCC 27759] (581 aa)
Score = 636, Expect = 3.4e-64, Identities = 154/368 (41%), Positives = 220/368 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGR 371
           ++KTKI  TLGP+         D ++   K ++E            G++V RFNFSHGD+ +     + + ++  E G+ ++T+LDTKGPEIRV    E +VE+  + +    TT   +G   K S+     TY N+  DV+PG+ I +DDG + +++      E  I     N   +  +K +N+P  N ++P++SD DR DIIF IKN FD+IAASFV + D++ EI+KIL E+  ++I II+KIE M G+ ++D+II  SD IMVARGD+G+E+P  DVP  +K IIK   +  K VI ATQMLDS+    +PTRAE TDV  A+  GT   MLSGETA G YP+ A+  M  I   +E   DY +
  S:     3 LRKTKIICTLGPA--------TDDDEVLRKLMLE------------GMDVARFNFSHGDHAQHRKNKDRIEKLRDELGLPVATLLDTKGPEIRVGDFKEGKVEL-VEGQTFTLTTDDVLGDQAKVSI-----TYKNLVNDVKPGDIILIDDGLINMKIEKVTGTE--IVCRVENGGPVSNHKGVNVPRVNLTMPYISDVDREDIIFGIKNDFDFIAASFVRSADDILEIRKILDEYECDNINIIAKIENMQGVDNIDEIIRVSDGIMVARGDMGVEIPLEDVPIIQKMIIKKVYNADKQVITATQMLDSMMIHPRPTRAEATDVANAIYDGTSAIMLSGETAAGKYPVEALHTMKTIAERAEMDIDYNK 343
>gi|194682751|emb|CAR42967.1| pyruvate kinase [Proteus mirabilis HI4320] (470 aa)
Score = 636, Expect = 3.6e-64, Identities = 170/460 (36%), Positives = 246/460 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIA-TLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +KKTKI  T+GP                       +++ L  L DAG+NV+R NFSHGDYEE   R+  +R V  + G   + +LDTKGPEIR  K     +V + +       T    +G  ++ +V     TY+  A+D+  GNT+ VDDG + ++VI     E + E +  N   L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V E++  LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I   ++      R           + E V   A  +A  L AP  V+  +G         G   R I+        API  +T+ +E A +  L  GV  ++V+ +
  S:     1 MKKTKIVCTIGPKTE--------------------SEEKLTQLLDAGMNVMRLNFSHGDYEEHGNRIKNLRNVCAKTGKKAAILLDTKGPEIRTIKLEGGNDVSLVAGQTFTFTTDTSVVGNKDRVAV-----TYDGFARDLTVGNTVLVDDGLIGMKVIKVTDTEVVCEVL--NNGDLGENKGVNLPGVSIGLPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVEEMRAHLKAHGGENIMIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNAARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPVEAVTIMATICDRTDRIMK-SRLESYQLGAKLRVTEAVCRGAVEMAEKLDAPLIVVATYG---------GKSARSIRKYFP---TAPILALTNNEETARQLLLVKGVTTQLVNKI 423
>gi|154502729|ref|ZP_02039789.1| hypothetical protein RUMGNA_00543 [Ruminococcus gnavus ATCC 29149] >gi|153796612|gb|EDN79032.1| hypothetical protein RUMGNA_00543 [Ruminococcus gnavus ATCC 29149] (478 aa)
Score = 636, Expect = 3.7e-64, Identities = 164/452 (36%), Positives = 247/452 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGT-LATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +KKTK+  T+GP+   K                E  +K    L   G++V RFNFSHGD+EEQ  R++L++E+ +E+  + + +LDTKGPEIR     + +     +    + T +  +G   K S+        +A+DVQ G  I +DDG + L+V    V++ I+  I  N   L E K +N+P+    +P +++KD+ DI F ++   D+IAASFV   + V EI+  LKE    +I II+KIE   GI+++D+II  +D IMVARGD+G+E+P  +VP  +K +I+ C +  KTVI ATQMLDS+    +PTRAEVTDV  AV  GTD  MLSGETA G YP+ A+++M  I  ++E   DY   +D           K G  L   I++ +    V+        +I+         + +SN++   PI  VT  +    R  + +GV
  S:     1 MKKTKVVCTMGPNTNDK----------------EVMRK----LIQNGMDVARFNFSHGDHEEQKFRMDLLKELREEEHAHTAILLDTKGPEIRTGLLKDGKKVTLQEGNTFVLTMEDIVGDDTKVSL----SYKGLAEDVQQGTVILIDDGLIGLKV-KEIVDQDIVCEIV-NGGELGERKGVNVPNVPVRLPAITEKDKEDIKFGVEQDIDFIAASFVRNAECVLEIRAFLKELDAPYIPIIAKIENAEGIRNIDEIIRAADGIMVARGDMGVEIPAEEVPYLQKMLIQKCNNNFKTVITATQMLDSMIRNPRPTRAEVTDVANAVYDGTDAVMLSGETAQGKYPVEALQMMVHIIENTEQHLDYDMILD-----------KAGDHLKRGISSAIGYSSVLAAANLKAKAIITPTVSGATARVMSNLKPIQPIIGVTPSERALRRMSIYWGV 416
>gi|16122616|ref|NP_405929.1| pyruvate kinase [Yersinia pestis CO92] >gi|22125836|ref|NP_669259.1| pyruvate kinase [Yersinia pestis KIM] >gi|45441972|ref|NP_993511.1| pyruvate kinase [Yersinia pestis biovar Microtus str. 91001] >gi|51596630|ref|YP_070821.1| pyruvate kinase [Yersinia pseudotuberculosis IP 32953] >gi|108807733|ref|YP_651649.1| pyruvate kinase [Yersinia pestis Antiqua] >gi|108812009|ref|YP_647776.1| pyruvate kinase [Yersinia pestis Nepal516] >gi|145598057|ref|YP_001162133.1| pyruvate kinase [Yersinia pestis Pestoides F] >gi|149365696|ref|ZP_01887731.1| pyruvate kinase I [Yersinia pestis CA88-4125] >gi|153948891|ref|YP_001400724.1| pyruvate kinase [Yersinia pseudotuberculosis IP 31758] >gi|162421904|ref|YP_001606991.1| pyruvate kinase [Yersinia pestis Angola] >gi|165926472|ref|ZP_02222304.1| pyruvate kinase I [Yersinia pestis biovar Orientalis str. F1991016] >gi|165938604|ref|ZP_02227160.1| pyruvate kinase I [Yersinia pestis biovar Orientalis str. IP275] >gi|166010773|ref|ZP_02231671.1| pyruvate kinase I [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211216|ref|ZP_02237251.1| pyruvate kinase I [Yersinia pestis biovar Antiqua str. B42003004] >gi|167400887|ref|ZP_02306393.1| pyruvate kinase I [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422137|ref|ZP_02313890.1| pyruvate kinase I [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167424887|ref|ZP_02316640.1| pyruvate kinase I [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170024094|ref|YP_001720599.1| pyruvate kinase [Yersinia pseudotuberculosis YPIII] >gi|186895686|ref|YP_001872798.1| pyruvate kinase [Yersinia pseudotuberculosis PB1/+] >gi|21958766|gb|AAM85510.1|AE013797_5 pyruvate kinase I [Yersinia pestis KIM] >gi|45436835|gb|AAS62388.1| pyruvate kinase I [Yersinia pestis biovar Microtus str. 91001] >gi|51589912|emb|CAH21544.1| pyruvate kinase I [Yersinia pseudotuberculosis IP 32953] >gi|108775657|gb|ABG18176.1| pyruvate kinase [Yersinia pestis Nepal516] >gi|108779646|gb|ABG13704.1| pyruvate kinase [Yersinia pestis Antiqua] >gi|115348095|emb|CAL21021.1| pyruvate kinase I [Yersinia pestis CO92] >gi|145209753|gb|ABP39160.1| pyruvate kinase [Yersinia pestis Pestoides F] >gi|149292109|gb|EDM42183.1| pyruvate kinase I [Yersinia pestis CA88-4125] >gi|152960386|gb|ABS47847.1| pyruvate kinase I [Yersinia pseudotuberculosis IP 31758] >gi|162354719|gb|ABX88667.1| pyruvate kinase I [Yersinia pestis Angola] >gi|165913478|gb|EDR32099.1| pyruvate kinase I [Yersinia pestis biovar Orientalis str. IP275] >gi|165921693|gb|EDR38890.1| pyruvate kinase I [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990475|gb|EDR42776.1| pyruvate kinase I [Yersinia pestis biovar Antiqua str. E1979001] >gi|166208396|gb|EDR52876.1| pyruvate kinase I [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958949|gb|EDR55970.1| pyruvate kinase I [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049740|gb|EDR61148.1| pyruvate kinase I [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167056074|gb|EDR65852.1| pyruvate kinase I [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169750628|gb|ACA68146.1| pyruvate kinase [Yersinia pseudotuberculosis YPIII] >gi|186698712|gb|ACC89341.1| pyruvate kinase [Yersinia pseudotuberculosis PB1/+] (470 aa)
Score = 636, Expect = 3.9e-64, Identities = 146/356 (41%), Positives = 207/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L +AG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K    +       +   +TT + +  ++K   +   G    A D++ GNT+ VDDG + +EVI   V E  +     N+  L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGEHIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTNLLNAGMNVMRLNFSHGDYAEHGQRIKNLRAVMAKTGKKAAILLDTKGPEIRTMKLEGGKDAALVAGQTFTFTTDQSVVGNDKIVAVTYPG---FAADLKIGNTVLVDDGLIGMEVIE--VTEHTVVCKVLNSGDLGENKGVNLPGVSIQLPALAEKDKGDLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGEHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVTIMATI 331
>gi|70991575|ref|XP_750636.1| pyruvate kinase [Aspergillus fumigatus Af293] >gi|66848269|gb|EAL88598.1| pyruvate kinase [Aspergillus fumigatus Af293] >gi|159124196|gb|EDP49314.1| pyruvate kinase [Aspergillus fumigatus A1163] (527 aa)
Score = 636, Expect = 3.9e-64, Identities = 165/452 (36%), Positives = 247/452 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           K  ++T I  T+GP                       + + + AL  AG+NVVR NFSHG YE     ++  RE  + + G  ++  LDTKGPEIR   T  +K++ I++  ++ I T +K    + +K   LD     N+ K +QPG  I+VDDG L  EV+   V++  +     N   +   K +NLP ++  +P +S+KD ND+ F +KN+ D I ASF+  G ++R I+++L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV++M++  + +E    + +  D      P   + V ++A  +A + A   +      +  +IVV     +  + LS  R   PI  VT +   A R+   Y
  S:    30 KNFRRTSIICTIGPKTN--------------------SVEKINALRKAGLNVVRMNFSHGSYEYHQSVIDNAREAERVQPGRPVAIALDTKGPEIRTGNTVGDKDIPIQAGHELNITTDEKYATASDDKNMYLDYK---NITKVIQPGKLIYVDDGILSFEVLEI-VDDQTLRVRCLNNGNISSRKGVNLPGTDVDLPALSEKDINDLKFGVKNRVDMIFASFIRRGSDIRHIREVLGEEGKE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFLAQKMMIAKCNMKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPTEAVKMMSETCLLAEVAIPHFQVFDELRNLAPRPTDTVESIA--MAAVSASLEL------NAGAIVVLTTSGKTARLLSKYRPVCPIIMVT-RNPMAARYSHLY 450
>gi|37678684|ref|NP_933293.1| pyruvate kinase [Vibrio vulnificus YJ016] >gi|37197424|dbj|BAC93264.1| pyruvate kinase [Vibrio vulnificus YJ016] (495 aa)
Score = 635, Expect = 4.6e-64, Identities = 173/465 (37%), Positives = 258/465 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF--DYGRAIDVYFKETPFMK--EKVGTLAT-TIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIA 468
           +KKTKI  T+GP                     E+ +K L  L ++G+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T    +G  +  +V     TY   A D+  GNTI VDDG +++EVI++   E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+    +V+EI+++L  +GG +IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV +MA+I   +++    + G  +D     +P ++  E V   A  T   L AP  ++   G         G   R ++        A I  +T  K+ A +  L  GV   VVD++++  A
  S:    26 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNSGMNVMRLNFSHGDYVEHGTRIANFRQVMENTGKQLAILLDTKGPEIRTIKLENGDDVDLVAGQEFTFTTDTSVVGNKDIVAV-----TYPGFAADLSAGNTILVDDGLIEMEVIATTATE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVKEIREVLAANGGANIQIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVTIMAQIANRTDSVLKAELGSRLD-----SPRLRITEAVCKGAVDTAEKLAAPLIIVATEG---------GKSARSVRKYFP---TANILALTTNKKTAAQLVLTKGVTPVVVDSIDNTDA 453
>gi|118586871|ref|ZP_01544305.1| pyruvate kinase [Oenococcus oeni ATCC BAA-1163] >gi|118432703|gb|EAV39435.1| pyruvate kinase [Oenococcus oeni ATCC BAA-1163] (477 aa)
Score = 635, Expect = 5.2e-64, Identities = 174/461 (37%), Positives = 251/461 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGE-HIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN-FFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +KKTKI +TLGP+                        K ++AL + G+NV RFNFSHGD++E   R+ LV +  K+ G  I  MLDTKG EIR  V  T   ++E K   ++RI   +K  GT EK +V    G Y+   DV+ G  +  DDG +++ VIS + E+  +     N  +L   K +N P    ++P ++ KD++DI F ++   D+IAASFV    +V +I+K+LK+H  E H+ I  KIE+  GI + + II  SD +MV RGD+G+E+PY +VP  +K +I+     GK VI ATQMLDS+    + TRAE+ DV  AV  GTD TMLSGE+ANG +P+ AV+ M+  D  +EN   D G  ID+  +      E +   A   A     K ++ +    Y++        RLI   S  R   PI  +T  ++ A    +NY V+  V D  E
  S:     1 MKKTKIVSTLGPA--------------------SNDLKIISALINNGINVARFNFSHGDHDEHAARMALVHDAEKKTGKLIGFMLDTKGAEIRTTVQDTPNGKIEFKKGDRLRISMNEKIKGTKEKIAV-TYKGLYD---DVKVGGKVLFDDGIIEMTVISKDSEKKELLVQVDNDGVLGGRKGVNAPGVAINLPGITKKDKSDIEFGLEQGIDFIAASFVRKAQDVLDIRKLLKKHHQENHVMIFPKIESQEGIDNFESIIAVSDGLMVPRGDMGVEIPYEEVPVIQKMMIRYMNRLGKPVITATQMLDSMIENPRATRAEINDVENAVWDGTDATMLSGESANGSWPVEAVKTMSTSDEYAENHVHDDGNRIDLRNEPKSSDTEVLAQAAVDAAREAGAKAIVASTASGYTA--------RLI---SKYRPDMPILAITYDEQVARSLTVNYAVYPVVKDAPE 430
>gi|167758311|ref|ZP_02430438.1| hypothetical protein CLOSCI_00650 [Clostridium scindens ATCC 35704] >gi|167664208|gb|EDS08338.1| hypothetical protein CLOSCI_00650 [Clostridium scindens ATCC 35704] (478 aa)
Score = 635, Expect = 5.2e-64, Identities = 151/366 (41%), Positives = 225/366 (61%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           +KKTKI  T+GP+               + G++        AL   G+++ RFNFSHGD+EEQ  R+++++++ +E+   ++ +LDTKGPEIR     + K++ +++ +   + +T+  +G   K S+     TY  + +DVQ G+TI VDDG + L+V     +E +   I  N   L E K +N+P+    +P ++DKDR DI F ++ + D+IAASFV   + + EIK  L+E G  +I II+KIE   GIK++D+II  +D IMVARGDLG+E+P  +VP  +K +I+ C    K VI ATQMLDS+    +PTRAEVTDV  AV  GTD  MLSGETA G YP+ A+++M  I  ++E   DY
  S:     1 MKKTKIICTMGPNTN-------------DAGLMR-------ALVQNGMDIARFNFSHGDHEEQKDRMDMLKKIREEENKPVAILLDTKGPEIRTGILKDGKKINLQAGNLFTL-STEDIVGDESKVSI-----TYAGLVEDVQVGSTILVDDGLIGLKVKEKKAKEIVCTVI--NGGELGERKGVNVPNVPVRLPAITDKDREDIRFGVEQEIDFIAASFVRNAECILEIKAFLRECGAPYIPIIAKIENAEGIKNIDEIIRCADGIMVARGDLGVEIPAEEVPYLQKMMIQKCNDNYKPVITATQMLDSMIRNPRPTRAEVTDVANAVYDGTDAVMLSGETAQGKYPVEALQMMVHIVENTEEHLDY 340
>gi|145299331|ref|YP_001142172.1| pyruvate kinase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852103|gb|ABO90424.1| pyruvate kinase I [Aeromonas salmonicida subsp. salmonicida A449] (472 aa)
Score = 635, Expect = 5.2e-64, Identities = 177/460 (38%), Positives = 249/460 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKE--IGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI----------DVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +KKTKI  T+GP                       +K+ LA + DAG+NV+R NFSHGDY E   R+N +R V  E G + + +LDTKGPEIR  K     +V + +        T  +  IG  +K +V     TY   A D++ GN I VDDG + L+VI     E I + +  N+  L ENK INLP  +  +P +++KD+ D+IF  +   D++AASF+   ++V EI++ L+ HGGE+IQIISKIE   G+ + D+I+  SD IMVARGD+G+E+P  +V   +K II  C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I          ++S+ N  +  R  +   K      EK+G          AP  V+   G             +  +A+      A I  +T  K+ A +  L  GV   VVD++
  S:     1 MKKTKIVCTIGPKTE--------------------SKEMLAKMLDAGMNVMRLNFSHGDYAEHGGRINNLRAVMAETGKHAAILLDTKGPEIRTIKLEGGNDVALVAGQTFTFTFTTDQTVIGNKDKVAV-----TYAGFANDLRVGNRILVDDGLIGLDVIEITEREVICKVL--NSGDLGENKGINLPGVSIKLPALAEKDKRDLIFGCEQGVDFVAASFIRKKEDVLEIREHLRAHGGENIQIISKIENQEGLDNFDEILAVSDGIMVARGDMGVEIPVEEVIFAQKMIITKCNKARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATICERTDAVMPSNLSAANDSNKLRITEAVCKGAVETSEKLG----------APLIVVATEG------------GKSAKAIRKYFPQAWILAITTNKKTAAQLVLTKGVVTHVVDSI 425
>gi|42519006|ref|NP_964936.1| pyruvate kinase [Lactobacillus johnsonii NCC 533] >gi|41583293|gb|AAS08902.1| pyruvate kinase [Lactobacillus johnsonii NCC 533] (589 aa)
Score = 635, Expect = 5.3e-64, Identities = 148/361 (40%), Positives = 216/361 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +KKTKI +TLGP+                   +ET  K    L +AG NV RFNFSHGD+EE   R+N+VREV K+ G  +   LDTKG EIR  +    +  I +   +RI     + G  +   V     TY+ +  D   G  + +DDG + L +   +  +  +   A+NT ++   K +N P     +P +++KD NDI F +K   ++I ASFV    +V +I+++L+E   E+++I  KIE+  GI ++D+I+  SD +MVARGD+G+E+P+ +VP  +K +IK C   GK VI ATQMLDS++   +PTRAEVTDV  AV  GTD TMLSGE+ANG+YP+ AV+ MA+ID+ +E
  S:     1 MKKTKIVSTLGPASND----------------VETITK----LAEAGANVFRFNFSHGDHEEHRARMNMVREVEKKTGKLLGIALDTKGAEIRTTEQEGGKFTINTGDTIRISMDDTKKGNKDMIHV-----TYDGLYDDTHVGGHVLIDDGLVDLLIKDKDDAKRELVCEAQNTGVIGSKKGVNAPGVEIRLPGITEKDTNDIKFGLKEGINFIFASFVRKAQDVLDIRQLLEEAHCEYVKIFPKIESQEGIDNIDEILKVSDGLMVARGDMGVEIPFINVPFVQKELIKRCNALGKPVITATQMLDSMQENPRPTRAEVTDVANAVLDGTDATMLSGESANGLYPVKAVKAMAEIDMRTE 337
>gi|110805653|ref|YP_689173.1| pyruvate kinase [Shigella flexneri 5 str. 8401] >gi|110615201|gb|ABF03868.1| pyruvate kinase [Shigella flexneri 5 str. 8401] (542 aa)
Score = 635, Expect = 5.4e-64, Identities = 142/321 (44%), Positives = 199/321 (61%)
  Q:    39 AKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:    88 SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEKGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 403
>gi|157145956|ref|YP_001453275.1| pyruvate kinase [Citrobacter koseri ATCC BAA-895] >gi|157083161|gb|ABV12839.1| hypothetical protein CKO_01709 [Citrobacter koseri ATCC BAA-895] (470 aa)
Score = 634, Expect = 5.9e-64, Identities = 150/356 (42%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGD+G+E+P  +V   +K II+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTKMLDAGMNVMRLNFSHGDYAEHGQRIKNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDMGVEIPVEEVIFAQKMIIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATI 331
>gi|183598861|ref|ZP_02960354.1| hypothetical protein PROSTU_02293 [Providencia stuartii ATCC 25827] >gi|188021068|gb|EDU59108.1| hypothetical protein PROSTU_02293 [Providencia stuartii ATCC 25827] (470 aa)
Score = 634, Expect = 6.9e-64, Identities = 148/356 (41%), Positives = 205/356 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L DAG+NV+R NFSHGDYEE   R+  +R V    G   + +LDTKGPEIR  K     +V + +       T    IG  ++ +V     TY  +  D+  G+T+ VDDG + ++V      E I E +  N   L E K +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI+  LK+HGGE+IQIISKIE   G+ + DDI++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEKLNQLLDAGMNVMRLNFSHGDYEEHGQRIKNLRAVCARTGKQAAILLDTKGPEIRTMKLEGGNDVSLVAGQTFTFTTDTSVIGNKDRVAV-----TYAGLTADLNAGDTVLVDDGLIGMKVKDVTATEVICEVL--NNGDLGEKKGVNLPGVSIGLPALAEKDKEDLIFGCEQGVDFVAASFIRKRSDVEEIRAHLKKHGGENIQIISKIENQEGLNNFDDILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCVAARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPVEAVTIMATI 331
>gi|157358333|emb|CAO65979.1| unnamed protein product [Vitis vinifera] (510 aa)
Score = 634, Expect = 6.9e-64, Identities = 150/390 (38%), Positives = 218/390 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           I KTKI  TLGP+               ++ V    K     L  AG+NV RFNFSHG +E     LN +R   +   +  + MLDTKGPEIR  +    K +++K   ++ I T     G  E  S+        +  D++PGNTI   DG + L V+S +   G +     NT +L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++  ++K+L  H  + IQ++SK+E   G+ + D+I+ E+DS MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++MA+I + +E+  DYG       + TP     + +LA++
  S:    19 IPKTKIVCTLGPA---------------SRSVPMVEK-----LLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTQILCAVMLDTKGPEIRTGFLKDGKPIQLKEGEEITITTDYSIKGDQEMISM----SYKKLPVDLKPGNTILCADGTITLTVLSCDPAAGTVRCRCENTALLGERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNKIDMIALSFVRKGSDLVHVRKVLGSHA-KRIQLMSKVENQEGVINFDEILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMARICIEAESSLDYGAIFKERIRSTPLPMSPLESLASS 385
>gi|1526982|emb|CAA68205.1| pyruvate kinase like protein [Salmonella typhimurium] (470 aa)
Score = 634, Expect = 7.1e-64, Identities = 148/356 (41%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L+ + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLSKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVVGNNEIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGNKCICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|116491032|ref|YP_810576.1| pyruvate kinase [Oenococcus oeni PSU-1] >gi|116091757|gb|ABJ56911.1| pyruvate kinase [Oenococcus oeni PSU-1] (477 aa)
Score = 634, Expect = 7.3e-64, Identities = 174/461 (37%), Positives = 251/461 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGE-HIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN-FFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +KKTKI +TLGP+                        K ++AL + G+NV RFNFSHGD++E   R+ LV +  K+ G  I  MLDTKG EIR  V  T   ++E K   ++RI   +K  GT EK +V    G Y+   DV+ G  +  DDG +++ VIS + E+  +     N  +L   K +N P    ++P ++ KD++DI F ++   D+IAASFV    +V +I+K+LK+H  E H+ I  KIE+  GI + + II  SD +MV RGD+G+E+PY +VP  +K +I+     GK VI ATQMLDS+    + TRAE+ DV  AV  GTD TMLSGE+ANG +P+ AV+ M+  D  +EN   D G  ID+  +      E +   A   A     K ++ +    Y++        RLI   S  R   PI  +T  ++ A    +NY V+  V D  E
  S:     1 MKKTKIVSTLGPA--------------------SNDLKIISALINNGINVARFNFSHGDHDEHAARMALVHDAEKKTGKLIGFMLDTKGAEIRTTVQDTPNGKIEFKKGDRLRISMNEKIKGTKEKIAV-TYKGLYD---DVKVGGKVLFDDGIIEMTVISKDSEKKELLVQVDNDGVLGGRKGVNAPGVAINLPGITKKDKSDIEFGLEQGIDFIAASFVRKAQDVLDIRKLLKKHHQENHVMIFPKIESQEGIDNFESIIAVSDGLMVPRGDMGVEIPYEEVPVIQKMMIRYMNRLGKPVITATQMLDSMIENPRATRAEINDVENAVWDGTDATMLSGESANGSWPVEAVKTMSTSDEYAENHVHDDGNRIDLRNEPKSSDTEVLAQAAVDAAREAGAKAIVASTASGYTA--------RLI---SKYRPDMPILAITYDEKVARSLTVNYAVYPVVKDAPE 430
>gi|170768727|ref|ZP_02903180.1| pyruvate kinase I [Escherichia albertii TW07627] >gi|170122275|gb|EDS91206.1| pyruvate kinase I [Escherichia albertii TW07627] (470 aa)
Score = 633, Expect = 7.4e-64, Identities = 149/356 (41%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNNEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|90407511|ref|ZP_01215694.1| pyruvate kinase [Psychromonas sp. CNPT3] >gi|90311432|gb|EAS39534.1| pyruvate kinase [Psychromonas sp. CNPT3] (469 aa)
Score = 633, Expect = 7.4e-64, Identities = 149/356 (41%), Positives = 214/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           ++KTKI  T+GP                       +K+ L  L + G+NV+R NFSHGD+ E   R+  +RE+ +E G N++ +LDTKGPEIR  K +   +V +++  +  + T +  IG +   +V     TY + A D+  GNTI +DDG +++ VIS  +  G +     NT  L ENK +NLP     +P +S KD+ D+IF  +   D+IAASF+   ++V EI+ +LK +GGE+IQIISKIE   G+ + D+I++ SD+IMVARGDLG+E+   +V   +K +I+      K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP  AVE+MA I
  S:     1 MRKTKIVCTIGPK--------------------SESKEMLTKLVNNGMNVMRLNFSHGDFAEHGARITTIREICQETGKNVAVLLDTKGPEIRTVKLAGGNDVTLQAGQEFTLSTNQSIIGDNTIVAV-----TYADFANDLSVGNTILLDDGLIEMTVIS--IANGDVLCRVENTGDLGENKGVNLPGVKVQLPALSVKDKGDLIFGCEQNVDFIAASFIRKKEDVLEIRALLKANGGENIQIISKIENQEGVDNFDEILEVSDAIMVARGDLGVEIAVEEVIFAQKMMIEKANAARKPVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPAEAVEIMATI 331
>gi|156057673|ref|XP_001594760.1| pyruvate kinase [Sclerotinia sclerotiorum 1980] >gi|154702353|gb|EDO02092.1| pyruvate kinase [Sclerotinia sclerotiorum 1980] (527 aa)
Score = 633, Expect = 8.3e-64, Identities = 170/455 (37%), Positives = 249/455 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           K  ++T I  T+GP    K  ++   NK                L  AG+NVVR NFSHG YE     ++  RE  + + G  ++  LDTKGPEIR   T    ++ I   S++ I T  K      +K   LD     N+ K ++PG  I+VDDG L  +V+   V++  I   ARN   +  NK +NLP+++  +P +S+KD+ D+ F +KN  D + ASF+  G+++  I+K+L E G +HIQII+KIE   G+ +  +I+ E+D +MVARGDLG+E+P  +V   +K +I  C   GK VI ATQML+S+    +PTRAE++DV  AV  G DC MLSGETA G YP  AV  M +  +S+EN   Y      +F+E   + E+  ++  + A       +  N G    +I+V        + LS  R   PIF VT +   A+R+G  Y GV+
  S:    29 KNYRRTSIICTIGP----KTNSVEALNK----------------LRIAGLNVVRMNFSHGSYEYHQSVIDNTREAERVQAGRQLAIALDTKGPEIRTGSTVGHADIPISIGSEINITTDDKYATACDDKNMYLDYK---NITKVIEPGRIIYVDDGVLAFDVLEI-VDDKTIRCRARNNGKISSNKGVNLPNTDVDLPALSEKDQADLRFGVKNNVDMVFASFIRRGEDITAIRKVLGEDG-KHIQIIAKIENRQGLNNFAEILKETDGVMVARGDLGIEIPAAEVFAAQKKMIAMCNMAGKPVICATQMLESMILNPRPTRAEISDVGNAVTDGADCVMLSGETAKGNYPNEAVNEMHECCLSAENSIAYVS----HFEELCKLAERPVSVVESCAMSAVRASLDINAG----AIIVLSTSGESARLLSKYRPVCPIFMVT-RNASASRYGHLYRGVY 453
>gi|70726228|ref|YP_253142.1| pyruvate kinase [Staphylococcus haemolyticus JCSC1435] >gi|123660449|sp|Q4L739|KPYK_STAHJ Pyruvate kinase (PK) >gi|68446952|dbj|BAE04536.1| pyruvate kinase [Staphylococcus haemolyticus JCSC1435] (586 aa)
Score = 633, Expect = 8.9e-64, Identities = 161/453 (35%), Positives = 246/453 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  T+GP+                      +++ L  L  AG+NV R NFSHG +EE   R++ +R+VA   G  I  +LDTKGPEIR +   +  + ++   +V +  ++ E GT EKFSV     TY ++  DVQ G+ I +DDG ++L+V   +  +G ++    NT  L+  K +NLP    ++P ++DKD +DI+F IK   DYIAASFV    +V +I++IL+     +I I  KIE   GI ++++I++ SD +MVARGD+G+E+P   VP  +K +I+ C   GK VI ATQMLDS++   + TRAE +DV  A+  GTD  MLSGETA G+YP  AV+ M  I VS+E   DY +           + ++   + T++   +           +  +IV           +S  R  + I  VT  +  A +  L +G +
  S:     1 MRKTKIVCTIGPA--------------------SESEEMLEKLMKAGMNVARLNFSHGSHEEHKARIDTIRKVADRLGKTIGILLDTKGPEIRTHDMKDGLIMLEKGKEVIVSMSQVE-GTPEKFSV-----TYEDLINDVQVGSYILLDDGLVELQVKDIDKTKGEVKCDILNTGELKNKKGVNLPGVKVNLPGITDKDADDILFGIKEDVDYIAASFVRRPSDVLDIREILERENNHNITIFPKIENQEGIDNIEEILEVSDGLMVARGDMGVEIPPESVPIVQKDLIRKCNKLGKPVITATQMLDSMQRNPRATRAEASDVANAIYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKK----------LLSDRTKLVETSLVNAIGVSVAHTALNLNVKAIVAATESGSTAVTISKYRPHSDIIAVTPSEHTARQLALVWGAY 418
>gi|90961844|ref|YP_535760.1| pyruvate kinase [Lactobacillus salivarius UCC118] >gi|90821038|gb|ABD99677.1| Pyruvate kinase [Lactobacillus salivarius UCC118] (586 aa)
Score = 633, Expect = 9.2e-64, Identities = 163/452 (36%), Positives = 238/452 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVG-TLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +KKTKI +TLGP+                     +    +  L +AG NV RFNFSHGD+EE   R+NLV E  K  G  +  +LDTKG EIR     E ++      +VRI       GT EK +V    G Y+   DV  G  +  DDG + +++   +     +     N   L   K +N P  + ++P +++KD +DI F +    +YIAASFV    ++ +I+++L+E   EH+QI  KIE+  GI + D+I+  SD +M+ARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  AV  GTD TMLSGE+ANG YP+ +V  MA+ID+ SEN     +A+ +   +   + E +G ++A T   L            +  +IV         + +S  R  A I  VT          +N+GV
  S:     1 MKKTKIVSTLGPA--------------------SSDLDTIVKLIEAGANVFRFNFSHGDHEEHLGRMNLVHEAEKITGKTVGFLLDTKGAEIRTTVQKEGKIHFAIGDEVRISMDDSIEGTKEKIAV-TYPGLYD---DVHEGGHVLFDDGLIDMQIEKKDDANKELVCKVLNEGTLGSRKGVNAPGVSINLPGITEKDSDDIRFGLDQDINYIAASFVRKPQDILDIRELLEEKHMEHVQIFPKIESQEGINNFDEILKVSDGLMIARGDMGVEIPAENVPLVQKSLIKKCNLAGKPVITATQMLDSMQENPRPTRAEASDVANAVFDGTDATMLSGESANGDYPVESVATMARIDIKSENALRQHKALTLDAFDKTDVTEAIGRSVAETAENL------------NIKTIVAATKSGHTARMISKYRPNADILAVTFDDRTRRGLTVNWGV 417
>gi|52547718|gb|AAU81894.1| pyruvate kinase [Phaeodactylum tricornutum] (539 aa)
Score = 632, Expect = 1.0e-63, Identities = 161/443 (36%), Positives = 247/443 (55%)
  Q:    39 AKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV--YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRF-GLNYGVFVKVVDNVEHAIANKTEIIDAINSQL 481
           +++ L  L DAG+NV RFNFSHGD+E     L  +R+VAKEK  NI+ +LDTKGPEIR   +     ++ +     + + T     G S++ +    T    +AK V  G  I + DG L L V+S +     ++    N   + E K +NLP     +P  +++D NDI+ F IKNK D+IAASFV  G +V  ++K+L ++GG  I+II KIE   G+++  DI++ +D+IMVARGDLG+E+P   V   +KY+I++    GK V+ ATQML+S+ T  +PTRAE +DV  AV  GTD  MLSGETANG +   AV VMA+    +E+  +Y              +  + T  +  ++ V  K  +D    +   IVV     ++   ++  R    +  +T  +  A +  GL  G+   VVD++E +     E+++ +N +L
  S:    48 SEEGLGQLMDAGMNVARFNFSHGDHEGHGKVLERLRKVAKEKKRNIAVLLDTKGPEIRTGFFADGIDKINLSKGDTIVLTTDYDFKGDSKRLACSYPT----LAKSVTQGQAILIADGSLVLTVLSIDTANNEVQCRVENNASIGERKNMNLPGVVVDLPTFTERDVNDIVNFGIKNKVDFIAASFVRKGSDVTNLRKLLADNGGPQIKIICKIENQEGLENYGDILEHTDAIMVARGDLGMEIPSSKVFLAQKYMIREANVAGKPVVTATQMLESMVTNPRPTRAECSDVANAVYDGTDAVMLSGETANGPHFEKAVLVMARTCCEAESSRNYNLLFQSVRNSIVIARGGLSTGESMASSAV--KSALD---IEAKLIVVMSETGKMGNYVAKFRPGLSVLCMTPNETAARQASGLLLGMHTVVVDSLEKS----EELVEELNYEL 481
>gi|66362152|ref|XP_628040.1| pyruvate kinase [Cryptosporidium parvum Iowa II] >gi|46227634|gb|EAK88569.1| pyruvate kinase [Cryptosporidium parvum Iowa II] (532 aa)
Score = 632, Expect = 1.1e-63, Identities = 172/462 (37%), Positives = 245/462 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGG------EHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYG---RAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHA 466
           +KT+I  T+GPS                        ++L  L D G++V R NFSHGD+E     L  +RE AK +    +  MLDTKGPEIR       K +E+K+   ++I T    +G SE  S   S     + K VQ G+T+ + DG L  +V+   + +  I     N+  + E K +NLP     +P + DKDR+DI+ FA+K   D+IA SFV  G +V+  ++I+ E+          I+IISKIE + G+ + D I  ESD IMVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE+TDV  AV  G+DC MLSGETANG +P +AV VM+++   +E   DY     AI     +   + E +   A   A  V  K +I        +I   GN  RLI   S  R +  I   T K E A    +  GV   V++++ H+
  S:    50 RKTQIICTIGPSCNNV--------------------ESLIGLIDKGMSVARLNFSHGDHESHFKTLQNIREAAKARPHSTVGIMLDTKGPEIRTGMLEGGKPIELKAGQTLKITTDYSMLGNSECISCSYSL----LPKSVQIGSTVLIADGSLSTQVLE--IGDDFIVCKVLNSVTIGERKNMNLPGCKVHLPIIGDKDRHDIVDFALKYNLDFIALSFVQNGADVQLCRQIISENTQYSNGIPSSIKIISKIENLEGVINFDSICSESDGIMVARGDLGMEIPPEKIFVAQKCMISKCNVAGKPVVTATQMLESMIKSNRPTRAEMTDVANAVLDGSDCVMLSGETANGAFPFDAVNVMSRVCAQAETCIDYPVLYHAIHSSVPKPVAVPEAIACSAVESAHDVNAKLII--------TITETGNTARLI---SKYRPSQTIIACTAKPEVARGLKIARGVKTYVLNSIHHS 486
>gi|1310978|pdb|1PKY|A Chain A, Pyruvate Kinase From E. Coli In The T-State >gi|1310979|pdb|1PKY|B Chain B, Pyruvate Kinase From E. Coli In The T-State >gi|1310980|pdb|1PKY|C Chain C, Pyruvate Kinase From E. Coli In The T-State >gi|1310981|pdb|1PKY|D Chain D, Pyruvate Kinase From E. Coli In The T-State (470 aa)
Score = 632, Expect = 1.1e-63, Identities = 149/356 (41%), Positives = 208/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI AT MLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATMMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|167551657|ref|ZP_02345411.1| hypothetical protein Sentente_14294 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168463215|ref|ZP_02697146.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195634569|gb|EDX52921.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Newport str. SL317] (470 aa)
Score = 632, Expect = 1.1e-63, Identities = 149/356 (41%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L+ + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLSKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVIGNNEIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|154483123|ref|ZP_02025571.1| hypothetical protein EUBVEN_00824 [Eubacterium ventriosum ATCC 27560] >gi|149735931|gb|EDM51817.1| hypothetical protein EUBVEN_00824 [Eubacterium ventriosum ATCC 27560] (473 aa)
Score = 632, Expect = 1.1e-63, Identities = 163/452 (36%), Positives = 254/452 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  TLGP+              +   V+E   KN       G+NV R NFSHG +EE   R+N V+E+ ++    ++ +LDTKGPEIR       +V + S     +   +K IG   + ++     TY ++ KDV+PG+ I +DDG +K+EV    V + ++  + +N   + + K +N+PD + ++ ++S++D+ DIIF I+   +YIAASFV   ++V +I+ ILKE+GGE+I II+KIE   GI ++D II+ +D IMVARGD+G+E+P  +VP  +K IIK     GK VI ATQMLDS+    +PTRAE TDV  A+  GT   MLSGETA G YPI+A++ M +I   +E        +D+ +K+  F  + + T    I   V        +  +  +I+      R  + +S+ R    +   T  ++   +  L++GV
  S:     1 MRKTKIVCTLGPAT-------------DKDNVLEELIKN-------GLNVARCNFSHGSHEEHLGRMNKVKELREKCNKPVAILLDTKGPEIRTGNFENGKVHVFSGQTFTLVGGEKIIGDENRVNI-----TYPDLYKDVEPGSVILIDDGLIKMEV-EKIVGQDVVCKV-KNDGKISDKKGVNVPDIHINMEYLSEQDKKDIIFGIEQDVEYIAASFVRCAEDVEQIRAILKENGGENINIIAKIENSEGILNIDSIIEAADGIMVARGDMGVELPEEEVPIIQKMIIKKVYQAGKKVITATQMLDSMMNNPRPTRAETTDVANAIYDGTSAIMLSGETAAGKYPIDALQTMVRIAERTE--------MDINYKQR-FFNQNIHT-ERNITQAVCHATCTTAYDLEAKAILTVTKSGRSARMISSCRPDCMVIAGTTDEKTCRQLSLSWGV 416
>gi|191638358|ref|YP_001987524.1| Pyruvate kinase [Lactobacillus casei] >gi|63212277|gb|AAP72039.2| pyruvate kinase [Lactobacillus casei] >gi|190712660|emb|CAQ66666.1| Pyruvate kinase [Lactobacillus casei BL23] (588 aa)
Score = 632, Expect = 1.1e-63, Identities = 147/361 (40%), Positives = 211/361 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +KKTKI +TLGP+                          +  L +AG NV RFNFSHGD+EE   R+N+V E  K  G  +  MLDTKG EIR  +  T   +++  +  KVRI       GT EK +V    G Y+   D   G  +  DDG + +++   + +   + T+ +N  +L   K +N P    ++P +++KD +DI F + N  ++IAASFV    +V +I+++L+E    ++QI  KIE+  GI ++DDI+  SD +MVARGD+G+E+P+  VP  +K +IK C   GK VI ATQMLDS++   +PTRAEV DV  AV  GTD TMLSGE+ANG YP+ +V  MA+ID  +E
  S:     1 MKKTKIVSTLGPA--------------------SNTTDIIVKLIEAGANVFRFNFSHGDHEEHLARMNMVHEAEKITGKTVGIMLDTKGAEIRTTLEDTPNGKIDFHTGDKVRISMDASLKGTKEKVAV-TYPGLYD---DTHVGGHVLFDDGLIDMKITEKDEKNRELVTVVQNDGVLGGKKGVNAPGVAINLPGITEKDSDDIRFGLDNGINFIAASFVRKPQDVLDIRELLEEKNALNVQIFPKIESQEGIDNIDDILKVSDGLMVARGDMGVEIPFEHVPIVQKRLIKKCNSLGKPVITATQMLDSMQENPRPTRAEVNDVANAVFDGTDATMLSGESANGDYPVESVAAMARIDEYTE 339
>gi|148977482|ref|ZP_01814071.1| pyruvate kinase [Vibrionales bacterium SWAT-3] >gi|145963277|gb|EDK28543.1| pyruvate kinase [Vibrionales bacterium SWAT-3] (470 aa)
Score = 631, Expect = 1.4e-63, Identities = 151/356 (42%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L DAG+NV+R NFSHGD+ E   R+   REV  + G  ++ +LDTKGPEIR  K     +V++ +  +    T    +G  E  +V     TY   A D+  GNTI VDDG +++EVIS+   E  ++    N   L ENK +NLP  +  +P +S+KD+ D+ F  +   D++AASF+    +V+EI++IL  +GG  I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVDAGMNVMRLNFSHGDFAEHGTRIANFREVMDKVGKQLAILLDTKGPEIRTIKLEGGNDVDLVAGQEFTFTTDTSVVGNKETVAV-----TYAGFAADLNAGNTILVDDGLIEMEVISTTETE--VKCKVLNNGALGENKGVNLPGVSVQLPALSEKDKADLKFGCEQGVDFVAASFIRKASDVKEIREILDANGGNDIHIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKMVITATQMLDSMINNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVTIMAQI 331
>gi|123442425|ref|YP_001006404.1| pyruvate kinase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122089386|emb|CAL12234.1| pyruvate kinase I [Yersinia enterocolitica subsp. enterocolitica 8081] (470 aa)
Score = 631, Expect = 1.4e-63, Identities = 149/356 (41%), Positives = 207/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L  AG+NV+R NFSHGDYEE   R+  +R V  + G+    +LDTKGPEIR  K    K+  + +       T +  IG +   +V     TY   A D++ GNT+ VDDG + +EV  + V E  +     N   L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGEHIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTNLLKAGMNVMRLNFSHGDYEEHGQRIKNIRAVMAKTGLKAGILLDTKGPEIRTMKLEGGKDAALIAGQTFTFTTDQSVIGNNNIVAV-----TYPGFAADLKIGNTVLVDDGLIGMEV--TEVTESTVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKADLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGEHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVTIMATI 331
>gi|22296818|gb|AAM94348.1| pyruvate kinase [Glycine max] (511 aa)
Score = 631, Expect = 1.4e-63, Identities = 151/390 (38%), Positives = 222/390 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           + KTKI  TLGP+               ++ V  T K     L  AG+NV RFNFSHG  DY ++T  LN ++      G+  + MLDTKGPEIR  +    K +++K   +V I T     G  E  S+        +   ++PGNTI   DG + L V+S + + G +     NT  L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++  ++K+L  H  ++IQ++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++MA+I + +E+  DYG       + TP     + +LA++
  S:    20 VPKTKIVCTLGPA---------------SRSVEMTEK-----LLRAGMNVARFNFSHGTHDYHQET--LNNLKTAMHNTGILCAVMLDTKGPEIRTGFLKDGKPIQLKEGQEVTITTDYDIKGDPEMISM----SYKKLPVHLKPGNTILCSDGTITLTVLSCDPDAGTVRCRCENTATLGERKNVNLPGVVVDLPTLTEKDKEDILGWGVPNKIDMIALSFVRKGSDLVNVRKVLGPHA-KNIQLMSKVENQEGVLNFDEILRETDAFMVARGDLGMEIPVEKIFLAQKMMIYKCNLVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMARICIEAESSLDYGAIFKEMIRSTPLPMSPLESLASS 386
>gi|68138979|gb|AAY86035.1| pyruvate kinase [Citrus sinensis] (510 aa)
Score = 631, Expect = 1.4e-63, Identities = 156/438 (35%), Positives = 228/438 (52%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV 439
           K + KTKI  TLGP+                      +   L  L  AG+NV RFNFSHG +E Q   LN +R       +  + MLDTKGPEIR  +    K +++K   ++ + T     G  E  ++        +  DV+PGNTI   DG + L V+S + + G +     NT +L E K +NLP     +P +++KD+ DI+ + + N  D IA SFV  G ++  ++K+L  H  ++IQ++SK+E   G+ + DDI+ E+DS MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++M +I + +E+  DY        + TP     + +LA++        R           IVV        + ++  R A PI  V
  S:    17 KRLPKTKIVCTLGPA--------------------SRSVPMLEKLLRAGMNVARFNFSHGTHEYQQETLNNLRAAMHNTQILCAVMLDTKGPEIRTGFLKDGKPIQLKEGQEITVSTDYDFKGNEEMITM----SYKKLPVDVKPGNTILCADGTITLTVLSCDPKSGTVRCRCENTAMLGERKNVNLPGVVVDLPTLTEKDKEDILRWGVPNNIDMIALSFVRKGSDLVTVRKVLGPHA-KNIQLMSKVENQEGVVNFDDILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEIAVKIMRRICIEAESSLDYRAVFKEMIRSTPLPMSPLESLASSAVRTANKARA--------KLIVVLTRGGTTAKLVAKYRPAVPILSV 423
>gi|116494851|ref|YP_806585.1| pyruvate kinase [Lactobacillus casei ATCC 334] >gi|116105001|gb|ABJ70143.1| pyruvate kinase [Lactobacillus casei ATCC 334] (588 aa)
Score = 631, Expect = 1.4e-63, Identities = 147/361 (40%), Positives = 211/361 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +KKTKI +TLGP+                          +  L +AG NV RFNFSHGD+EE   R+N+V E  K  G  +  MLDTKG EIR  +  T   +++  +  KVRI       GT EK +V    G Y+   D   G  +  DDG + +++   + +   + T+ +N  +L   K +N P    ++P +++KD +DI F + N  ++IAASFV    +V +I+++L+E    ++QI  KIE+  GI ++DDI+  SD +MVARGD+G+E+P+  VP  +K +IK C   GK VI ATQMLDS++   +PTRAEV DV  AV  GTD TMLSGE+ANG YP+ +V  MA+ID  +E
  S:     1 MKKTKIVSTLGPA--------------------SNTTDIIVKLIEAGANVFRFNFSHGDHEEHLARMNMVHEAEKITGKTVGIMLDTKGAEIRTTLEDTPNGKIDFHTGDKVRISMDASLKGTKEKVAV-TYPGLYD---DTHVGGHVLFDDGLIDMKITEKDEKNRELVTVVQNDGVLGGKKGVNAPGVAINLPGITEKDSDDIRFGLDNGINFIAASFVRKPQDVLDIRELLEEKNALNVQIFPKIESQEGIDNIDDILKVSDGLMVARGDMGVEIPFEHVPIVQKRLIKKCNSLGKPVITATQMLDSMQENPRPTRAEVNDVANAVFDGTDATMLSGESANGDYPVESVAAMARIDEYTE 339
>gi|2497538|sp|Q42806|KPYC_SOYBN Pyruvate kinase, cytosolic isozyme (PK) >gi|466350|gb|AAA17000.1| pyruvate kinase (511 aa)
Score = 631, Expect = 1.5e-63, Identities = 151/390 (38%), Positives = 222/390 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           + KTKI  TLGP+               ++ V  T K     L  AG+NV RFNFSHG  DY ++T  LN ++      G+  + MLDTKGPEIR  +    K +++K   +V I T     G  E  S+        +   ++PGNTI   DG + L V+S + + G +     NT  L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++  ++K+L  H  ++IQ++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++MA+I + +E+  DYG       + TP     + +LA++
  S:    20 VPKTKIVCTLGPA---------------SRSVEMTEK-----LLRAGMNVARFNFSHGTHDYHQET--LNNLKTAMHNTGILCAVMLDTKGPEIRTGFLKDGKPIQLKEGQEVTITTDYDIKGDPEMISM----SYKKLPVHLKPGNTILCSDGTITLTVLSCDPDAGTVRCRCENTATLGERKNVNLPGVVVDLPTLTEKDKEDILGWGVPNKIDMIALSFVRKGSDLVNVRKVLGPHA-KNIQLMSKVENQEGVLNFDEILRETDAFMVARGDLGMEIPVEKIFLAQKMMIYKCNLVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMARICIEAESSLDYGAIFKEMIRSTPLPMSPLESLASS 386
>gi|27364101|ref|NP_759629.1| pyruvate kinase [Vibrio vulnificus CMCP6] >gi|27360219|gb|AAO09156.1|AE016799_54 Pyruvate kinase [Vibrio vulnificus CMCP6] (470 aa)
Score = 631, Expect = 1.6e-63, Identities = 173/465 (37%), Positives = 258/465 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF--DYGRAIDVYFKETPFMK--EKVGTLAT-TIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIA 468
           +KKTKI  T+GP                     E+ +K L  L ++G+NV+R NFSHGDY E   R+   R+V +  G  ++ +LDTKGPEIR  K     +V++ +  +    T    +G  +  +V     TY   A D+  GNTI VDDG +++EVI++   E  ++    N   L ENK +NLP  + ++P +S+KD+ND+ F  +   D++AASF+    +V+EI+++L  +GG +IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGETA G YP+ AV +MA+I   +++    + G  +D     +P ++  E V   A  T   L AP  ++   G         G   R ++        A I  +T  K+ A +  L  GV   VVD++++  A
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELVNSGMNVMRLNFSHGDYVEHGTRIANFRQVMENTGKQLAILLDTKGPEIRTIKLENGDDVDLVAGQEFTFTTDTSVVGNKDIVAV-----TYPGFAADLSAGNTILVDDGLIEMEVIATTATE--VKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKASDVKEIREVLAANGGANIQIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGETAKGKYPVEAVTIMAQIANRTDSVLKAELGSRLD-----SPRLRITEAVCKGAVDTAEKLAAPLIIVATEG---------GKSARSVRKYFP---TANILALTTNKKTAAQLVLTKGVTPVVVDSIDNTDA 428
>gi|9955371|pdb|1E0U|A Chain A, Structure R271l Mutant Of E. Coli Pyruvate Kinase >gi|9955372|pdb|1E0U|B Chain B, Structure R271l Mutant Of E. Coli Pyruvate Kinase >gi|9955373|pdb|1E0U|C Chain C, Structure R271l Mutant Of E. Coli Pyruvate Kinase >gi|9955374|pdb|1E0U|D Chain D, Structure R271l Mutant Of E. Coli Pyruvate Kinase (470 aa)
Score = 631, Expect = 1.6e-63, Identities = 149/356 (41%), Positives = 208/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI AT MLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|16760530|ref|NP_456147.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|31076744|sp|Q8Z6K2|KPYK1_SALTI Pyruvate kinase I (PK-1) >gi|25287757|pir||AB0702 pyruvate kinase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16502826|emb|CAD01987.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Typhi] (470 aa)
Score = 630, Expect = 1.6e-63, Identities = 148/356 (41%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L+ + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLSKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVVGNNEIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|16764728|ref|NP_460343.1| pyruvate kinase [Salmonella typhimurium LT2] >gi|29141709|ref|NP_805051.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|62179969|ref|YP_216386.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161614209|ref|YP_001588174.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167545812|ref|ZP_02341380.1| hypothetical protein Sentent_21172 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167995363|ref|ZP_02576452.1| hypothetical protein Sententer_01000086_0100028210 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168233569|ref|ZP_02658627.1| hypothetical protein Sententerica_21479 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239259|ref|ZP_02664317.1| hypothetical protein Senteenterica_23999 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168240887|ref|ZP_02665819.1| hypothetical protein Senterienterica_04631 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263794|ref|ZP_02685767.1| hypothetical protein Salmentericaenterica_22169 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168474946|ref|ZP_02703969.1| hypothetical protein Salmoentericaenterica_09786 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168822244|ref|ZP_02834244.1| hypothetical protein Salentericaenterica_22858 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194445372|ref|YP_002040633.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194447474|ref|YP_002045384.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469681|ref|ZP_03075665.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736115|ref|YP_002114393.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|20141578|sp|P77983|KPYK1_SALTY Pyruvate kinase I (PK-1) >gi|16419898|gb|AAL20302.1| pyruvate kinase I [Salmonella typhimurium LT2] >gi|29137337|gb|AAO68900.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|62127602|gb|AAX65305.1| pyruvate kinase I (formerly F), fructose stimulated [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161363573|gb|ABX67341.1| hypothetical protein SPAB_01951 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194404035|gb|ACF64257.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194405778|gb|ACF65997.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194456045|gb|EDX44884.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711617|gb|ACF90838.1| pyruvate kinase I [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (470 aa)
Score = 630, Expect = 1.7e-63, Identities = 148/356 (41%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L+ + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLSKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVVGNNEIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|116629537|ref|YP_814709.1| pyruvate kinase [Lactobacillus gasseri ATCC 33323] >gi|116095119|gb|ABJ60271.1| pyruvate kinase [Lactobacillus gasseri ATCC 33323] (589 aa)
Score = 630, Expect = 1.7e-63, Identities = 146/361 (40%), Positives = 216/361 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +KKTKI +TLGP+                   +ET  K    L +AG NV RFNFSHGD+EE   R+N+VRE+ K+ G  +   LDTKG EIR  +    +  I +   +RI     + G  +   V     TY+ +  D   G  + +DDG + L +   +  +  +   A+NT ++   K +N P     +P +++KD NDI F +K   ++I ASFV    +V +I+++L+E   E+++I  KIE+  GI ++D+I+  SD +MVARGD+G+E+P+ +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAEVTDV  AV  GTD TMLSGE+ANG+YP+ AV+ MA+ID+ +E
  S:     1 MKKTKIVSTLGPASND----------------VETITK----LAEAGANVFRFNFSHGDHEEHRARMNMVREIEKKTGKLLGIALDTKGAEIRTTEQEGGKFTINTGDTIRISMDDTKKGNKDMIHV-----TYDGLYDDTHVGGHVLIDDGLVDLLIKEKDDAKRELVCEAQNTGLIGSKKGVNAPGVEIRLPGITEKDTNDIKFGLKEGINFIFASFVRKAQDVLDIRQLLEEAHCEYVKIFPKIESQEGIDNIDEILKVSDGLMVARGDMGVEIPFINVPFVQKELIRRCNALGKPVITATQMLDSMQENPRPTRAEVTDVANAVLDGTDATMLSGESANGLYPVKAVKAMAEIDMRTE 337
>gi|160944005|ref|ZP_02091235.1| hypothetical protein FAEPRAM212_01506 [Faecalibacterium prausnitzii M21/2] >gi|158444681|gb|EDP21685.1| hypothetical protein FAEPRAM212_01506 [Faecalibacterium prausnitzii M21/2] (653 aa)
Score = 630, Expect = 1.9e-63, Identities = 161/452 (35%), Positives = 252/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI--DVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  TLGPS              + +GV       L  L   G+NV RFNFSHG +EE   RL  ++ + +E G  ++ +LDTKGPEIR+ K  +  VE     +    TT+   GT+E  S+     TY ++  DV+P  TI +DDG +KL++ + N +  I+ T+  N  I +  K +N+P  + S+P+MS +D++DIIF I+  +D+IAASFV T  +V +I+ +L ++   +I+II+KIE   G+ ++D I+  +D++MVARGDLG+E+ + ++P  +K II      GK ++ ATQMLDS+    +PTRAE++DV  A+  GT   MLSGETA G YP+ A++ M+ I      E F   GR +D             G ++ + AT  A    +     + ++IV         + LS  R   PI     +++   +  L++G+
  S:    71 MRKTKIICTLGPST-------------DKEGV-------LRELIANGMNVARFNFSHGSHEEHLGRLEKLKALREELGKPVAALLDTKGPEIRL-KDFKNGVENLVAGQTFTLTTRDVEGTNEICSI-----TYKDLPMDVEPNGTIMLDDGLIKLQIQTVN-DTDIVCTVLNNGKI-KNKKGVNVPGVHLSMPYMSQRDKDDIIFGIQQGYDFIAASFVRTAQDVYDIRNLLNQYD-SNIRIIAKIENREGVNNIDSILAAADAVMVARGDLGVEIDFTELPGIQKTIIDRSFSFGKPIVTATQMLDSMIVNPRPTRAEISDVANAIYDGTSAIMLSGETAAGAYPVEALKTMSAIAERTEQEGFHLRGRTMD----------SNPGKISVSDAT--AHAACLTARDVNAAAIVTVSESGTTARLLSKYRPQQPIIACVMREQVQRQLSLSWGI 484
>gi|56413649|ref|YP_150724.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56127906|gb|AAV77412.1| pyruvate kinase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (470 aa)
Score = 630, Expect = 1.9e-63, Identities = 148/356 (41%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L+ + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLSKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVVGNNEIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|118725348|ref|ZP_01573990.1| pyruvate kinase [Clostridium cellulolyticum H10] >gi|118665339|gb|EAV71959.1| pyruvate kinase [Clostridium cellulolyticum H10] (580 aa)
Score = 630, Expect = 2.0e-63, Identities = 163/457 (35%), Positives = 247/457 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVV 460
           +++TKI  TLGP+              +N+ +       L  +   G+++ R NFSHG +EE   R +LV+++ +E  + I  +LDTKGPEIR  K    +  +K +++  I   +  +G   K ++     TY  + KDV  G+ I ++DG ++LEV  + ++   I     N   +  +K IN+P +   +P ++++D +DI F IKN FD IAASFV    +V EI+K+L+++GG+ I II+KIE   GIK+ +DI+  SD IMVARGDLG+E+P  +VP  +K II+ C   GK VI ATQMLDS+    +PTRAE +DV  A+  GT C MLSGETA G YPI  +EVMAKI   +E   DY         E          L T++   ++            ++I+         + ++  R A PI   T   +   +  L++GV   +V
  S:     1 MRRTKIICTLGPA-------------SDNEDI-------LRKMMLGGMSLARMNFSHGTHEEHKKRADLVKKIREELNLPIPLLLDTKGPEIRTGKFKNDQAILKENNEF-ILVNEDILGDETKCTI-----TYKELYKDVSRGSKILINDGLVELEV--TEIKNKDIYCRVLNGGAVGNHKGINVPGAEIKLPSLTEQDIDDIKFGIKNDFDIIAASFVRKASDVVEIRKVLEKNGGKDILIIAKIENREGIKNFNDILKVSDGIMVARGDLGVEIPVEEVPIVQKNIIEKCYQNGKPVITATQMLDSMIRNPRPTRAEASDVANAIFDGTSCVMLSGETAAGKYPIETIEVMAKIAEKAEKSMDYWNRFATARTE----------LDTSVTNAISHATCTTALDLKAAAIITVTQSGHTARMIARFRPACPIIATTANPKVQRQLNLSWGVMPYLV 420
>gi|168221365|ref|ZP_02646597.1| hypothetical protein Senterenterica_13292 [Salmonella enterica subsp. enterica serovar Agona str. SL483] (455 aa)
Score = 630, Expect = 2.0e-63, Identities = 148/356 (41%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L+ + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLSKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVVGNNEIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|22296820|gb|AAM94349.1| pyruvate kinase [Glycine max] (510 aa)
Score = 630, Expect = 2.1e-63, Identities = 150/390 (38%), Positives = 222/390 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           + KTKI  TLGP+               ++ V  T K     L  AG+NV RFNFSHG  DY ++T  LN ++      G+  + MLDTKGPEIR  +    K +++K   ++ I T     G  E  S+        +   ++PGNTI   DG + L V+S + + G +     NT  L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++  ++K+L+ H  + IQ++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++MA+I + +E+  DYG       + TP     + +LA++
  S:    19 VPKTKIVCTLGPA---------------SRSVEMTEK-----LLRAGMNVARFNFSHGTHDYHQET--LNNLKTAMHNTGILCAVMLDTKGPEIRTGFLKDGKPIQLKEGQEITITTDYDIKGDQEMISM----SYKKLPVHLKPGNTILCSDGTITLTVLSCDPDAGTVRCRCENTATLGERKNVNLPGVVVDLPTLTEKDKEDILQWGVPNKIDMIALSFVRKGSDLVNVRKVLEPHA-KTIQLMSKVENQEGVLNFDEILRETDAFMVARGDLGMEIPVEKIFLAQKMMIYKCNLVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMARICIEAESSLDYGAIFKEMIRSTPLPMSPLESLASS 385
>gi|152002493|dbj|BAF73517.1| pyruvate kinase [Onion yellows phytoplasma OY-W] (317 aa)
Score = 630, Expect = 2.1e-63, Identities = 141/319 (44%), Positives = 207/319 (64%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           +NV RFNFSH  YE+  + +  ++ ++ +   +   MLDTKGPEIR ++  +  V I+ DS+V+I  T+  +G ++ FSV  S    N+  +++ G+ + +DDG L LEV+  +  +  + T A+NT  ++    +N+P  N  + F+S KD  DI+FA +  FDYIAASFV    +V++I+KIL+E G  +IQIISKIE   G+ +L++II ESD IMVARGDLG+EV    VP Y+  +I  C   GK V+VATQML+S++   +PT+AE +DVF AV  GT  TMLSGE+A+G YP+ AV  M KI+  +E   +Y
  S:     1 MNVARFNFSHAQYEQTKLLMKTIKTISDKLDKHTGLMLDTKGPEIRTHEF-DGVVTIQKDSEVKISMTEV-LGNAKLFSVSYS----NLYNELKVGDMVNIDDGYLSLEVVGKDEAKQQLVTKAKNTHSIKSRIGVNVPKVNLEMDFISPKDYQDIVFAAQQDFDYIAASFVRRAQDVKDIRKILQEQGNSNIQIISKIENQEGVDNLEEIIQESDGIMVARGDLGIEVDGELVPLYQTRMITKCLEYGKPVVVATQMLESMQRNPRPTKAETSDVFNAVREGTTFTMLSGESASGEYPVEAVTYMKKINYQAEKVVNY 313
>gi|77979574|ref|ZP_00834992.1| COG0469: Pyruvate kinase [Yersinia intermedia ATCC 29909] (472 aa)
Score = 630, Expect = 2.1e-63, Identities = 146/355 (41%), Positives = 204/355 (57%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KKTKI  T+GP                       +++ L  L DAG+NV+R NFSHGDY E   R+  +R V  + G     +LDTKGPEIR  K    +       +   +TT + +  ++K   +   G    A D++ GNT+ VDDG + +EV  + V E  +     N   L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGEHIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     4 KKTKIVCTIGPKTE--------------------SEEMLTKLLDAGMNVMRLNFSHGDYVEHGQRIKNIRAVMAKTGHKAGILLDTKGPEIRTMKLEGGKDAALVAGQTFTFTTDQSVIGNDKIVAVTYPG---FAADLKIGNTVLVDDGLIGMEV--TEVTESAVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKADLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGEHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVTIMATI 333
>gi|161503526|ref|YP_001570638.1| pyruvate kinase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160864873|gb|ABX21496.1| hypothetical protein SARI_01602 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (470 aa)
Score = 629, Expect = 2.2e-63, Identities = 148/356 (41%), Positives = 208/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G +E  +V     TY     D+  GNT+ VDDG + +EV +  +E   +     N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVVGNNEIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTA--IEGNKVVCKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|90580774|ref|ZP_01236577.1| pyruvate kinase [Vibrio angustum S14] >gi|90438042|gb|EAS63230.1| pyruvate kinase [Vibrio angustum S14] (470 aa)
Score = 629, Expect = 2.4e-63, Identities = 165/461 (35%), Positives = 244/461 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +KKTKI  T+GP                       + + L  L +AG+NV+R NFSHGD+EE   R+  +REV    G  ++ +LDTKGPEIR  K    ++  + +       T    +G     +V     TY   AKD+  GNTI VDDG +++EV+ +   E  ++    N   L ENK +NLP  +  +P +++KD+ D+ F  +   D++AASF+   ++V+EI+ +L  +GGE+IQIISKIE   G+ + D I+D SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YPI AV +MA+I   ++            +   P +  ++ +    I   V    V      +   I+V     +  +++      A I  VT   + A +  L+ GV   VVD++E
  S:     1 MKKTKIVCTIGPKTE--------------------SVEMLTKLANAGMNVMRLNFSHGDFEEHGQRIRNLREVMANTGKELAILLDTKGPEIRTIKLEGGQDFSLVAGQDFTFTTDTSVVGNQNCVAV-----TYPGFAKDLTKGNTILVDDGLIEMEVLETTDTE--VKCKVLNNGDLGENKGVNLPGVSVKLPALAEKDKADLKFGCEQGVDFVAASFIRKAEDVQEIRALLTANGGENIQIISKIENQEGVDNFDAILDASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGESAKGKYPIEAVTIMAQICARTD------------YVVKPELGSRLDSPRLRITEAVCKGAVDTAEKLNAPLIIVATEAGKSARSVRKYFPTARILAVTTNTKTAAQLCLSKGVTPVVVDSIE 424
>gi|116333412|ref|YP_794939.1| pyruvate kinase [Lactobacillus brevis ATCC 367] >gi|116098759|gb|ABJ63908.1| pyruvate kinase [Lactobacillus brevis ATCC 367] (585 aa)
Score = 629, Expect = 2.4e-63, Identities = 166/458 (36%), Positives = 243/458 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI +TLGP+                     T    +  L ++G N+ RFNFSHGD+EE   RL  V +  K  G  +  MLDTKG EIR       +++ K+  + RI       GT EK +V    G Y+   DV  G  +  DDG L   V   +     +   A+N  +L   K +N P  + ++P +++KD +DI F + ++ ++IAASFV    +V +I+++L+E   EH+QI  KIE+  GI + DDII  SD +MVARGD+G+E+P  +VP  +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  AV  GTD TMLSGE+ANG YP+ +V  M +ID+ +EN   D+GR  D    +   + E +G     +A  +  K ++      Y++           + +S  R  A I  VT          +N+GV+  V +
  S:     1 MKKTKIVSTLGPA--------------------STDVDTIVKLIESGANIFRFNFSHGDHEEHLGRLENVHKAEKITGKTVGIMLDTKGAEIRTTVEKGGKLQFKTGDQFRISMDDSLEGTKEKIAV-TYPGLYD---DVHEGGHVLFDDGLLDTVVDKKDDATKELIVTAQNDGVLGSRKGVNAPGVSINLPGITEKDSDDIRFGLDHEINFIAASFVRKPQDVMDIRELLEEKHMEHVQIFPKIESQEGINNFDDIIKVSDGLMVARGDMGVEIPTENVPLVQKALIKKCNILGKPVITATQMLDSMQENPRPTRAEASDVANAVFDGTDATMLSGESANGEYPVESVATMNRIDIKAENALKDFGR--DNLDFDNGDVTESIGASVARVANELGVKTIVAATETGYTA-----------KMISKYRPNADILAVTFDDRTRRGLMVNWGVYPIVTE 422
>gi|119946502|ref|YP_944182.1| pyruvate kinase [Psychromonas ingrahamii 37] >gi|119865106|gb|ABM04583.1| pyruvate kinase [Psychromonas ingrahamii 37] (469 aa)
Score = 628, Expect = 3.1e-63, Identities = 149/356 (41%), Positives = 212/356 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           ++KTKI  T+GP                       +K+ L  L   G+NV+R NFSHGD+ E   R+N +RE+ +E G N++ +LDTKGPEIR  K T+  +V + +  +  + T +  +G +   +V     TY N+  D+  GNT+ +DDG ++L V      E I + +  NT  L ENK +NLP     +P +S KD+ D+IF  + + D+IAASF+   ++V EI+++LK HGGE I IISKIE   G+ + D+I+  SD+IMVARGDLG+E+   +V   +K +I+      K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP  AVE+MA I
  S:     1 MRKTKIVCTIGPK--------------------SESKEMLGKLVKNGMNVMRLNFSHGDFNEHGGRINTIREICRETGKNVAILLDTKGPEIRTVKLTNGADVLLTAGQEFTLTTDQTVVGDNTVVAV-----TYENLTNDLAVGNTVLLDDGLIELTVKRITDTEVICDVM--NTGELGENKGVNLPGVKVQLPALSPKDKGDLIFGCEQQVDFIAASFIRKKEDVLEIRELLKAHGGEKIHIISKIENQEGVDNFDEILAASDAIMVARGDLGVEIAVEEVIFAQKMMIEKANAARKPVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPAEAVEIMATI 331
>gi|160878899|ref|YP_001557867.1| pyruvate kinase [Clostridium phytofermentans ISDg] >gi|160427565|gb|ABX41128.1| pyruvate kinase [Clostridium phytofermentans ISDg] (580 aa)
Score = 627, Expect = 3.8e-63, Identities = 148/366 (40%), Positives = 216/366 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           ++KTKI  TLGP+              E+  V       L  L   G++V RFNFSHGDYE+ T     +R ++ E  + I+T+LDTKGPEIR+      ++E+K   ++   TT   +G   + S+     TY N+ +D++ G  I +DDG ++L+V +    + I E +  N  ++  +K +N+P    S+PF+S +D  DI+F I   FD+IAASF    D++ +I+KIL E+    + II+KIE + G+ ++D+II  SD IMVARGD+G+E+P  +VP  +K IIK   +  K VI ATQMLDS+    +PTRAE TDV  A+  GT   MLSGETA G+YP+ A+  M KI   +E   DY
  S:     1 MRKTKIVCTLGPAT-------------EDDAV-------LRQLMIEGMDVARFNFSHGDYEQHTRNYERIRRLSAELKLPIATLLDTKGPEIRIGTFENGKIELKK-GQIFTLTTNDIVGDETQVSI-----TYKNLIRDIKNGVKILIDDGLIELKVFNITDTDIICEVL--NGGMISNHKGVNVPGVELSMPFISKRDYEDIVFGIGQGFDFIAASFTRCADDIIQIRKILNEYNCNTVNIIAKIENLQGVNNIDEIIRVSDGIMVARGDMGVEIPLEEVPVIQKMIIKKVYNAEKQVITATQMLDSMMKNPRPTRAEATDVANAIYDGTSAIMLSGETAAGLYPVEALRTMVKIAKRTEADIDY 339
>gi|146311424|ref|YP_001176498.1| pyruvate kinase [Enterobacter sp. 638] >gi|145318300|gb|ABP60447.1| pyruvate kinase [Enterobacter sp. 638] (473 aa)
Score = 627, Expect = 3.8e-63, Identities = 147/356 (41%), Positives = 210/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L+ + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  +G S+  +V     TY     D+  GNT+ VDDG + +EV +   +  + + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLSKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKSGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKTVVGNSDIVAV-----TYEGFTSDLSVGNTVLVDDGLIGMEVTAIEGKNVVCKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCVRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIIDGTDAVMLSGESAKGKYPLEAVTIMATI 331
>gi|89075584|ref|ZP_01161989.1| pyruvate kinase [Photobacterium sp. SKA34] >gi|89048724|gb|EAR54296.1| pyruvate kinase [Photobacterium sp. SKA34] (470 aa)
Score = 627, Expect = 3.9e-63, Identities = 165/461 (35%), Positives = 244/461 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +KKTKI  T+GP                       + + L  L +AG+NV+R NFSHGD+EE   R+  +REV    G  ++ +LDTKGPEIR  K    ++  + +       T    +G     +V     TY   AKD+  GNTI VDDG +++EV+ +   E  ++    N   L ENK +NLP  +  +P +++KD+ D+ F  +   D++AASF+   ++V+EI+ +L  +GGE+IQIISKIE   G+ + D I+D SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YPI AV +MA+I   ++            +   P +  ++ +    I   V    V      +   I+V     +  +++      A I  VT   + A +  L+ GV   VVD++E
  S:     1 MKKTKIVCTIGPKTE--------------------SVEMLTKLANAGMNVMRLNFSHGDFEEHGQRIRNLREVMVNTGKELAILLDTKGPEIRTIKLEGGQDFSLVAGQDFTFTTDTSVVGNQNCVAV-----TYPGFAKDLTKGNTILVDDGLIEMEVLETTETE--VKCKVLNNGDLGENKGVNLPGVSVKLPALAEKDKADLKFGCEQGVDFVAASFIRKAEDVQEIRALLTANGGENIQIISKIENQEGVDNFDAILDASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGESAKGKYPIEAVTIMAQICARTD------------YVVKPELGSRLDSPRLRITEAVCKGAVDTAEKLNAPLIIVATEAGKSARSVRKYFPTARILAVTTNTKTAAQLCLSKGVTPVVVDSIE 424
>gi|159485210|ref|XP_001700639.1| pyruvate kinase [Chlamydomonas reinhardtii] >gi|158272071|gb|EDO97877.1| pyruvate kinase [Chlamydomonas reinhardtii] (421 aa)
Score = 627, Expect = 4.0e-63, Identities = 161/437 (36%), Positives = 239/437 (54%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV 439
           +++KTKI  T GP+                      +++ L  L DAG N+VR NFSHGD+E     L   R+V  EK  + + +LDTKGPEIR     + K++E+ ++ KV I+   K+  T E    L S G   +   V+ GN I + DG + + ++      G +     NT  L + K  NLP     IP ++ KD +D+  F +K+K D++AASFV +  +V  I+ IL + GG+ ++IISKIE   G+K+ D+I++ +D +MVARGDLG+E+P   VP  +K +I      GK VI ATQM++S+ T   PTRAE+TDV  AV  G D  MLSGE+ANG Y   AVE MA+I  S+E   ++ ++ D   K TP     V  + +++A     K  +D        IVVF    ++ + ++  R  AP+  V
  S:    18 IVRKTKIICTAGPACW--------------------SEEGLGKLLDAGCNIVRLNFSHGDHEGHFSVLQRWRKVCAEKDSHAACLLDTKGPEIRTAMLKDGKDIELVANQKVTIHAGYKDAATGETHIGL-SYG--KLCSSVKAGNRILLADGSISIVIVDGTTLIGTV----LNTKKLGQRKNCNLPGVKVDIPVLTKKDIDDLQNFCVKHKMDFVAASFVQSQQDVLYIRSILDDAGGKDVKIISKIENAEGLKNFDEILEVTDGVMVARGDLGMEIPVEKVPLAQKMLITKANIAGKFVICATQMMESMITNPVPTRAEMTDVANAVWDGVDAVMLSGESANGAYFGQAVETMARIARSAEIGVNFYQSFDYTHKFTPKPVSAVEAMCSSLA-----KNAVD---IRPGMIVVFSEGGKVARLVAKYRPCAPVLVV 421
>gi|77962191|ref|ZP_00826014.1| COG0469: Pyruvate kinase [Yersinia mollaretii ATCC 43969] (470 aa)
Score = 627, Expect = 4.1e-63, Identities = 148/356 (41%), Positives = 207/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L +AG+NV+R NFSHGDYEE   R+  +R V  + G+    +LDTKGPEIR  K    K+  + +       T +  IG +   +V     TY   A D++ GNT+ VDDG + +EV  + V E  +     N   L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGG HIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTNLLNAGMNVMRLNFSHGDYEEHGQRIKNIRAVMAKTGLKAGILLDTKGPEIRTMKLEGGKDAALVAGQTFTFTTDQSVIGNNSIVAV-----TYPGFAADLKIGNTVLVDDGLIGMEV--TEVTESTVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKADLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGGHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVTIMATI 331
>gi|156088845|ref|XP_001611829.1| pyruvate kinase, putative [Babesia bovis] >gi|154799083|gb|EDO08261.1| pyruvate kinase, putative [Babesia bovis] (509 aa)
Score = 627, Expect = 4.2e-63, Identities = 162/433 (37%), Positives = 234/433 (54%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVRE-VAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNM-AKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIF 437
           K T I  T+GP++              +  ++E        L DAG+N+ RFNFSHGD+  Q   L+ VRE +AK    NI  +LDTKGPEIR       K + +     ++I T     G +E  S      +Y M    V+ G  I + DG L  EV   + +  +++ +  N   + E K +NLP     +P + +KD NDI+ FA+ + FD+IA SF  + D+++  +K+L E  G+HI+II KIE + G+   D I+DE+D +MVARGDLG+E+P   V   +KY+IK C  K K VI ATQML+S+    +PTRAE  DV  AV  GTDC MLSGE+ANG YP   V+ MAK+   +E+   Y +       ET         LA + A L      ++ H    ++IV   +D ++I+ +S  R   P+F
  S:    35 KHTHIVCTMGPALV------------SSDAIVE--------LIDAGMNICRFNFSHGDHVSQKQMLDKVREAMAKRPNANIGLLLDTKGPEIRTGLLKDHKAITLVHGQSLKITTDYTIEGDNECISC-----SYPMLTTSVKVGGIILIADGSLSCEVTEVHDKHIVVKVL--NNATIGERKNMNLPGVKVELPVLGEKDINDIVNFAVPHNFDFIALSFAQSADDIKLCRKVLGE-AGKHIKIIPKIENVEGLIHFDAILDEADGVMVARGDLGMEIPLEKVCMAQKYMIKKCNEKSKPVITATQMLESMINNPRPTRAESCDVANAVMDGTDCVMLSGESANGKYPALCVQHMAKLCFEAESCSAYRKLFGKAIAETKTKVSDEEALARSAALL-----SMELHA---AAIVCVSDDDKIIRHISKCRPVCPVF 435
>gi|188589682|ref|YP_001922463.1| pyruvate kinase [Clostridium botulinum E3 str. Alaska E43] >gi|188499963|gb|ACD53099.1| pyruvate kinase [Clostridium botulinum E3 str. Alaska E43] (471 aa)
Score = 627, Expect = 4.5e-63, Identities = 165/460 (35%), Positives = 253/460 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           ++KTK+  T+GP+              E++ ++E        +  AG+N  R NFSHGD+EE   R+  V+E++K+    I+ +LDTKGPEIR  K    +VE+   ++  +Y     + G + K +V     TY  +A DV+PGNTI +DDG + L V S  VE   +    +NT ++  +K +N+P  +  +P +++KD++D+IF  +     IAASFV    +V  I+K+L E+GG++I I  KIE   G+ ++D I++ SD++MVARGDLG+E+P   VP  +K II+ C   GK V+ ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGE+ANG YP+ AV  MAKI   +E    +  A   Y  +   M E +   A   A           +  + ++I+         + +S  R    I  VT  +  A +   ++GV+  V D +
  S:     1 MRKTKMICTIGPA-------------SEDREILEQ-------VMLAGMNASRHNFSHGDHEEHRGRIEKVKELSKKLDKEIAIILDTKGPEIRTGKFEPNKVELVKGTEFTVYAGDMSVVGDTTKCAV-----TYEGLANDVKPGNTILIDDGLVGLTVKS--VEGNAVICEVQNTGLVGTHKGVNVPGVSIQLPALTEKDKSDLIFGCEMGVTMIAASFVRKAADVVAIRKVLDENGGKNILICPKIENQEGVDNIDSILEISDAVMVARGDLGVEIPIEQVPAVQKMIIQKCNAAGKPVVTATQMLDSMIRNPRPTRAEVSDVANAILDGTDAIMLSGESANGTYPVEAVRTMAKIAAETEKQLAHKVA---YSNDKSSMSEVISRAACNAA-----------NELEATAIISSTQTGATAKRISKSRPDCTIIAVTPDEVVAKQLAFSWGVYPIVADKM 421
>gi|134298258|ref|YP_001111754.1| pyruvate kinase [Desulfotomaculum reducens MI-1] >gi|134050958|gb|ABO48929.1| pyruvate kinase [Desulfotomaculum reducens MI-1] (578 aa)
Score = 626, Expect = 5.1e-63, Identities = 171/452 (37%), Positives = 246/452 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+ + ++ T+ +  K                   AG+NV R NFSHG +EE   R+  +R  A+E G NI+ +LDTKGPEIR+    E+ V +++       TT+  IG     SV     TY +++KDV+ G+ I VDDG +  E++   VEE  I     N   +   K +NLPD + ++P +++KD  DI F I+ + D+IAASFV    +V  I+KIL++ G + I II+KIE+   + +LD+II  SD IMVARGDLG+E+P  +VP  +K II  C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+ANG YP+ AV  M +I   SE    D  +     F  T  + + V T+A  +               D ++I+         + +S  R  + I  VT  +    R  L +GV
  S:     1 MRKTKIVCTIGPA-SERLETINEMIK-------------------AGMNVARLNFSHGSHEEHAKRITTIRCAAQEMGQNIAILLDTKGPEIRLGDFQEQPVLLEAGQSF-FLTTEPIIGDQHGVSV-----TYEDLSKDVKRGDRILVDDGLI--ELVVEAVEEKKIVCRVMNGGKVSNRKGVNLPDIHVNLPAVTEKDIADIKFGIEQQVDFIAASFVRKAGDVLAIRKILEDDGAK-IDIIAKIESREAVDNLDEIIQASDGIMVARGDLGVEIPAEEVPIIQKKIITICNQVGKPVITATQMLDSMIQNPRPTRAEASDVANAIFDGTDAIMLSGESANGKYPVEAVRTMDRIARRSEQALSDGAKTYTNCFSVTDALGQAVCTVANQL---------------DAAAIITATTSGYTAKMISRYRPQSAIVAVTPDRGVMRRLSLVWGV 410
>gi|152970682|ref|YP_001335791.1| pyruvate kinase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150955531|gb|ABR77561.1| pyruvate kinase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (470 aa)
Score = 626, Expect = 5.6e-63, Identities = 148/356 (41%), Positives = 209/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  + +AG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG +E  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+IQIISKIE   G+ + D+I++ SD IMVARGD+G+E+P  +V   +K II+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTKMLEAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKKAAILLDTKGPEIRTIKLEGGNDVSLKAGQTFTFTTDKSVIGNNEIVAV-----TYEGFTSDLAVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVVEIREHLKAHGGENIQIISKIENQEGLNNFDEILEASDGIMVARGDMGVEIPVEEVIFAQKMIIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVTIMATI 331
>gi|59712865|ref|YP_205641.1| pyruvate kinase [Vibrio fischeri ES114] >gi|163730300|ref|ZP_02137775.1| pyruvate kinase [Vibrio fischeri MJ11] >gi|59480966|gb|AAW86753.1| pyruvate kinase I [Vibrio fischeri ES114] >gi|161396452|gb|EDQ20746.1| pyruvate kinase [Vibrio fischeri MJ11] (470 aa)
Score = 626, Expect = 6.0e-63, Identities = 148/356 (41%), Positives = 214/356 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                     E+ +K L  L +AG+NV+R NFSHGD+ E   R++ VR+V K  G  ++ +LDTKGPEIR  K     +V + +       T    +G  +  +V     TY   A D++ GNTI VDDG +++EV+++   E  ++    N   L ENK +NLP  +  +P +S+KD+ D+ F  +   D++AASF+   ++V+EI+++L  +GGE+IQIISKIE   G+ + D I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ AV +MA+I
  S:     1 MKKTKIVCTIGPKT-------------------ESVEK-LTELANAGMNVMRLNFSHGDFAEHGQRIDNVRQVMKNTGKQLAILLDTKGPEIRTIKLENGDDVALVAGQDFTFTTDTSVVGNKDVVAV-----TYPGFANDLEVGNTILVDDGLIEMEVVATTETE--VKCKVLNNGDLGENKGVNLPGVSVQLPALSEKDKADLKFGCEQGVDFVAASFIRKEEDVKEIRELLVANGGENIQIISKIENQEGVDNFDSILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGESAKGKYPVEAVTIMAQI 331
>gi|159485206|ref|XP_001700637.1| pyruvate kinase [Chlamydomonas reinhardtii] >gi|158272069|gb|EDO97875.1| pyruvate kinase [Chlamydomonas reinhardtii] (2159 aa)
Score = 625, Expect = 6.5e-63, Identities = 162/458 (35%), Positives = 247/458 (53%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY------NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVV 460
           +++KTKI  T GP+                      +++ L  L DAG N+VR NFSHGD+E     L   R+V  EK  + + +LDTKGPEIR     + K++E+ ++ KV I+    E    E +    +  T+       +   V+ GN I + DG + + V+   V+   +     NT  L + K  NLP     IP ++ KD +D+  F +K+K D++AASFV +  +V  I+ IL + GG+ ++IISKIE   G+K+ D+I++ +D +MVARGDLG+E+P   VP  +K +I      GK VI ATQM++S+ T   PTRAE+TDV  AV  G D  MLSGE+ANG Y   AVE MA+I  S+E   ++ ++ D   K TP     V  + +++A     K  +D        IVVF    ++ + ++  R  AP+  VT     A      +G + +++
  S:  1116 IVRKTKIICTAGPACW--------------------SEEGLGKLLDAGCNIVRLNFSHGDHEGHFSVLQRWRKVCAEKDSHAACLLDTKGPEIRTAMLKDGKDIELVANQKVTIHAVGDEYVKWEGYKDAATGETHIGLSYGKLCSSVKAGNRILLADGSISI-VVDEIVDGTTLIGTVLNTKKLGQRKNCNLPGVKVDIPVLTKKDIDDLQNFCVKHKMDFVAASFVQSQQDVLYIRSILDDAGGKDVKIISKIENAEGLKNFDEILEVTDGVMVARGDLGMEIPVEKVPLAQKMLITKANIAGKFVICATQMMESMITNPVPTRAEMTDVANAVWDGVDAVMLSGESANGAYFGQAVETMARIARSAEIGVNFYQSFDYTHKFTPKPVSAVEAMCSSLA-----KNAVD---IRPGMIVVFSEGGKVARLVAKYRPCAPVLVVTSNAGLARYCSSLFGCYPRLL 1552
Score = 604, Expect = 2.1e-60, Identities = 161/453 (35%), Positives = 246/453 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY------NMAKDVQPGNTIFVDDGKLKL---EVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEH-GGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-----------GRAIDVYFKETPFMKEKVGTLATTIATLVAP---KRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYG 454
           ++ +KTKI  T GP+                      +++ L  L DAG NV+RFNFSHGD++     L   R+V   KG   + +LDTKGPEIR     + K++E+++   + +     E    E +    +  T+       +   V+PG+ I + DG + +   E+ S+    G +     N+  L + K  NLP     IP +++KD +D+  FA K+K D++AASFV +  +V+ I++ L    GGEH++IISKIE + G+K+ D+I+ ESD IMVARGDLG+E+P   VP  +K +I      GK VI ATQML+S+ +  +PTRAE+TDV  AV  G DC MLSGE+ANG +P  AV  MA I  ++E   DY            +  ++       M   V ++A        P   +RV  N+    + IVV   D R    +S  R    +   +  ++   +  +++G
  S:     8 ELARKTKIICTAGPACW--------------------SEEGLGKLLDAGCNVLRFNFSHGDHDGHYSVLERFRKVCTAKGSYAACLLDTKGPEIRTAMLKDGKDIELEAGQSIVVEAVGAEYTKWEGYKDAANGETHIGLSYDKLCSSVKPGSKILLADGSISIRVDEITSARTLRGTV----MNSKKLGQRKNCNLPGVKVDIPVLTEKDIDDLQQFAAKHKMDFVAASFVQSAADVQFIRRTLDAAPGGEHVKIISKIENLEGLKNYDEILRESDGIMVARGDLGMEIPSEKVPVAQKMMITKANIAGKFVICATQMLESMISNPRPTRAEMTDVANAVYDGVDCVMLSGESANGDFPDIAVSTMAAIVANAEVGVDYYSQYSFIRYWATKGNEIAMTPDECMMSSVASMAVGFTEDTTPEAFRRVARNNTL--TIIVVLTADGRAANLVSKYRPPCLVVVASTNEQVLRQAAVSFG 460
Score = 570, Expect = 1.8e-56, Identities = 145/375 (38%), Positives = 215/375 (57%)
  Q:     7 TKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNIST-----------MLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTG------TY-NMAKDVQPGNTIFVDDGKLKL---EVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETP 381
           TK+  T+GPS                      +++ +  L DAG++++R NFSHGD++     L   R+V K K    S            +LDTKGPEIR     + K++E+ +   + I     +    E +   ++TG      +Y  +   VQ GN I + DG + +   EV S+N+  G +     N+  L + K  NLP     IP +++KD +D+  F  K++ DY+AASFV +  +V+ I+++L E GG  ++IISKIE   G+ + D+I+ ESD IMVARGDLG+E+P   VP  +K +I      GK +I ATQML+S+ +  +PTRAE+TDV  AV  GTDC MLSGETANG +P  AV  MA I +++E   +  +        TP
  S:   573 TKVICTMGPSCW--------------------SEETMGKLLDAGMDIIRLNFSHGDHKGHFEVLERFRKVCKTKQEEFSAKGAPSAPHWGCLLDTKGPEIRTAMLKDGKDIELVAGQTIFIEAVGADYVKWEGYKD-EATGETRIGLSYGKLCSSVQQGNKILLADGSISIVVEEVCSANLLRGTV----LNSKKLGQRKNCNLPGVKVDIPVLTEKDIDDLQNFCAKHEMDYVAASFVQSAADVQFIRRVLDEAGGHRVKIISKIENAEGLVNYDEILRESDGIMVARGDLGMEIPAEKVPLAQKMMITKANIAGKFIITATQMLESMISNPRPTRAEMTDVANAVLDGTDCVMLSGETANGSFPEAAVSTMAAICLNAEQMVEVNKRFRFLRNHTP 945
Score = 430, Expect = 2.7e-40, Identities = 115/367 (31%), Positives = 192/367 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-----YKTSE--KEVEIKSDSKVRIYTTKKE-----IGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYG 370
           ++KTK+  T+GPS                      ++  L  L   G N+ RFNF+HG+       LN +R V   +G  ++ MLD  G  +R      Y T +  K++E+++  KV +Y T        +G      V       ++A+ V+PG  I V DG +  EV+S     G ++ +  N   L   K ++L        F +  D   ++ FA+ N  +++A   VN+ ++V  I+  L ++GGE I++I+KIE+  G+++LD+IID +D +++ARG LG+ V    V   +  ++      GK VI++ QML+S+ +  +PTRAE+TDV  AV  G  C ML  ET++G +P ++      I  ++E+   Y 
  S:  1662 VRKTKLGFTMGPSCN--------------------SEDVLRQLVRGGANIARFNFAHGEMAAHQAMLNKLRTVCAAEGRTVAVMLDLDGNVLRTSDLIDYDTKQPIKKIELQAGDKVELYGTDDTSPNHFVGYKVADKVRIGVSLADLAECVKPGGLIRVHDGLITFEVVSVR-PGGPVQAVVLNHAFLYARKPVHLVGVTIHSSFPAPADLEALMAFALPNAIEFVAVG-VNSRNDVNAIRSFLDDNGGESIKLIAKIESEGGLRNLDEIIDAADGVILARGKLGMVVTPEKVALAQSVVVTKANVAGKPVIISRQMLESMVSNPRPTRAEMTDVANAVLDGASCLMLCSETSSGAFPADSFTTAVNIVRNAEHATSYA 2019
>gi|119468563|ref|XP_001257862.1| pyruvate kinase [Neosartorya fischeri NRRL 181] >gi|119406014|gb|EAW15965.1| pyruvate kinase [Neosartorya fischeri NRRL 181] (527 aa)
Score = 625, Expect = 7.7e-63, Identities = 162/452 (35%), Positives = 246/452 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           K  ++T I  T+GP                       + + + AL  AG+NVVR NFSHG YE     ++  RE  + + G  ++  LDTKGPEIR   T  +K++ I++  ++ I T +K      +K   LD     N+ K ++PG  I+VDDG L  EV+   V++  +     N   +   K +NLP ++  +P +S+KD +D+ F +KN+ D + ASF+  G ++R I+++L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV++M++  + +E    + +  D      P   + V ++A  +A + A   +      +  +IVV     +  + LS  R   PI  VT +   A R+   Y
  S:    30 KNFRRTSIICTIGPKTN--------------------SVEKINALRRAGLNVVRMNFSHGSYEYHQSVIDNAREAERVQTGRPVAIALDTKGPEIRTGNTVGDKDIPIQAGHELNITTDEKYATACDDKNMYLDYK---NITKVIEPGKLIYVDDGILSFEVLEI-VDDQTLRVKCLNNGNISSRKGVNLPGTDVDLPALSEKDISDLKFGVKNRVDMVFASFIRRGSDIRHIREVLGEQGKE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFLAQKMMIAKCNMKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPTEAVKMMSETCLLAEVAIPHFQVFDELRNLAPRPTDTVESIA--MAAVSASLEL------NAGAIVVLTTSGKTARLLSKYRPVCPIIMVT-RNPMAARYSHLY 450
>gi|27468291|ref|NP_764928.1| pyruvate kinase [Staphylococcus epidermidis ATCC 12228] >gi|57867187|ref|YP_188834.1| pyruvate kinase [Staphylococcus epidermidis RP62A] >gi|81674239|sp|Q5HNK7|KPYK_STAEQ Pyruvate kinase (PK) >gi|81843668|sp|Q8CS69|KPYK_STAES Pyruvate kinase (PK) >gi|27315837|gb|AAO04972.1|AE016748_206 pyruvate kinase [Staphylococcus epidermidis ATCC 12228] >gi|57637845|gb|AAW54633.1| pyruvate kinase [Staphylococcus epidermidis RP62A] (585 aa)
Score = 624, Expect = 8.4e-63, Identities = 163/452 (36%), Positives = 247/452 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+                      +++ L  L +AG+NV R NFSHG +EE   R++ +R+VAK     I  +LDTKGPEIR +   +  + ++   +V +   + E GT EKFSV     TY N+  DV  G+ I +DDG ++L+V   N ++G ++    NT  L+  K +NLP    ++P ++DKD +DI F IK   D+IAASFV    +V +I++IL+E   E I I  KIE   GI ++++I++ SD +MVARGD+G+E+P   VP  +K +I+ C   GK VI ATQMLDS++   + TRAE +DV  A+  GTD  MLSGETA G YP  AV+ M  I VS+E   DY +           + ++   + T++   +           +  +IV         + +S  R  + I  VT  ++ A +  + +GV
  S:     1 MRKTKIVCTIGPA--------------------SESEEMLEKLMNAGMNVARLNFSHGSHEEHKARIDTIRKVAKRLNKTIGLLLDTKGPEIRTHNMKDGLIVLEKGKEVIVSMNEVE-GTPEKFSV-----TYENLINDVNIGSYILLDDGLVELQVKEINKDKGEVKCDILNTGELKNKKGVNLPGVKVNLPGITDKDADDIRFGIKENVDFIAASFVRRPSDVLDIRQILEEEKAE-ITIFPKIENQEGIDNIEEILEVSDGLMVARGDMGVEIPPESVPMVQKDLIRKCNKLGKPVITATQMLDSMQRNPRATRAEASDVANAIYDGTDAVMLSGETAAGQYPEEAVKTMRNIAVSAEAAQDYKK----------LLSDRTKLVETSLVNAIGVSVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEKTARQCAIVWGV 416
>gi|194291653|ref|YP_002007560.1| PYRUVATE KINASE; tartrate degradation [Cupriavidus taiwanensis] >gi|193225557|emb|CAQ71503.1| PYRUVATE KINASE; tartrate degradation [Cupriavidus taiwanensis] (472 aa)
Score = 624, Expect = 9.1e-63, Identities = 151/455 (33%), Positives = 242/455 (53%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M+ ++  KI ATLGP+ T             + G+IE       ALFDAG +V R NFSHG +++   RL+ +R + +E+G  I  +LD +GP++R+   +E  V++ +++  R+   +   G++ + S+        +   ++ G+ + +DDGK++L V          +T   N   L + K +N+P     +  M+DKDR D+ F +    D+IA SFV   +++ EIK I+++  G    I++K+E    I+SLD I+ E+D++MVARGDLG+E+P   VP+ +K+I++ CR  GK VIVATQML+S+     PTRAE +DV  AV  G D  MLS E+A+G YP+ AV++M  I   +E+   Y  AI      TP   E    +   +  +    RV         + V + +       ++  R   PI  +T +   A R  L +GV
  S:     1 MRRLRNAKIVATLGPAST-------------SPGIIE-------ALFDAGADVFRLNFSHGSHDDHRQRLDTIRAIERERGRPIGVLLDLQGPKLRIGAFAEGPVQLAAEASFRLDLDQDVPGSAARVSLPHP----EIFAALREGSELLLDDGKIRLRV--DRCGSDFADTTVVNGGTLSDRKGVNVPGVVLPLSAMTDKDRRDLEFGLALGVDWIALSFVQRPEDIHEIKAIVQDRAG----IVAKLEKPAAIQSLDAIVAEADAVMVARGDLGVEMPAEQVPSLQKHIVRACRKAGKPVIVATQMLESMVAAPVPTRAEASDVATAVYDGADAVMLSAESASGRYPVEAVKMMNSIITRTESDPLYHDAIQA--SHTPPRAEAADAIGYAVRHVAGLLRV--------PATVAYTSSGYSALRMARERPEVPILGMTPRIATARRLALAWGV 415
>gi|147678549|ref|YP_001212764.1| pyruvate kinase [Pelotomaculum thermopropionicum SI] >gi|146274646|dbj|BAF60395.1| pyruvate kinase [Pelotomaculum thermopropionicum SI] (584 aa)
Score = 624, Expect = 9.7e-63, Identities = 168/452 (37%), Positives = 243/452 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +++TKI  T+GP+                   +E  KK    L  AG+NV R NFSHG +EE   R+  +R  A E G N++ MLDTKGP+IR+    E+ V +     V + TT+   G  E+  V        +  DV+PG+T+ V DG + L+V+S+N  E  I     N   L   K +N+P    ++P ++DKD  DI F I+ + D+IAASF+    +V  I+++L+E G + I IISKIE+   + +LDDII  SD IMVARGDLG+E+P  +VP  +K II+ C   GK V+ ATQML+S+    +PTRAE +DV  A+  GTD  MLSGETA G YP+ AVE MA+I   +E    Y    ++  K+  F   +  T A + AT    + +        ++I+         + +S  R  AP+  VT       +  L +GV
  S:     1 MRRTKIVCTIGPA----------------SDDVEVIKK----LLRAGMNVARLNFSHGTHEEHGRRIASIRRAAGEVGKNVAIMLDTKGPQIRLGYFKEEPVILSQGDMVSL-TTQDVKGDKERIPV----NYPGLPGDVRPGDTVLVADGLIALKVLSTNETE--IRCRVENGGELTSQKGVNVPGVPVNLPAVTDKDVEDIRFGIEQRVDFIAASFIRKKADVLAIRQLLEEAGAD-IDIISKIESREAVDNLDDIIKVSDGIMVARGDLGVEIPAEEVPLVQKIIIEKCNRAGKPVVTATQMLESMIHNPRPTRAEASDVANAIFDGTDAVMLSGETAAGKYPVEAVETMARIAERAEAALRYE---EILVKKRAFSSRRNVTDAISYATCATAQDL------GAAAIITATESGYTAKNVSKYRPQAPVVAVTPHARVMRKLALVWGV 415
>gi|9955367|pdb|1E0T|A Chain A, R292d Mutant Of E. Coli Pyruvate Kinase >gi|9955368|pdb|1E0T|B Chain B, R292d Mutant Of E. Coli Pyruvate Kinase >gi|9955369|pdb|1E0T|C Chain C, R292d Mutant Of E. Coli Pyruvate Kinase >gi|9955370|pdb|1E0T|D Chain D, R292d Mutant Of E. Coli Pyruvate Kinase (470 aa)
Score = 624, Expect = 1.0e-62, Identities = 148/356 (41%), Positives = 207/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ LA + DAG+NV+R NFSHGDY E   R+  +R V  + G   + +LDTKGPEIR  K     +V +K+       T K  IG SE  +V     TY     D+  GNT+ VDDG + +EV +    + I + +  N   L ENK +NLP  + ++P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGGE+I IISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI AT MLDS+    +PT AE  DV  A+  GTD  MLSGE+A G YP+ AV +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAV-----TYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVL--NNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATMMLDSMIKNPRPTDAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATI 331
>gi|172058220|ref|YP_001814680.1| pyruvate kinase [Exiguobacterium sibiricum 255-15] >gi|171990741|gb|ACB61663.1| pyruvate kinase [Exiguobacterium sibiricum 255-15] (582 aa)
Score = 623, Expect = 1.1e-62, Identities = 164/460 (35%), Positives = 246/460 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +++TKI  T+GP+                      ++K L  + +AG+NV R NFSHGDYEE   R+  +R  A+E    ++ +LDTKGPEIR +   E K + ++    + +     EI GT++KFSV     TY+ +  DV+ G+ I +DDG + L V        ++  I  N  I++  K +NLP+   ++P ++DKD  DI F IK+  D IAASFV    +V  I+++L++H   HI+I  KIE   G+ ++++II  SD +MVARGDLG+E+P  +V   +K +IK C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G YPI +V++M  I   +E   DY             +K++      T+   +A          D  +I+           +S  R    I  VT     A +  + +GV+  VVD++
  S:     1 MRRTKIVCTIGPA----------------------SEKRLPEMIEAGMNVARLNFSHGDYEEHGARITDIRRAAEEANKLVTILLDTKGPEIRTHTFEEGKALLVRGKQVIVVSGDANEIVGTADKFSV-----TYDGLYDDVEVGSMIMLDDGLIGLRVAEKLDNRELLCDI-ENEGIIKTKKGVNLPNVKVNLPALTDKDIADIEFGIKSDIDLIAASFVRRASDVVAIRQLLEKHNASHIKIFPKIENQEGVANIEEIIAISDGLMVARGDLGIEIPTEEVTPTQKDLIKICNDYGKPVITATQMLDSMQRFPRPTRAEASDVANAILDGTDAIMLSGETAAGDYPIESVQMMHTIAKRTEKMLDYKM----------LLKDRQTRSEHTVTDAIAQAVTHTAINLDAKAILTPTQSGYTAARISKYRPEPNIVAVTPSARVARQLNIVWGVYPIVVDHL 425
>gi|146296836|ref|YP_001180607.1| pyruvate kinase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410412|gb|ABP67416.1| pyruvate kinase [Caldicellulosiruptor saccharolyticus DSM 8903] (583 aa)
Score = 623, Expect = 1.2e-62, Identities = 165/453 (36%), Positives = 257/453 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLAT-TIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI  TLGP+   +                E  +K    L + G++V R NFSHG +EE   ++++++++ +E    I  +LDTKGPEIR+    + +VE+K   +  + TT++ +G  E  S+     TY  + KDV+PG+ I +DDG ++L V+    ++ II  + +N  IL   K +N+P     +P ++ KD+ DI+F I+N  D++AASF+    +V EI++ L +H G+ I II+KIET  G+ + D+II  +D IMVARGDLG+E+P+ +VP  +K +I+ C   GK VI ATQML+S+    +PTRAEV+D+  A+  GT   MLSGETA G YP+ +V  MAKI    E+  DY +       + P       + AT T A  +  K +I        ++   GN  R++   S  R A PI   T  ++   +  L++GV+
  S:     1 MRKTKIICTLGPATNSE----------------EIIRK----LIENGMDVARLNFSHGTHEEHKKKIDMIKKIREELDKPIPILLDTKGPEIRIGFFKDGKVELKEGQRFTL-TTEEILGNEEIVSI-----TYKELVKDVKPGDKILIDDGLIEL-VVEDKTDKNIICKV-KNGGILTNQKGVNVPGIPIRLPALTQKDKEDILFGIENDVDFVAASFIRKASDVVEIREFLNKHNGKDILIIAKIETQEGVANCDEIIRVADGIMVARGDLGVELPFEEVPLVQKMLIEKCYKAGKPVITATQMLESMIRNPRPTRAEVSDIANAIFDGTSAIMLSGETAMGKYPVESVATMAKIAERVESQIDYVKRFQSQVFDMPVNVTNAISHATCTTAHDLGAKAII--------TVTKSGNTARMV---SKFRPACPIIATTPCEKVRRQLNLSWGVY 416
>gi|157337777|emb|CAO22123.1| unnamed protein product [Vitis vinifera] (491 aa)
Score = 623, Expect = 1.3e-62, Identities = 146/388 (37%), Positives = 216/388 (55%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+                      +   L  L  AG+NV RFNFSHG +E     L+ +R      G+  + MLDTKGPEIR  +   EK + +K   ++ I +T   I   EK   +       +A+DV+P + I   DG +   V+S + ++G++     N+ +L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++ E++K+L +H  ++I ++SK+E   G+ + D+I+  SD+ MVARGDLG+E+P   +   +K ++  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV  MAKI + +E+  DYG       K  P     + +LA +
  S:    17 KTKIVCTLGPACR--------------------SVPMLEKLLRAGMNVARFNFSHGSHEYHLETLSNLRAAMDSTGILCAVMLDTKGPEIRTGFLKDEKPIHLKQGQEITI-STDYNIKGDEKMICMSYK---KLAEDVKPDSVILCADGTITFTVLSCDKQKGLVCCRCENSAVLGERKNVNLPGVIVDLPTLTEKDKEDILNWGVPNKIDMIALSFVRKGSDLVEVRKLLGKHA-KNILLMSKVENQEGVANFDEILANSDAFMVARGDLGMEIPIEKIFLAQKVMVYKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICIEAESTLDYGDVFKRIMKNAPVPMSPLESLAAS 381
>gi|169350605|ref|ZP_02867543.1| hypothetical protein CLOSPI_01376 [Clostridium spiroforme DSM 1552] >gi|169292659|gb|EDS74792.1| hypothetical protein CLOSPI_01376 [Clostridium spiroforme DSM 1552] (476 aa)
Score = 622, Expect = 1.5e-62, Identities = 141/366 (38%), Positives = 217/366 (59%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           + KTKI  T+GP+                      +K+ +  L  AG+NV+R NFSHG +EE   R+ L+ E+ KE G +++ +LDTKGPEIR         E K    V I     E GTS++F++       ++  D++PG+ I V+DG++  E++  +V+   I  +  N  +++  + IN+P       ++S +D +D+ F     F+Y+AASFV    ++ +IKK+L E+    IQ+I+KIE   G++++D+I++ +D IM+ARGDLG+EVP  DVP  +K II  C+  GK VI ATQML+S++T  +PTRAEV+DV  A+  GTD  MLSGE+A G YP  +V  M++I + +E   DY
  S:     7 MSKTKIICTIGPA--------------------SESKEMMTKLVKAGMNVMRLNFSHGSHEEHLNRIKLITEINKELGSSVAILLDTKGPEIRTGDFKGGYAEFKKGQIVTICQEDIE-GTSDRFTI----SYKDLYHDIKPGSFILVNDGQV--ELLVDHVDGTDIVCVCANDGVVKNKRGINVPGIKLGFNYLSKRDIDDLKFGCLQPFNYVAASFVRRAQDIFDIKKLLIENDRPDIQVIAKIENKEGVENIDEILNIADGIMIARGDLGVEVPAEDVPLIQKSIISKCKDMGKIVITATQMLESMQTNPRPTRAEVSDVANAIFDGTDAIMLSGESAAGQYPQESVMTMSRIALKTEQSLDY 345
>gi|15242313|ref|NP_196474.1| pyruvate kinase, putative [Arabidopsis thaliana] >gi|9759351|dbj|BAB10006.1| pyruvate kinase [Arabidopsis thaliana] >gi|29824378|gb|AAP04149.1| putative pyruvate kinase [Arabidopsis thaliana] >gi|30793821|gb|AAP40363.1| putative pyruvate kinase [Arabidopsis thaliana] >gi|110739085|dbj|BAF01459.1| pyruvate kinase [Arabidopsis thaliana] (510 aa)
Score = 621, Expect = 2.2e-62, Identities = 150/390 (38%), Positives = 214/390 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           I KTKI  TLGP+                  +IE        L  AG+NV RFNFSHG +E     L+ +R      G+  + MLDTKGPEIR  +      +++K   ++ I TT  +I   E      S     +  DV+PGNTI   DG + L V+S + E G +     N+ +L E K +NLP     +P ++DKD  DI+ + + N  D IA SFV  G ++  ++K+L  H  + I ++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV+VMAKI + +E+  DY        + TP     + +LA++
  S:    19 IPKTKIVCTLGPA-------------SRTVSMIEK-------LLKAGMNVARFNFSHGSHEYHQETLDNLRSAMHNTGILAAVMLDTKGPEIRTGFLKDGNPIQLKEGQEITI-TTDYDIQGDES---TISMSYKKLPLDVKPGNTILCADGSISLAVLSCDPESGTVRCRCENSAMLGERKNVNLPGVVVDLPTLTDKDIEDILGWGVPNSIDMIALSFVRKGSDLVNVRKVLGSHA-KSIMLMSKVENQEGVINFDEILRETDAFMVARGDLGMEIPIEKIFLAQKLMIYKCNLAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEIAVKVMAKICIEAESSLDYNTIFKEMIRATPLPMSPLESLASS 385
>gi|50120797|ref|YP_049964.1| pyruvate kinase [Pectobacterium atrosepticum SCRI1043] >gi|49611323|emb|CAG74770.1| pyruvate kinase [Erwinia carotovora subsp. atroseptica SCRI1043] (470 aa)
Score = 620, Expect = 2.4e-62, Identities = 143/356 (40%), Positives = 208/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L  AG+NV+R NFSHGDY E   R+  +R V ++ G   + +LDTKGPEIR  K     +V + +       T +  +G  ++ +V     TY    +D+  GNT+ VDDG + ++V + +  + + + +  N   L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI+  LK HGGEHIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLGNLLSAGMNVMRLNFSHGDYVEHGQRIKNLRAVMEKTGQQAAILLDTKGPEIRTMKLENGADVTLTAGQTFTFTTDQSIVGNKDRVAV-----TYAGFTEDLSVGNTVLVDDGLIGMQVTAVSGNDVVCKVL--NNGDLGENKGVNLPGVSIQLPALAEKDKRDLIFGCEQGVDFVAASFIRKRSDVEEIRAHLKAHGGEHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNLARKVVITATQMLDSMIKNPRPTRAEAGDVANAIIDGTDAVMLSGESAKGKYPLESVTIMATI 331
>gi|86171639|ref|XP_966251.1| putative pyruvate kinase [Plasmodium falciparum 3D7] >gi|46361220|emb|CAG25081.1| putative pyruvate kinase; pyruvate kinase, putative [Plasmodium falciparum 3D7] (511 aa)
Score = 620, Expect = 2.6e-62, Identities = 150/365 (41%), Positives = 215/365 (58%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVN--ISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           KKT I  TLGP+                   +ET    L  L DAG+++ RFNFSHG +E+     N V + A+E   N  +  +LDTKGPEIR      KEV +K  SK+++ T  + +G     +         + + V+PGN I + DG +  +V+ ++ +  I E +  N+ ++ E K +NLP+    +P +S+KD+NDI+ FAI    ++IAASF+ + D+VR I+ +L   G  HI+II KIE + GI   D I+ ESD IM+ARGDLG+E+    V   +K +I  C  +GK +I ATQML+S+    +PTRAEVTDV  AV  GTDC MLSGETA G +P+ AV +M+KI + +E   DY
  S:    37 KKTHIVCTLGPACKS----------------VET----LVKLIDAGMDICRFNFSHGSHEDHKEMFNNVLK-AQELRPNCLLGMLLDTKGPEIRTGFLKNKEVHLKEGSKLKLVTDYEFLGDETCIAC----SYKKLPQSVKPGNIILIADGSVSCKVLETHEDHVITEVL--NSAVIGERKNMNLPNVKVDLPIISEKDKNDILNFAIPMGCNFIAASFIQSADDVRLIRNLLGPRG-RHIKIIPKIENIEGIIHFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCNLQGKPIITATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDY 376
>gi|15236190|ref|NP_194369.1| pyruvate kinase, putative [Arabidopsis thaliana] >gi|4033431|sp|O65595|KPYC_ARATH Probable pyruvate kinase, cytosolic isozyme (PK) >gi|2982467|emb|CAA18231.1| pyruvate kinase like protein [Arabidopsis thaliana] >gi|7269491|emb|CAB79494.1| pyruvate kinase like protein [Arabidopsis thaliana] (497 aa)
Score = 620, Expect = 3.0e-62, Identities = 146/370 (39%), Positives = 213/370 (57%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYG 370
           M+   KTKI  TLGP+               ++ V    K     L  AG++V RFNFSHG YE     L+ +R+     G+  + MLDTKGPEIR  +    K +++K   ++ I +T  ++   EK   +       +A+DV PG  I   DG + L+V+S + E+G +     NT +L E K +NLP     +P +++KD+ DI+ + + N+ D IA SFV  G ++ +++K+L +H  + I ++SK+E   G+ + DDI+  SD+ M+ARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV  MAKI V +E+  DYG
  S:     3 MEQRPKTKIVCTLGPA---------------SRSVPMVEK-----LLMAGMSVARFNFSHGSYEYHQETLDNLRQAMLNTGMLCAVMLDTKGPEIRTGFLKDGKPIQLKQGQEITI-STDYDLKGDEKTICMSYK---KLAQDVNPGMVILCADGTISLKVLSCDKEKGTVRCRCENTSMLGERKNVNLPGVVVDLPTLTEKDKQDILEWGVPNQIDMIALSFVRKGSDLVQVRKLLGKHA-KTILLMSKVENQEGVANFDDILINSDAFMIARGDLGMEIPIEKIFLAQKVMIYKCNFMGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICVEAESTLDYG 349
>gi|115435946|ref|NP_001042731.1| Os01g0276700 [Oryza sativa (japonica cultivar-group)] >gi|56783704|dbj|BAD81116.1| putative pyruvate kinase, cytosolic isozyme [Oryza sativa Japonica Group] >gi|113532262|dbj|BAF04645.1| Os01g0276700 [Oryza sativa (japonica cultivar-group)] (510 aa)
Score = 619, Expect = 3.2e-62, Identities = 144/393 (36%), Positives = 216/393 (54%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           M+   KTKI  TLGP+                      + + +  L  AG+ V RFNFSHG +E     L+ +R   +  G+  + MLDTKGPEIR  +    K V++K   ++ + T     G     S+        +A D++PG+ I   DG + L V+  + E+G++     NT +L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++ E++K+L +H  + I ++SK+E   G+ + DDI+ +SD+ MVARGDLG+E+P   +   +K +I  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV  MAKI + +E+  D+           P     + +LA++
  S:    15 MRRRPKTKIVCTLGPA--------------------SRSVEMIGRLLRAGMCVARFNFSHGSHEYHQETLDNLRAAMESTGILCAVMLDTKGPEIRTGFLKDGKPVQLKKGQEITVSTDYSIKGDDNMISM----SYKKLAVDLKPGSVILCADGTITLTVLHCDKEQGLVRCRCENTAMLGERKNVNLPGVIVDLPTLTEKDKEDILKWGVPNKIDMIALSFVRKGSDLVEVRKVLGKHA-KSIMLMSKVENQEGVANFDDILAQSDAFMVARGDLGMEIPIEKIFYAQKVMIFKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICLQAESCVDHAAVFKSITASAPIPMSPLESLASS 384
>gi|15835226|ref|NP_296985.1| pyruvate kinase [Chlamydia muridarum Nigg] >gi|13629242|sp|Q9PK61|KPYK_CHLMU Pyruvate kinase (PK) >gi|7190647|gb|AAF39440.1| pyruvate kinase [Chlamydia muridarum Nigg] (481 aa)
Score = 619, Expect = 3.3e-62, Identities = 153/454 (33%), Positives = 250/454 (55%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDV-----YFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           MI +TKI  T+GP+           N PE           L  L DAG+NV R NFSHG +E     + +++E+ +++ V ++ MLDTKGPEIR+ +  E  +++K   ++ + T+K+ +G+ E    L  +  +   ++  P   + +DDG ++  V+  N +E +IE   +N+  ++ NK +++ D + ++PFM++KD  D+ F ++ + D IAASFV   +++  ++K+L+  G  ++ II+KIE   G+++  +I   SD IM+ARGDLG+E+   +VP  +K++ +  R  G+  I ATQML+S+     PTRAEV+DV  A+  GT   MLSGETA+G YPI AV+ M  I   +E  FDY     +       K +P++ E +G     IA   + K           +I+V+         LS  R   PI  VT  +    R  + +GV+
  S:     1 MIARTKIICTIGPAT----------NTPEM----------LEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQVPLAIMLDTKGPEIRLGQV-ESPIKVKPGDRLTL-TSKEILGSKEAGVTLYPSCVFPFVRERAP---VLIDDGYIQAVVV--NAQEHLIEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDITDLKFGVEQELDLIAASFVRCNEDIDSMRKVLENFGRPNMPIIAKIENHLGVQNFQEIAKASDGIMIARGDLGIELSIVEVPALQKFMARVSRETGRFCITATQMLESMIRNPLPTRAEVSDVANAIHDGTSAVMLSGETASGTYPIEAVKTMRSIIQETEKSFDYQAFFQLNDKNSALKVSPYL-EAIGASGIQIAEKASAK-----------AIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVY 420
>gi|187933683|ref|YP_001887522.1| pyruvate kinase [Clostridium botulinum B str. Eklund 17B] >gi|187721836|gb|ACD23057.1| pyruvate kinase [Clostridium botulinum B str. Eklund 17B] (471 aa)
Score = 619, Expect = 3.4e-62, Identities = 150/361 (41%), Positives = 218/361 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           ++KTK+  T+GP+              E++ ++E        +  AG+N  R NFSHGD+EE   R+  V+E++K+    I+ +LDTKGPEIR  K    +VE+   ++  +Y     + G + K SV     TY  +A DV+ GNTI +DDG + L V S      I E   +NT ++  +K +N+P  +  +P ++DKD++D+IF  +     IAASFV    +V  I+K+L E+GG++I I  KIE   G+ ++D I++ SD+IMVARGDLG+E+P   VP  +K II+ C   GK V+ ATQMLDS+    +PTRAEV+DV  A+  GTD  MLSGE+ANG YP+ AV  MAKI   +E
  S:     1 MRKTKMICTIGPA-------------SEDREILEQ-------VMLAGMNASRHNFSHGDHEEHRGRIEKVKELSKKLDKEIAIILDTKGPEIRTGKFEPNKVELVKGTEFTVYAGDMSVVGDTTKCSV-----TYEGLANDVKAGNTILIDDGLVGLTVKSVKGNAVICEV--QNTGLVGTHKGVNVPGVSIQLPALTDKDKSDLIFGCEMGVTMIAASFVRKAADVVAIRKVLDENGGKNILICPKIENQEGVDNIDSILEISDAIMVARGDLGVEIPIEQVPAVQKMIIQKCNAAGKPVVTATQMLDSMIRNPRPTRAEVSDVANAILDGTDAIMLSGESANGTYPVEAVRTMAKIAEETE 336
>gi|167628213|ref|YP_001678712.1| pyruvate kinase [Heliobacterium modesticaldum Ice1] >gi|167590953|gb|ABZ82701.1| pyruvate kinase [Heliobacterium modesticaldum Ice1] (596 aa)
Score = 619, Expect = 3.7e-62, Identities = 139/369 (37%), Positives = 208/369 (56%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAID 374
           +TKI  T+GP+ +                        L  +  AG+ V R NFSHG YEE   R+  VR+ A   G  I+ +LDTKGPEIR+ + S  ++ +   ++V ++     +GT E+  +        + +DV+PG  + +DDG +++EV +  VE G I    +N   +   K +++P     +P +S+K+  D+ F I    D++A SFV    +V  I+KIL++ G   +Q+I+KIE   G+ ++D+I+  SD IMVARGDLG+ +P  DVP  +K II+ C   GK VI ATQMLDS+    +PTRAE TDV  A+  GTD  MLSGETA G YP+ AV +MA+I + +E    +   +D
  S:    15 RTKIVCTVGPASSDPTI--------------------LMEMIRAGMRVARLNFSHGTYEEHAARIAAVRQAADALGQPIAILLDTKGPEIRLGQVSGGKITLDEGAEVTLFPDDGTLGTKERLPI----SYAGLVEDVRPGVRVLIDDGNIEMEVTA--VEAGEIRCRIKNGGDVSSRKGVSVPGVALRMPAISEKEVKDLEFGIAQDMDFVAISFVRDASDVLGIRKILEDRGAS-MQLIAKIENHQGVDNIDEILAVSDGIMVARGDLGVAIPTEDVPLVQKMIIEKCNIAGKPVITATQMLDSMIRNPRPTRAEATDVANAILDGTDAIMLSGETAAGKYPVEAVTMMARIAIRTEQALRHDEELD 356
>gi|77959199|ref|ZP_00823221.1| COG0469: Pyruvate kinase [Yersinia bercovieri ATCC 43970] (470 aa)
Score = 619, Expect = 4.0e-62, Identities = 147/356 (41%), Positives = 206/356 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       +++ L  L +AG+NV+R NFSHGDY E   R+  +R V  + G+    +LDTKGPEIR  K    K+  + +       T +  IG +   +V     TY   A D++ GNT+ VDDG + +EV  + V E  +     N   L ENK +NLP  +  +P +++KD+ D+IF  +   D++AASF+    +V EI++ LK HGG HIQIISKIE   G+ + D+I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YP+ +V +MA I
  S:     1 MKKTKIVCTIGPKTE--------------------SEEMLTNLLNAGMNVMRLNFSHGDYAEHGQRIKNIRAVMAKTGLKAGILLDTKGPEIRTMKLEGGKDAALVAGQTFTFTTDQSVIGNNTIVAV-----TYPGFAADLKIGNTVLVDDGLIGMEV--TEVTESNVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKADLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGGHIQIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVTIMATI 331
>gi|59668642|emb|CAI53675.1| pyruvate kinase [Glycine max] (502 aa)
Score = 618, Expect = 4.9e-62, Identities = 142/388 (36%), Positives = 218/388 (56%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+                      +   +  L  AG+NV RFNFSHG +E     L+ +R   +  G+  + MLDTKGPEIR  +    K +++   +++ I +T  ++   EK   +       + +DV+PG  I   DG +   V+S + + G+++    N+  L E K +NLP     +P ++DKD+ DI+ + + NK D IA SFV  G ++ E++K+L +H  ++I ++SK+E   G+ + D+I+  SD+ M ARGDLG+E+P   +   +K +I  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV+ MAKI + +E+  DYG       + +P     + +LA++
  S:    13 KTKIVCTLGPA--------------------SRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMENTGILCAVMLDTKGPEIRTGFLKDGKPIQLIQGNEITI-STDYDLKGDEKTICMSYK---KLPEDVRPGMVILCADGTISFTVLSCDKQAGLVQCRCENSATLGERKNVNLPGVIVDLPTLTDKDKEDILAWGVPNKIDMIALSFVRKGSDLVEVRKVLGKHA-KNIMLMSKVENQEGVANFDEILANSDAFMTARGDLGMEIPIEKIFLAQKVMIYKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPDLAVQTMAKICIEAESTLDYGDVFKRIMEHSPVPMSPLESLASS 377
>gi|4033434|sp|Q27788|KPYK_TRYBO Pyruvate kinase (PK) >gi|673499|emb|CAA54472.1| pyruvate kinase [Trypanoplasma borreli] (498 aa)
Score = 618, Expect = 4.9e-62, Identities = 150/357 (42%), Positives = 205/357 (57%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYT--TKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           + +  KI  T+GPS                      + + L  L  AG+NV R NFSHG YE     ++ VR+ A E G+++   LDTKGPEIR       +V I++   V + T  T KE GT+EKF V       N+ K V  G  IFVDDG L L V+  + ++  IE +A+NT  +   K INLP+++  +P +S+KD  D+ F  KN+ D++ ASF+   D V E+++      G  I +I+KIE   GI ++D IID +D IMVARGDLG+E+P   V   +K I+  C   GKTVI ATQMLDS+    +PTRAEV+DV  +V  G DC MLSGETA G YP+  V  M++I
  S:    21 LFRSNKIICTIGPS--------------------SQSVEVLKDLMKAGLNVARMNFSHGTYEYHQKTIDNVRKAASELGIHVGIALDTKGPEIRTGLFPAGDVVIEAHKTVILTTDETFKEKGTAEKFYV----DYMNITKVVPVGGHIFVDDGLLDLIVVKISGKD--IECVAQNTHTISNRKGINLPNADVDLPAVSEKDLMDLQFGAKNRVDFVFASFIRNADQVNEVRQAF----GGKIAVIAKIENYQGIDNIDAIIDAADGIMVARGDLGVEIPAEKVVIAQKMIMSKCNKVGKTVICATQMLDSMTHGPRPTRAEVSDVAKSVLDGADCVMLSGETAKGKYPVETVVYMSRI 349
>gi|118486626|gb|ABK95150.1| unknown [Populus trichocarpa] (512 aa)
Score = 618, Expect = 5.1e-62, Identities = 153/436 (35%), Positives = 225/436 (51%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV 439
           + +TKI  TLGPS                      +   L  L  AG+NV RFNFSHG +E     LN +R   +   +  + MLDTKGPEIR  +      +++K   ++ I T     G ++  S+        +  D++P NTI   DG + L V+S + + G +     NT +L E K +NLP     +P ++DKD+ DI+ + + N  D IA SFV  G ++  ++K+L  H  +HIQ++SK+E   G+ + D+I+ E+DS MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV+ M +I + +E+  DY        + TP     + +LA++        R           IVV        + ++  R A PI  V
  S:    21 VPRTKIVCTLGPS--------------------SRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTNILAAVMLDTKGPEIRTGFLKDGNPIQLKEGQEITITTDYSIKGDTDMISM----SYKKLPVDIKPRNTILCADGTITLTVLSCDPKAGTVRCRCENTAMLGERKNVNLPGVVVDLPTLTDKDKEDILGWGVPNNIDMIALSFVRKGSDLVNVRKVLGPHA-KHIQLMSKVENQEGVVNFDEILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNIVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKTMRRICIEAESSLDYAAIFKEMIRSTPLPMSPLESLASSAVRTANKARA--------KLIVVLTRGGTTAKLVAKYRPAVPILSV 425
>gi|145238652|ref|XP_001391973.1| pyruvate kinase pkiA-Aspergillus niger >gi|134076467|emb|CAK45107.1| pyruvate kinase pkiA-Aspergillus niger (526 aa)
Score = 617, Expect = 5.4e-62, Identities = 165/453 (36%), Positives = 250/453 (55%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           MK+   +K+   + PS   +  ++     P+   V     + + +L  AG+NVVR NFSHG YE     ++  RE AK + G  ++  LDTKGPEIR   T  +K++ IK   ++ I T ++    + +K   LD     N+ K + PG  I+VDDG L  EV+   V++  I     N   +   K +NLP ++  +P +S+KD  D+ F ++NK D + ASF+  G ++R I+++L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV++M++  + +E    +    D      P   + V ++A  +A + A   +      +  +IVV     +  + LS  R   PI  VT +   A+R+   Y
  S:    14 MKLEWHSKLNTEMVPSKNFRRTSIIGTIGPKTNSV-----EKINSLRTAGLNVVRMNFSHGSYEYHQSVIDNAREAAKTQVGRPLAIALDTKGPEIRTGNTPDDKDIPIKQGHELNITTDEQYATASDDKNMYLDYK---NITKVISPGKLIYVDDGILSFEVLEV-VDDKTIRVRCLNNGNISSRKGVNLPGTDVDLPALSEKDIADLKFGVRNKVDMVFASFIRRGSDIRHIREVLGEEGKE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPNEAVKMMSETCLLAEVAIPHFNVFDELRNLAPRPTDTVESIA--MAAVSASLEL------NAGAIVVLTTSGKTARYLSKYRPVCPIVMVT-RNPAASRYSHLY 450
>gi|39945886|ref|XP_362480.1| pyruvate kinase [Magnaporthe grisea 70-15] >gi|145019300|gb|EDK03528.1| pyruvate kinase [Magnaporthe grisea 70-15] (528 aa)
Score = 617, Expect = 6.3e-62, Identities = 163/455 (35%), Positives = 245/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKE-KGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           K  +++ I  T+GP  T  +  + D  K                   AG+NVVR NFSHG YE     ++  RE  K+  G  ++  LDTKGPEIR   T   E    S  K   +TT ++  TS      D+   Y    N+ K ++ G  I+VDDG L  EV+   ++E  +   ARN   +   K +NLP+++  +P +S+KD+ D+ F +KN  D + ASF+  G ++++I+++L + G  HIQII+KIE   G+ +  +I+ E+D +MVARGDLG+E+P  +V   +K +I  C   GK VI ATQML+S+    +PTRAE++DV  AV  G+DC MLSGETA G YP  AV  M+   + +EN   Y      +F+E      +  ++  + A + A +  +D    +   I+V        + LS  R   PIF VT +   A+R+   Y GV+
  S:    28 KNYRRSSIICTIGPK-TNSVEAMNDLRK-------------------AGMNVVRMNFSHGSYEYHQSVIDNAREAEKQMPGRQLAIALDTKGPEIRTGNTKNDEDLPISAGKELNFTTDEQYATS-----CDTDNVYVDYKNITKVIEKGRIIYVDDGVLAFEVLDV-IDEKTVRVRARNNGFICSKKGVNLPNTDVDLPALSEKDKADLRFGVKNNVDMVFASFIRRGQDIKDIREVLGQDGA-HIQIIAKIENRQGLNNFPEILKETDGVMVARGDLGIEIPAAEVFAAQKKMIALCNMAGKPVICATQMLESMIKNPRPTRAEISDVGNAVTDGSDCVMLSGETAKGSYPCEAVREMSDACLKAENTIPYVS----HFEEMCGAVHRPVSIVESCA-MAAVRASLD---INAGGIIVLSTSGVSARLLSKYRPVCPIFMVT-RNASASRYSHLYRGVY 452
>gi|673500|emb|CAA54473.1| pyruvate kinase [Trypanoplasma borreli] (497 aa)
Score = 617, Expect = 6.5e-62, Identities = 150/357 (42%), Positives = 205/357 (57%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYT--TKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           + +  KI  T+GPS                      + + L  L  AG+NV R NFSHG YE     ++ VR+ A E G+++   LDTKGPEIR       +V I++   V + T  T KE GT+EKF V       N+ K V  G  IFVDDG L L V+  + ++  IE +A+NT  +   K INLP+++  +P +S+KD  D+ F  KN+ D++ ASF+   D V E+++      G  I +I+KIE   GI ++D IID +D IMVARGDLG+E+P   V   +K I+  C   GKTVI ATQMLDS+    +PTRAEV+DV  +V  G DC MLSGETA G YP+  V  M++I
  S:    20 LFRSNKIICTIGPS--------------------SQSVEVLKDLMKAGLNVARMNFSHGTYEYHQKTIDNVRKAASELGIHVGIALDTKGPEIRTGLFPAGDVVIEAHKTVILTTDETFKEKGTAEKFYV----DYMNITKVVPVGGHIFVDDGLLDLIVVKISGKD--IECVAQNTHTISNRKGINLPNADVDLPAVSEKDLMDLQFGAKNRVDFVFASFIRNADQVNEVRQAF----GGKIAVIAKIENYQGIDNIDAIIDAADGIMVARGDLGVEIPAEKVVIAQKMIMSKCNKVGKTVICATQMLDSMTHGPRPTRAEVSDVAKSVLDGADCVMLSGETAKGKYPVETVVYMSRI 348
>gi|184155344|ref|YP_001843684.1| pyruvate kinase [Lactobacillus fermentum IFO 3956] >gi|183226688|dbj|BAG27204.1| pyruvate kinase [Lactobacillus fermentum IFO 3956] (473 aa)
Score = 617, Expect = 6.7e-62, Identities = 163/458 (35%), Positives = 244/458 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD-YGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +KKTKI +TLGP+                     T    +  L +AG N+ RFNFSHGD+ E   R+  V +  +  G ++  MLDTKG EIR     E ++E     KVRI       GT EK +V     TY  +  DV  G  +  DDG L + V   +     +     N  IL   K +N P  + ++P +++KD +DI F + N  ++IAASFV    ++ +I+ +L+E   E +QI  KIE+  GI + + II+ +D +MV RGD+G+E+P  +VP  +K +I+ C   GK VI ATQMLDS++   +PTRAEV+DV  AV  GTD TMLSGE+ANG YP+ +V  M +ID+ +EN  D +GR  +V+  +   + E +G+   T A  +  K ++      Y++           + +S  R +A I  +T  +       +N+GV   VV+
  S:     1 MKKTKIVSTLGPA--------------------STDVDTIVKLINAGANIFRFNFSHGDHPEHLGRIENVHKAEEITGKHVGIMLDTKGAEIRTTVQKEGKIEFNIGDKVRISMDDSLEGTKEKIAV-----TYAGLFDDVHEGGHVLFDDGLLDMLVDEKDEANKELVCHVLNHGILGSRKGVNAPGVSINLPGITEKDTSDINFGLDNGINFIAASFVRKPQDIEDIRVLLREKNMEDVQIFPKIESQEGIDNFEAIIEVADGLMVPRGDMGVEIPAENVPLVQKNMIRRCNELGKPVITATQMLDSMQENPRPTRAEVSDVANAVFDGTDATMLSGESANGDYPVESVATMNRIDIKAENNLDKFGR--EVFDFDKSDVTETIGSAVATAARDLGVKAIVAATASGYTA-----------RMISKYRPSADILALTFDERTERGLMINWGVQPYVVE 422
>gi|157353413|emb|CAO45352.1| unnamed protein product [Vitis vinifera] (493 aa)
Score = 617, Expect = 6.7e-62, Identities = 149/390 (38%), Positives = 219/390 (56%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           I KTKI  TLGP+                      +   L  L  AG+NV RFNFSHG  DY ++T  L+ +R   +   +  + MLDTKGPEIR  +    K +++K   ++ I +T   I   EK   + S     +  D++PGNTI   DG + L V+S ++  G +     NT  L E K +NLP     +P +++KD+ DI+ + + N  D IA SFV  G ++  ++K+L  H  + IQ++SK+E   G+ + D+I+ E+DS MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++MA+I + +E+  DY        + TP     + +LA++
  S:    19 IPKTKIVCTLGPA--------------------SRSVPMLEKLLRAGMNVARFNFSHGTHDYHQET--LDNLRIAMQNTQILCAVMLDTKGPEIRTGFLKDAKPIQLKEGEEITI-STDYSIKGDEK---MISMSYKKLPVDLKPGNTILCADGTITLTVLSCDLGAGTVRCRCENTATLGERKNVNLPGVVVDLPTLTEKDKEDILGWGVPNNIDMIALSFVRKGSDLVNVRKVLGSHA-KRIQLMSKVENQEGVINFDEILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEIAVKIMARICIEAESSLDYAAIFKEMIRSTPLPMSPLESLASS 385
>gi|145202295|gb|ABF06651.2| pyruvate kinase [Lactobacillus reuteri] (473 aa)
Score = 616, Expect = 7.1e-62, Identities = 161/462 (34%), Positives = 245/462 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN-FFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEH 465
           +KKTKI +TLGP+                     T    +  L +AG N+ RFNFSHGD+ E   R+  V +  +  G ++  MLDTKG EIR     E ++  +   KVRI       GT +K +V    G Y+   D   G  +  DDG + + +   +     +     N  +L   K +N P  + ++P +++KD +DI F ++NK +YIAASFV    +V +I+++LKE   E +QI  KIE+  GI + ++II  SD +MV RGD+G+E+P  +VP  +K++IK C   GK VI ATQMLDS++   +PTRAEV+DV  AV  GTD TMLSGE+ANG YP+ +V +M  ID+ +EN  +++G   + +  +   + E +G+     A              D  +IV +       + +S  R  A I  +T  +       +N+GV   VVD +++
  S:     1 MKKTKIVSTLGPA--------------------STDVDTIVKLINAGANIFRFNFSHGDHPEHLGRIENVHKAEEITGKHVGLMLDTKGAEIRTTVQKEGKINFEIGDKVRISMDPSIEGTHDKIAV-TYPGLYD---DTHVGGHVLFDDGLIDMVIDEKDDANKELVCHVLNHGVLGSRKGVNAPGVSINLPGITEKDSSDIRFGLENKINYIAASFVRKAQDVLDIRELLKEKNMEDVQIFPKIESQEGIDNFEEIIAVSDGLMVPRGDMGVEIPAQNVPIVQKHMIKRCNELGKPVITATQMLDSMQENPRPTRAEVSDVANAVFDGTDATMLSGESANGDYPVESVAMMNDIDIKAENHLWEFG--TEKFDWDKSDVTETIGSAVANAAK-----------DLDIHTIVAYTASGYTAKMISKYRPNADIVALTPNERVERGLMINWGVQPYVVDEMKN 426
>gi|49471811|gb|AAT66164.1| pyruvate kinase [Mycoplasma arthritidis] (392 aa)
Score = 616, Expect = 7.1e-62, Identities = 139/323 (43%), Positives = 199/323 (61%)
  Q:   134 TGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           T +Y M KD+  G  + +DDGKL    I   ++  II    +N  +L+ NKR+N+P  ++S+PFMS KDR DII+  K   D+IAASFVN+  NV EI++ILK+   EHIQI SKIE+ TGI ++D+II+ SDSIM+ARGDLGLE+PYY+VP +EK II  CR   K VIVATQMLDS+E    PTRAE++DV++A E G   TM SGETA+G YP+ A++ MA I+  +E  +    A     +  P  K ++G +A  +      K       F Y+  +    D +L++ ++  +    +  +    +  T FG+ +G+F
  S:    34 TVSYRMDKDMHVGAKVLLDDGKLV--TIVKEIKPEIILVEVQNDHVLKTNKRVNIPGIDFSMPFMSPKDREDIIWGAKYGVDFIAASFVNSAKNVHEIREILKQANAEHIQICSKIESQTGIDNIDEIIEASDSIMIARGDLGLEIPYYEVPYWEKKIIAKCRKANKEVIVATQMLDSMEKTPLPTRAEISDVYWATELGASATMTSGETASGQYPVEAIKTMATINHRAEQEYFNEIATSCNCQCQP--KCELGHVAKEL------KEKTKTGDFPYT--IAISEDGKLLKKIAKYKPNTTVIALVSDPKIETAFGITFGIF 344
>gi|171679992|ref|XP_001904942.1| unnamed protein product [Podospora anserina] >gi|170939622|emb|CAP64849.1| unnamed protein product [Podospora anserina] (528 aa)
Score = 616, Expect = 7.1e-62, Identities = 163/452 (36%), Positives = 255/452 (56%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           ++T I  T+GP    K  ++   NK                L +AG+NVVR NFSHG YE     ++  R   K +KG  ++  LDTKGPEIR   T ++ ++ I + + + I T +K     T+E   V       N+ K + PG  I+VDDG L  +V+   V++  I+  ARN   +   K +NLP+++  +P +S+KD+ D++F +KN  D + ASF+  G ++++I+++L E G +HIQII+KIE   G+ +  +I++E+D +MVARGDLG+E+P  +V   +K II  C   GK VI ATQML+S+    +PTRAE++DV  AV  G DC MLSGETA G YP  AV  M++  + +EN   Y      +F+E   + ++  ++  + A + A +  +D    + S+I V        + +S  R   PI  +T +   A+R+   Y GV+
  S:    32 RRTSIICTIGP----KTNSVEAINK----------------LREAGLNVVRMNFSHGSYEYHQSVIDNARAAEKAQKGRQVAIALDTKGPEIRTGNTVNDADLPISAGAILNITTDEKYATACTTENMYV----DYKNITKVISPGRIIYVDDGVLAFDVLEI-VDDKTIKVQARNNGFISSRKGVNLPNTDVDLPALSEKDKADLLFGVKNNVDMVFASFIRRGQDIKDIREVLGEEG-KHIQIIAKIENRQGLNNFAEILEETDGVMVARGDLGIEIPAAEVFAAQKKIIAMCNIAGKPVICATQMLESMIKNPRPTRAEISDVGNAVTDGADCVMLSGETAKGSYPNEAVREMSEACLKAENTIPYVS----HFEELCALVKRPVSIVESCA-MAAVRTSLD---LNASAIFVLSTSGVSARLISKYRPVCPIIMIT-RNASASRYAHLYRGVY 453
>gi|159475254|ref|XP_001695738.1| pyruvate kinase [Chlamydomonas reinhardtii] >gi|158275749|gb|EDP01525.1| pyruvate kinase [Chlamydomonas reinhardtii] (2430 aa)
Score = 616, Expect = 8.2e-62, Identities = 164/452 (36%), Positives = 246/452 (54%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGT------YNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLV--APKRVIDNHG---FDYSS---IVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KTKI  TLGPS                      +++ L  L DAG++V RFNFSHG ++     L+ +R+V + K  + + +LDTKGPEIR     + K++E+ +  +V +    ++    E +    +  T        +   ++ G  I + DG + +EV+    +  ++ ++  N+  L + K  NLP  +  +P +S KD +D+  FA+KN+ D+IAASFV   D+V+ I+++L + GG HI+II KIE   G++++D I++ +D IMVARGDL +EVP   +   +K II  C   GKTVI ATQML+S+     PTRAE+TDV  AV  GTD  MLSGETANG YP  AV  MA I   +E   DY    D + K        V  L  T+A +   A    +D +G    D S     VVF       Q ++  R   P+  ++D      +  L YG++
  S:    97 RKTKIVCTLGPSCW--------------------SEEGLGGLLDAGMDVARFNFSHGTHQAHQEVLDRLRKVVEAKKRHTAFLLDTKGPEIRTAMLKDGKDIELVAGQEVTVVGVGEDYDKWEGYKDEKTGETKIGISYAKLCASIKVGGVILIADGAISIEVVKILNDRELLGSVI-NSHKLGQRKNCNLPGVHVDLPVLSPKDIDDVQNFAVKNQMDFIAASFVQCADDVKMIRRVLDDAGGYHIKIICKIENEAGLRNIDTILEVTDGIMVARGDLAMEVPAEKIALAQKMIIAKCNVLGKTVITATQMLESMTGSPLPTRAEMTDVANAVYDGTDAVMLSGETANGAYPHAAVRTMAHIVEYAELGVDYAFHHD-WVKRHNAGLAPVSPLEATLACVAKSAITFSMDANGDGVLDASEGCVAVVFTRSGLAAQVIAKYRPPCPVIVLSDHDWVLRQASLTYGLY 542
Score = 615, Expect = 1.1e-61, Identities = 166/460 (36%), Positives = 247/460 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGT------YNMAKDVQPGNTIFVDDGKLKLEV--ISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDI-IFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           +KTKI  TLGPS                      +++ L  + +AG++V RFNFSHG ++     L+ +R+V K     I+ +LDTKGPE+R     E K++++ ++ +V +     +    E +    +  T        + + V+ G+ I V DG L +EV  I+S  E   +     NT +L + K +NLP  +  IP ++ KD  D+  F + N  D++AASFV + D+VR I+++L E GG ++QIISKIE   G+K  D I+ ESD IMVARGDL +E+P   V   +K +I      GK VI ATQML+S+ +   PTRAE+TDV  AV  GTD  MLSGETANG +P  AVE MA I  ++EN   Y          TP   +  G    T  + VA    +D +     ++   G  +R +   S  R A P   VTD    A +  +++G +  +V +++
  S:  1879 RKTKIVCTLGPSCW--------------------SEEGLNGIINAGMDVARFNFSHGTHQAHQEVLDRLRKVEKAGTKRIAYLLDTKGPEVRTAMLREGKDIKLDANQEVTVVAVGDDYDKWEGYKDEKTGETKIGISYAKLCQSVRVGSRILVADGSLTIEVLEITSATE---LRGRCLNTKVLGQRKNVNLPGVHVDIPVLTPKDIEDLQKFCVGNDMDFVAASFVQSADDVRLIRRVLDEAGGYNVQIISKIENEAGLKYFDGILAESDGIMVARGDLAMEIPSEKVALAQKMMITKANIAGKFVITATQMLESMTSAPLPTRAEMTDVANAVFDGTDAVMLSGETANGKFPRPAVETMAAIVANAENGTAYVSTQWFIRDHTP---KPFGITEATGVSCVAAS--VDCNAQLIITLTSGGYTSRFV---SKYRPAVPQIVVTDSVHVANQASVHFGQYALLVGDID 2317
Score = 607, Expect = 9.9e-61, Identities = 167/459 (36%), Positives = 251/459 (54%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVN--ISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGT-------YNMAKDVQPGNTIFVDDGKLKLE-----VISSNVEEGIIETIAR----NTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVY--FKETPFMKEKVGTLATTIATL-VAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +KTK+  TLGP                       +K+ L  L D G+NV RFNFSHG + +    L+ +R V  E+G    ++ +LDTKGPE+R     + K++ +++  ++ +     +  T E F   ++TG         ++ +DV+ G  I + DG + LE     ++   V E +  T  R    N+  L + K +NLP  +  +P +   D ND+  FA KN  D++AASFV + D+VR I+K+L E GG++++IISKIE+  G+ + D I+ ESD IMVARGDL +E+P   V   +K +I      GK VI ATQML+S+     PTRAE+TDV  AV  GTD  MLSGETANG +P  A+  M  I  ++E   +Y +  D    F   P        ++T  A L  A K V+D    D + I+V  +     + ++  R   P+  +TD    A      +GV+V +VD +
  S:  1197 RKTKVVCTLGPKCW--------------------SKEGLEMLVDTGINVARFNFSHGSHADHQEVLDRLRLVLDERGARHRVALLLDTKGPEVRTAMLKDGKDINLEAGQELTVVAVGDKYTTWEGFKD-EATGETRIGLSYQHLCRDVKVGGMIKIGDGLITLEDGGGGIVHLQVLEILSPTELRVRALNSKALGQRKNVNLPGVHVDMPVLGPNDINDVQNFAAKNNMDFVAASFVQSADDVRFIRKVLDEAGGKNVRIISKIESTAGLINYDAILAESDGIMVARGDLAMEIPSEKVALAQKMMITKANIAGKFVITATQMLESMIKSPLPTRAEMTDVANAVFDGTDAVMLSGETANGDFPQLALATMCAISANAEVGTNYPQVYDFIRDFSARP--------MSTAEAVLGCAAKNVLD---VDAALILVISSTGASARLVAKYRPRVPVLLITDSMAAARSVAPLFGVYVSIVDEL 1646
Score = 280, Expect = 6.9e-23, Identities = 74/258 (28%), Positives = 131/258 (50%)
  Q:   197 FMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYG 454
           F+ D+D   ++F  KN  D+++   V +  +V  ++++L  +GG   +IIS + T   I + D+I+D +D+++++R  +G+ +P   V   +K++      KGK  IV+ Q++ S+    +PTRAE+TDV  A+  G D  ML  ETA G +    V + A I   +E   D    ++     TP   + + TL    ++ V  K  +D      + I V  + +  ++AL+  R    I  VT +   A +  +NYG
  S:   837 FLGDRDCEAVLFCAKNMIDFVSIPNVRSRADVMAVRELLDANGGARCKIISHVSTAKAIANYDEILDATDAVLISRAYMGMRIPAAKVSLAQKWMTAKANLKGKPCIVSAQIMYSMVDSPRPTRAEMTDVANALYDGADALMLREETAVGSFVERVVSITADILRDAEVGVDTYAQLNQLRNFTP---KPMPTLECLCSSAV--KAAVDMRA---ALIAVITDTSAPVRALAKYRPGQAIVVVTTRTHVARQCNMNYG 1086
>gi|115390717|ref|XP_001212863.1| pyruvate kinase [Aspergillus terreus NIH2624] >gi|114193787|gb|EAU35487.1| pyruvate kinase [Aspergillus terreus NIH2624] (526 aa)
Score = 616, Expect = 8.7e-62, Identities = 166/452 (36%), Positives = 248/452 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSV-LDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVF---GNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           K  ++T I  T+GP                       + + + AL  +G+NVVR NFSHG YE     ++  RE A+ + G  ++  LDTKGPEIR   T++ K++ IK   ++ I T +K    S+  ++ LD     N+ K + PG  I+VDDG L  +V+   V++  +     N   +   K +NLP ++  +P +S+KD +D+ F +KN  D I ASF+  G ++R I+++L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV++M +  + +E    + +  D      P     V ++A  +A + A   +      +  +IVV    GN  RLI   S  R   P+  V+ +   ATR+   Y
  S:    30 KNFRRTSIIGTIGPKTN--------------------SVEKINALRSSGLNVVRMNFSHGSYEYHQSVIDNAREAARVQTGRPLAIALDTKGPEIRTGNTTDDKDIPIKEGHELNITTDEKYATCSDDQNMYLDYK---NITKVIAPGKLIYVDDGILSFQVLEV-VDDKTLRVKCLNNGNISSRKGVNLPGTDVDLPALSEKDISDLRFGVKNNVDMIFASFIRRGSDIRHIREVLGEEGKE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGSYPCEAVKMMHETCLLAEVAIPHFQVFDELRNLAPRPTATVESIA--MAAVSASLEL------NAGAIVVLTTSGNTARLI---SKYRPVCPVLMVS-RNPRATRYSHLY 450
>gi|148543982|ref|YP_001271352.1| pyruvate kinase [Lactobacillus reuteri F275] >gi|184153377|ref|YP_001841718.1| pyruvate kinase [Lactobacillus reuteri F275] >gi|194467804|ref|ZP_03073790.1| pyruvate kinase [Lactobacillus reuteri 100-23] >gi|148531016|gb|ABQ83015.1| pyruvate kinase [Lactobacillus reuteri F275] >gi|183224721|dbj|BAG25238.1| pyruvate kinase [Lactobacillus reuteri F275] >gi|194452657|gb|EDX41555.1| pyruvate kinase [Lactobacillus reuteri 100-23] (473 aa)
Score = 616, Expect = 8.7e-62, Identities = 161/462 (34%), Positives = 245/462 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN-FFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEH 465
           +KKTKI +TLGP+                     T    +  L +AG N+ RFNFSHGD+ E   R+  V +  +  G ++  MLDTKG EIR     E ++  +   KVRI       GT +K +V    G Y+   D   G  +  DDG + + +   +     +     N  +L   K +N P  + ++P +++KD +DI F ++NK +YIAASFV    +V +I+++LKE   E +QI  KIE+  GI + ++II  SD +MV RGD+G+E+P  +VP  +K++IK C   GK VI ATQMLDS++   +PTRAEV+DV  AV  GTD TMLSGE+ANG YP+ +V +M  ID+ +EN  +++G   + +  +   + E +G+     A              D  +IV +       + +S  R  A I  +T  +       +N+GV   VVD +++
  S:     1 MKKTKIVSTLGPA--------------------STDVDTIVKLINAGANIFRFNFSHGDHPEHLGRIENVHKAEEITGKHVGLMLDTKGAEIRTTVQKEGKINFEIGDKVRISMDPSIEGTHDKIAV-TYPGLYD---DTHVGGHVLFDDGLIDMVIDEKDDANKELVCHVLNHGVLGSRKGVNAPGVSINLPGITEKDSSDIRFGLENKINYIAASFVRKAQDVLDIRELLKEKNMEDVQIFPKIESQEGIDNFEEIIAVSDGLMVPRGDMGVEIPAQNVPIVQKHMIKRCNELGKPVITATQMLDSMQENPRPTRAEVSDVANAVFDGTDATMLSGESANGDYPVESVAMMNDIDIKAENHLWEFG--TEKFDWDKSDVTETIGSAVANAAK-----------DLDIHTIVAYTASGYTAKMISKYRPNADIVALTPNERVERGLMINWGVQPYVVDEMKN 426
>gi|51891976|ref|YP_074667.1| pyruvate kinase [Symbiobacterium thermophilum IAM 14863] >gi|51855665|dbj|BAD39823.1| pyruvate kinase [Symbiobacterium thermophilum IAM 14863] (584 aa)
Score = 615, Expect = 1.0e-61, Identities = 161/470 (34%), Positives = 243/470 (51%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTE 472
           M++KTKI AT+GP+                        + L  L +AGV+V R NFSHG  +EQ  R+  +RE  +  G +++ M+D KGPEIR+      +V ++ D  +   TT+  +G  E+  V        +  DV  G  + +DDG L  + +     E     I     +L + K++NLP +  S+P +S+KD  DI F ++   D++A SF+    +V EI+++++E GG H QIISK+E+  G  +L+ I+  SD +MVARGDLG+EVP  +VP  +K +I+     GK VI ATQML+S+  + +PTRAE +DV  A+  GTD  MLS E+A G YP+ AV  MA I   +E   D+ + +    +   F +    T A + AT      V   H    ++IV         + +S  R   PI  VT     A +  L +GVF  VV+ V     + T+
  S:     1 MLRKTKIVATIGPA--------------------SEQVEVLTRLIEAGVDVCRLNFSHGTLDEQRRRIENIREAGRRVGKDVAIMIDLKGPEIRIGTFENGKVTLR-DGDLFTLTTEPCVGNQERVWVQYP----GIVHDVAEGGYLLLDDGNLTFQAVEVTPTEIRCRVIVGG--VLSDRKKVNLPGTKVSLPALSEKDIEDIRFGVEMGVDFVAGSFIRKAQDVLEIRRVIEEAGG-HQQIISKVESQEGFDNLEAILQVSDGLMVARGDLGVEVPTEEVPLMQKRMIERANAMGKPVITATQMLESMVNRPRPTRAEASDVANAIMDGTDAIMLSAESAAGKYPVEAVRTMATIARRTEEALDHSQLMA---RRGRFGRMDSVTEAISHAT------VTTAHDLGATAIVSATTSGFTARMVSKYRPGCPIIAVTPDPRVARQLRLVWGVF-PVVEPVASGTEDLTQ 432
>gi|2497543|sp|Q42954|KPYC_TOBAC Pyruvate kinase, cytosolic isozyme (PK) >gi|444023|emb|CAA82628.1| pyruvate kinase [Nicotiana tabacum] (508 aa)
Score = 615, Expect = 1.0e-61, Identities = 149/388 (38%), Positives = 218/388 (56%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+                      +   +  L  AG+NV RFNFSHG  DY ++TI  + +R+  +  G+  + MLDTKGPEIR  +    K V++K   ++ I +T   I   E    +       +A+DV+P + I   DG++   V+S + E G+      NT +L E K +NLP     +P ++DKD++DI+ + + N  D IA SFV  G ++ E++K+L EH  ++I ++SK+E   G+ + DDI+  SD+ MVARGDLG+E+P   +   +K +I  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV  MAKI + +E+  DY           P     + +LA++
  S:    19 KTKIVCTLGPA--------------------SRSVPMIEKLLRAGMNVARFNFSHGSHDYHQETI--DNLRQAMESTGILCAVMLDTKGPEIRTGFLKDAKPVQLKQGQEITI-STDYSIKGDESMICMSYK---KLAEDVKPQSVILCADGQITFTVLSCDKENGLDRCRCENTAVLGERKNVNLPGVIVDLPTLTDKDKDDILNWGVPNHIDMIALSFVRKGSDLVEVRKLLGEHA-KNILLMSKVENQEGVANFDDILLNSDAFMVARGDLGMEIPIEKIFLAQKVMIYKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPDLAVGTMAKICIEAESTIDYPDVFKRIMSNAPVPMSPLESLASS 383
>gi|2497537|sp|Q12669|KPYK_ASPNG Pyruvate kinase (PK) >gi|250607|gb|AAB22392.1| pyruvate kinase [Aspergillus niger] (526 aa)
Score = 615, Expect = 1.1e-61, Identities = 164/453 (36%), Positives = 250/453 (55%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           MK+   +K+   + PS   +  ++     P+   V     + + +L  AG+NVVR NFSHG Y+     ++  RE AK + G  ++  LDTKGPEIR   T  +K++ IK   ++ I T ++    + +K   LD     N+ K + PG  I+VDDG L  EV+   V++  I     N   +   K +NLP ++  +P +S+KD  D+ F ++NK D + ASF+  G ++R I+++L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV++M++  + +E    +    D      P   + V ++A  +A + A   +      +  +IVV     +  + LS  R   PI  VT +   A+R+   Y
  S:    14 MKLEWHSKLNTEMVPSKNFRRTSIIGTIGPKTNSV-----EKINSLRTAGLNVVRMNFSHGSYQYHQSVIDNAREAAKTQVGRPLAIALDTKGPEIRTGNTPDDKDIPIKQGHELNITTDEQYATASDDKNMYLDYK---NITKVISPGKLIYVDDGILSFEVLEV-VDDKTIRVRCLNNGNISSRKGVNLPGTDVDLPALSEKDIADLKFGVRNKVDMVFASFIRRGSDIRHIREVLGEEGKE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPNEAVKMMSETCLLAEVAIPHFNVFDELRNLAPRPTDTVESIA--MAAVSASLEL------NAGAIVVLTTSGKTARYLSKYRPVCPIVMVT-RNPAASRYSHLY 450
>gi|49483939|ref|YP_041163.1| pyruvate kinase [Staphylococcus aureus subsp. aureus MRSA252] >gi|81650936|sp|Q6GG09|KPYK_STAAR Pyruvate kinase (PK) >gi|49242068|emb|CAG40767.1| pyruvate kinase [Staphylococcus aureus subsp. aureus MRSA252] (585 aa)
Score = 615, Expect = 1.1e-61, Identities = 163/452 (36%), Positives = 251/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+              E++ +IE        L +AG+NV R NFSHG +EE   R++ +R+VAK     ++ +LDTKGPEIR +   +  +E++  ++V +   + E GT EKFSV     TY N+  DVQ G+ I +DDG ++L+V   +  +  ++    N+  L+  K +NLP    S+P +++KD  DI F IK   D+IAASFV    +V EI++IL+E    +I +  KIE   GI ++++I++ SD +MVARGD+G+E+P   VP  +K +I+ C   GK VI ATQMLDS++   + TRAE +DV  A+  GTD  MLSGETA G+YP  AV+ M  I VS+E   DY +           + ++   + T++   +           +  +IV         + +S  R  + I  VT  +E A +  + +GV
  S:     1 MRKTKIVCTIGPA-------------SESEEMIEK-------LINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVE-GTPEKFSV-----TYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRFGIKENVDFIAASFVRRPSDVLEIREILEEQKA-NISVFPKIENQEGIDNIEEILEVSDGLMVARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANAIYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKK----------LLSDRTKLVETSLVNAIGISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGV 416
>gi|54307642|ref|YP_128662.1| pyruvate kinase [Photobacterium profundum SS9] >gi|46912065|emb|CAG18860.1| putative pyruvate kinase I [Photobacterium profundum SS9] (470 aa)
Score = 615, Expect = 1.1e-61, Identities = 146/356 (41%), Positives = 208/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKE-VEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       + + L  L +AG+NV+R NFSHG++EE   R+  +REV       ++ +LDTKGPEIR  K    E   + +  +    T    +G  ++ +V     TY   AKD+  GN I VDDG +++EV+ +   E  ++    N   L ENK +NLP  +  +P +S+KD+ D++F  +   D++AASF+   D+V+EI+ +L  +GGE IQIISKIE   G+ + D I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YPI AV +MA+I
  S:     1 MKKTKIVCTIGPKTE--------------------SVEMLTKLANAGMNVMRLNFSHGNFEEHGQRIVNLREVMATSAQPLAILLDTKGPEIRTIKLENGEDFALVAGQEFTFTTDITVVGNQDRVAV-----TYPGFAKDLTKGNIILVDDGLIEMEVLETTETE--VKCKVLNNGDLGENKGVNLPGVSVKLPALSEKDKADLVFGCEQGVDFVAASFIRKEDDVKEIRALLAANGGEKIQIISKIENQEGVDNFDSILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGESAKGKYPIEAVTIMAQI 331
>gi|66880206|ref|ZP_00405190.1| COG0469: Pyruvate kinase [Mycoplasma genitalium G-37] (288 aa)
Score = 614, Expect = 1.4e-61, Identities = 126/284 (44%), Positives = 186/284 (65%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTY 287
           +K+TKI AT GP++T  + +L   +  E   + + A  N+ A+  +GV+V+R NFSHG +EEQ +R+ +VR+VAK   + +S MLDT GPEIR+ +T ++ ++I  DS+V I T  K I +  +F+V D++G YNM  DV  G  I VDDGKL L V   + +   +  +A+N   +   KR+NLP++ YSIPF+S+KD  DI F +    DYIAASFVNT  ++++++  LK      ++II+KIE+   + ++D II  SD IMVARGDLGLE+PYY VP +
  S:     5 LKRTKIIATCGPALTKSLVSLKMLDDNEYAAIKKVAYANIEAIIKSGVSVIRLNFSHGTHEEQQVRIKIVRDVAKAMNIPVSIMLDTNGPEIRIVETKKEGLKITKDSEVIINTMSKMIASDNQFAVSDASGKYNMVNDVNIGQKILVDDGKLTLVVTRVDKQHNQVICVAKNDHTVFTKKRLNLPNAQYSIPFLSEKDLKDIDFGLSQGIDYIAASFVNTVADIKQLRDYLKLKNASGVKIIAKIESNHALNNIDKIIKASDGIMVARGDLGLEIPYYQVPYW 288
>gi|116492854|ref|YP_804589.1| pyruvate kinase [Pediococcus pentosaceus ATCC 25745] >gi|116103004|gb|ABJ68147.1| pyruvate kinase [Pediococcus pentosaceus ATCC 25745] (587 aa)
Score = 614, Expect = 1.5e-61, Identities = 150/362 (41%), Positives = 209/362 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKN-KFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           +KKTKI +TLGP+                     T+   +  L +AG NV RFNFSHGD+EE   R N+V+E  K  G ++  +LDTKG EIR     +   E  ++ KVRI        T EK +V     TY+ +  DV  G  +  DDG L  ++   + E   +   A N  +L   K  N P  + ++P +++KD +DI F +++   ++IAASFV    +V EI+++L+E   E +QI  KIE+  GI + D+I+  SD IM+ARGD+G+E+P  +VP  +K +IK C   G  VI ATQMLDS+    +PTRAE +DV  AV  GTD TMLSGE+ANG YP+ AV  MAKID  +EN
  S:     1 MKKTKIVSTLGPA--------------------STSVDTIVKLIEAGANVFRFNFSHGDHEEHLGRYNMVKEAEKITGKSVGILLDTKGAEIRTTPQKDGNQEYHTNDKVRISMDDTLETTKEKIAV-----TYDGLFDDVHVGGHVLFDDGLLDFKIDEKDEENRELVAHATNNGVLGSRKGTNAPGVSINLPGITEKDADDIRFGLESMNINFIAASFVRKPQDVLEIRELLEEKNMEDVQIFPKIESQEGIDNTDEILKVSDGIMIARGDMGVEIPAENVPLVQKTLIKKCNAVGLPVITATQMLDSMIENPRPTRAEASDVANAVWDGTDATMLSGESANGDYPVEAVATMAKIDEKAEN 339
>gi|168047859|ref|XP_001776386.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162672230|gb|EDQ58770.1| predicted protein [Physcomitrella patens subsp. patens] (596 aa)
Score = 613, Expect = 1.6e-61, Identities = 163/451 (36%), Positives = 233/451 (51%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVN-ISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-------DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +KTKI  T+GP+                       K+ +  L +AG+NV R N SHGD+      ++LVRE  KE   N I+ MLDTKGPE+R     +  +  K D     +T K+ +GT    SV       +   DV+ G+T+ +D G + LEV S   EE + E +      L+  + +N+   + ++P +++KD  DI F ++NK D+ A SFV     V E+K  LK    + I +I KIE+   I +L  I+D +D  MVARGDLG E+P  +VP  +  II+ CR  GK VIVAT ML+S+ T   PTRAEV+D+  AV  G D  MLSGETA+G YP+ AV VM  + + +E          + GRA   +      M E     AT ++  +             +SI VF     +   LS+ R A  IF  T+ K+  +R  L +GV
  S:   125 RKTKIVCTIGPT--------------------SNTKEMIWKLAEAGMNVARLNMSHGDHASHKKVIDLVREYNKEANANVIALMLDTKGPEVRSGDLPQPIMLKKGDPFT--FTIKRGVGTDTCVSV----NYDDFVNDVESGDTLLIDGGMMSLEVKSKTHEEVLCEVVDGGE--LKSRRHLNVRGKSATLPSITEKDWEDIKFGVENKVDFYALSFVKDAQVVHELKSFLKGKSAD-IHVIVKIESADSIPNLQSILDAADGAMVARGDLGAELPIEEVPLLQGEIIRSCRAMGKPVIVATNMLESMITHPTPTRAEVSDIAIAVREGADAVMLSGETAHGKYPLKAVRVMHTVAMRTEATMPEEEAPSNLGRAFKTH------MSEMFAFHATLMSNTLG------------TSICVFTRSGFMALLLSHYRPAGTIFAFTNDKKVQSRLALYHGV 536
>gi|90411916|ref|ZP_01219924.1| pyruvate kinase [Photobacterium profundum 3TCK] >gi|90327174|gb|EAS43546.1| pyruvate kinase [Photobacterium profundum 3TCK] (470 aa)
Score = 613, Expect = 1.8e-61, Identities = 145/356 (40%), Positives = 208/356 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKE-VEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +KKTKI  T+GP                       + + L  L +AG+NV+R NFSHG++EE   R+  +REV       ++ +LDTKGPEIR  K    E   + +  +    T    +G  ++ +V     TY   AKD+  GN I VDDG +++EV+ +   E  ++    N   L ENK +NLP  +  +P +S+KD+ D++F  +   D++AASF+   ++V+EI+ +L  +GGE IQIISKIE   G+ + D I++ SD IMVARGDLG+E+P  +V   +K +I+ C    K VI ATQMLDS+    +PTRAE  DV  A+  GTD  MLSGE+A G YPI AV +MA+I
  S:     1 MKKTKIVCTIGPKTE--------------------SVEMLTKLANAGMNVMRLNFSHGNFEEHGQRIENLREVMAASAQPLAILLDTKGPEIRTIKLENGEDFALVAGQEFTFTTDITVVGNQDRVAV-----TYPGFAKDLTKGNIILVDDGLIEMEVLETTETE--VKCKVLNNGDLGENKGVNLPGVSVKLPALSEKDKADLVFGCEQGVDFVAASFIRKEEDVKEIRALLTANGGEKIQIISKIENQEGVDNFDSILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGESAKGKYPIEAVTIMAQI 331
>gi|162458157|ref|NP_001105266.1| PK protein [Zea mays] >gi|48256714|gb|AAT41588.1| putative pyruvate kinase [Zea mays] (509 aa)
Score = 613, Expect = 1.9e-61, Identities = 144/388 (37%), Positives = 215/388 (55%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+                      + + ++ L  AG+ V RFNFSHG +E     L+ +    +  G+  + MLDTKGPEIR  +    K +++    ++ I +T   I   EK   + S     +A D++PG+ I   DG + L V+  + E+G++     NT+ L E K +NLP     +P ++DKD+ DI+ + + NK D IA SFV  G ++ E++K+L EH  + I ++SK+E   G+ + DDI+  SD+ MVARGDLG+E+P   +   +K +I  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV+ MAKI + +E+  D+           P     + +L ++
  S:    20 KTKIVCTLGPA--------------------SRSVEMISRLLRAGMCVARFNFSHGSHEYHQETLDNLHAAMELTGILCAVMLDTKGPEIRTGFLKDGKPIQLIKGQEITI-STDYSIQGDEK---MISMSYKKLAVDLKPGSVILCADGTITLTVLHCDKEQGLVRCRCENTFKLGERKNVNLPGVIVDLPTLTDKDKEDILKWGVPNKIDMIALSFVRKGSDLVEVRKVLGEHA-KSIMLMSKVENQEGVANFDDILANSDAFMVARGDLGMEIPIEKIFFAQKVMIFKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVQTMAKICLQAESCVDHAAIFKSIMASAPIPMSPLESLGSS 384
>gi|51246968|ref|YP_066852.1| pyruvate kinase [Desulfotalea psychrophila LSv54] >gi|50878005|emb|CAG37845.1| probable pyruvate kinase [Desulfotalea psychrophila LSv54] (581 aa)
Score = 612, Expect = 2.2e-61, Identities = 150/366 (40%), Positives = 212/366 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIK-SDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           + KTKI ATLGP                       + + + +L  AG+NV R N SHGD E     ++ V+E  K    + + +LD +GPEIRV   SE E +I   D +  + T + E  +  + +    T    +A DVQ G+ I +DDGKL LEV++   EE I + IA    IL   KR+ LPD+  ++P +S+KD+ DI F ++   D+IAASFV    +V  ++KI++++GG+  +II+KIE   G+ +LD+I+  ++ IMVARGDLG+EVP  +VP  +K IIK     GK VI ATQML+S+ T   PTRAE  DV  A+  GTD  MLSGETA G YP+ AV  + +    +EN  DY
  S:     1 MNKTKIIATLGPQ--------------------SQSVEEIYSLIQAGMNVARINLSHGDAESYKHLISNVKEARKLAEKDTAILLDNRGPEIRV---SEMEEDIHLVDGEELVITNRAETVSPSRIT----TNYPQLAGDVQVGSRILLDDGKLALEVLAIEDEEVITKVIAGG--ILSSRKRVALPDNEVNLPSLSEKDKEDIAFGVEQDVDFIAASFVRQAGDVWAVRKIIEDNGGDQ-EIIAKIENRQGVNNLDEILQAANGIMVARGDLGVEVPAEEVPIIQKSIIKAANRLGKPVITATQMLESMITCPTPTRAEANDVTNAIFDGTDAVMLSGETAIGKYPVQAVAFLVRCATIAENALDY 337
>gi|3660261|pdb|1PKL|A Chain A, The Structure Of Leishmania Pyruvate Kinase >gi|3660262|pdb|1PKL|B Chain B, The Structure Of Leishmania Pyruvate Kinase >gi|3660263|pdb|1PKL|C Chain C, The Structure Of Leishmania Pyruvate Kinase >gi|3660264|pdb|1PKL|D Chain D, The Structure Of Leishmania Pyruvate Kinase >gi|3660265|pdb|1PKL|E Chain E, The Structure Of Leishmania Pyruvate Kinase >gi|3660266|pdb|1PKL|F Chain F, The Structure Of Leishmania Pyruvate Kinase >gi|3660267|pdb|1PKL|H Chain H, The Structure Of Leishmania Pyruvate Kinase >gi|3660268|pdb|1PKL|G Chain G, The Structure Of Leishmania Pyruvate Kinase (499 aa)
Score = 612, Expect = 2.5e-61, Identities = 151/413 (36%), Positives = 229/413 (55%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           L  L  +G++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR  +    +  ++  +   + T     + GT +KF +       N++K V+PGN I++DDG L L+V  S+ +E  +E    N+  + + + +NLP  +  +P +S KDR D+ F ++   D I ASF+ + + V +++K L   G + I II KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++  +      V+F       +K+  +  +    V    V   +     ++VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:    38 LKGLIQSGMSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGDAVMERGATCYVTTDPAFADKGTKDKFYI----DYQNLSKVVRPGNYIYIDDGILILQV-QSHEDEQTLECTVTNSHTISDRRGVNLPGCDVDLPAVSAKDRVDLQFGVEQGVDMIFASFIRSAEQVGDVRKALGPKGRD-IMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSALNEY----VFFNSI----KKLQHIPMSADEAVCSSAVNSVYETKAKAMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 438
>gi|85094167|ref|XP_959838.1| pyruvate kinase [Neurospora crassa OR74A] >gi|164425652|ref|XP_001728254.1| pyruvate kinase, variant [Neurospora crassa OR74A] >gi|54036128|sp|Q7RVA8|KPYK_NEUCR Pyruvate kinase (PK) >gi|28921293|gb|EAA30602.1| pyruvate kinase [Neurospora crassa OR74A] >gi|157071009|gb|EDO65163.1| pyruvate kinase, variant [Neurospora crassa OR74A] (527 aa)
Score = 612, Expect = 2.5e-61, Identities = 163/452 (36%), Positives = 255/452 (56%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           ++T I  T+GP    K  ++   NK                L DAG+NVVR NFSHG YE     ++  R+  K   G  I+  LDTKGPEIR   T +++++ I + + + I T +K  +  T E   V       N+ K + PG  I+VDDG L  EV+   V++  I+  ARN   +   K +NLP+++  +P +S+KD+ D+ F +KNK D + ASF+  G ++++I+++L E G + IQII+KIE   G+ +  +I+ E+D +MVARGDLG+E+P  +V   +K II  C   GK VI ATQML+S+    +PTRAE++DV  AV  G DC MLSGETA G YP  AV  M++  + +EN   Y      +F+E   + ++  ++  + A + + +  +D    + ++I+V        + +S  R   PI  +T + + A+R+   Y GV+
  S:    32 RRTSIICTIGP----KTNSVEAINK----------------LRDAGLNVVRMNFSHGSYEYHQSVIDNARQAEKVHPGRPIAIALDTKGPEIRTGNTKNDEDIPISAGTILNITTDEKYKDECTIEHMYV----DYVNITKVIAPGRIIYVDDGVLAFEVLEI-VDDKTIKVKARNNGYISSRKGVNLPNTDVDLPALSEKDKADLRFGVKNKVDMVFASFIRRGQDIKDIREVLGEDG-KQIQIIAKIENRQGLNNFAEILAETDGVMVARGDLGIEIPAAEVFAAQKKIIAMCNIAGKPVICATQMLESMIKNPRPTRAEISDVGNAVTDGADCVMLSGETAKGAYPTEAVREMSEAVLKAENTIPYVS----HFEELCSLAKRPVSIVESCA-MASVRASLD---LNAAAILVLSTSGESARLISKYRPVCPIIMIT-RNDSASRYAHLYRGVY 453
>gi|15924687|ref|NP_372221.1| pyruvate kinase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927275|ref|NP_374808.1| pyruvate kinase [Staphylococcus aureus subsp. aureus N315] >gi|21283370|ref|NP_646458.1| pyruvate kinase [Staphylococcus aureus subsp. aureus MW2] >gi|49486523|ref|YP_043744.1| pyruvate kinase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650568|ref|YP_186581.1| pyruvate kinase [Staphylococcus aureus subsp. aureus COL] >gi|87162024|ref|YP_494338.1| pyruvate kinase [Staphylococcus aureus subsp. aureus USA300] >gi|88195506|ref|YP_500311.1| pyruvate kinase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268177|ref|YP_001247120.1| pyruvate kinase [Staphylococcus aureus subsp. aureus JH9] >gi|150394244|ref|YP_001316919.1| pyruvate kinase [Staphylococcus aureus subsp. aureus JH1] >gi|151221804|ref|YP_001332626.1| pyruvate kinase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980014|ref|YP_001442273.1| pyruvate kinase [Staphylococcus aureus subsp. aureus Mu3] >gi|161509911|ref|YP_001575570.1| pyruvate kinase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727709|ref|ZP_02759986.1| pyruvate kinase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|81649170|sp|Q6G8M9|KPYK_STAAS Pyruvate kinase (PK) >gi|81694312|sp|Q5HF76|KPYK_STAAC Pyruvate kinase (PK) >gi|81704352|sp|Q7A0N4|KPYK_STAAW Pyruvate kinase (PK) >gi|81705550|sp|Q7A559|KPYK_STAAN Pyruvate kinase (PK) >gi|81781444|sp|Q99TG5|KPYK_STAAM Pyruvate kinase (PK) >gi|122539317|sp|Q2FXM9|KPYK_STAA8 Pyruvate kinase (PK) >gi|123485463|sp|Q2FG40|KPYK_STAA3 Pyruvate kinase (PK) >gi|13701493|dbj|BAB42787.1| pyruvate kinase [Staphylococcus aureus subsp. aureus N315] >gi|14247469|dbj|BAB57859.1| pyruvate kinase [Staphylococcus aureus subsp. aureus Mu50] >gi|21204810|dbj|BAB95506.1| pyruvate kinase [Staphylococcus aureus subsp. aureus MW2] >gi|49244966|emb|CAG43427.1| pyruvate kinase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284754|gb|AAW36848.1| pyruvate kinase [Staphylococcus aureus subsp. aureus COL] >gi|87127998|gb|ABD22512.1| pyruvate kinase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203064|gb|ABD30874.1| pyruvate kinase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741246|gb|ABQ49544.1| pyruvate kinase [Staphylococcus aureus subsp. aureus JH9] >gi|149946696|gb|ABR52632.1| pyruvate kinase [Staphylococcus aureus subsp. aureus JH1] >gi|150374604|dbj|BAF67864.1| pyruvate kinase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722149|dbj|BAF78566.1| pyruvate kinase [Staphylococcus aureus subsp. aureus Mu3] >gi|160368720|gb|ABX29691.1| pyruvate kinase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (585 aa)
Score = 611, Expect = 2.7e-61, Identities = 163/452 (36%), Positives = 250/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+              E++ +IE        L +AG+NV R NFSHG +EE   R++ +R+VAK     ++ +LDTKGPEIR +   +  +E++  ++V +   + E GT EKFSV     TY N+  DVQ G+ I +DDG ++L+V   +  +  ++    N+  L+  K +NLP    S+P +++KD  DI F IK   D+IAASFV    +V EI++IL+E    +I +  KIE   GI ++ +I++ SD +MVARGD+G+E+P   VP  +K +I+ C   GK VI ATQMLDS++   + TRAE +DV  A+  GTD  MLSGETA G+YP  AV+ M  I VS+E   DY +           + ++   + T++   +           +  +IV         + +S  R  + I  VT  +E A +  + +GV
  S:     1 MRKTKIVCTIGPA-------------SESEEMIEK-------LINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVE-GTPEKFSV-----TYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRFGIKENVDFIAASFVRRPSDVLEIREILEEQKA-NISVFPKIENQEGIDNIAEILEVSDGLMVARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANAIYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKK----------LLSDRTKLVETSLVNAIGISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGV 416
>gi|82751285|ref|YP_417026.1| pyruvate kinase [Staphylococcus aureus RF122] >gi|123547911|sp|Q2YTE3|KPYK_STAAB Pyruvate kinase (PK) >gi|82656816|emb|CAI81245.1| pyruvate kinase [Staphylococcus aureus RF122] (585 aa)
Score = 611, Expect = 2.8e-61, Identities = 163/452 (36%), Positives = 250/452 (55%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  T+GP+              E++ +IE        L +AG+NV R NFSHG +EE   R++ +R+VAK     ++ +LDTKGPEIR +   +  +E++  ++V +   + E GT EKFSV     TY N+  DVQ G+ I +DDG ++L+V   +  +  ++    N+  L+  K +NLP    S+P +++KD  DI F IK   D+IAASFV    +V EI++IL+E    +I +  KIE   GI ++ +I++ SD +MVARGD+G+E+P   VP  +K +I+ C   GK VI ATQMLDS++   + TRAE +DV  A+  GTD  MLSGETA G+YP  AV+ M  I VS+E   DY +           + ++   + T++   +           +  +IV         + +S  R  + I  VT  +E A +  + +GV
  S:     1 MRKTKIVCTIGPA-------------SESEEMIEK-------LINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRLDKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVE-GTPEKFSV-----TYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKKGVNLPGVRVSLPGITEKDAEDIRFGIKENVDFIAASFVRRPSDVLEIREILEEQKA-NISVFPKIENQEGIDNIAEILEVSDGLMVARGDMGVEIPPEKVPMVQKDLIRQCNKLGKPVITATQMLDSMQRNPRATRAEASDVANAIYDGTDAVMLSGETAAGLYPEEAVKTMRNIAVSAEAAQDYKK----------LLSDRTKLVETSLVNAIGISVAHTALNLNVKAIVAATESGSTARTISKYRPHSDIIAVTPSEETARQCSIVWGV 416
>gi|17544584|ref|NP_502029.1| ZK593.1 [Caenorhabditis elegans] >gi|5824898|emb|CAA93424.2| C. elegans protein ZK593.1, confirmed by transcript evidence [Caenorhabditis elegans] (515 aa)
Score = 611, Expect = 2.9e-61, Identities = 160/452 (35%), Positives = 244/452 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDS---TGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KT +  T+GP+ +                 +ET +K    + + G+N+ R NFSHG +E     +  +RE A+     ++  LDTKGPEIR  ++  + KEV++++   VR+ T       S +F+   S       N+ K VQPG+ I++DDG + L ++ S  E  +I TI  N   L   K +NLP +   +P ++ KD  D++F ++   D I ASF+   D + +I+++L E G +HI II+KIE+  G+ + D+II+ SD +MVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+ TK +PTRAE +DV  AV  G DC MLSGETA G YP+ A+ +M  I   +E+ F + +    +F+E     +K   +  T A + A    I         I   G   RL    S  R   PI  V+  +  + +  L+ G+F
  S:    34 RKTGVICTIGPACSD----------------VETLRK----MINTGMNIARLNFSHGTHEAHAATIKTIREAAENAPFPVAIALDTKGPEIRTGMFANNMKEVQLENGKSVRVSTDP-----SMEFAATSSHIYADYRNLPKVVQPGSRIYIDDGLISL-IVESCEETAVICTI-ENGGALGTRKGVNLPGTIVDLPAVTSKDIEDLLFGVEQGVDIIFASFIRNADGIHKIRQVLGEKG-KHIYIIAKIESEDGVTNCDEIIEASDGVMVARGDLGIEIPAEKVFLAQKMLIAKCNLAGKPVICATQMLESMITKPRPTRAECSDVANAVLDGVDCVMLSGETAKGDYPVEALAIMHNICKEAESAFFHMK----HFEELILHTKKPTGMTHTTA-IAAVSATITCRAVAIILITTTGKTARLC---SRYRPPVPIITVSRDERISRQLHLHRGIF 454
>gi|169767990|ref|XP_001818466.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|9955873|dbj|BAB12236.1| pyruvate kinase [Aspergillus oryzae] >gi|83766321|dbj|BAE56464.1| unnamed protein product [Aspergillus oryzae] (526 aa)
Score = 611, Expect = 3.3e-61, Identities = 162/452 (35%), Positives = 244/452 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSV-LDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           K  ++T I  T+GP                       + + + AL  +G+NVVR NFSHG YE     ++  RE A+ + G  ++  LDTKGPEIR   T++ K++ IK   ++ I T +K    S+  ++ LD     N+   + PG  I+VDDG L  +V+   V++  +     N   +   K +NLP ++  +P +S+KD +D+ F +KN  D I ASF+  G ++R I+ +L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV++M++  + +E    +    D      P   + V ++A  +A + A   +      +  +IVV        + LS  R   PI  VT +   A+R+   Y
  S:    30 KNFRRTSIIGTIGPKTN--------------------SVEKINALRRSGLNVVRMNFSHGSYEYHQSVIDNAREAARVQTGRPLAIALDTKGPEIRTGNTTDDKDIPIKEGHELNITTDEKYANASDDQNMYLDYKNITNV---IAPGKLIYVDDGILSFQVLEV-VDDKTLRVKCLNNGNISSRKGVNLPGTDVDLPALSEKDISDLKFGVKNGVDMIFASFIRRGSDIRHIRDVLGEEGKE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGSYPCEAVKMMSETCLLAEVAIPHFNVFDELRNLAPRPTDTVESIA--MAAVSASLEL------NAGAIVVLTTSGNTARLLSKYRPVCPILMVT-RNPRASRYSHLY 450
>gi|400142|sp|P31865|KPYK_TRIRE Pyruvate kinase (PK) >gi|170553|gb|AAA02922.1| pyruvate kinase (538 aa)
Score = 610, Expect = 3.5e-61, Identities = 156/414 (37%), Positives = 235/414 (56%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIK-SDSKVRIYTTKKEIGTSEKFSVLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           L  L DAG+NV R NFSHG YE  Q++  N+   VA   G  ++  LDTKGPEIR   T+  +V+I  S   V  +TT ++  T+      D+   Y    N+ K +QPG  I+VDDG L  +V+S   ++  +E  ARN   +   K +NLP+++  +P +S+KD+ D+ F +KN  D + ASF+    ++++I+ +L   G + IQII+KIE   G+ +  +I++E+D +MVARGDLG+E+P  +V   +K +I  C   GK VI ATQML+S+    +PTRAE++DV  AV  G DC MLSGETA G YP  ++  M +  + +EN   Y   +  + +    +K  V T+ +    + A +  +D        I+V        + LS  R   PIF VT +    +RF   Y GV+
  S:    60 LNKLRDAGLNVARMNFSHGSYEYHQSVIDNVRASVAAHPGRPVAIALDTKGPEIRTGNTA-GDVDIPISAGTVMNFTTDEKYATA-----CDTQNMYVDYKNITKVIQPGRVIYVDDGVLAFDVLSIK-DDQTVEVRARNNGFISSRKGVNLPNTDVDLPALSEKDKADLRFGVKNNVDMVFASFIRRAQDIKDIRDVLGPEG-KQIQIIAKIENRQGLNNFAEILEETDGVMVARGDLGIEIPAAEVFAAQKKMIAMCNIAGKPVICATQMLESMIKNPRPTRAEISDVGNAVTDGADCVMLSGETAKGNYPAESIHEMHEASLKAENTIPY---VSHFEEMCTLVKRPVSTVES--CAMAAVRASLD---LGAGGIIVLSTSGDSARLLSKYRPVCPIFMVT-RNPTTSRFSHLYRGVY 463
>gi|58337255|ref|YP_193840.1| pyruvate kinase [Lactobacillus acidophilus NCFM] >gi|58254572|gb|AAV42809.1| pyruvate kinase [Lactobacillus acidophilus NCFM] (589 aa)
Score = 610, Expect = 3.9e-61, Identities = 143/361 (39%), Positives = 211/361 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +KKTKI +TLGP+                   IET    + AL +AG NV RFNFSHGD+EE   R+N+VREV K  G  +   LDTKG EIR  +    +  I +   +RI     + G  +   V     TY+ +  D   G  + +DDG + L +   +  +  +   A+NT ++   K +N P     +P ++ KD +DI F +K   ++I ASF     ++ +I+K+ +  G ++++I  KIE+  GI + D+I+  SD +MVARGD+G+E+P+ +VP  +K +I+     GK VI ATQMLDS++   +PTRAEV+DV  AV  GTD TMLSGE+ANG+YP+NAV+ MA+ID  +E
  S:     1 MKKTKIVSTLGPASND----------------IET----ITALANAGANVFRFNFSHGDHEEHRSRMNMVREVEKNTGKLLGIALDTKGAEIRTTEQEGGKFTINTGDTIRISMDDTKKGNKDMIHV-----TYDGLYDDTHVGGHVLIDDGLVDLLIKEKDDAKRELVCEAQNTGLIGSKKGVNAPGVEIRLPGITQKDTDDINFGLKEGINFIFASFARKAQDILDIRKLCEAAGADYVKIFPKIESQEGIDNADEILQVSDGLMVARGDMGVEIPFMEVPFVQKNLIRKANALGKPVITATQMLDSMQENPRPTRAEVSDVANAVLDGTDATMLSGESANGLYPVNAVKAMAEIDERTE 337
>gi|13928580|dbj|BAB47171.1| pyruvate kinase [Toxoplasma gondii] (531 aa)
Score = 610, Expect = 4.3e-61, Identities = 138/327 (42%), Positives = 203/327 (62%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKG-VNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           L  + DAG+NV R NFSHGD+E     +  ++E  K++    ++ +LDTKGPEIR  +    K + ++  + ++I T    IG  ++ ++  S G   + + V+PGNTI + DG L ++V+   V    + T A+NT  + E K +NLP+    +P + +KD++DI+ F I    ++IAASFV + D+VR I+ +L   G  HI+II KIE + G+ + D+I+ E+D IM+ARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAE  DV  AV  GTDC MLSGETANG +P+  VE MA+I   +E   DY
  S:    74 LVKMIDAGMNVCRLNFSHGDHETHARTVQNIQEAMKQRPEARLAILLDTKGPEIRTGFLKDHKPITLQQGATLKIVTDYNLIG--DETTIACSYGA--LPQSVKPGNTILIADGSLSVKVVE--VGSDYVITQAQNTATIGERKNMNLPNVKVQLPVIGEKDKHDILNFGIPMGCNFIAASFVQSADDVRYIRGLLGPRG-RHIRIIPKIENVEGLVNFDEILAEADGIMIARGDLGMEIPPEKVFLAQKMMIAKCNVVGKPVITATQMLESMIKNPRPTRAEAADVANAVLDGTDCVMLSGETANGEFPVITVETMARICYEAETCVDY 396
>gi|67538080|ref|XP_662814.1| KPYK_EMENI Pyruvate kinase (PK) [Aspergillus nidulans FGSC A4] >gi|146345447|sp|P22360|KPYK_EMENI Pyruvate kinase (PK) >gi|40743201|gb|EAA62391.1| KPYK_EMENI Pyruvate kinase (PK) [Aspergillus nidulans FGSC A4] (526 aa)
Score = 609, Expect = 4.7e-61, Identities = 160/452 (35%), Positives = 243/452 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           K  ++T I  T+GP                       + + + AL  AG+NVVR NFSHG YE     ++  RE  K++ G  ++  LDTKGPEIR   T  +K++ IK+  ++ I T ++    S+  ++       N+ K +  G  I+VDDG L  EV+   V++  +     N   +   K +NLP ++  +P +S+KD +D+ F +KNK D + ASF+  G ++R I+++L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV +M++  + +E    +    D      P   + V ++A  +A + A   +      +  +IVV        + +S  R   PI  V+ +   ATR+   Y
  S:    30 KNFRRTSIICTIGPKTN--------------------SVEKINALRRAGLNVVRMNFSHGSYEYHQSVIDHAREAEKQQAGRPVAIALDTKGPEIRTGNTVGDKDIPIKAGHEMNISTDEQYATASDDQNMY--VDYKNITKVISAGKLIYVDDGILSFEVLEV-VDDKTLRVRCLNNGNISSRKGVNLPGTDVDLPALSEKDISDLKFGVKNKVDMVFASFIRRGSDIRHIREVLGEEGRE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPCEAVTMMSETCLLAEVAIPHFNVFDELRNLAPRPTDTVESIA--MAAVSASLEL------NAGAIVVLTTSGNTARMISKYRPVCPIIMVS-RNPAATRYSHLY 450
>gi|189424672|ref|YP_001951849.1| pyruvate kinase [Geobacter lovleyi SZ] >gi|189420931|gb|ACD95329.1| pyruvate kinase [Geobacter lovleyi SZ] (480 aa)
Score = 609, Expect = 5.2e-61, Identities = 159/464 (34%), Positives = 249/464 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV---FVKVVDNVEHAIA 468
           ++TKI ATLGP+                     ++   +  L + GV++ R NFSHG  ++++  +N +R  + + G  +  + D +GP+IR  + +   + +K   +V I TT   +G       L  T    + +DV PG+ I +DDG L+L+V++   EE  +  +  N  +L+ NK INLP    S P +++KD  D+ F +    DYIA SFV T ++V +IK+I+    G+ I +++KIE    +++ + I+  SD++MVARGDLG+E+    VP  +K II+ C   GK VI ATQML+S+ T  +PTRAE +DV  A+  GTD  MLSGETA+G +P+ AVE MA+I +  EN   YG   +     TP + + VG  A   A+ +  K           +I VF         +S  R   PI   T+  E   +  L +GV    +K+++++E  IA
  S:     6 RRTKIVATLGPA--------------------SSSPDMIERLLNTGVDLFRLNFSHGTLDDKSSLINAIRAASAKLGREVGILADLQGPKIRTGRMAGDGMLLKKGQEVVI-TTADVLGADG----LIPTIYTELPRDVTPGSRILLDDGLLELKVLAIEAEE--VRCLVVNGGLLKNNKGINLPGVKVSAPSLTEKDLADLDFCLWVDVDYIALSFVRTHEDVEQIKRIIY-GAGKDIPVVAKIEKPEALRNFNKILKVSDAVMVARGDLGVEIQAEKVPLIQKKIIQACNQAGKPVITATQMLESMITNPRPTRAETSDVANAIIDGTDAVMLSGETASGAHPLAAVETMARIALDVEN-AGYGSKANAPVLVTPSIAQAVGEAACRAASCLKAK-----------AIAVFTQSGSTAALISRFRPPIPIVAFTNAVEIQRKLTLYWGVRTKSIKMLESMEQQIA 432
>gi|71003247|ref|XP_756304.1| hypothetical protein UM00157.1 [Ustilago maydis 521] >gi|46096309|gb|EAK81542.1| hypothetical protein UM00157.1 [Ustilago maydis 521] (528 aa)
Score = 609, Expect = 5.8e-61, Identities = 171/455 (37%), Positives = 239/455 (52%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEE-QTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           K  +KT I AT+GP                         + L AL  AG+N+VR N SHG +E  +++  N    VAK  G  ++  LDTKGPE+R       E ++K       Y T  +   +EK S+      Y N+A+ V+ G TIF+DDG L L+V++   ++ +++  A N  +L   K +NLP +   +P +SDKDR DI FA++   D I ASF+  G +VR I++IL E G  HI+IISK+E   G+++ D+I+ ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YPI AV++MA+    +E    Y       F E   +         TIA + A    ++ H      +   G   RL+   S  R + PI  +T     A    L  G +
  S:    27 KFFRKTSIIATIGPKTNNV--------------------EMLGALRQAGMNIVRLNASHGSHEYFKSVVDNARAVVAKTPGRPLAIALDTKGPEMRTGVMVNGE-DVKISMGHEFYVTTDD-AYAEKCSLDYLYIDYKNLAQKVEVGRTIFIDDGILSLQVLAIESDK-LVKVRAVNNGVLSSKKGVNLPMTEVDLPAISDKDRKDIEFAVEQDLDMIFASFIRRGSDVRTIREILGEKGA-HIKIISKVENHQGVQNFDEILKESDGIMVARGDLGIEIPAPQVFMAQKMMISKCNIAGKPVICATQMLESMIVNNRPTRAEVSDVANAVLDGADCVMLSGETAKGAYPIEAVKMMAETAYLAEQSVSYVP----LFNEMRTLTSIPTDTNETIA-MAAVAASLEQHAGAILLMSTSGTTARLV---SKYRPSCPILTITRNSHTARDVHLYRGCY 451
>gi|195502547|ref|XP_002098272.1| GE10290 [Drosophila yakuba] >gi|194184373|gb|EDW97984.1| GE10290 [Drosophila yakuba] (824 aa)
Score = 608, Expect = 5.9e-61, Identities = 162/450 (36%), Positives = 251/450 (55%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREV----AKEKGV--NISTMLDTKGPEIRVYKTS----EKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD-------NVEHAIANKTEIIDAINSQLPEVKKTVVVIN 492
           L  L  AG+ VVR NFSHG +E     +   R+      ++ G+   ++  LDTKGPEIR  K +      E+E+K+  KV + T K+    S K ++        + + V+PGN IFVDDG + L V  +  +E I +    N   L  +K INLP     +P +++KD+ D+IF  + K D I ASF+  G+ ++EI+++L     E I+IISKIE   G+ ++D+II ESD IMVARGD+G+E+P  DVP  +K I+  C   GK VI ATQM++S+ +K +PTRAE +DV  A+  G+D  MLSGETA G YP+  V+ MA+I    E    Y    +   +E   ++       + + T +A    +        +IVV    + + Q +S++R   PI  +T  +  A +  L  GV+  +V+       N    + +  +++  ++   P  K +VVV+N
  S:    89 LLELIRAGMRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTLAIALDTKGPEIRTGKLAGGDDRAEIELKAGDKVTLSTKKELADKSTKENIY--VDYQRLPELVKPGNHIFVDDGLIALIVKEAKGDEVICQV--ENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLIFGAEQKVDMIFASFIRDGNALKEIRQVLGP-AAECIKIISKIENQQGLANIDEIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTSKPRPTRAEASDVANAIFDGSDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLKRE---IRTSAADHISAVTTAIAEAATVGQA----RAIVVASPCSMVAQMVSHMRPPCPIVMLTGSQSEAAQSLLFRGVYPLLVEEMVIGSLNFRRIMQSGLKLMGKMDILEPGQKGSVVVVN 543
>gi|15241190|ref|NP_200446.1| pyruvate kinase, putative [Arabidopsis thaliana] >gi|10177833|dbj|BAB11262.1| pyruvate kinase [Arabidopsis thaliana] >gi|15450942|gb|AAK96742.1| pyruvate kinase [Arabidopsis thaliana] >gi|17978781|gb|AAL47384.1| pyruvate kinase [Arabidopsis thaliana] >gi|21592702|gb|AAM64651.1| pyruvate kinase [Arabidopsis thaliana] (498 aa)
Score = 608, Expect = 6.5e-61, Identities = 148/393 (37%), Positives = 217/393 (55%)
  Q:     1 MKMIK---KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           M MI+   KTKI  TLGP+               ++ V    K     L  AG+NV RFNFSHG +E     L+ + +     G+  + MLDTKGPEIR  +    K +++K   ++ I T     G      +        +A DV PG  I   DG + L V+S + E G +     N+ +L E K +NLP     +P +++KD+ DI+ + + N+ D IA SFV  G ++ +++K+L +H  ++I ++SK+E   G+ + DDI+  SD+ M+ARGDLG+E+P   +   +K +I  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV  MAKI V +E+  DYG         +P     + +LA++
  S:     1 MAMIEQRPKTKIVCTLGPA---------------SRSVPMVEK-----LLRAGMNVARFNFSHGSHEYHQETLDNLHQAMLNTGILCAVMLDTKGPEIRTGFLKDGKPIQLKQGQEITISTDYDLKGDENTICM----SYKKLAVDVNPGMVILCADGTISLLVLSCDKENGTVRCRCENSAMLGERKNVNLPGVVVDLPTLTEKDKEDIMQWGVPNQIDMIALSFVRKGSDLVQVRKLLGKHA-KNILLMSKVENQEGVANFDDILVNSDAFMIARGDLGMEIPIEKIFLAQKVMIYKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICVEAESTLDYGDVFKRIMLYSPVPMSPLESLASS 373
>gi|4033429|sp|O44006|KPYK_EIMTE Pyruvate kinase (PK) >gi|2854033|gb|AAC02529.1| pyruvate kinase [Eimeria tenella] (531 aa)
Score = 608, Expect = 6.9e-61, Identities = 144/364 (39%), Positives = 207/364 (56%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           +TKI  T+GPS         D +K             +  L DAG+NV R NFSHGD+E     +  ++E  K++ G  ++ +LDTKGPEIR      +K +E+ +   ++I T    +G     +         +   V+PGNTI + DG L +EV+     +  + T   N  I+   K +NLP     +P + +KD+NDI+ F I    ++IAASFV + D+VR I+ IL   G  +I+II KIE + G+ + D+I+ E+D IM+ARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAE  DV  AV  GTDC MLSGETANG +P+ AV VM+++   +E   DY
  S:    57 RTKIVCTMGPSCW-------DVDK-------------MVQLIDAGMNVCRLNFSHGDHEAHGRVVKNLQEALKQRPGKRVALLLDTKGPEIRTGMLEGDKPIELHAGDMLKIVTDYSFVGNKSCIAC----SYEKLPSSVKPGNTILIADGSLSVEVVECG--KDYVMTRVMNPAIIGNKKNMNLPGVKVDLPVIGEKDKNDILNFGIPMGCNFIAASFVQSADDVRYIRSILGTKG-RNIKIIPKIENVEGLLNFDEILQEADGIMIARGDLGMEIPPEKVFLAQKMMISKCNVAGKPVITATQMLESMTKNPRPTRAEAADVANAVLDGTDCVMLSGETANGSFPVQAVTVMSRVCFEAEGCIDY 396
>gi|15242863|ref|NP_201173.1| pyruvate kinase, putative [Arabidopsis thaliana] >gi|10177049|dbj|BAB10461.1| pyruvate kinase [Arabidopsis thaliana] (510 aa)
Score = 608, Expect = 7.3e-61, Identities = 149/388 (38%), Positives = 214/388 (55%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+               ++ V    K     L  AG+NV RFNFSHG +E     L+ +R   +  G+  + MLDTKGPEIR  +      +++K   ++ I TT  +I   EK     S     +  DV+PGNTI   DG + L V+S +   G +     NT +L E K +NLP     +P ++DKD  DI+ + + N  D IA SFV  G ++  ++K+L  H  + I ++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV+ MAKI + +E+  DY        + TP     + +LA++
  S:    21 KTKIVCTLGPA---------------SRSVTMIEK-----LLKAGMNVARFNFSHGSHEYHQETLDNLRTAMQNTGILAAVMLDTKGPEIRTGFLKDGNPIQLKEGQEITI-TTDYDIKGDEK---TISMSYKKLPVDVKPGNTILCADGSISLAVVSCDPNAGTVICRCENTAMLGERKNVNLPGVVVDLPTLTDKDVEDILKWGVPNNIDMIALSFVRKGSDLVNVRKVLGSHS-KSIMLMSKVENQEGVLNFDEILRETDAFMVARGDLGMEIPIEKIFLAQKMMIYKCNLAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEIAVKTMAKICIEAESSLDYNTIFKEMIRATPLPMSTLESLASS 385
>gi|52547716|gb|AAU81893.1| pyruvate kinase [Phaeodactylum tricornutum] (543 aa)
Score = 607, Expect = 7.7e-61, Identities = 174/492 (35%), Positives = 264/492 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV--YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLA--TTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRF-GLNYGVFVKVVDNVEHAIANKTEI-IDAINSQLPEVKKTVVVINDSIY 496
           ++TKI  T+GP         A +N  +           L  L ++G+NV RFNFSHGD+      L  VR+ A+ KG NI+ +LDTKGPEIR   +     ++E+     + + +  K  G   K +      +Y  +A+ V  G  I V DG L L V+ ++   G +     N   + E K +NLP     +P  ++KD +DI+ F IK+K D+IAASFV    +V  ++++L E+GG+ I+I  KIE   G+++ D I+  +DSIMVARGDLG+E+P   V   +K +I++    GK VI ATQML+S+    +PTRAE +DV  AV  GTDC MLSGETANG Y   AV+VMA+    +EN  +Y     +Y      +  K G++    ++A+  A K  ID    +   I+V          +S  R    I  +T     A +  G+  GV   VVDN+++      E  ++A+ + +  V   +VV++ ++Y
  S:    31 RRTKIVCTIGP---------ACWNVDQ-----------LEILIESGMNVARFNFSHGDHAGHGAVLERVRQAAQNKGRNIAILLDTKGPEIRTGFFANGASKIELVKGETIVLTSDYKFKGDQHKLAC-----SYPALAQSVTQGQQILVADGSLVLTVLQTDEAAGEVSCRIDNNASMGERKNMNLPGVKVDLPTFTEKDVDDIVNFGIKHKVDFIAASFVRKQSDVANLRQLLAENGGQQIKICCKIENQEGLENYDAILQATDSIMVARGDLGMEIPPAKVFLAQKMMIREANIAGKPVITATQMLESMINNPRPTRAECSDVANAVLDGTDCVMLSGETANGPYFEEAVKVMARTCCEAENSRNYN---SLYSAVRSSVMAKYGSVPPEESLAS-SAVKTAID---VNARLILVLSESGMTAGYVSKFRPGRAIVCLTPSDAVARQTGGILKGVHSYVVDNLDNTEELIAETGVEAVKAGIASVGDLMVVVSGTLY 498
>gi|110739133|dbj|BAF01483.1| pyruvate kinase [Arabidopsis thaliana] (510 aa)
Score = 607, Expect = 8.6e-61, Identities = 149/388 (38%), Positives = 214/388 (55%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+               ++ V    K     L  AG+NV RFNFSHG +E     L+ +R   +  G+  + MLDTKGPEIR  +      +++K   ++ I TT  +I   EK     S     +  DV+PGNTI   DG + L V+S +   G +     NT +L E K +NLP     +P ++DKD  DI+ + + N  D IA SFV  G ++  ++K+L  H  + I ++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV+ MAKI + +E+  DY        + TP     + +LA++
  S:    21 KTKIVCTLGPA---------------SRSVTMIEK-----LLKAGMNVARFNFSHGSHEYHQETLDNLRTAMQNTGILAAVMLDTKGPEIRTGFLKDGNPIQLKEGQEITI-TTDYDIKGDEK---TISMSYKKLPVDVKPGNTILCADGSISLAVVSCDPNAGTVICRCENTAMLGERKNVNLPGVVVDLPTLTDKDVEDILKWGVPNNIDMIALSFVRKGSDLVNVRKVLGSHS-KSIMLMSKVENQEGVLNFDEILRETDAFMVARGDLGMEIPIEKIFLAQKIMIYKCNLAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEIAVKTMAKICIEAESSLDYNTIFKEMIRATPLPMSTLESLASS 385
>gi|168074|gb|AAA33320.1| pyruvate kinase (526 aa)
Score = 607, Expect = 8.7e-61, Identities = 160/452 (35%), Positives = 242/452 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           K  ++T I  T+GP                       + + + AL  AG+NVVR NFSHG YE     ++  RE  K+  G  ++  LDTKGPEIR   T  +K++ IK+  ++ I T ++    S+  ++       N+ K +  G  I+VDDG L  EV+   V++  +     N   +   K +NLP ++  +P +S+KD +D+ F +KNK D + ASF+  G ++R I+++L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV +M++  + +E    +    D      P   + V ++A  +A + A   +      +  +IVV        + +S  R   PI  V+ +   ATR+   Y
  S:    30 KNFRRTSIICTIGPKTN--------------------SVEKINALRRAGLNVVRMNFSHGSYEYHQSVIDHAREAEKQAAGRPVAIALDTKGPEIRTGNTVGDKDIPIKAGHEMNISTDEQYATASDDQNMY--VDYKNITKVISAGKLIYVDDGILSFEVLEV-VDDKTLRVRCLNNGNISSRKGVNLPGTDVDLPALSEKDISDLKFGVKNKVDMVFASFIRRGSDIRHIREVLGEEGRE-IQIIAKIENQQGVNNFDEILEETDGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPCEAVTMMSETCLLAEVAIPHFNVFDELRNLAPRPTDTVESIA--MAAVSASLEL------NAGAIVVLTTSGNTARMISKYRPVCPIIMVS-RNPAATRYSHLY 450
>gi|147821580|emb|CAN70030.1| hypothetical protein [Vitis vinifera] (500 aa)
Score = 606, Expect = 1.1e-60, Identities = 142/388 (36%), Positives = 212/388 (54%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+                   +E  +K    L  AG+NV RFNFSHG +      L+ +R          + MLDTKGPEIR  +    K V++K   ++ I T     G      +        +A+D++P + I   DG + L V++ + E G++     N+ +L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++ E++ +L EH  + I ++SK+E   G+ + D+I+  SD+ MVARGDLG+E+P   +   +K +I  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV+ MA+I + +EN  +YG       +  P     + +LA++
  S:    11 KTKIVCTLGPASRS----------------VEVIEK----LLRAGMNVARFNFSHGSHAYHQQTLDNLRTAMANTETLCAVMLDTKGPEIRTGFLKDGKPVQLKKGQEITISTDYSIKGDDHMICM----SYQKLAEDLRPQSVILCADGTITLTVLACDKELGLVRCRCENSAVLGERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNKIDMIALSFVRKGSDLVEVRMLLAEHA-KSILLMSKVENQEGVANFDEILANSDAFMVARGDLGMEIPIEKIFLAQKVMIYKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVQTMARICLEAENSLNYGDVFKTIMETAPMPMSPIESLASS 375
>gi|83590701|ref|YP_430710.1| pyruvate kinase [Moorella thermoacetica ATCC 39073] >gi|83573615|gb|ABC20167.1| pyruvate kinase [Moorella thermoacetica ATCC 39073] (582 aa)
Score = 606, Expect = 1.2e-60, Identities = 155/452 (34%), Positives = 245/452 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++ TKI  T+GP+              E   VI+       A+  AG+NV RFNFSHG + E   R+  VR+ A E G  ++ MLD KGPEIR+ +  + EV +K   +V + TT+  IG + +  V        +  DV+PG  I +DDG ++LEV+++   E  I    R+  ++  +K +N+P +  S+P  +++D  D+ F ++   D+IA SFV T  +V  +++ L++     + II+KIE   G+ ++ +I++ +D +MVARGDLG+E+P  +VP  +K II+ C   GK VI ATQML+S+    +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV  MA+I   +E    YG   D+  K+     E+  T A + A+          +  D ++I+         + ++  R  API   +  ++   +  L +GV
  S:     1 MRHTKIVCTMGPA-------------SERVEVIK-------AMIRAGMNVARFNFSHGSHAEHGARMAAVRQAAAELGARVALMLDNKGPEIRLGEI-QGEVTLKDGDQVTL-TTEPIIGDARRLPV----SFAGLPGDVRPGQIILLDDGLVELEVLATTATE--IHCRVRHGDVISSHKGVNVPGAEISLPPFTEQDIKDLEFGLQQGIDFIALSFVRTAGDVLAVRRELEKRNAR-VAIIAKIENHAGVNNIHEILEVADGVMVARGDLGVEIPVEEVPLVQKKIIEACNLAGKPVITATQMLESMIHNPRPTRAEASDVANAIFDGTDAIMLSGETATGRYPVEAVATMARIARRAERGLPYG---DLLTKKG-LAAERTATDAISHASCTIA------YELDAAAIITPTASGSTARRVAKYRPRAPILATSPNEKVLNQLCLVWGV 413
>gi|125606|sp|P22200|KPYC_SOLTU Pyruvate kinase, cytosolic isozyme (PK) >gi|22576|emb|CAA37727.1| pyruvate kinase [Solanum tuberosum] (510 aa)
Score = 606, Expect = 1.2e-60, Identities = 153/436 (35%), Positives = 223/436 (51%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV 439
           I KTKI  TLGPS                          L  L  AG+NV RFNFSHG +E     L+ ++   +   +  + MLDTKGPEIR  + T  K +++K   ++ + T     G  E  S+        +  D++PGNTI   DG + L V+S +   G +     NT  L E K +NLP     +P +++KD+ DI+ + + N  D IA SFV  G ++  ++K+L  H  + IQ++SK+E   G+ + D+I+ E+DS MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+     PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++M++I + +E+  D         + TP     + +LA++        R           IVV        + ++  R A PI  V
  S:    19 IPKTKIVCTLGPS--------------------SRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLKIAMQNTQILCAVMLDTKGPEIRTGFLTDGKPIQLKEGQEITVSTDYTIKGNEEMISM----SYKKLVMDLKPGNTILCADGTITLTVLSCDPPSGTVRCRCENTATLGERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNNIDMIALSFVRKGSDLVNVRKVLGPHA-KRIQLMSKVENQEGVINFDEILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKAVVTATQMLESMIKSPAPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMSRICIEAESSLDNEAIFKEMIRCTPLPMSPLESLASSAVRTANKARA--------KLIVVLTRGGSTAKLVAKYRPAVPILSV 423
>gi|110637804|ref|YP_678011.1| pyruvate kinase [Cytophaga hutchinsonii ATCC 33406] >gi|110280485|gb|ABG58671.1| pyruvate kinase [Cytophaga hutchinsonii ATCC 33406] (470 aa)
Score = 606, Expect = 1.2e-60, Identities = 147/376 (39%), Positives = 221/376 (58%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKET 380
           KKTKI AT+GP+                       K+ L  L  AG N+ R NFSHG ++     +N +RE+ KE  VNI+ + D +GP+IR  +     VE+ + +++ I T +K +GT +K S    T    +  DV+ G+ I +DDG ++L+V+ +    G +  +     IL+  K INLP++  S P ++DKD+ D++F +KN+ D+IA SFV +  ++ E+K I+ EHG +  ++I+K+E    +K +D II+ SD+IMVARGDLG+E+   DVP  +K IIK C    K VIVATQM++S+ T  +PTRAE +DV  A+  GTD  MLS ETA+G YP+  V+ M +I  + E      +  D+Y K T
  S:     4 KKTKIIATVGPACN--------------------TKEKLWELVQAGANIFRLNFSHGTHDVHQGVINAIRELRKEHNVNIAILQDLQGPKIRTDEVENNGVELVAGAQIVI-TKEKMLGTKDKIS----TSYKMLTSDVKKGDAILIDDGNIELKVLETG--NGEVTCVVIYGGILKSRKGINLPNTIVSEPSLTDKDKEDLLFGLKNEVDWIALSFVRSAVDLNELKAIIAEHG-KSCKVIAKVEKPEAVKDIDAIIEASDAIMVARGDLGVELQMEDVPMIQKMIIKKCNQLAKPVIVATQMMESMITNARPTRAEASDVANAIIDGTDTIMLSAETASGNYPVITVKAMTRICQAVE------KEADIYNKST 345
>gi|18311131|ref|NP_563065.1| pyruvate kinase [Clostridium perfringens str. 13] >gi|20141599|sp|Q46289|KPYK_CLOPE Pyruvate kinase (PK) >gi|18145814|dbj|BAB81855.1| pyruvate kinase [Clostridium perfringens str. 13] (474 aa)
Score = 606, Expect = 1.2e-60, Identities = 150/455 (32%), Positives = 244/455 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTK+  T+GPS                      +++ L      G+N  R NFSHGD+     ++ L++ + KE+    + +LD KGP+IR Y     E E+K+  +       + +G + K S+        + +D++PG +I VDDG L+ +V      + I E I   T  ++++K +N+P+    +P +++KDR+D+IF  + + D++AASF+   ++V E+++IL  HGG+ I+IISKIE+  G+ ++ +II  +D +MVARGD+G+E+P  +VP  +K IIK C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A+G +PI A   M++I   +E   DY   +       P        ++ + A+  A K       F   +IV         + LS  + + PI  +T  ++      LN+G+  K
  S:     1 MQKTKMIFTIGPS--------------------SDSEEILREFIRIGMNAARLNFSHGDHASHKEKIELIKRLRKEEKSATAILLDIKGPKIRTYNFKNGEAELKNGDEFTFSCGDEILGDNTKCSI----SYKELYEDIKPGGSILVDDGLLEFKVKEVRGTDIICEVIEGGT--IKDHKGVNVPNVPIKLPAVTEKDRSDLIFGCEMEVDFVAASFIRKPEDVLEVREILDSHGGKDIKIISKIESQEGVDNIKEIIKVTDGVMVARGDMGVEIPIENVPIIQKNIIKKCNQAGKIVITATQMLDSMIRNPRPTRAEASDVCNAIFDGTDAIMLSGESASGSFPIEAAMTMSRIAKKAEANLDYNYLLRRLKDPNPNPDAFADAISYS-ASKTASK-------FPTKAIVAATQTGSTAKILSKYKPSCPIIAITPYEKVRRSLALNFGIISK 421
>gi|134300151|ref|YP_001113647.1| pyruvate kinase [Desulfotomaculum reducens MI-1] >gi|134052851|gb|ABO50822.1| pyruvate kinase [Desulfotomaculum reducens MI-1] (583 aa)
Score = 606, Expect = 1.3e-60, Identities = 159/460 (34%), Positives = 251/460 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           +++TKI  T+GP+                   +ET K  + A    G+NV R NFSHG +E+   R+  +R+ A E   NI+ +LDTKGPEIR+ K ++  V +K D +  + TT++  G +   SV     TY ++ KDV+PG+ I V DG +  E++  +VE   +     N   L   K +NLP  N ++P +++KD  DI F I+ + D+IAASF+    +V  I++IL+E+  + I II+KIE+  G+++L  II+ +D IMVARGDLG+E+P  +VP  +K +I+ C   GK VI ATQML+S+    +PTRAE +DV  A+  GTD  MLSGETA G YP+  VE MA+I   +E   ++   +++          +   +  T+   ++            ++IV         + +S  R   P+  VT +     +  L +GV   ++++V
  S:     1 MRRTKIVCTIGPASED----------------VETLKNMMLA----GMNVARLNFSHGTHEDHAKRIAAIRQSADELNKNIAILLDTKGPEIRLKKFAQPPVILKQDQQFTL-TTREVTGDNTIVSV-----TYQDLPKDVKPGSRIAVADGLI--EMVVESVEGPDVHCRVVNGGQLSNQKGVNLPGVNVNLPSITEKDIEDIRFGIEQRVDFIAASFIRKPGDVLAIRQILEEYDAD-IDIIAKIESRQGVENLTGIINVADGIMVARGDLGVEIPAEEVPVLQKTMIEMCNRAGKPVITATQMLESMTQNPRPTRAEASDVANAIFDGTDAIMLSGETAAGKYPVQTVETMARIAQRAELAVNFDDLLEI----------RGAAIQRTVTDGISQAVCSVARELGVTAIVTATASGHTARMISKYRPKVPVIAVTPRSNVLRKMALVWGVVPLLIEDV 422
>gi|121699058|ref|XP_001267897.1| pyruvate kinase [Aspergillus clavatus NRRL 1] >gi|119396039|gb|EAW06471.1| pyruvate kinase [Aspergillus clavatus NRRL 1] (526 aa)
Score = 605, Expect = 1.4e-60, Identities = 161/452 (35%), Positives = 237/452 (52%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY 453
           K  ++T I  T+GP                       + + + AL   G+NVVR NFSHG YE     ++  RE  K + G  ++  LDTKGPEIR   T  +K++ IK+  ++ I T +K      ++   LD     N+ K ++ G  I+VDDG L  +V+   V++  +     N   +   K +NLP ++  +P +S+KD +D+ F +KNK D I ASF+  G ++  I+K+L E G E IQII+KIE   G+ + D+I++ +D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV +M++  + +E    + +  D      P          T  A  +A   V  +   +  +IVV     +  + LS  R   PI  VT +   A R+   Y
  S:    30 KNFRRTSIICTIGPKTN--------------------SVEKINALRKVGLNVVRMNFSHGSYEYHQSVIDNAREAEKVQSGRPLAIALDTKGPEIRTGNTVGDKDIPIKAGHELNITTDEKYATACDDQNMYLDYK---NITKVIEAGKLIYVDDGILSFQVLEV-VDDKTLRVKCLNNGNISSRKGVNLPGTDVDLPALSEKDISDLKFGVKNKVDMIFASFIRRGSDIEHIRKVLGEEGKE-IQIIAKIENQQGVNNFDEILEATDGVMVARGDLGIEIPAPKVFLAQKMMIAKCNMKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPTEAVTMMSETCLLAEVATPHFQVFDELRNLVP--------RPTCTAESIAMAAVSASLELNAGAIVVLTTSGKTARLLSKYRPVCPILMVT-RNPMAARYSHLY 450
>gi|55979972|ref|YP_143269.1| pyruvate kinase [Thermus thermophilus HB8] >gi|55771385|dbj|BAD69826.1| pyruvate kinase [Thermus thermophilus HB8] (474 aa)
Score = 605, Expect = 1.5e-60, Identities = 159/485 (32%), Positives = 252/485 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYF-KETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVK 485
           M   K+TKI ATLGP+              ++K VI        AL +AG +V R NFSHG  E+   R+  VREVA+E G  ++ + D +GP+IRV +  E +V ++   +  + T +   G   + SV        + +DV PG  + +DDG+++L+V+     E + E       +L  NK IN+P ++ SIP +S+KD  D+    +   D++A SFV T D++   +  L  +G +  ++++KIE  + +   ++I++E+D IMVARGDLG+E+P  +VP  +K +I  C   GK VI ATQML+S+     PTRAE +DV  A+  GTD  MLS ETA G YP+ AV +MA+I  + E+  ++ + ++V     TP  ++ +   A  +   V  +           +IVVF       + ++  R   PI  +T   E   +  L +GV+        H   +  +  D +   L EVK
  S:     1 MPPFKRTKIVATLGPAT-------------DDKEVIR-------ALAEAGADVFRLNFSHGAPEDHRRRVGWVREVAEELGRTLAVLQDLQGPKIRVGRFREGQVLLRPGQRF-VLTAEPVEGDEHRVSV----SYKGLPEDVSPGQILLLDDGRIRLKVLEVRSPEILTEVEVGG--VLSNNKGINIPGADLSIPALSEKDIQDLALGAELGVDWVAVSFVRTRDDLLLARHYLSRYGSK-ARLMAKIEKPSAVARFEEILEEADGIMVARGDLGVEMPLEEVPIVQKRLILRCIAAGKPVITATQMLESMVQNPSPTRAEASDVANAIFDGTDAVMLSAETAAGAYPVEAVAMMARIAKAVESSPEFLQKLNVLRPAPTPTTQDAIAQAADDVVEAVGAR-----------AIVVFTATGGSARRIARTRPQVPILALTPNPEVRNQLALVWGVY-------PHLAPDPQDTDDMVRIALREVK 440
>gi|153853280|ref|ZP_01994689.1| hypothetical protein DORLON_00675 [Dorea longicatena DSM 13814] >gi|149754066|gb|EDM63997.1| hypothetical protein DORLON_00675 [Dorea longicatena DSM 13814] (480 aa)
Score = 604, Expect = 1.8e-60, Identities = 145/366 (39%), Positives = 220/366 (60%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           +KKTKI  T+GP+   +                      +  L   G+++ RFNFSHGD+EEQ  R+++++++ +E+   I+ +LDTKGPEIR     + K+V++++     + TT + +G ++  S+     TY  + +DV+ G+TI +DDG ++L+V          E +  N   L E K +N+P+    +P ++DKDR+D+ F ++   D+IAASFV   + + EIK  L+E    +I +I+KIE    IK++D+II  +D IMVARGDLG+E+P  +VP  +K II+ C    K VI ATQMLDS+    +PTRAEVTDV  AV  GTD  MLSGETA G YP+ A+++M  I  ++E   DY
  S:     1 MKKTKIICTMGPNTNDESL--------------------MRKLVQNGMDIARFNFSHGDHEEQKGRMDMLKKIREEENKPIAILLDTKGPEIRTGVLKDGKKVQLEAGETFTL-TTDEIVGDNKIVSI-----TYKGLVEDVKAGSTILIDDGLIELKVKDKKGNNINCEVV--NGGELGEKKGVNVPNVAIRLPAITDKDRDDLKFGVEQGVDFIAASFVRNAECILEIKSFLRECKAPYIPVIAKIENFEAIKNIDEIIRCADGIMVARGDLGVEIPAEEVPYLQKTIIQKCNDNFKPVITATQMLDSMMRNPRPTRAEVTDVANAVYDGTDAVMLSGETAQGKYPLEALQMMVHIVENTEEHLDY 340
>gi|194247412|emb|CAQ40812.1| Pyruvate kinase, putative [Plasmodium knowlesi strain H] (511 aa)
Score = 603, Expect = 2.3e-60, Identities = 144/365 (39%), Positives = 211/365 (57%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEE-QTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           KKT I  TLGP+                   +ET    L  L DAG+N+ RFNFSHG +E+ + I  N+++   +     +  +LDTKGPEIR      KE  +K  SK+++ T    +G     +         + + V+ GN I + DG +  +V+ ++ +  I E +  N+  + E K +NLP+    +P + +KD+NDI+ FAI    ++IAASF+ + ++VR I+ +L   G  HI+II KIE + GI + D I+ ESD IM+ARGDLG+E+    V   +K +I  C  +GK +I ATQML+S+    +PTRAEVTDV  AV  GTDC MLSGETA G +P+ AV +M+KI + +E   DY
  S:    37 KKTHIVCTLGPACKS----------------VET----LVQLIDAGMNICRFNFSHGSHEDHKEIFNNVLKAQEQRPNALLGMLLDTKGPEIRTGLLKNKEAHLKEGSKLKLVTDYDFLGDETCIAC----SYKKLPQSVKKGNIILIADGSVSCKVLETHDDHVITEVL--NSATIGEKKNMNLPNVKVDLPVIGEKDKNDILNFAIPMGCNFIAASFIQSAEDVRMIRNLLGPRG-RHIKIIPKIENIEGIINFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCNLQGKPIITATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDY 376
>gi|157756067|ref|XP_001670377.1| Hypothetical protein CBG05956 [Caenorhabditis briggsae AF16] >gi|187034581|emb|CAP26398.1| Hypothetical protein CBG05956 [Caenorhabditis briggsae] (515 aa)
Score = 603, Expect = 2.5e-60, Identities = 154/452 (34%), Positives = 246/452 (54%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +KT +  T+GP+ +                 +ET +K    + + G+N+ R NFSHG +E     +  +R+ AK+    ++  LDTKGPEIR  ++  + KEV +++   +R+ T      ++  F++       N+ K V PG+ I++DDG + L ++ S  E  ++ TI  N   L   K +NLP +   +P ++ KD  D++F ++   D I ASF+  G+ +++I+++L E G +HI II+KIE+  G+ + D+II+ SD +MVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+ +K +PTRAE +DV  AV  G DC MLSGETA G YP+ A+ +M  I   +E+ F + +    +F+E     +K   +  T A + A    I         I   G   RL    S  R   PI  V+  ++ + +  L+ G+F
  S:    34 RKTGVICTIGPACSD----------------VETLRK----MINTGMNIARLNFSHGSHEAHAATIKTIRKAAKDAPFPVAIALDTKGPEIRTGMFANNAKEVILENGKSIRVSTDPSMEFSATAFNIY--ADYKNLPKVVTPGSRIYIDDGLISL-IVDSCEENAVVCTI-ENGGALGTRKGVNLPGTVVDLPAVTSKDIEDLLFGVEQGIDIIFASFIRNGEGIQKIRQVLGEKG-KHIYIIAKIESEDGVINADEIIEASDGVMVARGDLGIEIPPEKVFLAQKMLIAKCNLAGKPVICATQMLESMISKPRPTRAECSDVANAVLDGVDCVMLSGETAKGDYPVEALAIMHNICKEAESAFFHMK----HFEELILHTKKPTGMTHTTA-IAAVSATITCRAVAIILITTTGRTARLC---SRYRPPVPIITVSRDEQISRQLHLHRGIF 454
>gi|4033433|sp|Q27686|KPYK_LEIME Pyruvate kinase (PK) >gi|577072|emb|CAA52898.1| pyruvate kinase [Leishmania mexicana] (499 aa)
Score = 603, Expect = 2.6e-60, Identities = 135/323 (41%), Positives = 197/323 (60%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           L  L  +G++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR  +    +  ++  +   + T     + GT +KF +       N++K V+PGN I++DDG L L+V  S+ +E  +E    N+  + + + +NLP  +  +P +S KDR D+ F ++   D I ASF+ + + V +++K L   G + I II KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++
  S:    38 LKGLIQSGMSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGDAVMERGATCYVTTDPAFADKGTKDKFYI----DYQNLSKVVRPGNYIYIDDGILILQV-QSHEDEQTLECTVTNSHTISDRRGVNLPGCDVDLPAVSAKDRVDLQFGVEQGVDMIFASFIRSAEQVGDVRKALGPKGRD-IMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQS 356
>gi|76789057|ref|YP_328143.1| pyruvate kinase [Chlamydia trachomatis A/HAR-13] >gi|76167587|gb|AAX50595.1| pyruvate kinase [Chlamydia trachomatis A/HAR-13] (485 aa)
Score = 603, Expect = 2.6e-60, Identities = 154/465 (33%), Positives = 248/465 (53%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDV-----YFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAI 467
           MI +TKI  T+GP+           N PE           L  L DAG+NV R NFSHG +E     + +++E+ +++ V ++ MLDTKGPEIR+    + E  IK     R+    KEI G+ E    L  +  +   ++  P   + +DDG ++  V+  N +E ++E   +N+  ++ NK +++ D + ++PFM++KD  D+ F ++ + D IAASFV   +++  ++K+L+  G  ++ II+KIE   G+++  +I   +D IM+ARGDLG+E+   +VP  +K+I +  R  G+  I ATQML+S+     PTRAEV+DV  A+  GT   MLSGETA G +P++AV+ M  I   +E  FDY     +       K +P++ E +G     IA   + K           +I+V+         LS  R   PI  VT  +    R  + +GV+  +     H +
  S:     1 MIARTKIICTIGPAT----------NTPEM----------LEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQVPLAIMLDTKGPEIRL---GQVESPIKVQPGDRLTLVSKEILGSKESGVTLYPSCVFPYVRERTP---VLIDDGYIQAVVV--NAQEHMVEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDIDSMRKVLESFGRPNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIELSIVEVPGLQKFIARASRETGRFCITATQMLESMIRNPLPTRAEVSDVANAIYDGTSAVMLSGETALGAHPVHAVKTMRSIIQETEKTFDYHAFFQLNDKNSALKVSPYL-EAIGFSGIQIAEKASAK-----------AIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVYPMLTLESNHTV 431
>gi|154273240|ref|XP_001537472.1| hypothetical protein HCAG_07781 [Ajellomyces capsulatus NAm1] >gi|150415984|gb|EDN11328.1| hypothetical protein HCAG_07781 [Ajellomyces capsulatus NAm1] (542 aa)
Score = 603, Expect = 2.7e-60, Identities = 155/408 (37%), Positives = 227/408 (55%)
  Q:    49 AGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           AG+NVVR NFSHGDYE  Q++  N  R    ++G  ++  LDTKGPEIR  KT   K+++I   +++ I T+  +         L      N+ K +Q G  I+VDDG L  EV+   +++  +     N  ++   K +NLP ++  +P +S+KD+ D+ F +KNK D I ASF+    ++R+I+ +L E G E IQII+KIE   G+ + D+I++E+D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV+ G DC MLSGETA G YP  AV +M +  + +E    Y    D      P   + V ++A  +A + A   +      +  +I+V        + LS  R   PI  VT     A    L  GV+
  S:    48 AGLNVVRMNFSHGDYEYHQSVVDNARRAEKIQEGRPLAIALDTKGPEIRTGKTVGGKDIKITEGTELVI-TSHDDYAEKSDLHYL-YVDYKNITKVIQKGKLIYVDDGILSFEVLEI-IDDSSLRARCLNNGVISSKKGVNLPGTDIDLPALSEKDKQDLRFGVKNKVDMIFASFIRRASDIRDIRAVLGEEGKE-IQIIAKIENEQGVNNFDEILEETDGVMVARGDLGIEIPAAKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVQDGADCVMLSGETAKGDYPKEAVTMMHETCLIAEVAIPYVNVFDELRNLAPRPMDTVESIA--MAAVSASLEL------NAGAILVLTTSGHSARLLSKYRPICPIIMVTRNGIAARYSHLYRGVY 445
>gi|73811195|gb|AAZ86534.1| pyruvate kinase [Capsicum annuum] (511 aa)
Score = 603, Expect = 2.7e-60, Identities = 142/379 (37%), Positives = 207/379 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF 382
           + KTKI  TLGPS                      +   L  L  AG+NV RFNFSHG +E     LN ++   +   +  + MLDTKGPEIR  +    K +++K   ++ + T     G  E  S+        +  D++PGNTI   DG + L V+S +   G +     NT  L E K +NLP     +P +++KD+ DI+ + + N  D IA SFV  G ++  ++K+L  H  + IQ++SK+E   G+ + D+I+ E+DS MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++MA+I + +E+  +Y        + TP 
  S:    19 VPKTKIVCTLGPS--------------------SRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLKIAMQNTQILCAVMLDTKGPEIRTGFLKDGKPIQLKEGQEITVSTDYTIKGNVEMISM----SYKKLVVDLKPGNTILCADGTITLTVLSCDPAAGTVRCRCENTATLGERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNNIDMIALSFVRKGSDLVNVRKVLGPHA-KRIQLMSKVENQEGVVNFDEILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMARICLEAESSLEYEAIFKEMIRCTPL 374
>gi|166154543|ref|YP_001654661.1| pyruvate kinase [Chlamydia trachomatis 434/Bu] >gi|166155418|ref|YP_001653673.1| pyruvate kinase [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930531|emb|CAP04026.1| pyruvate kinase [Chlamydia trachomatis 434/Bu] >gi|165931406|emb|CAP06980.1| pyruvate kinase [Chlamydia trachomatis L2b/UCH-1/proctitis] (485 aa)
Score = 603, Expect = 2.8e-60, Identities = 152/454 (33%), Positives = 246/454 (54%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDV-----YFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           MI +TKI  T+GP+           N PE           L  L DAG+NV R NFSHG +E     + +++E+ +++ V ++ MLDTKGPEIR+    + E  IK     R+    KEI G+ E    L  +  +   ++  P   + +DDG ++  V+  N +E ++E   +N+  ++ NK +++ D + ++PFM++KD  D+ F ++ + D IAASFV   +++  ++K+L+  G  ++ II+KIE   G+++  +I   +D IM+ARGDLG+E+   +VP  +K++ +  R  G+  I ATQML+S+     PTRAEV+DV  A+  GT   MLSGETA+G +P++AV+ M  I   +E  FDY     +       K +P++ E +G     IA   + K           +I+V+         LS  R   PI  VT  +    R  + +GV+
  S:     1 MIARTKIICTIGPAT----------NTPEM----------LEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQVPLAIMLDTKGPEIRL---GQVESPIKVQPGDRLTLVSKEILGSKESGVTLYPSCVFPYVRERAP---VLIDDGYIQAVVV--NAQEHMVEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDIDSMRKVLESFGRPNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIELSIVEVPGLQKFMARASRETGRFCITATQMLESMIRNPLPTRAEVSDVANAIYDGTSAVMLSGETASGAHPVHAVKTMRSIIQETEKTFDYHAFFQLNDKNSALKVSPYL-EAIGFSGIQIAEKASAK-----------AIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVY 420
>gi|145354579|ref|XP_001421558.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144581796|gb|ABO99851.1| predicted protein [Ostreococcus lucimarinus CCE9901] (527 aa)
Score = 602, Expect = 3.0e-60, Identities = 142/363 (39%), Positives = 209/363 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD 368
           K+KI  TLGP                    +    + L  +  AG++V RFNFSHG +E     L+ +R      G++   +LDTKGPEIR    +     +    K  + TT  E  G++EK +V     +Y ++AKDV+PG+ I   DG +   V+  +V +G +     N+  L E K +NLP  N ++P +++KDR D+I + +KN  D+IAASFV  G +V  I+ +L +   + + IISK+E M G+ + DDI+++SD +MVARGDLG+E+    +   +K +IK C + GK V+ ATQML+S+    +PTRAE TDV  A+  GTD  MLSGETA G Y I+AV+ MA I   +E + D
  S:    40 KSKIICTLGP--------------------VSRTVEILEEMLRAGMSVARFNFSHGSHEYHQETLDNLRAACANTGIHCGVLLDTKGPEIRTGMLACGGPVMLEAGKEIVLTTDYEFKGSAEKLAV-----SYPDLAKDVKPGSKILCADGSVTFTVLECDVAKGEVRCRLENSAKLGERKNMNLPGVNVNLPTITEKDRLDLIEWGVKNNVDFIAASFVRKGSDVEYIRSVLGDFANK-VSIISKVENMEGLDNYDDIVEKSDGVMVARGDLGMEIRMEQIFLAQKRMIKRCNYAGKPVVTATQMLESMTGAPRPTRAEATDVANAILDGTDAVMLSGETAAGNYAIDAVKCMASICREAEAYVD 379
>gi|116055375|emb|CAL58043.1| Pyruvate kinase (ISS) [Ostreococcus tauri] (468 aa)
Score = 602, Expect = 3.0e-60, Identities = 147/410 (35%), Positives = 235/410 (57%)
  Q:    46 LFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVT-----DKKEYATRFGLNYGV 455
           +  AG+++ RFNFSHG +E     L+ +R      G++   +LDTKGPEIR         V +++ +++ + T     G++EK +V     +Y ++AKDV+PG+ I   DG +   V+  +V +G +     N+  L E K +NLP    ++P +++KDR+D+I + +KN+ D+IAASFV  G +V  I+ +L +   + + IISK+E M G+ + +DI++ SD +MVARGDLG+E+    +   +K +IK C   GK V+ ATQML+S+    +PTRAE TDV  A+  GTD  MLSGETA G YP++AV+ MA I   +E + D         ++ P     V +LA++ A   A K        D ++I+         + ++  R AAPI  V      +  + A +F ++ G+
  S:     1 MLRAGMSIARFNFSHGSHEYHQETLDNLRRACANTGIHCGVLLDTKGPEIRTGMLACGGPVMLEAGNEITLTTDYDFKGSAEKIAV-----SYPDLAKDVKPGSKILCADGSVTFTVLECDVAKGEVRCKLENSAKLGERKNMNLPGVVVNLPTITEKDRHDLIEWGVKNQVDFIAASFVRKGSDVEYIRSVLGDFASK-VSIISKVENMEGLDNFEDIVEASDGVMVARGDLGMEIRMEQIFLAQKRMIKRCNIAGKPVVTATQMLESMTGAPRPTRAEATDVANAILDGTDAVMLSGETAAGSYPLDAVKCMASICREAEAYVDNLATYFTILEQQPMPMSTVESLASS-AVRTAQK-------VDAAAIITLSKSGDTARLIAKYRPAAPIVAVAYASVENPGQIARKFLMSRGI 404
>gi|182624007|ref|ZP_02951795.1| pyruvate kinase [Clostridium perfringens D str. JGS1721] >gi|177910900|gb|EDT73254.1| pyruvate kinase [Clostridium perfringens D str. JGS1721] (474 aa)
Score = 602, Expect = 3.1e-60, Identities = 148/455 (32%), Positives = 245/455 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTK+  T+GP+                      +++ L      G+N  R NFSHGD+     ++ L++ + KE+    + +LD KGP+IR +     E E+K+  +       + +G + K S+        + +D++PG +I VDDG L+ +V      + I E I   T  ++++K +N+P+    +P +++KDR+D+IF  + + D++AASF+   ++V E+++IL  HGG+ I+IISKIE+  G+ ++ +II  +D +MVARGD+G+E+P  +VP  +K IIK C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A+G +PI A   M++I   +E+  DY   +       P        ++ + A+  A K       F   +IV         + LS  + + PI  +T  ++      LN+G+  K
  S:     1 MQKTKMIFTIGPA--------------------SDSEEILREFIRIGMNAARLNFSHGDHASHKEKIELIKRLRKEEKSATAILLDIKGPKIRTHNLKNGEAELKNGDEFTFSCGDEILGDNTKCSI----SYKELYEDIKPGGSILVDDGLLEFKVKEVRGTDIICEVIEGGT--IKDHKGVNVPNVPIKLPAVTEKDRSDLIFGCEMEVDFVAASFIRKPEDVLEVREILDSHGGKDIKIISKIESQEGVDNIKEIIKVTDGVMVARGDMGVEIPIENVPIIQKNIIKKCNQAGKIVITATQMLDSMIRNPRPTRAEASDVCNAIFDGTDAIMLSGESASGSFPIEAAMTMSRIAKKAEDNLDYNYLLRRLKDPNPNPDAFADAISYS-ASKTASK-------FPTKAIVAATQTGSTAKILSKYKPSCPIIAITPYEKVRRSLALNFGIISK 421
>gi|189202850|ref|XP_001937761.1| pyruvate kinase [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187984860|gb|EDU50348.1| pyruvate kinase [Pyrenophora tritici-repentis Pt-1C-BFP] (527 aa)
Score = 602, Expect = 3.1e-60, Identities = 161/455 (35%), Positives = 239/455 (52%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           K  ++T I  T+GP                       + + + +L   G+NVVR NFSHG YE     ++  RE  K + G  ++  LDTKGPEIR   T  + ++ IK+ + + I T +K      +K   +D     N+ K + PG TI+VDDG L  EV+    ++  ++    N   +   K +NLP ++  +P +S+KD+ D+ F +KNK D + ASF+  G ++  I+++L E G + IQII+K+E   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP+ AV +M +  + +E    Y  A D   K  P     V    T    + A    ++ +      +   G   RL+   S  R   PI  VT + E A R+   Y GV+
  S:    29 KQYRRTSIICTIGPKTN--------------------SAEKINSLRKVGLNVVRMNFSHGSYEYHQSVIDNAREAEKTQPGRPLAIALDTKGPEIRTGNTVDDADIPIKAGAVINITTDEKYATACDDKNMYVDYK---NITKVIAPGRTIYVDDGVLSFEVLEVT-DDKTLKCKCVNNGKISSRKGVNLPKTDIDLPPLSEKDKADLRFGVKNKVDMVFASFIRRGSDITAIREVLGEEGKD-IQIIAKVENQQGVNNFDEILRETDGVMVARGDLGIEIPPSQVFIAQKMMITKCNIAGKPVICATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVEAVTMMHETCLLAEVAIPYVNAFDELRKLAP-----VPCPTTETCAMAAVSASLEQNAGAILVLTTSGTTARLV---SKYRPVCPIIMVT-RNEMAARYSHLYRGVY 453
>gi|168212814|ref|ZP_02638439.1| pyruvate kinase [Clostridium perfringens CPE str. F4969] >gi|170715598|gb|EDT27780.1| pyruvate kinase [Clostridium perfringens CPE str. F4969] (474 aa)
Score = 602, Expect = 3.4e-60, Identities = 149/455 (32%), Positives = 244/455 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTK+  T+GPS                      +++ L      G+N  R NFSHGD+     ++ L++ + KE+    + +LD KGP+IR +     E E+K+  +       + +G + K S+        + +D++PG +I VDDG L+ +V      + I E I   T  ++++K +N+P+    +P +++KDR+D+IF  + + D++AASF+   ++V E+++IL  HGG+ I+IISKIE+  G+ ++ +II  +D +MVARGD+G+E+P  +VP  +K IIK C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A+G +PI A   M++I   +E   DY   +       P        ++ + A+  A K       F   +IV         + LS  + + PI  +T  ++      LN+G+  K
  S:     1 MQKTKMIFTIGPS--------------------SDSEEILREFIRIGMNAARLNFSHGDHASHKEKIELIKRLRKEEKSATAILLDIKGPKIRTHNFKNGEAELKNGDEFTFSCGDEILGNNTKCSI----SYKELYEDIKPGGSILVDDGLLEFKVKEVRGTDIICEVIEGGT--IKDHKGVNVPNVPIKLPAVTEKDRSDLIFGCEMEVDFVAASFIRKPEDVLEVREILDSHGGKDIKIISKIESQEGVDNIKEIIKVTDGVMVARGDMGVEIPIENVPIIQKNIIKKCNQAGKIVITATQMLDSMIRNPRPTRAEASDVCNAIFDGTDAIMLSGESASGSFPIEAAMTMSRIAKKAEANLDYNYLLRRLKDPNPNPDAFADAISYS-ASKTASK-------FPTKAIVAATQTGSTAKILSKYKPSCPIIAITPYEKVRRSLALNFGIISK 421
>gi|167745679|ref|ZP_02417806.1| hypothetical protein ANACAC_00371 [Anaerostipes caccae DSM 14662] >gi|167654991|gb|EDR99120.1| hypothetical protein ANACAC_00371 [Anaerostipes caccae DSM 14662] (483 aa)
Score = 602, Expect = 3.5e-60, Identities = 149/366 (40%), Positives = 217/366 (59%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD 368
           + KKTKI  T+GP+              ++  V       L  L   G+++ R NFSHGD+EEQ  R+  ++   +E  + I+ +LDTKGPEIR     ++ +VE+K   +  + TT+   G      +     TY  + +DV  GNTI +DDG ++L V        I+  +  N   L   K +N+P+   ++P +++KD++DI F ++N  D+IAASF+   D V EIK+I+K H  E + +ISKIE + G+++++ II  SD IMVARGDLG+E+P  +VP  +K IIK C +  K VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YP+ AV +M +I +S+E   D
  S:     8 LTKKTKIVCTMGPAT-------------DDDAV-------LKQLMLEGMDIARLNFSHGDHEEQLGRIKRIKRFREELNIPIAILLDTKGPEIRTGLLDTDGDVELKEGQEF-VLTTRDIKGNDSIVGI-----TYEELPQDVAEGNTILIDDGLIELRVKEIKDGTDIVCDVV-NGGFLGSRKGVNVPNVRVNLPSITEKDKSDIEFGLENGIDFIAASFIRNADAVNEIKEIVKAHNME-VGVISKIENVEGVENIESIIQASDGIMVARGDLGVEIPAEEVPFMQKAIIKKCNNAFKPVITATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAKGKYPVEAVRMMNQIAISTELHLD 347
>gi|46199913|ref|YP_005580.1| pyruvate kinase [Thermus thermophilus HB27] >gi|46197540|gb|AAS81953.1| pyruvate kinase [Thermus thermophilus HB27] (474 aa)
Score = 602, Expect = 3.6e-60, Identities = 158/485 (32%), Positives = 252/485 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYF-KETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVK 485
           M   K+TKI ATLGP+              ++K VI        AL +AG +V R NFSHG  E+   R+  VREVA+E G  ++ + D +GP+IRV +  E +V ++   +  + T +   G   + SV        + +DV PG  + +DDG+++L+V+     E + E       +L  NK IN+P ++ SIP +S+KD  D+    +   D++A SFV T D++   +  L  +G +  ++++KIE  + +   ++I++E+D IMVARGDLG+E+P  +VP  +K +I  C   GK VI ATQML+S+     PTRAE +DV  A+  GTD  MLS ETA G YP+ AV +M++I  + E+  ++ + ++V     TP  ++ +   A  +   V  +           +IVVF       + ++  R   PI  +T   E   +  L +GV+        H   +  +  D +   L EVK
  S:     1 MPPFKRTKIVATLGPAT-------------DDKEVIR-------ALAEAGADVFRLNFSHGAPEDHRRRVGWVREVAEELGRTLAVLQDLQGPKIRVGRFREGQVLLRPGQRF-VLTAEPVEGDEHRVSV----SYKGLPEDVSPGQILLLDDGRIRLKVLEVRSPEILTEVEVGG--VLSNNKGINIPGADLSIPALSEKDIQDLALGAELGVDWVAVSFVRTRDDLLLARHYLSRYGSK-ARLMAKIEKPSAVARFEEILEEADGIMVARGDLGVEMPLEEVPIVQKRLILRCIAAGKPVITATQMLESMVQNPSPTRAEASDVANAIFDGTDAVMLSAETAAGAYPVEAVAMMSRIAKAVESSPEFLQKLNVLRPAPTPTTQDAIAQAADDVVEAVGAR-----------AIVVFTATGGSARRIARTRPQVPILALTPNPEVRNQLALVWGVY-------PHLAPDPQDTDDMVRIALREVK 440
>gi|68069541|ref|XP_676682.1| pyruvate kinase [Plasmodium berghei strain ANKA] >gi|56496489|emb|CAH97765.1| pyruvate kinase, putative [Plasmodium berghei] (511 aa)
Score = 602, Expect = 3.6e-60, Identities = 141/365 (38%), Positives = 212/365 (58%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEE-QTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           KKT I  TLGP+                   +ET    L  L DAG+++ RFNFSHG +++ + +  N+++  A+     +  +LDTKGPEIR      KE  +K  SK+++ T    +G     +         + + V+PG+ I + DG +   V+ ++ +  I E +  N   + E K +NLP+    +P +S+KD++DI+ FAI    ++IAASF+ + ++VR I+ +L   G  HI+II KIE + GI + D I+ E+D IM+ARGDLG+E+    V   +K +I  C  +GK +I ATQML+S+    +PTRAEVTDV  AV  GTDC MLSGETA G +P+ AV +M+KI + +E   DY
  S:    37 KKTHIVCTLGPACKS----------------VET----LVQLIDAGMDICRFNFSHGTHDDHKQMFENVLKAQAQRPNCTLGMLLDTKGPEIRTGLLKNKEAHLKEGSKLKLVTDYSYLGDETCIAC----SYTKLPQSVKPGSIILIADGSVSCRVLETHDDHVITEVL--NNATIGEKKNMNLPNVKVDLPIISEKDKDDILNFAIPMGCNFIAASFIQSAEDVRLIRNLLGPRG-RHIKIIPKIENIEGIINFDKILAEADGIMIARGDLGMEISAEKVFLAQKLMISKCNLQGKPIITATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDY 376
>gi|110803000|ref|YP_699425.1| pyruvate kinase [Clostridium perfringens SM101] >gi|110683501|gb|ABG86871.1| pyruvate kinase [Clostridium perfringens SM101] (474 aa)
Score = 602, Expect = 3.7e-60, Identities = 149/455 (32%), Positives = 244/455 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTK+  T+GPS                      +++ L      G+N  R NFSHGD+     ++ L++ + KE+    + +LD KGP+IR +     E E+K+  +       + +G + K S+        + +D++PG +I VDDG L+ +V      + I E I   T  ++++K +N+P+    +P +++KDR+D+IF  + + D++AASF+   ++V E+++IL  HGG+ I+IISKIE+  G+ ++ +II  +D +MVARGD+G+E+P  +VP  +K IIK C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A+G +PI A   M++I   +E   DY   +       P        ++ + A+  A K       F   +IV         + LS  + + PI  +T  ++      LN+G+  K
  S:     1 MQKTKMIFTIGPS--------------------SDSEEILREFIRIGMNAARLNFSHGDHASHKEKIELIKRLRKEEKSATAILLDIKGPKIRTHNFKNGEAELKNGDEFTFSCGDEILGDNTKCSI----SYKELYEDIKPGGSILVDDGLLEFKVKEVRRTDIICEVIEGGT--IKDHKGVNVPNVPIKLPAVTEKDRSDLIFGCEMEVDFVAASFIRKPEDVLEVREILDSHGGKDIKIISKIESQEGVDNIKEIIKVTDGVMVARGDMGVEIPIENVPIIQKNIIKKCNQAGKIVITATQMLDSMIRNPRPTRAEASDVCNAIFDGTDAIMLSGESASGSFPIEAAMTMSRIAKKAEANLDYNYLLRRLKDPNPNPDAFADAISYS-ASKTASK-------FPTKAIVAATQTGSTAKILSKYKPSCPIIAITPYEKVRRSLALNFGIISK 421
>gi|156101167|ref|XP_001616277.1| pyruvate kinase, putative [Plasmodium vivax SaI-1] >gi|148805151|gb|EDL46550.1| pyruvate kinase, putative [Plasmodium vivax] (511 aa)
Score = 602, Expect = 3.8e-60, Identities = 146/365 (40%), Positives = 213/365 (58%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVN--ISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           KKT I  TLGP+                   +ET    L  L DAG+N+ RFNFSHG +++     N V + A+E+  N  +  +LDTKGPEIR      KE  +K  SK+++ T  + +G     +         + + V+ GN I + DG +  +V+ ++ +  I E +  N+  + E K +NLP+    +P + +KD+NDI+ FAI    ++IAASF+ + ++VR I+ +L   G  HI+II KIE + GI + D I+ ESD IM+ARGDLG+E+    V   +K +I  C  +GK +I ATQML+S+    +PTRAEVTDV  AV  GTDC MLSGETA G +P+ AV +M+KI + +E   DY
  S:    37 KKTHIVCTLGPACKS----------------VET----LVQLIDAGMNICRFNFSHGSHDDHKEMFNNVLK-AQEQRPNALLGMLLDTKGPEIRTGLLKNKEAHLKEGSKLKLVTDYEFLGDETCIAC----SYKKLPQSVKEGNIILIADGSVSCKVLETHDDHVITEVL--NSATIGEKKNMNLPNVKVDLPVIGEKDKNDILNFAIPMGCNFIAASFIQSAEDVRMIRNLLGPRG-RHIKIIPKIENIEGIINFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCNLQGKPIITATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDY 376
>gi|169596136|ref|XP_001791492.1| hypothetical protein SNOG_00819 [Phaeosphaeria nodorum SN15] >gi|111071194|gb|EAT92314.1| hypothetical protein SNOG_00819 [Phaeosphaeria nodorum SN15] (527 aa)
Score = 601, Expect = 3.9e-60, Identities = 164/455 (36%), Positives = 240/455 (52%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEK-GVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           K  ++T I  T+GP                       + + + AL  AG+NVVR NFSHG YE     ++  RE  K++ G  ++  LDTKGPEIR   T  + ++ IK+ +++ I TT     T       D    Y    N+ K ++ G TI+VDDG L  EV+   V++  +     N   +   K +NLP ++  +P +S+KD+ D+ F +KNK D + ASF+  G ++  I+++L E G + IQII+K+E   G+ + DDI+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP+ AV +M +  + +E    Y  A D   K  P     V    T    + A    ++ +      +   G   RL+   S  R   PI  VT +   A+R+   Y GV+
  S:    29 KEYRRTSIIGTIGPKTN--------------------SAEKMNALRRAGLNVVRMNFSHGSYEYHQSVIDNAREAEKQQSGRPLAIALDTKGPEIRTGNTVGDADIPIKAGTELNI-TTDDAYATK-----CDDKNMYVDYKNITKVIEVGRTIYVDDGVLSFEVLEV-VDDQTLRVKCVNNGKISSKKGVNLPKTDIDLPPLSEKDKADLKFGVKNKVDMVFASFIRRGSDITAIREVLGEEGKD-IQIIAKVENQQGVNNFDDILKETDGVMVARGDLGIEIPPSQVFIAQKMMITKCNIAGKPVICATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVEAVTMMHETCLLAEVAIPYVNAFDELRKLAP-----VPCPTTETCAMAAVSASLEQNAGAILVLTTSGTTARLV---SKYRPVCPIIMVT-RNASASRYSHLYRGVY 453
>gi|74273683|gb|AAA13372.2| cytosolic pyruvate kinase [Solanum tuberosum] (510 aa)
Score = 600, Expect = 5.1e-60, Identities = 152/436 (34%), Positives = 223/436 (51%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV 439
           I KTKI  TLGPS                          L  L  AG+NV RFNFSHG +E     L+ ++   +   +  + MLDTKGPEIR  + T  K +++K   ++ + T     G  E  S+        +  D++PGNTI   DG + L V+S +   G +     N+  L E K +NLP     +P +++KD+ DI+ + + N  D IA SFV  G ++  ++K L  H  + IQ++SK+E   G+ + D+I+ E+DS MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++M++I + +E+  D         + TP     + +LA++        R           IVV        + ++  R A PI  V
  S:    19 IPKTKIVCTLGPS--------------------SRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLKIAMQNTQILCAVMLDTKGPEIRTGFLTDGKPIQLKEGQEITVSTDYTIKGNEEMISM----SYKKLVVDLKPGNTILCADGTITLTVLSCDPPSGTVRCRCENSATLGERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNNIDMIALSFVRKGSDLVNVRKALGPHA-KRIQLMSKVENQEGVINFDEILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKAVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPELAVKIMSRICIEAESSLDNEAIFKEMIRCTPLPMSPLESLASSAVRTANKARA--------KLIVVLTRGGSTAKLVAKYRPAVPILSV 423
>gi|116694906|ref|YP_729117.1| pyruvate kinase [Ralstonia eutropha H16] >gi|113529405|emb|CAJ95752.1| pyruvate kinase [Ralstonia eutropha H16] (472 aa)
Score = 600, Expect = 5.2e-60, Identities = 147/455 (32%), Positives = 236/455 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M+ ++  KI ATLGP+                     +  + + ALF+AG +V R NFSHG +E+   R   +R V +++G  I  +LD +GP++R+   ++  V++ + +  R+       G++ +  +        +++ V+    + +DDGK++L V       G  ET   N   L + K +N+PD+   +  M++KDR D+ F +    D+IA SFV   +++REIK I+    G    I++K+E    I+SLD I+ E+D+IMVARGDLG+E+P   VP+ +K I++ CR  GK VIVATQML+S+     PTRAE +DV  A+  G D  MLS E+A+G YP+ AV +M  I   +E+   Y  AI+     TP   +    +   +  +V   RV         + V + +       ++  R   PI  +T +   A R  L +GV
  S:     1 MRRLRNAKIVATLGPA--------------------SSTPELIDALFEAGADVFRLNFSHGTHEDHRQRFEAIRAVERKRGRPIGVLLDLQGPKLRIGTFADGPVQLAAGAGFRLDLDSAAPGSASRVCLPHPEIFAALSEGVE----LLLDDGKIRLRV--EQCGAGFAETTVVNGGTLSDRKGVNVPDAVLPLSAMTEKDRRDLDFGLALGADWIALSFVQRPEDIREIKAIVNGRAG----IVAKLEKPAAIQSLDLIVAEADAIMVARGDLGVEMPAEQVPSLQKQIVRACRKAGKPVIVATQMLESMIAAPVPTRAEASDVATAIYDGADAVMLSAESASGRYPVEAVRMMNSIISRTESDPLYRDAIEA--SHTPPRADAADAIGYAVRHIVGLLRV--------PATVAYTSSGYSALRMARERPQVPILGMTPRMATARRLTLTWGV 415
>gi|145354865|ref|XP_001421695.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144581933|gb|ABO99988.1| predicted protein [Ostreococcus lucimarinus CCE9901] (572 aa)
Score = 600, Expect = 5.5e-60, Identities = 142/363 (39%), Positives = 209/363 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD 368
           K+KI  TLGP                    +    + L  +  AG++V RFNFSHG +E     L+ +R      GV+   +LDTKGPEIR    +     +    K  + TT  E  G++EK +V     +Y ++AKDV+PG+ I   DG +   V+  +V +G +     N+  L E K +NLP  N ++P +++KDR+D+I + +KN  D+IAASFV  G +V  I+ +L +   + + IISK+E M G+ + +DI+++SD +MVARGDLG+E+    +   +K +IK C   GK V+ ATQML+S+    +PTRAE TDV  A+  GTD  MLSGETA G Y I+AV+ MA I   +E + D
  S:    87 KSKIICTLGP--------------------VSRTVEILEEMLRAGMSVARFNFSHGSHEYHQETLDNLRAACANTGVDCGVLLDTKGPEIRTGMLACGGPVMLEAGKEIVLTTDYEFKGSAEKLAV-----SYPDLAKDVKPGSKILCADGSVTFTVLECDVAKGEVRCRLENSAKLGERKNMNLPGVNVNLPTITEKDRHDLIEWGVKNNVDFIAASFVRKGSDVEYIRSVLGDFANK-VSIISKVENMEGLDNFNDIVEKSDGVMVARGDLGMEIRMEQIFLAQKRMIKRCNLAGKPVVTATQMLESMTGAPRPTRAEATDVANAILDGTDAVMLSGETAAGNYAIDAVKCMASICREAEAYVD 426
>gi|33862951|ref|NP_894511.1| pyruvate kinase [Prochlorococcus marinus str. MIT 9313] >gi|33634868|emb|CAE20854.1| Pyruvate kinase [Prochlorococcus marinus str. MIT 9313] (605 aa)
Score = 600, Expect = 5.9e-60, Identities = 149/455 (32%), Positives = 247/455 (54%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-GRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + + ++TKI AT+GP+                    E+A++ +  L + G    R NFSHGD++E   R++ +R+V+ E G++I  + D +GP+IR+ +  +  + + +     +  T K++  ++  +    T TY+ +A +V  G+ I +DDG+++++V+  +  E  +  I     +L  NK +N PD   S+  +++KDR D+ F ++   D++A SFV    +++EI+K++++HG     +I+KIE    I  +D I+   D +MVARGDLG+E+P  +VP  +K +I+     G  +I ATQMLDS+ +  +PTRAEV+DV  A+  GTD  MLS ETA G YP+ AV+ MA I    E   DY  R I+ Y             LA+TI+  ++          + ++IV           +S  R AAPI  VT+K   A +  L +GV
  S:    15 IDLTRRTKIVATIGPAT-------------------ESAER-IRELVEVGATTFRLNFSHGDHDEHAKRISTIRQVSDELGMHIGILQDLQGPKIRLGRFDKGPITLANGDSFAL--TSKQVQCNQSVA----TVTYDKLADEVTTGSRILLDDGRVEMKVLKIDQSEQTLHCIVTVGGVLSNNKGVNFPDVQLSVRALTEKDRQDLAFGLQQGVDWVALSFVRNPSDMKEIRKLIRDHG-HSTPVIAKIEKFEAIDQIDSILPLCDGVMVARGDLGVEMPAEEVPLLQKDLIRKANSLGIPIITATQMLDSMASSPRPTRAEVSDVANAILDGTDAVMLSNETAVGDYPVEAVQTMATIARRIER--DYPQRPIETY-------------LASTISNAISSAVSSIASHLNAAAIVPLTESGATAHNVSKFRPAAPILAVTNKLAVARKLQLAWGV 429
>gi|82541463|ref|XP_724971.1| pyruvate kinase [Plasmodium yoelii yoelii str. 17XNL] >gi|23479805|gb|EAA16536.1| pyruvate kinase [Plasmodium yoelii yoelii] (511 aa)
Score = 599, Expect = 7.2e-60, Identities = 140/365 (38%), Positives = 212/365 (58%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEE-QTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           KKT I  TLGP+                   +ET    L  + DAG+++ RFNFSHG +++ + +  N+++  A+     +  +LDTKGPEIR      KE  +K  SK+++ T    +G     +         + + V+PG+ I + DG +   V+ ++ +  I E +  N   + E K +NLP+    +P +S+KD++DI+ FAI    ++IAASF+ + ++VR I+ +L   G  HI+II KIE + GI + D I+ E+D IM+ARGDLG+E+    V   +K +I  C  +GK +I ATQML+S+    +PTRAEVTDV  AV  GTDC MLSGETA G +P+ AV +M+KI + +E   DY
  S:    37 KKTHIVCTLGPACKS----------------VET----LVQMIDAGMDICRFNFSHGTHDDHKQMFENVLKAQAQRPNCTLGMLLDTKGPEIRTGLLKNKEAHLKEGSKLKLVTDYSYLGDETCIAC----SYTKLPQSVKPGSIILIADGSVSCRVLETHDDHVITEVL--NNATIGEKKNMNLPNVKVDLPIISEKDKDDILNFAIPMGCNFIAASFIQSAEDVRLIRNLLGPRG-RHIKIIPKIENIEGIINFDKILAEADGIMIARGDLGMEISAEKVFLAQKLMISKCNLQGKPIITATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDY 376
>gi|157348610|emb|CAO23502.1| unnamed protein product [Vitis vinifera] (475 aa)
Score = 599, Expect = 7.4e-60, Identities = 142/388 (36%), Positives = 211/388 (54%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP+                   +E  +K    L  AG+NV RFNFSHG +      L+ +R          + MLDTKGPEIR  +    K V++K   ++ I T     G      +        +A+D++P + I   DG + L V++ + E G+      N+ +L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++ E++ +L EH  + I ++SK+E   G+ + D+I+  SD+ MVARGDLG+E+P   +   +K +I  C  +GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G YP  AV+ MA+I + +EN  +YG       +  P     + +LA++
  S:    11 KTKIVCTLGPASRS----------------VEVIEK----LLRAGMNVARFNFSHGSHAYHQQTLDNLRTAMANTETLCAVMLDTKGPEIRTGFLKDGKPVQLKKGQEITISTDYSIKGDDHMICM----SYQKLAEDLRPQSVILCADGTITLTVLACDKELGLARCRCENSAVLGERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNKIDMIALSFVRKGSDLVEVRMLLAEHA-KSILLMSKVENQEGVANFDEILANSDAFMVARGDLGMEIPIEKIFLAQKVMIYKCNIQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVQTMARICLEAENSLNYGDVFKTIMETAPMPMSPIESLASS 375
>gi|110800773|ref|YP_696827.1| pyruvate kinase [Clostridium perfringens ATCC 13124] >gi|168208851|ref|ZP_02634476.1| pyruvate kinase [Clostridium perfringens B str. ATCC 3626] >gi|169344157|ref|ZP_02865139.1| pyruvate kinase [Clostridium perfringens C str. JGS1495] >gi|110675420|gb|ABG84407.1| pyruvate kinase [Clostridium perfringens ATCC 13124] >gi|169297615|gb|EDS79715.1| pyruvate kinase [Clostridium perfringens C str. JGS1495] >gi|170713193|gb|EDT25375.1| pyruvate kinase [Clostridium perfringens B str. ATCC 3626] (474 aa)
Score = 598, Expect = 8.4e-60, Identities = 148/455 (32%), Positives = 244/455 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTK+  T+GP+                      +++ L      G+N  R NFSHGD+     ++ L++ + KE+    + +LD KGP+IR +     E E+K+  +       + +G + K S+        + +D++PG +I VDDG L+ +V      + I E I   T  ++++K +N+P+    +P +++KDR+D+IF  + + D++AASF+   ++V E+++IL  HGG+ I+IISKIE+  G+ ++ +II  +D +MVARGD+G+E+P  +VP  +K IIK C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A+G +PI A   M++I   +E   DY   +       P        ++ + A+  A K       F   +IV         + LS  + + PI  +T  ++      LN+G+  K
  S:     1 MQKTKMIFTIGPA--------------------SDSEEILREFIRIGMNAARLNFSHGDHASHKEKIELIKRLRKEEKSATAILLDIKGPKIRTHNFKNGEAELKNGDEFTFSCGDEILGDNTKCSI----SYKELYEDIKPGGSILVDDGLLEFKVKEVRGTDIICEVIEGGT--IKDHKGVNVPNVPIKLPAVTEKDRSDLIFGCEMEVDFVAASFIRKPEDVLEVREILDSHGGKDIKIISKIESQEGVDNIKEIIKVTDGVMVARGDMGVEIPIENVPIIQKNIIKKCNQAGKIVITATQMLDSMIRNPRPTRAEASDVCNAIFDGTDAIMLSGESASGSFPIEAAMTMSRIAKKAEANLDYNYLLRRLKDPNPNPDAFADAISYS-ASKTASK-------FPTKAIVAATQTGSTAKILSKYKPSCPIIAITPYEKVRRSLALNFGIISK 421
>gi|15605055|ref|NP_219839.1| pyruvate kinase [Chlamydia trachomatis D/UW-3/CX] >gi|7404396|sp|P94685|KPYK_CHLTR Pyruvate kinase (PK) >gi|3328751|gb|AAC67927.1| Pyruvate Kinase [Chlamydia trachomatis D/UW-3/CX] (485 aa)
Score = 598, Expect = 8.7e-60, Identities = 152/454 (33%), Positives = 245/454 (53%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDV-----YFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           MI +TKI  T+GP+           N PE           L  L DAG+NV R NFSHG +E     + +++E+ +++ V ++ MLDTKGPEIR+    + E  IK     R+    KEI G+ E    L  +  +   ++  P   + +DDG ++  V+  N +E ++E   +N+  ++ NK +++ D + ++PFM++KD  D+ F ++ + D IAASFV   +++  ++K+L+  G  ++ II+KIE   G+++  +I   +D IM+ARGDLG+E+   +VP  +K++ +  R  G+  I ATQML+S+     PTRAEV+DV  A+  GT   MLSGETA G +P++AV+ M  I   +E  FDY     +       K +P++ E +G     IA   + K           +I+V+         LS  R   PI  VT  +    R  + +GV+
  S:     1 MIARTKIICTIGPAT----------NTPEM----------LEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQVPLAIMLDTKGPEIRL---GQVESPIKVQPGDRLTLVSKEILGSKESGVTLYPSCVFPYVRERAP---VLIDDGYIQAVVV--NAQEHMVEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDIDSMRKVLESFGRPNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIELSIVEVPGLQKFMARASRETGRFCITATQMLESMIRNPLPTRAEVSDVANAIYDGTSAVMLSGETALGAHPVHAVKTMRSIIQETEKTFDYHAFFQLNDKNSALKVSPYL-EAIGFSGIQIAEKASAK-----------AIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVY 420
>gi|168205616|ref|ZP_02631621.1| pyruvate kinase [Clostridium perfringens E str. JGS1987] >gi|168215776|ref|ZP_02641401.1| pyruvate kinase [Clostridium perfringens NCTC 8239] >gi|170662928|gb|EDT15611.1| pyruvate kinase [Clostridium perfringens E str. JGS1987] >gi|182382278|gb|EDT79757.1| pyruvate kinase [Clostridium perfringens NCTC 8239] (474 aa)
Score = 598, Expect = 9.3e-60, Identities = 148/455 (32%), Positives = 244/455 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVK 458
           ++KTK+  T+GP+                      +++ L      G+N  R NFSHGD+     ++ L++ + KE+    + +LD KGP+IR +     E E+K+  +       + +G + K S+        + +D++PG +I VDDG L+ +V      + I E I   T  ++++K +N+P+    +P +++KDR+D+IF  + + D++AASF+   ++V E+++IL  HGG+ I+IISKIE+  G+ ++ +II  +D +MVARGD+G+E+P  +VP  +K IIK C   GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A+G +PI A   M++I   +E   DY   +       P        ++ + A+  A K       F   +IV         + LS  + + PI  +T  ++      LN+G+  K
  S:     1 MQKTKMIFTIGPA--------------------SDSEEILREFIRIGMNAARLNFSHGDHASHKEKIELIKRLRKEEKSATAILLDIKGPKIRTHNFKNGEAELKNGDEFTFSCGDEILGDNTKCSI----SYKELYEDIKPGGSILVDDGLLEFKVKEVRGTDIICEVIEGGT--IKDHKGVNVPNVPIKLPAVTEKDRSDLIFGCEMEVDFVAASFIRKPEDVLEVREILDSHGGKDIKIISKIESQEGVDNIKEIIKVTDGVMVARGDMGVEIPIENVPIIQKNIIKKCNQAGKIVITATQMLDSMIRNPRPTRAEASDVCNAIFDGTDAIMLSGESASGSFPIEAAMTMSRIAKKAEANLDYNYLLRRLKDPNPNPDAFADAISYS-ASKTASK-------FPTKAIVAATQTGSTAKILSKYKPSCPIIAITPYEKVRRSLALNFGIISK 421
>gi|115461330|ref|NP_001054265.1| Os04g0677500 [Oryza sativa (japonica cultivar-group)] >gi|38344200|emb|CAE05765.2| OSJNBa0064G10.16 [Oryza sativa (japonica cultivar-group)] >gi|90399037|emb|CAJ86233.1| H0402C08.9 [Oryza sativa (indica cultivar-group)] >gi|113565836|dbj|BAF16179.1| Os04g0677500 [Oryza sativa (japonica cultivar-group)] >gi|125550231|gb|EAY96053.1| hypothetical protein OsI_017286 [Oryza sativa (indica cultivar-group)] >gi|125592066|gb|EAZ32416.1| hypothetical protein OsJ_015899 [Oryza sativa (japonica cultivar-group)] (511 aa)
Score = 598, Expect = 1.1e-59, Identities = 141/390 (36%), Positives = 213/390 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           + KTK+  TLGP+                      +   L  L  AG+NV RFNFSHG +E     L+ +R+     GV  + MLDTKGPEIR  +    K +++    ++ + TT  EI   E    +       +  DV+PGN I   DG + L V+S + + G +     NT +L E K  NLP     +P +++KD+ DI+ + + N  D IA SFV  G ++  ++++L +H  + I+++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G YP  AV++MA+I V +E+  D         +  P     + +LA++
  S:    20 VPKTKLVCTLGPA--------------------SRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLRQAMHNTGVLCAVMLDTKGPEIRTGFLKDGKPIKLTKGQELTV-TTDYEIKGDENMITMSYK---KLPVDVKPGNVILCADGTISLTVLSCDPKAGTVRCRCENTAMLGERKNCNLPGIVVDLPTLTEKDKEDILGWGVPNDIDMIALSFVRKGSDLVTVRQLLGQHA-KRIKLMSKVENQEGVVNFDEILRETDAFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEVAVKIMARICVEAESSLDNEAVFKEMIRSAPLPMSPLESLASS 386
>gi|146100263|ref|XP_001468820.1| pyruvate kinase [Leishmania infantum] >gi|134073189|emb|CAM71909.1| pyruvate kinase, putative [Leishmania infantum] (507 aa)
Score = 597, Expect = 1.3e-59, Identities = 154/451 (34%), Positives = 237/451 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + T+I  T+GPS                      + + L  L  +G++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR  +    E  ++  +   + T     + GT +KF +       N++K V+PG+ I++DDG L L V  S+ +E  ++    N   + + + +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V E+++ L   G + I II KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++  +     +   K  P  M  +    ++ + ++   K  +         +VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:    28 RATRIVCTIGPSTQ--------------------SVEALKGLIQSGMSVARMNFSHGSHEYHRTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKFYI----DYQNLSKVVRPGSYIYIDDGILILHV-QSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQGVDMIFASFIRSAEQVGEVREALGAKGRD-IMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFNSIKKLQPIPMSAEEAVCSSAVNSVYETKAKV---------MVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 446
>gi|166031741|ref|ZP_02234570.1| hypothetical protein DORFOR_01441 [Dorea formicigenerans ATCC 27755] >gi|166028194|gb|EDR46951.1| hypothetical protein DORFOR_01441 [Dorea formicigenerans ATCC 27755] (478 aa)
Score = 596, Expect = 1.5e-59, Identities = 150/371 (40%), Positives = 217/371 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAID 374
           +KKTKI  T+GP+           +  EN          +  L   G+++ RFNFSHG +EEQ  R+++++++ +E+   ++ +LDTKGPEIR     + K+V +K    + +  T +EI   E    L   G   +  DVQ GN I +DDG + L+V     E  II TI  N   L E K +N+P+    +P +++KD+ D+ F ++ K D+IAASFV   + + EI+  L + G  +I II+KIE   GI ++D+II  +D IMVARGDLG+E+P  +VP  +K II+ C    K VI ATQMLDS+    +PTRAEV DV  AV  GTD  MLSGETA G YP+ A+++M  I  S+E   DY   ++
  S:     1 MKKTKIVCTMGPN-----------SNDENI---------MRRLVKEGMDIARFNFSHGSHEEQKGRMDMLKKIREEEKKPVAILLDTKGPEIRTGVLKDGKKVLLKEGETITL--TNEEIEGDETKVSLTYKG---LVDDVQIGNMILIDDGLIGLKV-KEKTETDIICTIV-NGGELGERKGVNVPNVPVRLPAITEKDKEDLKFGVEQKIDFIAASFVRNAECILEIRSYLNKCGAPYIPIIAKIENSEGIDNIDEIIRCADGIMVARGDLGVEIPAEEVPYLQKLIIQKCNDNYKPVITATQMLDSMIRNPRPTRAEVGDVANAVYDGTDAVMLSGETAQGKYPVEALKMMVHIVESTEQHLDYKEMLE 345
>gi|168060162|ref|XP_001782067.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162666478|gb|EDQ53131.1| predicted protein [Physcomitrella patens subsp. patens] (591 aa)
Score = 596, Expect = 1.6e-59, Identities = 162/451 (35%), Positives = 231/451 (51%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVN-ISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFF-------DYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +KTKI  T+GP+                       K+ +  L +AG+NV R N SHGD+      ++LVRE  KE   N I+ MLDTKGPE+R     +  +  K D     +T K+ +GT    SV       +   DV+ G+T+ +D G + LEV     EE   E +      L+  + +N+   + ++P +++KD  DI F ++NK D+ A SFV     V E+K  LKE   + I +I KIE+   I +L  I+D +D  MVARGDLG E+P  +VP  +  II+ CR  GK VIVAT ML+S+ T   PTRAEV+D+  AV  G D  MLSGETA+G YP+ AV VM  + + +E          + GRA   +      M E     AT ++  +             +SI+VF     +   LS+ R    IF  T+ K   +R  L +GV
  S:   120 RKTKIVCTIGPT--------------------SNTKEMIWKLAEAGMNVARLNMSHGDHASHKEVIDLVREFNKEAHANVIALMLDTKGPEVRSGDLPQPIMLKKGDPFT--FTIKRGVGTDTCVSV----NYDDFVTDVEIGDTLLIDGGMMSLEVKGKTHEEVYCEVVDGGE--LKSRRHLNVRGKSATLPSITEKDWEDIKFGVENKVDFYALSFVKDAQVVHELKSFLKEKSAD-IHVIVKIESADSIPNLQSILDAADGAMVARGDLGAELPIEEVPLLQGEIIRSCRAMGKPVIVATNMLESMITHPTPTRAEVSDIAIAVREGADAIMLSGETAHGKYPLKAVRVMHTVAMRTEATMPEEEAPANLGRAFKTH------MSEMFAFHATLMSNTLG------------TSILVFTRTGFMALLLSHYRPVGTIFAFTNDKRVQSRLALYHGV 531
>gi|160935049|ref|ZP_02082435.1| hypothetical protein CLOLEP_03925 [Clostridium leptum DSM 753] >gi|156866502|gb|EDO59874.1| hypothetical protein CLOLEP_03925 [Clostridium leptum DSM 753] (589 aa)
Score = 596, Expect = 1.7e-59, Identities = 156/452 (34%), Positives = 245/452 (54%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAI---DVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTKI  TLGPS           + PE           L  L   G++V R N SH D++ Q +R+  V+++ +E  + ++ +LDTKGPEIR    S  +VE++ + ++   TT   +G +     + S     + +DV+ G+ I +DDG +++ V+ S  +  ++ T+  N   +  +K IN+P    S+PF+S KD  DI FA++  FD+IAASF  +  ++ E++  LK++  + I+II+KIE   G++++D+II+ +D IMVARGDLG+E+P  ++P  +K +IK   + G  VI ATQMLDS+    +PTRAE TDV  A+  GT   MLSGETA G YP+ A++ MA+I   +E   DY       DVY  E P +   +     T A           H     +I+      +  + +S  R   PI   T       +  L++GV
  S:     1 MRKTKIICTLGPST----------DDPEV----------LKQLMLNGMDVARVNMSHQDHDAQRVRIGAVKKLREELNLPVALLLDTKGPEIRTGNFSTPKVELE-EGQIFTLTTNDVVGDN----TVSSVTFQGLPQDVKRGDRILIDDGLIEM-VVESTTDTDVVCTVI-NGGTISSHKGINVPGVTLSMPFISPKDEADIAFAVEEGFDFIAASFTRSASDILELRTELKKNHNDKIRIIAKIENQDGVENIDEIINVADGIMVARGDLGVEIPLEEIPIIQKELIKKAYNAGLQVITATQMLDSMMKNPRPTRAESTDVANAIYDGTSAIMLSGETAAGSYPVIALQTMARIAERTEEDIDYVSRFQKRDVY--ERPNVTSAISHATCTTA-----------HDLGAVAIMGVSKSGKTARMISKYRPKCPIICGTTDAMVWRQMNLSWGV 415
>gi|188588791|ref|YP_001919940.1| pyruvate kinase [Clostridium botulinum E3 str. Alaska E43] >gi|188499072|gb|ACD52208.1| pyruvate kinase [Clostridium botulinum E3 str. Alaska E43] (472 aa)
Score = 596, Expect = 1.8e-59, Identities = 148/453 (32%), Positives = 242/453 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTK+  T+GP+              +N+ +I             G+N  R NFSHG YE    ++ L++ V ++ G   + +LD KGP+IR +      VE+K+  +       + +G  E+ S+     TY  + KD+Q G  I VDDG L+ +VI+  VE   I        +++ +K +N+P+    +P +++KD  DI F  +   D+IAASF+    +V ++KKIL E+ G+HI++I+KIE   G+ ++D II+++D++MVARGD+G+E+P   VP  +K II+ C   GK V+ ATQMLDS+     PTRAE +D+  A+  GTD  MLSGE+A+G +PI A   M++I   +E   DY   +    +E P + +  G ++ T            ++  + S+IV           +S  R  +P+  +T  ++      L +GV 
  S:     1 MQKTKMIFTIGPA-------------SDNEEIIRK-------FIGIGMNAARLNFSHGTYESHREKIELIKRVREDMGTPTAIILDIKGPKIRTHNFVNDGVELKTGQEFCFVCGDEILGDEERCSI-----TYEELYKDIQIGGEILVDDGLLRFKVIA--VEGKAIRCNVTVGGMIKNHKGVNVPNVIIRLPSVTEKDIADIKFGCEMGVDFIAASFIRKASDVADVKKILSENNGKHIKVIAKIENQEGVDNIDSIIEQTDAVMVARGDMGVEIPIQKVPIIQKMIIRKCNDAGKFVVTATQMLDSMIRNSLPTRAEASDICNAIFDGTDAIMLSGESASGNFPIEAATTMSEIAQEAEAHLDYAH-LTARLRE-PSLTDYAGAISYTACR--------TSNLLNASAIVAATKSGATATMISRYRPKSPVIAITPYEQVRRSLALTFGVL 417
>gi|46447270|ref|YP_008635.1| pyruvate kinase [Candidatus Protochlamydia amoebophila UWE25] >gi|46400911|emb|CAF24360.1| probable pyruvate kinase [Candidatus Protochlamydia amoebophila UWE25] (598 aa)
Score = 596, Expect = 1.8e-59, Identities = 154/450 (34%), Positives = 238/450 (52%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +TKI  T+GP+                      + + +  L + G+NV R NFSHG  EE    +NL++E   +  + ++ MLDTKGPEIR+ K  + ++ +    K R+   KKE+ G   + S+       N+   +  G TI  DDG +   VI  N  EG++  I  N+ ++R +K +N+P+++ ++P +++KD +DI F      D IAASFV + ++V EIK++L +     I +I+KIE   G+++ D I+  +D IM+ARGDLG+EVP   VP  +K +I+     GK V+ ATQML+S+    +PTRAE +DV  A+   T   MLSGETA G YP+  V VM  I   +E  F+Y    D   +  P +   V + A T+AT      V   +     +I  F       + LS +R   PI  +T K++   +   N+GV
  S:     5 RTKIVCTIGPACN--------------------SLEKIIELINVGMNVARLNFSHGTQEEHLRTINLLKEARCQLNLPLAIMLDTKGPEIRLGKIRDGQIFLTVGQKWRL--VKKEVLGDESQVSIF----PLNILDQLPVGTTILFDDGYIASRVIE-NSSEGVLVEI-NNSGMIRSSKGVNIPNTSLNLPAVTEKDIDDIRFGCSQDIDLIAASFVRSAEHVLEIKRLLADEKKTDILVIAKIENSEGVQNFDSIVQAADGIMIARGDLGVEVPLSHVPRLQKMMIRKSYLAGKPVVTATQMLESMINNPRPTRAETSDVANAIYDSTSAIMLSGETAIGRYPVETVNVMRSIVEEAEADFNYSTFFD---QHAPLVYHDVPS-AVTLAT------VKTAYSSSAKAIFAFTKAGTTARLLSRLRPKMPIIAMTAKEKIFHQLAFNWGV 417
>gi|154269432|gb|ABS72343.1| pyruvate kinase [Leishmania donovani] (499 aa)
Score = 596, Expect = 1.8e-59, Identities = 154/451 (34%), Positives = 237/451 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + T+I  T+GPS                      + + L  L  +G++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR  +    E  ++  +   + T     + GT +KF +       N++K V+PG+ I++DDG L L V  S+ +E  ++    N   + + + +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V E+++ L   G + I II KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++  +     +   K  P  M  +    ++ + ++   K  +         +VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:    20 RATRIVCTIGPSTQ--------------------SVEALKGLIQSGMSVARMNFSHGSHEYHRTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKFYI----DYQNLSKVVRPGSYIYIDDGILILHV-QSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQGVDMIFASFIRSAEQVGEVREALGAKGRD-IMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFNSIKKLQPIPMSAEEAVCSSAVNSVYETKAKV---------MVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 438
>gi|168046904|ref|XP_001775912.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162672744|gb|EDQ59277.1| predicted protein [Physcomitrella patens subsp. patens] (517 aa)
Score = 595, Expect = 2.1e-59, Identities = 150/388 (38%), Positives = 215/388 (55%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEV-EIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDI-IFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           KTKI  TLGP             K  +  ++E        L  AG+NV RFNFSHG YE  +  L+ +++      +    +LDTKGPEIR     E +V ++    ++ I T  K  G +   ++     +Y  +A+DV+PGN I   DG + L V+  +   G ++    NT  L E+K +NLP     +P  + +D  DI I+ I N+ D+IAASFV  G +V  +K+IL     + I IISK+E   G+++ DDI+ E+D+IMVARGDLG+E+P   +   +K +I  C  KGK V+ ATQML+S+    +PTRAE TDV  AV  GTD  MLSGETANG+ P  AV +MA+I   +E   DY        +  P     + +LA++
  S:    25 KTKIICTLGP-------------KSRDVPMLEK-------LLRAGMNVARFNFSHGTYEYHSGTLDALKQAMYNTQIMCGVLLDTKGPEIRTGTLKEGQVIKLIRGQEIMITTDYKHEGDNTMIAM-----SYPKLAQDVKPGNLILCSDGTISLLVLECDTAGGKVKCRCENTASLGEHKNVNLPGVIVDLPTFTQRDIEDITIWGIPNRIDFIAASFVRKGIDVIRVKEILGR-ASKTIHIISKVENQEGLQNFDDILRETDAIMVARGDLGMEIPTEKIFLAQKMMIDKCNGKGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDAVMLSGETANGINPDVAVGIMARICREAEMAIDYATLFKDLCRNAPVPMSPLESLASS 389
>gi|70951516|ref|XP_744992.1| pyruvate kinase [Plasmodium chabaudi chabaudi] >gi|56525167|emb|CAH77914.1| pyruvate kinase, putative [Plasmodium chabaudi] (511 aa)
Score = 594, Expect = 2.5e-59, Identities = 139/365 (38%), Positives = 209/365 (57%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEE-QTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           KKT I  TLGP+                   +ET    L  L DAG+++ RFNFSHG +E+ + +  N+++  A+     +  + DTKGPEIR      KE  +K  SK+++ T    +G     +         + + V+PG  I + DG +   V+ ++ +  I E +  N   + E K +NLP+    +P +S+KD++DI+ FAI    ++IAASF+ + ++VR I+ +L   G  H++II KIE + GI + D I+ E+D IM+ARGDLG+E+    V   +K +I  C  +GK +I ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G +P+ AV +M+KI + +E   DY
  S:    37 KKTHIVCTLGPACKS----------------VET----LVQLIDAGMDICRFNFSHGTHEDHRQMFENVLKAQAQRPNCTLGMLFDTKGPEIRTGLLKNKEAHLKEGSKLKLVTDYSYVGDETCIAC----SYTKLPQSVKPGCIILIADGSVSCRVLETHEDHVITEVL--NNATIGERKNMNLPNVKVDLPIISEKDKDDILNFAIPMGCNFIAASFIQSAEDVRLIRNLLGPRG-RHMKIIPKIENIEGIINFDKILAEADGIMIARGDLGMEISAEKVFLAQKLMISKCNLQGKPIITATQMLESMTKNPRPTRAEATDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDY 376
>gi|167765574|ref|ZP_02437638.1| hypothetical protein CLOSS21_00068 [Clostridium sp. SS2/1] >gi|167712759|gb|EDS23338.1| hypothetical protein CLOSS21_00068 [Clostridium sp. SS2/1] (480 aa)
Score = 594, Expect = 2.5e-59, Identities = 147/362 (40%), Positives = 220/362 (60%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGI-IETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           + KKTKI  T+GP+                        + L  L  +G+++ R NFSHGD+EEQ  R+  +++  +E  + I+ +LDTKGPEIR     ++ +VE+ +  +  + TT+   G +E  S+     TY  + +DV+ GNTI +DDG ++L+V    +++G  I     N  +L   K +N+P+   ++P +++KD+ DI F ++N  D+IAASF+   + V EIK I+  H   H+ +ISKIE M G++++D IID S  IMVARGDLG+EVP  +VP  +K II+ C    K V+ ATQMLDS+    +PTRAE TDV  A+  GTD  MLSGETA G YP+ AV++M +I +S+E
  S:     2 LTKKTKIICTMGPATDDD--------------------EVLKDLMRSGMDIARLNFSHGDHEEQLGRIKRIKKFREELNLPIAILLDTKGPEIRTGLLETDDDVELVTGQEYTL-TTRDIKGNNEITSI-----TYAELPQDVEAGNTILIDDGLIELKV--KEIKDGTDIVCDVINGGLLGSRKGVNVPNVRVNLPSITEKDKADIEFGLENGIDFIAASFIRNAEAVEEIKDIIGAHN-MHVGVISKIENMEGVENIDAIIDASAGIMVARGDLGVEVPAEEVPFLQKEIIRKCNDAFKPVVTATQMLDSMIRNPRPTRAEATDVANAIYDGTDAIMLSGETAKGKYPVEAVKMMNQIAISTE 337
>gi|72546717|ref|XP_843114.1| pyruvate kinase, putative [Leishmania major strain Friedlin] >gi|70905593|gb|AAZ14232.1| pyruvate kinase, putative [Leishmania major strain Friedlin] (499 aa)
Score = 594, Expect = 2.5e-59, Identities = 154/451 (34%), Positives = 237/451 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + T+I  T+GPS                      + + L  L  +G++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR  +    E  ++  +   + T     + GT +KF +       N++K V+PG+ I++DDG L L V  S+ +E  ++    N   + + + +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V +++K L   G + I II KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++  +     +   K  P  M  +    ++ + ++   K  +         +VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:    20 RATRIVCTIGPSTQ--------------------SVEALKGLIQSGMSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKFYI----DYQNLSKVVRPGSYIYIDDGILILHV-QSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQGVDMIFASFIRSAEQVGDVRKALGAKGHD-IMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFNSIKKLQPIPMSAEEAVCSSAVNSVYETKAKV---------MVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 438
>gi|187932499|ref|YP_001884761.1| pyruvate kinase [Clostridium botulinum B str. Eklund 17B] >gi|187720652|gb|ACD21873.1| pyruvate kinase [Clostridium botulinum B str. Eklund 17B] (472 aa)
Score = 594, Expect = 2.5e-59, Identities = 147/453 (32%), Positives = 243/453 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTK+  T+GP+              +N+ +I             G+N  R NFSHG YE    ++ L+++V ++ G   + +LD KGP+IR +      VE+K+  +       + +G  E+ S+     TY  + KD+Q G  I VDDG L+ +VI+  VE   I        +++ +K +N+P+    +P +++KD  DI F  +   D+IAASF+    +V ++KKIL E+ G+HI++I+KIE   G+ ++D II+++D++MVARGD+G+E+P   VP  +K II+ C   GK V+ ATQMLDS+     PTRAE +D+  A+  GTD  MLSGE+A+G +PI A   M++I   +E   DY   +    +E P + +  G ++ T            ++  + ++IV           +S  R  +P+  +T  ++      L +GV 
  S:     1 MQKTKMIFTIGPA-------------SDNEEIIRK-------FIGIGMNAARLNFSHGTYESHREKIELIKKVREDMGTPTAIVLDIKGPKIRTHNFVNDGVELKTGQEFCFVCGDELLGDEERCSI-----TYEELYKDIQVGGEILVDDGLLRFKVIA--VEGKSIRCAVTVGGMIKNHKGVNVPNVIIRLPSVTEKDIADIKFGCEMGVDFIAASFIRKASDVADVKKILSENNGKHIKVIAKIENQEGVDNIDSIIEQTDAVMVARGDMGVEIPIQKVPIIQKMIIRKCNDSGKFVVTATQMLDSMIRNSLPTRAEASDICNAIFDGTDAIMLSGESASGNFPIEAATTMSEIAQEAEAHLDYAH-LTARLRE-PSLTDYSGAISYTACR--------TSNLLNAAAIVAATKSGATATMISRYRPKSPVIAITPYEQVRRSLALTFGVL 417
>gi|104780827|ref|YP_607325.1| pyruvate kinase [Pseudomonas entomophila L48] >gi|95109814|emb|CAK14519.1| pyruvate kinase I [Pseudomonas entomophila L48] (471 aa)
Score = 594, Expect = 2.7e-59, Identities = 153/472 (32%), Positives = 247/472 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD---NVEHAIANKTEIIDA 476
           KK KI ATLGP+I G                      ++  L +AGVN+ R NFSHG++ +  +R   +REV ++    +  ++D +GP++RV + +E +V+++    +R+    K  G S + ++        +   ++PG  + +DDGKL+L V + + +    E +A     L + K +N+P +   +  +++KDR D+ F ++   D++A SFV   +++ E ++++    G+   +++KIE  + ++ L  I + SD+IMVARGDLG+EVP   VP  +K II  CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP+ AV++M+KI    EN  DY   +DV   +         + A    + + P  V+ N+    +S +    +          R  API  +T     A R  + +GV   V D    V+  ++   EI  A
  S:     5 KKVKILATLGPAINGI--------------------DDIRQLVEAGVNIFRLNFSHGEHADHALRYQWIREVEQQLNYPLGILMDLQGPKLRVGRFAEGKVQLQRGQALRL-DLDKTPGDSHRVNLPHP----EIIAALEPGMDLLLDDGKLRLRVTAKHHDAIDTEVLAGGE--LSDRKGVNVPQAVLDLSPLTEKDRRDLAFGLELGVDWVALSFVQRPEDITEARQLI----GDRAYLMAKIEKPSAVEQLQAIAELSDAIMVARGDLGVEVPAESVPQIQKRIIGTCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVANAVAEGADAVMLSAETASGDYPLEAVQMMSKIIRQVENGPDYQAQLDVGRPKAEATVSDAISCAIRRISGILPVAVLVNYSESGASTLRAARE----------RPRAPILNLTPNLNTARRLSVTWGVHSVVNDRLRQVDEVVSTALEIAQA 438
>gi|119178386|ref|XP_001240869.1| pyruvate kinase [Coccidioides immitis RS] >gi|90299655|gb|EAS29286.1| pyruvate kinase [Coccidioides immitis RS] (535 aa)
Score = 594, Expect = 2.7e-59, Identities = 162/455 (35%), Positives = 244/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAK-EKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           K  ++T I  T+GP                    +ET    +  L  AG+NVVR NFSHG +E     ++  +E  + + G  ++  LDTKGPEIR   T + K++ I + +++ I T       S+  ++       N+ K ++ G  IFVDDG L  EV+   V++  +     N   +   K +NLP ++  +P +S+KD +DI F +KN+ D I ASF+  GD+++ I+++L + G E IQII+KIE   G+ + D+I+D++D +MVARGDLG+E+P   V   +K +I  C  KGK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP  AV +M +  + +E    Y    D      P   + V ++A  +A + A   +      +  +I+V        + LS  R   PI  VT + E A R+   Y GV+
  S:    39 KNYRRTSIICTIGPKTNS----------------VET----INILRKAGLNVVRMNFSHGTHEYHQSVIDNAKEAERIQPGRPLAIALDTKGPEIRTGLTPDNKDIPISAGTELNITTHDDFAAKSDNKNLY--VDYKNITKVIEKGKLIFVDDGVLSFEVLGI-VDDQTLRVKCLNNGTISSKKGVNLPGTDVDLPALSEKDIDDIKFGVKNRVDMIFASFIRRGDDIKRIREVLGDEGHE-IQIIAKIENQQGVNNFDEILDQADGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPKEAVAMMHETCLQAEVAIPYFSVFDELRNLCPRPADTVESIA--MAAVSASLEL------NAGAILVLTTSGLTARLLSKYRPVCPIIMVT-RNEAAARYSHLYRGVY 463
>gi|124023245|ref|YP_001017552.1| pyruvate kinase [Prochlorococcus marinus str. MIT 9303] >gi|123963531|gb|ABM78287.1| Pyruvate kinase [Prochlorococcus marinus str. MIT 9303] (605 aa)
Score = 594, Expect = 3.0e-59, Identities = 149/455 (32%), Positives = 244/455 (53%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-GRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + + ++TKI AT+GP+                    ETA++ +  L   G    R NFSHGD++E   R++ +R+V+ E G++I  + D +GP+IR+ +  +  + + +     +  T K++  ++  +    T TY  +A +V  G+ I +DDG+++++V+  +  E  +  I     +L  NK +N PD   S+  +++KDR D+ F ++   D++A SFV    +++EI+K++ +HG     +I+KIE    I  +D I+   D +MVARGDLG+E+P  +VP  +K +I+     G  +I ATQMLDS+ +  +PTRAEV+DV  A+  GTD  MLS ETA G YP+ AV+ MA I    E   DY  R I+ Y             LA+TI+  ++          + ++IV           +S  R AAPI  VT++   A +  L +GV
  S:    15 IDLTRRTKIVATIGPAT-------------------ETAER-IRELVQVGATTFRLNFSHGDHDEHAKRISTIRQVSDELGMHIGILQDLQGPKIRLGRFDKGPITLANGDPFAL--TSKQVQCNQSVA----TVTYEKLADEVTTGSRILLDDGRVEMKVVKIDQSEQTLHCIVTVGGVLSNNKGVNFPDVQLSVRALTEKDRQDLAFGLQQGVDWVALSFVRNPSDMKEIRKLIGDHG-HSTPVIAKIEKFEAIDQIDSILPLCDGVMVARGDLGVEMPAEEVPLLQKDLIRKANSLGIPIITATQMLDSMASSPRPTRAEVSDVANAILDGTDAVMLSNETAVGDYPVEAVQTMATIARRIER--DYPQRPIETY-------------LASTISNAISSAVSSIASHLNAAAIVPLTESGATAHNVSKFRPAAPILAVTNEVAVARKLQLAWGV 429
>gi|161507448|ref|YP_001577402.1| pyruvate kinase [Lactobacillus helveticus DPC 4571] >gi|160348437|gb|ABX27111.1| Pyruvate kinase [Lactobacillus helveticus DPC 4571] (589 aa)
Score = 594, Expect = 3.0e-59, Identities = 138/361 (38%), Positives = 210/361 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +KKTKI +TLGP+                   IET    + AL  AG NV RFNFSHG++ E   R+ +VR+V K+ G+ +   LDTKG EIR  +    +  I +   +R+     + G  +   V    G Y+   D   G  + +DDG + L +   +  +  +   A+NT ++   K +N P     +P +++KD +DI F ++   ++I ASF     ++ EI+K+ +E G ++++I  KIE+  GI + D+I+  SD +MVARGD+G+E+P+ +VP  +K +I+     GK VI ATQMLDS++   +PTRAEV+DV  AV  GTD TMLSGE+ANG+YP+ AV+ MA+ID  +E
  S:     1 MKKTKIVSTLGPA----------------SDDIET----ITALAKAGANVFRFNFSHGNHPEHLARMKMVRQVEKDTGMLLGIDLDTKGAEIRTTEQEGGKFTINTGDMIRVSMDDTKKGNKDMIHV-TYEGLYD---DTHVGGHVLIDDGLVDLLIKEKDDAKRELVCEAQNTGVIGSKKGVNAPGVEIRLPGITEKDTDDIKFGLQYGINFITASFARKAQDILEIRKLCEEAGADYVKIFPKIESQEGIDNADEILQVSDGLMVARGDMGVEIPFMEVPFVQKSLIRKANALGKPVITATQMLDSMQENPRPTRAEVSDVANAVLDGTDATMLSGESANGLYPVKAVKAMAEIDERTE 337
>gi|159038925|ref|YP_001538178.1| pyruvate kinase [Salinispora arenicola CNS-205] >gi|157917760|gb|ABV99187.1| pyruvate kinase [Salinispora arenicola CNS-205] (482 aa)
Score = 594, Expect = 3.1e-59, Identities = 154/477 (32%), Positives = 246/477 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTL-ATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAI 477
           M + ++ KI  TLGP+ +           PE           +  L +AG+NV R NFSHG + +      LVRE A+  G  ++ + D +GP+IR+ + ++   E ++   V I T+   +G+ ++ S      TY  + ++V+PGN + +DDG++ +EV  ++V    I  +      +  NK ++LP+   S+P +SDKD  D+ FA+    D +A SFV + D+++ +  I+ E G  H  +++K+E    +  LD I+   D +MVARGDLG+E+P   VP  +K  ++ CR   K VIVATQMLDS+    +PTRAE +DV  AV  G D  MLSGET+ G YP+  V  MAKI  ++E     G       +  P       T+ A++IA  +  K           ++V F      ++ LS + C  P+   T   E   +  L++GV   ++  VEH  A   ++  A+
  S:     1 MGVTRRAKIVCTLGPATS----------SPER----------IRGLVEAGMNVARLNFSHGSHADHEAVCRLVREAAEAAGKPVAVLADLQGPKIRLGRFADGPYEWRTGDSVVI-TSDDVVGSRDRVSC-----TYGKLPQEVKPGNRLLIDDGRVAVEV--TDVTGTDIRCLVTEGGPVSNNKGVSLPNVAVSVPALSDKDAEDLRFALGLGVDLVALSFVRSADDIKLVHAIMSEEG-VHRPVLAKVEKPEAVDHLDAIVLAFDGVMVARGDLGVELPLDQVPLVQKRAVQLCRENAKPVIVATQMLDSMIENSRPTRAEASDVANAVLDGADAVMLSGETSVGKYPVLTVSTMAKIVTTTEA----GSIAVPRLQHDPRTHGGALTIAASSIARAINAK-----------ALVAFSQTGDTVRRLSRLHCDLPLLAFTPVPEVRNQLALSWGVETFLMPFVEHTDAMFRQVDQAL 435
>gi|266428|sp|P30615|KPYK1_TRYBB Pyruvate kinase 1 (PK 1) >gi|10948|emb|CAA41018.1| pyruvate kinase [Trypanosoma brucei] (499 aa)
Score = 593, Expect = 3.3e-59, Identities = 137/323 (42%), Positives = 191/323 (59%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYT--TKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           L  L  +G++V R NFSHG +E     +N VR  A E G++I   LDTKGPEIR     + EV       V + T    +++GT EKF +        +   V+PG +I+VDDG + L V+S   ++  ++    N   L + + INLP     +P +S+KDR D+ F +    D I ASF+ T + VRE++  L E G + I IISKIE   G++++D II+ S+ IMVARGDLG+E+P   V   +  II  C   GK VI ATQML+S+ +  +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I V +++
  S:    38 LKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYI----DYPQLTNAVRPGGSIYVDDGVMTLRVVSKE-DDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKD-ILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQS 356
>gi|26990992|ref|NP_746417.1| pyruvate kinase [Pseudomonas putida KT2440] >gi|148546806|ref|YP_001266908.1| pyruvate kinase [Pseudomonas putida F1] >gi|24986019|gb|AAN69881.1|AE016627_3 pyruvate kinase I [Pseudomonas putida KT2440] >gi|148510864|gb|ABQ77724.1| pyruvate kinase [Pseudomonas putida F1] (471 aa)
Score = 593, Expect = 3.6e-59, Identities = 153/472 (32%), Positives = 248/472 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD---NVEHAIANKTEIIDA 476
           KK KI ATLGP+I G                      ++  L +AGVN+ R NFSHG++ +  +R   +REV ++    +  ++D +GP++RV + +E +V+++    +R+    K  G S + ++        +   ++PG  + +DDGKL+L V + + +   I+T   N   L + K +N+P +   +  +++KDR D+ F ++   D++A SFV   +++ E ++++    G+   +++KIE  + ++ L  I + +D+IMVARGDLG+EVP   VP  +K II  CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP+ AV++M+KI    EN  DY   +DV   +         + A    + + P  V+ N+    +S +    +          R  API  +T     A R  + +GV   V D    V+  ++   EI  A
  S:     5 KKVKILATLGPAINGI--------------------DDIRQLVEAGVNIFRLNFSHGEHADHALRYQWIREVEQQLNYPLGILMDLQGPKLRVGRFAEGKVQLQRGQALRL-DLDKTPGDSRRVNLPHP----EIIAALEPGMDLLLDDGKLRLRVTAKHSDA--IDTEVLNGGELSDRKGVNVPQAVLDLSPLTEKDRRDLAFGLELGVDWVALSFVQRPEDIVEARQLI----GDRAYLMAKIEKPSAVEQLQAIAELADAIMVARGDLGVEVPAESVPQIQKRIIGTCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVANAVAEGADAVMLSAETASGDYPLEAVQMMSKIIRQVENGPDYQAQLDVGRPKAEATVSDAISCAIRRISGILPVAVLVNYSESGASTLRAARE----------RPRAPILNLTPNLNTARRLSVAWGVHSVVNDRLRQVDEVVSTALEIAQA 438
>gi|78043581|ref|YP_359989.1| pyruvate kinase [Carboxydothermus hydrogenoformans Z-2901] >gi|77995696|gb|ABB14595.1| pyruvate kinase [Carboxydothermus hydrogenoformans Z-2901] (583 aa)
Score = 593, Expect = 3.9e-59, Identities = 166/469 (35%), Positives = 247/469 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDG--KLKLEVISSNVEEGIIETIAR--NTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF---VKVVDNVEHAIANKTE 472
           +K+TKI  T+GP+               + G+       L  +  +G+NV R NF+HG +EE   R+  VR  + E G+ ++ ++DTKGPEIR+ K    ++ +K    V       +I   +   V        +A+DV  G TI +DDG  +LK+E I  N      + IAR      L  NK +NLP    ++P +++KDR DI F I+   D+IA SFV    +V  +++ L+E G + ++II+KIE   G++++D+II  +D IMVARGDLG+E+P  DVP  +K II+ C   GK VI ATQMLDS+    +PTRAE TDV  A+  GTD  MLSGETA G YP+ AV+ MA+I   +E      R ++      P  K        T+   ++   V      D  +I+   +     + +S  R A PI   T   +   +  L +GVF   VK  D+ +  ++   E
  S:     1 MKRTKIVCTIGPA-------------SNDVGI-------LKEMIISGMNVARINFAHGSHEEHRERIEKVRRASLEVGIPVAILIDTKGPEIRIGKVENGKIVLKEGDLV---VFDPDIAEGQGLRV--PVNYPGLARDVNVGGTILLDDGLIELKIEDIQGN------KVIARVITGGELSNNKGVNLPGVKVNLPALTEKDRKDIDFGIEIGADFIAHSFVRKAADVLALRRYLEEKGAD-MEIIAKIENQEGVENIDEIIKVADGIMVARGDLGVEIPTEDVPLVQKEIIEKCNKNGKPVITATQMLDSMIRNKRPTRAEATDVANAIFDGTDAVMLSGETAAGKYPVEAVKTMARIAEKAEEKLLTLRKLN-----KPTTKS-----FKTVTDAISHASVTTAEELDAGAIITPTSSGYTARMVSRYRPAVPIIAATPDMKVLRKLTLVWGVFPLLVKTSDSTDEMLSKAIE 434
>gi|195330981|ref|XP_002032181.1| GM26421 [Drosophila sechellia] >gi|194121124|gb|EDW43167.1| GM26421 [Drosophila sechellia] (849 aa)
Score = 593, Expect = 4.2e-59, Identities = 172/489 (35%), Positives = 260/489 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREV----AKEKGV--NISTMLDTKGPEIRVYKTS----EKEVEIKSDSKVRIYTTKKEIG---TSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD-------NVEHAIANKTEIIDAINSQLPEVKKTVVVIN 492
           I  + I  T+GPS           N PE           L  L  AG+ VVR NFSHG +E     +   R+      ++ G+   ++  LDTKGPEIR  K +      E+E+K+  KV + +TKKE+    T E   V        + + V+PGN IFVDDG + L V  +  +E I +    N   L  +K INLP     +P +++KD+ D+ F  + K D I ASF+   + ++EI++IL    G  I+IISKIE   G+ ++DDII ESD IMVARGD+G+E+P  DVP  +K I+  C   GK VI ATQM++S+  K +PTRAE +DV  A+  G+D  MLSGETA G YP+  V+ MA+I    E    Y    +   +E   ++       + + T +A    +        +IVV    + + Q +S++R   PI  +T  +  A    L  G++  +V+       N    + +  +++  ++   P  K +VV++N
  S:    84 IPLSSIICTIGPSS----------NSPEK----------LMELIRAGMRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTVAIALDTKGPEIRTGKLAGGNDRAEIELKTGGKVTL-STKKELADKSTQENIYV----DYQRLPELVKPGNRIFVDDGLIALIVKETKGDEVICQV--ENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDIIFASFIRDANALKEIRQILGP-AGACIKIISKIENHQGLINIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTNKPRPTRAEASDVANAIFDGSDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLKRE---IRTSAADHISAVTTAIAEAATVGQA----RAIVVASPCSMVAQMVSHMRPPCPIVMLTGNESEAAHSLLFRGIYPLLVEEMVIGSLNFRRIMQSGLKLMGKMDILEPGQKGSVVLVN 557
>gi|15230952|ref|NP_189225.1| pyruvate kinase, putative [Arabidopsis thaliana] >gi|9279601|dbj|BAB01059.1| pyruvate kinase [Arabidopsis thaliana] (497 aa)
Score = 592, Expect = 4.6e-59, Identities = 161/455 (35%), Positives = 239/455 (52%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV--------TDKKEYATRFGLNYGVFVKVV 460
           KTKI  TLGP+                   +E  +K    L  AG+NV RFNFSHG +      L+ +R      G+  + MLDTK P IR  +    K +++K   ++ I    K  G S   S+        +A+D++PG+ I   DG + L V+S +   G++     N+ +L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++ +++K+L EH  + I ++SK+E   G+ + D I++ SD+ MVARGDLG+E+P   +   +K +I      GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G +P  AV  M++I   +E+F DY    D+  K+T  M   V    + I +L A         F  S+IVV        + ++  R + PI  V        +D   +  R GL Y   + VV
  S:    17 KTKIVCTLGPASRS----------------VEMIEK----LLKAGMNVARFNFSHGSHSYHQETLDNLRTAMDNTGILCAVMLDTKSPVIRTGFLKEGKPIQLKQGQEITISIDYKIQGDSNTISM----SYKKLAEDLKPGDVILCSDGTISLNVLSCDKYLGLVRCRCENSALLGERKNVNLPGIVVDLPTLTEKDKEDIMQWGVPNKIDIIALSFVRKGSDLIQVRKLLGEHS-KSIMLMSKVENQEGVMNFDKILENSDAFMVARGDLGMEIPIEKMFLAQKTMINKANAHGKPVVTATQMLESMTVSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAHPETAVLTMSRICKEAEDFIDY----DILHKKTLGM---VSLPLSPIESLAASAVSTARSVF-ASAIVVLTRGGYTAELVAKYRPSVPILSVIMPEIAECSDSVAHVARRGLIYRGIIPVV 448
>gi|37676373|ref|NP_936769.1| pyruvate kinase [Vibrio vulnificus YJ016] >gi|37200915|dbj|BAC96739.1| pyruvate kinase [Vibrio vulnificus YJ016] (491 aa)
Score = 592, Expect = 5.0e-59, Identities = 160/455 (35%), Positives = 246/455 (54%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           MKM K TKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+    +  +++K+ D  +   T  +E GT E+   LD      +  D+Q GN + +DDG+++LEV + + +  ++ TIA N   L   K INL     S P ++DKD+ DI+ A + K D++A SF    D++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P  +K +I   ++ GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G+YP+ AVE M +I    E+  +   A   + K      +   + A  ++++++  +V  + G    +IV    +T L+  +S  +  A I+ V+DK E   +  +  GV
  S:     1 MKMCK-TKIVATLGPA--------------------SQTREKLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQDLNVSVGVLVDLQGPKIRIACFEQGSIQLKAGDPFILDGTLDREAGTQERVG-LDYP---ELIDDLQVGNILLLDDGRIQLEVTAVDTQTRLVNTIALNGGKLSNRKGINLLGGGLSAPALTDKDKQDILTAAELKADFLAVSFPRNADDI-EYARSLALQAGCHAHIVAKVERAEVVASEEAMDGVIRASDVIMVARGDLGVEIGDARLPGVQKALIARAKYLGKPVITATQMMESMIENPLPTRAEVLDVANAVLDGTDAVMLSAESAAGLYPVEAVEAMVRIAQGVEH--ETSCAQGCWDKLHHLCNDAGKSFA--LSSMISATKVHKDLGV---AIVTQHGETPLL--MSRCQSQATIWAVSDKPELLRKLAILRGV 424
>gi|68482226|ref|XP_714997.1| hypothetical protein CaO19.11059 [Candida albicans SC5314] >gi|68482353|ref|XP_714934.1| hypothetical protein CaO19.3575 [Candida albicans SC5314] >gi|46436533|gb|EAK95894.1| hypothetical protein CaO19.3575 [Candida albicans SC5314] >gi|46436598|gb|EAK95958.1| hypothetical protein CaO19.11059 [Candida albicans SC5314] (504 aa)
Score = 592, Expect = 5.3e-59, Identities = 173/460 (37%), Positives = 250/460 (54%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIGTS--EKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVFVKVVD 461
           K ++++ I  T+GP             K  N  V+   +K       AG+NVVR NFSHG YE  Q++  N  +     KG  ++  LDTKGPEIR   T  +K+  I  + ++ I+TT     T   +K   +D     N+ K + PG  I+VDDG L  EVIS + +E  ++  + N   +  +K +NLP ++  +P +S+KD  DI F +KNK   I ASF+ T ++V EI+K+L E G + IQIISKIE   G+ + D+I++ +D +MVARGDLG+E+P   V   +K +I  C    K VI ATQML+S+    +PTRAEV+DV  A+  G DC MLSGETA G YP+ AV +M    +++E    Y +     F E   + +K    ATT    VA   V   +  D  +IVV        + +S  +   PI  VT + E A +F   Y GV+  + D
  S:    20 KYLRRSSIIGTIGP-------------KTNNVDVLVKLRK-------AGLNVVRMNFSHGSYEYHQSVIDNARKSEEVYKGRPLAIALDTKGPEIRTGTTIGDKDYPIPPNHEM-IFTTDDAYKTKCDDKVMYIDYK---NITKVIAPGKIIYVDDGVLSFEVISVD-DEQTLKVRSLNAGKISSHKGVNLPGTDVDLPALSEKDIADIKFGVKNKVHMIFASFIRTANDVLEIRKVLGEEGKD-IQIISKIENQQGVNNFDEILEVTDGVMVARGDLGIEIPAPQVFVVQKQLIAKCNLAAKPVICATQMLESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPVEAVSMMHNTCLTAEKAIAYPQ----LFNELRSLAKK--PTATTETCAVAA--VSAAYEQDAKAIVVLSTSGLSARLVSKYKPDVPILMVT-RNERAAKFSHLYRGVYPFIYD 449
>gi|170722789|ref|YP_001750477.1| pyruvate kinase [Pseudomonas putida W619] >gi|169760792|gb|ACA74108.1| pyruvate kinase [Pseudomonas putida W619] (471 aa)
Score = 591, Expect = 5.8e-59, Identities = 153/472 (32%), Positives = 248/472 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD---NVEHAIANKTEIIDA 476
           KK KI ATLGP+I G                      ++  L +AGVN+ R NFSHG++ +  +R   +REV ++    +  ++D +GP++RV + +E +V+++    +R+    K  G S + ++        +   ++PG  + +DDGKL+L V + + +   I+T   N   L + K +N+P +   +  +++KDR D+ F ++   D++A SFV   +++ E ++++    G+   +++KIE  + ++ L  I + +D+IMVARGDLG+EVP   VP  +K II  CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP+ AV++M+KI    EN  DY   +DV   +         + A    + + P  V+ N+    +S +    +          R  API  +T     A R  + +GV   V D    V+  ++   EI  A
  S:     5 KKVKILATLGPAINGI--------------------DDIRQLVEAGVNIFRLNFSHGEHADHALRYQWIREVEQQLNYPLGILMDLQGPKLRVGRFAEGKVQLQRGQALRL-DLDKTPGDSRRVNLPHP----EIIAALEPGMDLLLDDGKLRLRVTAKHNDA--IDTEVLNGGELSDRKGVNVPQAVLDLSPLTEKDRRDLAFGLELGVDWVALSFVQRPEDIVEARQLI----GDRAYLMAKIEKPSAVEQLQAIAELADAIMVARGDLGVEVPAESVPQIQKRIIGTCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVANAVAEGADAVMLSAETASGDYPLEAVQMMSKIIRQVENGPDYQAQLDVGRPKAEATVSDAISCAIRRISGILPVAVLVNYSESGASTLRAARE----------RPRAPILNLTPNLVTARRLSVTWGVHSVVNDRLRQVDEVVSTALEIAQA 438
>gi|170086043|ref|XP_001874245.1| pyruvate kinase [Laccaria bicolor S238N-H82] >gi|164651797|gb|EDR16037.1| pyruvate kinase [Laccaria bicolor S238N-H82] (532 aa)
Score = 591, Expect = 6.2e-59, Identities = 165/455 (36%), Positives = 243/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKE-KGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           K ++KT I AT+GP +                    T +K LA L  AGVNVVR NFSHG YE  Q++  N  + VA++ +G  ++  LDTKGPEIR   T E K+  + +  +  I T  K      ++   +D T   N+ K   PG  I+VDDG L L V++ +     + T+  N   +   K +NLP ++  +P +SDKD+ D++F +KN  D I ASF+    +V++I+ +L   G  +I+II KIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I      GK VIVATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YPI +V +MA+  + +E+   Y    D      P   E   T+A       + +          S+I+V          +S  R + PI  VT  ++ + +  L+ G +
  S:    30 KYLRKTSIIATIGPKVN-------------------TVEK-LADLRRAGVNVVRMNFSHGSYEYHQSVIDNTRKMVAQDPQGRPVAIALDTKGPEIRTGLTREGKDWPVSAGHEFVISTDPKYSEACDDQVMWVDYT---NLPKVTAPGKLIYVDDGILSLLVLAIDGPNVRVRTL--NNGNISSRKGVNLPKTDVDLPALSDKDKKDLLFGVKNGVDMIFASFIRKAQDVKDIRTVLGPDGA-NIKIIVKIENEQGVANFDEILKETDGVMVARGDLGIEIPASQVFLAQKMMIAKSNIAGKPVIVATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPIQSVLMMAETCLLAESAICYPPLFDDIRSIQPRPTETAETVAIAAVAAASEQGA--------SAIIVLSTSGHTACLISKYRPSVPIITVTRNQQTSRQIHLHRGCY 454
>gi|116055384|emb|CAL58052.1| KPYC_SOLTU Pyruvate kinase, cytosolic isozyme (ISS) [Ostreococcus tauri] (699 aa)
Score = 591, Expect = 6.9e-59, Identities = 136/363 (37%), Positives = 211/363 (58%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD 368
           K+KI  TLGP                    +    + L  +  AG+++ RFNFSHG +E     L+ +R      GV+ + +LDTKGPEIR         + ++  +++ + T     G++EK +V     +Y ++AKDV+PG+ I   DG +   V+  +V +G +     N+  L E K +NLP    ++P +++KDR+D+I + +KN+ D+IAASFV  G +V  I+ +L +   + + IISK+E M G+ + +DI++ SD +MVARGDLG+E+    +   +K +IK C   GK V+ ATQML+S+    +PTRAE TDV  A+  GTD  MLSGETA G YP++AV+ MA I   +E + +
  S:    53 KSKIICTLGP--------------------VSRTVEILEKMLRAGMSIARFNFSHGSHEYHQETLDNLRLACANTGVDCAILLDTKGPEIRTGMLDGGGPIMLEVGNEITLTTDYDFKGSAEKIAV-----SYPDLAKDVKPGSKILCADGSVTFTVLECDVAKGEVRCKLENSAKLGERKNMNLPGVVVNLPTITEKDRHDLIEWGVKNQVDFIAASFVRKGSDVEYIRSVLGDFASK-VSIISKVENMEGLDNFEDIVEASDGVMVARGDLGMEIRMEQIFLAQKRMIKRCNLAGKPVVTATQMLESMTGAPRPTRAEATDVANAILDGTDAVMLSGETAAGSYPLDAVKCMASICREAEAYVN 392
>gi|70729087|ref|YP_258823.1| pyruvate kinase [Pseudomonas fluorescens Pf-5] >gi|68343386|gb|AAY90992.1| pyruvate kinase [Pseudomonas fluorescens Pf-5] (471 aa)
Score = 590, Expect = 7.3e-59, Identities = 158/472 (33%), Positives = 241/472 (51%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD---NVEHAIANKTEIIDA 476
           KK KI ATLGP+I G                IE  ++    L  AGVN+ R NFSHG + +   R   +R+V +E    +  ++D +GP++RV   +E +V++     +R+       G +++ S+        +   ++PG  + +DDGKL+L VI+   +   IET   N   L + K +N+P +   +  ++ KDR D+ F ++   D++A SFV   +++RE + ++    G+   +++KIE  + +  L +I + SD+IMVARGDLG+EVP   VP  +K II  CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP+ AV++M+KI    E   DY   +DV   +         + A      + P  V+ N+    SS +    +          R + PI  +T     A R  + +GV   V D    V+   A   EI  A
  S:     5 KKVKILATLGPAIDG----------------IEDIRE----LVQAGVNIFRLNFSHGAHADHAQRYEWIRQVERELNYPLGILMDLQGPKLRVGTFAEGKVQLVRGQALRL-DLDATPGNAQRVSLPHP----EIIAALEPGMDLLLDDGKLRLRVIAKQADA--IETTVLNGGELSDRKGVNVPQAVLDLSPLTAKDRRDLSFGLELGVDWVALSFVQRPEDIREARALI----GDKAYLMAKIEKPSAVTQLREIAELSDAIMVARGDLGVEVPAESVPQIQKNIISTCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVANAVAEGADAVMLSAETASGEYPLEAVQMMSKIIRQVETGPDYQAQLDVSRPQAEATVSDAISCAIRRVCSILPVAVLVNYSESGSSTLRAARE----------RPSVPILNLTPNLATARRLTVAWGVHSVVNDRLRQVDEVCATALEIAQA 438
>gi|126571553|gb|ABO21408.1| pyruvate kinase [Litopenaeus vannamei] (591 aa)
Score = 590, Expect = 8.6e-59, Identities = 157/422 (37%), Positives = 229/422 (54%)
  Q:    34 GVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNI------STMLDTKGPEIR---VYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           G +  + + L  + +AG+N+ R NFSHG +E  +  +  VR+ A++    I      +  LDTKGPEIR   +      E+E+K  + +++ T        SE    LD     N+ K V+PGN IFVDDG + L  I+ +V    I+    N  +L   K +NLP     +P +S+KDR D++  +K   D + ASF+     VREI+ +L E G ++I+IISKIE   G K++DDII+E D IM+ARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+  K +PTRAEV+DV  A+  G DC MLSGETA G YP+  V  MA I   +E    + +      ++     +   T  T IA + A  + +       ++I+V     R    +S  R   PI  VT   + A +  L  G+
  S:    43 GPVSRSVEMLEKMMEAGMNIARMNFSHGTHEYHSETMMNVRKAAQKYSDKIGHSYPVAIALDTKGPEIRTGLLEGGPSAEIELKEGATIKLTTDASYYEKCSEDVLYLDYV---NITKVVKPGNRIFVDDGLISL--IAKDVGSDSIDCEVENGGMLGSKKGVNLPGVPVDLPAVSEKDRGDLLLGVKMGVDIVFASFIRDAAGVREIRDVLGEKG-KNIKIISKIENHQGCKNIDDIIEEGDGIMIARGDLGIEIPAEKVFVAQKQMIAKCNKVGKPVICATQMLESMVKKPRPTRAEVSDVGNAILDGADCVMLSGETAKGGYPLVCVRTMANIAREAEAAIWHKQLFTELSQQVHLPTDSTHT--TAIAAVEASFKAM------ATAIIVITPTGRSAHLVSKYRPRCPIVAVTRYPQVARQCHLYRGI 460
>gi|154344353|ref|XP_001562199.1| pyruvate kinase, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134065455|emb|CAM43218.1| pyruvate kinase, putative [Leishmania braziliensis] (454 aa)
Score = 590, Expect = 8.6e-59, Identities = 149/405 (36%), Positives = 223/405 (55%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTK--KEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAID--VYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR          ++ D+   + T     + GT +KF +       N+ K V PG  I++DDG L L+V  S+ +E  ++    N   + + + +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V E++K L   GG+ I +I KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++      AI+  V+F       +K+  +  ++   V    V   +     ++VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:     1 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCYVTTDPAFSDKGTKDKFYI----DYANLPKVVSPGGYIYIDDGILILQV-QSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQGVDIIFASFIRSAEQVVEVRKALGAKGGD-IMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQS------AINEYVFFNSI----KKLQPIPMSVEEAVCSSAVNSVYETKAKALVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 393
>gi|167034861|ref|YP_001670092.1| pyruvate kinase [Pseudomonas putida GB-1] >gi|166861349|gb|ABY99756.1| pyruvate kinase [Pseudomonas putida GB-1] (471 aa)
Score = 590, Expect = 8.7e-59, Identities = 152/472 (32%), Positives = 248/472 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD---NVEHAIANKTEIIDA 476
           KK KI ATLGP+I G                      ++  L +AGVN+ R NFSHG++ +  +R   +REV ++    +  ++D +GP++RV + +E +V+++    +R+    K  G + + ++        +   ++PG  + +DDGKL+L V + + +   I+T   N   L + K +N+P +   +  +++KDR D+ F ++   D++A SFV   +++ E ++++    G+   +++KIE  + ++ L  I + +D+IMVARGDLG+EVP   VP  +K II  CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP+ AV++M+KI    EN  DY   +DV   +         + A    + + P  V+ N+    +S +    +          R  API  +T     A R  + +GV   V D    V+  ++   EI  A
  S:     5 KKVKILATLGPAINGI--------------------DDIRQLVEAGVNIFRLNFSHGEHADHALRYQWIREVEQQLNYPLGILMDLQGPKLRVGRFAEGKVQLQRGQALRL-DLDKTPGDNRRVNLPHP----EIIAALEPGMDLLLDDGKLRLRVTAKHSDA--IDTEVLNGGELSDRKGVNVPQAVLDLSPLTEKDRRDLAFGLELGVDWVALSFVQRPEDIVEARQLI----GDRAYLMAKIEKPSAVEQLQAIAELADAIMVARGDLGVEVPAESVPQIQKRIIGTCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVANAVAEGADAVMLSAETASGDYPLEAVQMMSKIIRQVENGPDYQAQLDVGRPKAEATVSDAISCAIRRISGILPVAVLVNYSESGASTLRAARE----------RPRAPILNLTPNLNTARRLSVAWGVHSVVNDRLRQVDEVVSTALEIAQA 438
>gi|148655571|ref|YP_001275776.1| pyruvate kinase [Roseiflexus sp. RS-1] >gi|148567681|gb|ABQ89826.1| pyruvate kinase [Roseiflexus sp. RS-1] (478 aa)
Score = 589, Expect = 1.1e-58, Identities = 159/466 (34%), Positives = 250/466 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKE-VEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE---NFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV------FVKVVDNVEHAIAN 469
           +++TKI AT+GP  +           PE   VIE        L +AG++V R NFSHG  +E   R+ ++REVA  KG  ++ + D +GP+IR     ++  V ++  ++  I TT+   GT+     L ST    + +DV+PG+ I + DG ++  V+  + ++   E +      LRE++ INLP    S P ++DKDR+D++F +    DY+A SFV    ++ EIK  +    G    +I+KIE    +   + I++ +D IMVARGDLG+E+P   VP  +K +I+     GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV++M +I   +E      D+   I   F E P +   + +    I  ++    ++        +  + G+  RL+   +  R   PIF +T  +    R  L +GV      +V  +D++E A+ N
  S:     6 MRRTKIVATIGPVSS----------TPE---VIER-------LLNAGMDVARLNFSHGTQDEHARRIEMLREVAVRKGRPLALLQDLQGPKIRTGSLVDRTPVMLQPGARFTI-TTRNVAGTAS----LVSTTYAALPRDVRPGDRILISDGLIEARVVRVSGDDVETEIVVGGE--LREHQGINLPGVAVSAPALTDKDRSDLLFGLAQGVDYVALSFVRRASDLVEIKAQIAA-AGASTPVIAKIEKPEALHEFEAILEAADGIMVARGDLGVEMPPEQVPIVQKQVIEATNMAGKPVITATQMLDSMIRNPRPTRAEASDVANAIIDGTDAVMLSGETATGAYPVEAVQMMGRIAEVTEASGRRGDHSHEIIWRFHEQPTVAAAISSAVHAIVQVLPVTAIV--------AFTMSGSTARLV---ARQRPKTPIFALTPSEAVYRRLNLVWGVTPLLCPYVDRLDDLEDAVRN 442
>gi|15228164|ref|NP_191124.1| pyruvate kinase, putative [Arabidopsis thaliana] >gi|7263553|emb|CAB81590.1| pyruvate kinase-like protein [Arabidopsis thaliana] (510 aa)
Score = 589, Expect = 1.1e-58, Identities = 163/455 (35%), Positives = 241/455 (52%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFV---------------TDKKEYATRFGLNYGVFVKVV 460
           KTKI  TLGP                    +  + + +  L  AG+NV RFNFSHG +      L+ +R      G+  + MLDTKGPEIR  +    K +++    ++ I       G S   S+        +A+DV+PG+ I   DG + L V+S +   G++     N+ IL E K +NLP     +P +++KD+ DII + + NK D IA SFV  G ++ E++++L EH  ++I ++SK+E   G+ + + I++ SD+ MVARGDLG+E+P   +   +K +IK     GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G +P  AV  M++I   +E+F DY    D+  K+T  M   V    + I +L A         F  S+IVV        + ++  R + PI  V               +D   +A R GL Y   + VV
  S:    17 KTKIICTLGP--------------------VSRSVEMIEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAMDNTGILSAVMLDTKGPEIRTGFLKEGKPIQLNQGQEITISIDYMIEGDSNVISM----SYKKLAEDVKPGDVILCSDGTISLTVLSCDKSFGLVRCRCENSAILGERKNVNLPGIVVDLPTLTEKDKEDIIQWGVPNKIDIIALSFVRKGSDLTEVRRLLGEHS-KNIMLMSKVENQEGVMNCEKILENSDAFMVARGDLGMEIPIEKMFLAQKTMIKMANALGKPVVTATQMLESMTVSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAHPEAAVLTMSRICKEAEDFIDY----DILHKKTLGM---VSLPLSPIESLAASVVSTAQSVF-ASAIVVLTKGGYTAELVAKYRPSVPILSVIVPEIAQGNDMEMSCSDSVAHAARRGLIYRRIIPVV 455
>gi|52547714|gb|AAU81892.1| pyruvate kinase [Phaeodactylum tricornutum] (513 aa)
Score = 589, Expect = 1.2e-58, Identities = 145/359 (40%), Positives = 210/359 (58%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETA-----------KKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIR--VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE 364
           +TKITA+ GP + G   TL    K  +    +T             + L +L DAG+++ RFNFSHGD+E     L+ +R+ A  K  +++ MLDTKGPEIR   +    K++ +     + + +     G   K +         +AK V PG  I V DG L L V+S +   G +     N   + E K +NLP     +P ++DKD +DI  + I N  D+IAASFV    +V +I+++L E G + I+II KIE   G+ + D+I++ +D+IMVARGDLG+E+P   V   +K +I+     GK V+ ATQML+S+ T  +PTRAE +DV  AV  GTDC MLSGETANG YP  AV +M++    +E
  S:     5 QTKITAS-GPELRGANITLDTIMKKTDVSTRQTKIVCTLGPACWEVEQLESLIDAGLSIARFNFSHGDHEGHKACLDRLRQAADHKKKHVAVMLDTKGPEIRSGFFADGAKKISLVKGETIVLTSDYSFKGDKHKLACSYPV----LAKSVTPGQQILVADGSLVLTVLSCDEAAGEVSCRVENNAGIGERKNMNLPGVIVDLPTLTDKDIDDIQNWGIVNDIDFIAASFVRKASDVHKIREVLGEKG-KGIKIICKIENQEGMDNYDEILEATDAIMVARGDLGMEIPPEKVFLAQKMMIRQANIAGKPVVTATQMLESMITNPRPTRAECSDVANAVLDGTDCVMLSGETANGEYPTAAVTIMSETCCEAE 371
>gi|89898143|ref|YP_515253.1| pyruvate kinase [Chlamydophila felis Fe/C-56] >gi|89331515|dbj|BAE81108.1| pyruvate kinase [Chlamydophila felis Fe/C-56] (481 aa)
Score = 588, Expect = 1.2e-58, Identities = 154/465 (33%), Positives = 246/465 (52%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDV-----YFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAI 467
           MI +TKI  T+GP+           N PE           L  L DAG+NV R NFSHG +E     + L++E+ + KG  ++ MLDTKGPE+R+ K       IK     +I    K+I G+ E+   L     +     V+ G  + +DDG ++  V+S+  +   +E I  N+  L+ NK +++ + + ++PFM+DKD  D+ F ++   D IAASFV   +++  ++K L + G   + II+KIE   G+++   I   SD IM+ARGDLG+E+   +VPT +K++ +  R  G+  I ATQML+S+   + PTRAEV+D+  A+  GT   MLSGETA+G YPI AV++M  +   +E   +Y   +++       K +P++ + +G     IA     +           +I+V+         LS  R   PI  VT  ++   R  L +GV+  + +    A+
  S:     1 MIARTKIICTIGPAT----------NTPEM----------LEKLLDAGMNVARLNFSHGTHESHGQTIRLLKELRESKGAPLAIMLDTKGPEVRLGKVP---TPIKVSRGQKITLVGKDIEGSMEEGITLHPRCVFPF---VREGAEVLIDDGYIQAIVVSTGDDHLELEFI--NSGELKSNKSLSIREIDLALPFMTDKDIADLKFGVEQGVDVIAASFVRCAEDIESMRKCLADFGRADMPIIAKIENRLGVENFSKIAQASDGIMIARGDLGIELSVVEVPTLQKFMARVSRETGRFCITATQMLESMIRNVLPTRAEVSDIANAIYDGTSAVMLSGETASGSYPIAAVKIMRSVIQETEKNLNYSSFLNLNDSECAVKVSPYL-QSIGLSGIQIAEKAEAR-----------AIIVYTESGGSPIFLSKYRPRFPIIAVTPNRDVYYRLALEWGVYPMLTEESVRAV 431
>gi|1791247|gb|AAB41226.1| pyruvate kinase [Chlamydia trachomatis] (496 aa)
Score = 588, Expect = 1.4e-58, Identities = 151/454 (33%), Positives = 245/454 (53%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDV-----YFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           MI +TKI  T+GP+           N PE           L  L DAG+NV R NFSHG +E     + +++E+ +++ V ++ MLDTKGPEIR+    + E  IK     R+    KEI  S++ ++L     Y  +  V+    + +DDG ++  V+  N +E ++E   +N+  ++ NK +++ D + ++PFM++KD  D+ F ++ + D IAASFV   +++  ++K+L+  G  ++ II+KIE   G+++  +I   +D IM+ARGDLG+E+   +VP  +K++ +  R  G+  I ATQML+S+     PTRAEV+DV  A+  GT   MLSGETA+G +P++AV+ M  I   +E  FDY     +       K +P++ E        IA   + K           +I+V+         LS  R   PI  VT  +    R  + +GV+
  S:    12 MIARTKIICTIGPAT----------NTPEM----------LEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQVPLAIMLDTKGPEIRL---GQVESPIKVQPGDRLTLVSKEILGSKESALLFIQVVY--SPYVRERAPVLIDDGYIQAVVV--NAQEHMVEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDIDSMRKVLESFGRPNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIELSIVEVPGLQKFMARASRETGRFCITATQMLESMIRNPLPTRAEVSDVANAIYDGTSAVMLSGETASGAHPVHAVKTMRSIIQETEKTFDYHAFFQLNDKNSALKVSPYL-EANWVFWIQIAEKASAK-----------AIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVY 431
>gi|154344357|ref|XP_001568120.1| pyruvate kinase, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134065457|emb|CAM43221.1| pyruvate kinase, putative [Leishmania braziliensis] (424 aa)
Score = 588, Expect = 1.4e-58, Identities = 149/405 (36%), Positives = 224/405 (55%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTK--KEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAID--VYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++VVR +FSHG +E     +N VR+ A E GVNI+  LDTKGPEIR          ++ D+   + T     + GT +KF +       N+ K V PG  I++DDG L L+V  S+ +E  ++    N   + + + +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V E++K L   GG+ I +I KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++      AI+  V+F       +K+  +  ++   V    V   +     ++VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:     1 MSVVRMDFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCYVTTDPAFSDKGTKDKFYI----DYANLPKVVSPGGYIYIDDGILILQV-QSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQGVDIIFASFIRSAEQVVEVRKALGAKGGD-IMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQS------AINEYVFFNSI----KKLQPIPMSVEEAVCSSAVNSVYETKAKALVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 393
>gi|82617854|gb|ABB84848.1| pyruvate kinase [uncultured delta proteobacterium DeepAnt-32C6] (466 aa)
Score = 588, Expect = 1.5e-58, Identities = 161/456 (35%), Positives = 234/456 (51%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKN-KFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKV 459
           +++ KI  T+GP+                       ++ + AL DAG++  R NFSHG  +       LVRE+A E G  I+ + D  GP+IRV +  E  VE+   +   + TT+   GT ++ S+        + +DV PG+ I +DDG ++L V    VE   I  I     +L E K IN+P S  S P ++DKD+ D+ FA+     D+IA SFV T  ++ E K + K     +  +I+K+E    I +L  I D +D  MVARGDLG+E+    VP  +K II++   +GK VI ATQMLDS+    +PTRAE  D+  AV  GTD  MLSGETA G YPI AV++M  I           R ++  + +   MKE+V       AT       + +   D  ++VVF  D R +Q LS  R  API  +T     A +  L +GV+ ++
  S:     1 MRRAKIVCTIGPATH--------------------TREGIRALIDAGMDCARLNFSHGTQQGHARVAALVRELATEAGRPIALLADLCGPKIRVGRFPEGAVELVEGTAFTL-TTRDVAGTDKQASI----NYAALPQDVDPGDAIMIDDGLIRLVV--REVEGPDIHCIVEVGGMLSERKGINVPGSALSTPALTDKDKRDLAFAVDTIGVDWIALSFVRTAADILEAKSLAK-----NTPVIAKLEKPEAIANLCAIADVADGAMVARGDLGVELGPEKVPLVQKRIIEEVNTRGKLVITATQMLDSMIRNPRPTRAEAADIANAVLDGTDALMLSGETAVGRYPIKAVKMMDVII----------REVETAWLKDASMKEQVIADKWGFATATTKAAALLSFVLDLKALVVFTQDGRTVQLLSEYRPRAPIIALTSDSRVANQLALEWGVYPRL 415
>gi|71419545|ref|XP_811202.1| pyruvate kinase 2, putative [Trypanosoma cruzi strain CL Brener] >gi|70875839|gb|EAN89351.1| pyruvate kinase 2, putative [Trypanosoma cruzi] (499 aa)
Score = 588, Expect = 1.5e-58, Identities = 134/323 (41%), Positives = 193/323 (59%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTK--KEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           L  L  +G++V R NFSHG +E     +N +R  A E G +I   LDTKGPEIR     +  + +     V + +    ++IGT EKF +      Y  ++  V+PG  I++DDG L L+V+S   +E  ++    N   L + K  NLP     +P +S+KDR D+ F ++   D + ASF+ T + V+E+++ L E G + I IISKIE   G++++D II+ SD IMVARGDLG+E+P   V   +  +I  C   GK VI ATQML+S+ T  +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++
  S:    38 LKGLIRSGMSVARMNFSHGSHEYHQTTINNLRAAATELGAHIGLALDTKGPEIRTGLFKDGGIALAPGDTVLVTSDPAFEKIGTKEKFYI-----EYPRLSITVRPGGFIYIDDGVLSLKVLSKE-DEYTLKCYVNNAHFLTDRKGCNLPGCEVDLPAVSEKDREDLKFGVEQGIDMVFASFIRTAEQVQEVREALGEKGKD-ILIISKIENHQGVQNIDGIIEASDGIMVARGDLGVEIPAEKVVVAQMILISKCNVAGKPVICATQMLESMTTNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQS 356
>gi|56757978|gb|AAW27129.1| SJCHGC06305 protein [Schistosoma japonicum] (561 aa)
Score = 588, Expect = 1.6e-58, Identities = 154/413 (37%), Positives = 224/413 (54%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVA---KEKGVNISTMLDTKGPEIR---VYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           L  +  AG+N+ R NFSHG +E     + LVRE A   K     I   LDTKGPEIR   +  +   EV ++   K+R+ T    +   +E    +D     N+   +  G+ IFVDDG + L V+S       +E    N   L   K +NLP ++  +P +S+KD+ D+ FA+++  D + ASF+     V EI+++L E+G  +I+II+KIE   G++  ++I++  D IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+ TK +PTRAE +DV  AV  G DC MLSGETA G+YP+  V+ M +I V +E    +G+  +          E   T  T IA + A  R       + ++I+V     R  Q +S  R   PI  VT  +  A +  L  GV
  S:    76 LQNMMTAGMNIARLNFSHGSHEYHAETIKLVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVSLEVGHKIRVTTDSAYMEACNESTLYVDYP---NIVHVLSNGSKIFVDDGLISLVVLSKG--PNYLECEVENGGKLGSRKGVNLPGAHVDLPAVSEKDKQDLRFAVEHNVDMVFASFIRNAGAVHEIRQLLGENGA-YIKIIAKIENHEGVQRFNEILEVVDGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLETVQTMHRICVQAEAAMFHGQLFEDLKSSLCGPTEMAHT--TAIAAVEAASRC------NAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEVIARQIHLYRGV 481
>gi|145595675|ref|YP_001159972.1| pyruvate kinase [Salinispora tropica CNB-440] >gi|145305012|gb|ABP55594.1| pyruvate kinase [Salinispora tropica CNB-440] (482 aa)
Score = 587, Expect = 1.6e-58, Identities = 151/477 (31%), Positives = 246/477 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAI 477
           M + ++ KI  TLGP+ +           PE           +  L +AG++V R NFSHG + +      LVRE A+  G  ++ + D +GP+IR+ + ++   E ++   V I T+   +GT ++ +      TY  + ++V+PG+ + +DDG++ +EV  ++V    I  +      +  NK ++LP+   S+P +SDKD  D+ FA+    D +A SFV + D+++++  I+ E G  H  +++K+E    ++ L  I+   D +MVARGDLG+E+P   VP  +K  ++ CR   K VIVATQMLDS+    +PTRAE +DV  AV  G D  MLSGET+ G YP+  V  MAKI  ++E     G       +  P      G   T  A+ +A          D  ++V F      ++ LS + C  P+   T   E   +  L++GV   ++  VEH  A   ++ +A+
  S:     1 MGVTRRAKIVCTLGPATS----------SPER----------IRGLVEAGMDVARLNFSHGSHADHEAVCRLVREAAEAAGRPVAVLADLQGPKIRLGRFADGPHEWRTGDSVVI-TSDDILGTRDRVAC-----TYRKLPQEVKPGDRLLIDDGRVAVEV--TDVTGNDIRCLVTEGGPVSNNKGVSLPNVAVSVPALSDKDAEDLRFALGLGADLVALSFVRSADDIKQVHSIMSEEG-VHRPVLAKVEKPEAVEQLGAIVLAFDGVMVARGDLGVEMPLDQVPLVQKRAVQLCRENAKPVIVATQMLDSMIENSRPTRAEASDVANAVLDGADAVMLSGETSVGKYPVLTVSTMAKIVATTEA----GSIAVPRLQHDP---RTHGGALTIAASSIA-------RAIDAKALVAFSQTGDTVRRLSRLHCDLPLLAFTPVPEVRNQLALSWGVQTFLMPFVEHTDAMFRQVDEAL 435
>gi|83856047|ref|ZP_00949576.1| pyruvate kinase [Croceibacter atlanticus HTCC2559] >gi|83849847|gb|EAP87715.1| pyruvate kinase [Croceibacter atlanticus HTCC2559] (476 aa)
Score = 587, Expect = 1.8e-58, Identities = 156/488 (31%), Positives = 260/488 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETP-------FMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVIN 492
           KKTKI ATLGPS + K                      L  + +AG NV R NFSH +Y++   R++++RE+ ++ G N S + D +GP++RV    + EV +    K+   T ++  GT+++  +   T      +DV+ G  I +DDGKL  EV+ +N ++ +   + +    LR  K +NLP++N S+P +++KD  D IFA +   D++A SFV   ++++E+++++K+H    I II+KIE   G++++D I+   D +MVARGDLG+E+P  +VP  +K ++   +     VI+ATQM++++ T + PTRAEV DV  +V  G D  MLSGET+ G YP+  ++ M +I  + E+      +  ++  E P       ++ + +   A  +A  +  K           +I    N       +S  R +A I   T  K   T+  L +GV     D    +  +  E ++ I  Q+  VKK+  VIN
  S:     5 KKTKIVATLGPSTSTKTV--------------------LKQMLEAGANVFRINFSHANYDDVKKRISMIRELNEKYGFNASILGDLQGPKLRV-GVMKGEVIVSKGDKLSFCTGEEFEGTADRVYMNYDT----FPRDVKAGERILLDDGKLIFEVLETNKKDEVKAKVIQGG-PLRSRKGVNLPNTNISLPALTEKDVKDAIFACEQGVDWMALSFVRHAEDLQELQELIKKHSEHKIPIIAKIEKPEGVENIDKIVAYCDGLMVARGDLGVEIPAQEVPLIQKQLVLKAKQARIPVIIATQMMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGQYPVQVIQKMCQILKTVED------SPLIHVPEEPPHIRTKRYITKSICYHAAHMANEIKAK-----------AICTLTNSGYTAFQISAWRPSAHILAFTSNKRILTQLSLLWGVHAYYYDKFT-STDDTVEDVNGIAKQMKYVKKSEFVIN 455
>gi|27366661|ref|NP_762188.1| pyruvate kinase [Vibrio vulnificus CMCP6] >gi|27358227|gb|AAO07178.1|AE016808_198 Pyruvate kinase [Vibrio vulnificus CMCP6] (489 aa)
Score = 587, Expect = 2.0e-58, Identities = 138/354 (38%), Positives = 201/354 (56%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A+E  V++  ++D +GP+IR+    +  +++K+ D  +   T  +E GT E+   LD      +  D+Q GN + +DDG+++LEV + + +  ++ TIA N   L   K INL     S P ++DKD+ DI+ A + K D++A SF    D++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P  +K +I   ++ GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G+YP+ AV  M +I
  S:     3 KTKIVATLGPA--------------------SQTREKLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQELNVSVGVLVDLQGPKIRIACFEQGSIQLKAGDPFILDGTLDREAGTQERVG-LDYP---ELIDDLQVGNILLLDDGRIQLEVTAVDTQTRLVNTIALNGGKLSNRKGINLLGGGLSAPALTDKDKQDILTAAELKADFLAVSFPRNADDI-EYARSLALQAGCHAHIVAKVERAEVVASEEAMDGVIRASDVIMVARGDLGVEIGDARLPGVQKALIARAKYLGKPVITATQMMESMIENPLPTRAEVLDVANAVLDGTDAVMLSAESAAGLYPVEAVAAMVRI 335
>gi|86134674|ref|ZP_01053256.1| pyruvate kinase [Tenacibaculum sp. MED152] >gi|85821537|gb|EAQ42684.1| pyruvate kinase [Polaribacter dokdonensis MED152] (475 aa)
Score = 586, Expect = 2.1e-58, Identities = 143/360 (39%), Positives = 215/360 (59%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVE-EGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           KTKI ATLGP+                       K+ L  L   GVNV R NFSH DYE+   ++ ++RE+ +E G NI+ + D +GP++RV    E+ VE+ +D     +TT+K IGT EK     +  TY    KDV+ G  I VDDGKL  EV+S+N E E +++ I      L+  K +NLP++  S+P +++KD  D +FAI+ + D+IA SFV T D++R ++ ++ +H    I +I+KIE    +K+LD +I   D +MVARGDLG+E+P  +VP  +K +++  +     VI+ATQM++++     PTRAEV DV  ++  G D  MLSGET+ G +PI  ++ M++I  S EN
  S:     6 KTKIVATLGPATD--------------------TKEILTDLAKTGVNVFRINFSHADYEDVKRKVKIIREINEENGFNIAILGDLQGPKLRV-GVMEEGVEL-NDGDTFTFTTEKCIGTKEK-----AFMTYQRFPKDVKVGEQILVDDGKLLFEVVSTNKETEVVVKVIVGGP--LKSKKGVNLPNTAISLPALTEKDMEDAVFAIEQEVDWIALSFVRTPDDLRMLRDLIAQHSEYRIPVIAKIEKPEAVKNLDALIPYCDGLMVARGDLGVEIPMQEVPLIQKKLVRRAKRARIPVIIATQMMETMIDNSVPTRAEVNDVANSIMDGADAVMLSGETSVGKHPIRVIQKMSEIIKSVEN 338
>gi|169843774|ref|XP_001828612.1| hypothetical protein CC1G_10283 [Coprinopsis cinerea okayama7#130] >gi|116510320|gb|EAU93215.1| hypothetical protein CC1G_10283 [Coprinopsis cinerea okayama7#130] (530 aa)
Score = 586, Expect = 2.2e-58, Identities = 173/455 (38%), Positives = 244/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKE--KGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFS-VLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN------FFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           K ++KT I AT+GP +                    T +K L  L  AGVN+VR NFSHG YE     ++  R V     KG  I+  LDTKGPEIR   T E +    S  +  I      + T E+++   DS   Y    N+ K   PG  I+VDDG L L V+S  V+   I   A N+  +   K +NLP ++  +P +S+KD+ D+ F +KN  D I ASF+   ++V++I+ +L   G  +I+II KIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VIVATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YPI +V +MA+  + +E+       FD  RAI      T    E V   A   A+    K ++         +   GN  RL+   S  + + PI  VT  ++ A +  L+ G +
  S:    29 KFLRKTSIIATIGPKVN-------------------TVEK-LTELVRAGVNIVRMNFSHGSYEYHQSVIDNTRAVQANDPKGRPIAIALDTKGPEIRTGVTKEGKDWPVSAGQEFI------VSTDERYAEACDSQVMYVDYANLPKVTAPGKLIYVDDGILSLLVLS--VDGKNIHVRALNSGNISSRKGVNLPKTDVDLPALSEKDKKDLEFGVKNGVDMIFASFIRKAEDVQDIRTVLGPDGA-NIKIIVKIENEQGVANFDEILKEADGVMVARGDLGIEIPASQVFLAQKMMIAKCNIVGKPVIVATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGNYPIQSVLMMAETCLLAESSICYPPLFDDIRAIQPRPTAT---AETVAIAAVAAASEQGAKAIL--------VLSTSGNTARLV---SKYKPSVPIITVTRNQQTARQIHLHRGCY 453
>gi|182435906|ref|YP_001823625.1| putative pyruvate kinase [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178464422|dbj|BAG18942.1| putative pyruvate kinase [Streptomyces griseus subsp. griseus NBRC 13350] (476 aa)
Score = 586, Expect = 2.2e-58, Identities = 151/483 (31%), Positives = 252/483 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSS-ENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKK 486
           ++++KI  TLGP++                     + + L AL +AG++V RFNFSHG +EE   R + VR+ A E G  +  + D +GP+IR+ K +E  VE+    +  I  T +++   +       T    +  DV  G+ I ++DG ++L+V++  VE   + TI     ++ ++K INLP +  ++P +S KD  D+ FA++   D +A SFV   D+V+++ K++ E G   + +I+K+E    ++ ++ ++   D +MVARGDL +E P   VP  +K +++ CR   K VIVATQM++S+ T  +PTRAE +DV  A+  G D  MLS E++ G YPI  V+ MAKI V++ E     G    V  K+       V   A  IA  +           D  ++V F       + LS  R A PI   T  +    +  L++GV   VV + +    N   ++D ++++L ++ +
  S:     1 MRRSKIVCTLGPAVD--------------------SHEQLVALIEAGMSVARFNFSHGTHEEHQGRYDRVRKAAAETGRAVGVLADLQGPKIRLAKFAEGPVELVRGDEFTI--TSEDVPGDKSIC---GTTYKGLPGDVVKGDPILINDGNVELKVVA--VEGPRVRTIVIEGGVISDHKGINLPGAAVNVPALSGKDVEDLRFALRMGCDLVALSFVRDADDVKDVHKVMDEEG-RRVPVIAKVEKPQAVEHMEGVVAAFDGVMVARGDLAVEYPLEKVPMVQKRLVELCRRNAKPVIVATQMMESMITNSRPTRAEASDVANAILDGADAVMLSAESSVGAYPIETVKTMAKIVVAAEEELLSKGLQPLVPGKKPRTQGGSVARAACEIADFL-----------DGKALVAFTQSGDTARRLSRYRTAQPILAFTTDEGTRNQLALSWGVESHVVPHAD----NTDAMVDLVDAELLKLNR 441
>gi|194291131|ref|YP_002007038.1| PYRUVATE KINASE; tartrate degradation [Cupriavidus taiwanensis] >gi|193224966|emb|CAQ70977.1| PYRUVATE KINASE; tartrate degradation [Cupriavidus taiwanensis] (487 aa)
Score = 586, Expect = 2.6e-58, Identities = 157/464 (33%), Positives = 240/464 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           M+  +K KI ATLGP+ T             +  VI        ALF+AG +V R NFSHG +E+   R + VR+V  E G  I+ + D +GP++R+   +  +V +++   V +  +    G        D T  Y     + +  QPG ++ +DDGK++L + S  V  G I T   N   L + K +N+PD+   IP +++KDR D+ FA+    D+I  SFV    ++ E ++I+    G    I+SKIE    ++ L++I+  SDS+MVARGDLG+E+P   VP  +K I++ CR  GK V++ATQML+S+     PTRAE +DV  A+  G D  MLS E+ANG YP+ AV +M +I    E    Y   +D    ETP        L T    + A  R +  H    ++ V + +        +  R  API  +T   + A R  + +G+   V  +V+
  S:     1 MRRQRKAKIVATLGPAST-------------DIAVIR-------ALFEAGADVFRLNFSHGTHEDHRARYDAVRQVEAETGRPIAVLADLQGPKLRIGTFAAGKVAVRT-GDVFVLDSDPTPG--------DGTRVYLPHPELFQAAQPGQSLLIDDGKVRLAIES--VTTGTITTRVANNGSLSDRKGVNVPDAVIPIPALTEKDRKDLDFALSLGADWIGLSFVQRPSDIVEAREIVGTRAG----ILSKIEKPAALQQLEEIVRVSDSVMVARGDLGVELPPERVPGVQKRILRVCRQLGKPVVIATQMLESMIDSPVPTRAEASDVASAIYEGADAVMLSAESANGRYPVQAVSMMNRIVTEVERDPLYRNLLDAQ-HETP--------LNTRQDAICAALREV-THIIGAAATVTYTSSGSTALRAARERPCAPIVSITPNLDIARRLAIAWGIHSTVSPDVQ 423
>gi|46126301|ref|XP_387704.1| KPYK_TRIRE Pyruvate kinase [Gibberella zeae PH-1] (540 aa)
Score = 586, Expect = 2.6e-58, Identities = 152/411 (36%), Positives = 229/411 (55%)
  Q:    46 LFDAGVNVVRFNFSHGDYEEQTIRLNLVREV-AKEKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNY-GVF 456
           L D+G+NVVR NFSHG YE     ++  RE  A   G N++  LDTKGPEIR   T  ++++ I    ++ I TT     T+      D    Y    N+   ++PG  I+VDDG L  +V+   V+E  I   ARN   +   K +NLP+++  +P +S+KD+ D+ F ++N  D + ASF+    ++ +I+ +L E G + IQII+KIE   G+ +  +I++ +D +MVARGDLG+E+P  +V   +K +I  C   GK VI ATQML+S+    +PTRAE++DV  A+  G DC MLSGETA G YP  AV+ M +  + +EN   Y   +  + +    +K  V T+ +    + A +  +D        I+V        + LS  R   PIF VT +    +RF   Y GV+
  S:    65 LRDSGLNVVRMNFSHGSYEYHKSVIDHARESEATHAGRNVAIALDTKGPEIRTGNTPGDEDIPISVGHEMNI-TTDDAYATAS-----DDKNMYVDYKNITNVIEPGRIIYVDDGVLAFDVLKI-VDEKTILVKARNNGAICSKKGVNLPNTDVDLPALSEKDKADLKFGVENNVDMVFASFIRRAQDIYDIRDVLGEQG-KRIQIIAKIENRQGLNNFREILEATDGVMVARGDLGIEIPAAEVFAAQKKLIAMCNLAGKPVICATQMLESMIKNPRPTRAEISDVGNAITDGADCVMLSGETAKGSYPSEAVKEMHEACLKAENTIPY---VSHFEEMCTLVKRPVSTVES--CAMAAVRASLD---LGAGGIIVLSTSGESARMLSKYRPVCPIFMVT-RSPTTSRFAHLYRGVY 465
>gi|108803755|ref|YP_643692.1| pyruvate kinase [Rubrobacter xylanophilus DSM 9941] >gi|108764998|gb|ABG03880.1| pyruvate kinase [Rubrobacter xylanophilus DSM 9941] (477 aa)
Score = 585, Expect = 3.1e-58, Identities = 142/370 (38%), Positives = 216/370 (58%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKN-KFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAI 373
           +++TKI ATLGP+ +                    +++++ AL  AGV+V+R NFSHG ++        VRE A E G N++ M D +GP+IR  +  E   E+   S+V I      +G + + S    T    +A+DV+PG+ + +DDG + L V  S  E G I         +  +K +N PDS+ SI  +++KD  D+ F ++  + D++A SFV TG+ V ++K+ ++E GG+ + +ISKIE    I +++++I+ SD +MVARGDL +E+    VP  +K I+  CR +G+ VIVATQMLDS+    +PTRAEV+DV  A+   TD  MLSGETA G YP  +V  M +I  ++E   DYGR I
  S:     3 VRRTKIVATLGPATS--------------------SEESIGALVRAGVDVMRLNFSHGTHDMHLDNARTVREAAAEAGRNVAIMQDLQGPKIRTGEV-EGGTELVEGSRVVI-APGDFVGDASRLS----TSYDRLAQDVKPGHRLLIDDGLIGLRV-ESIKENGEIVCEVLEGGPVSSHKGLNFPDSSLSISGLTEKDLEDLRFGLEELRPDWVAISFVRTGEEVLDVKERIRELGGD-VPVISKIEKHEAIDNIEEVIEASDGVMVARGDLAVELSAERVPIEQKRIVARCRRRGRPVIVATQMLDSMMRNPRPTRAEVSDVANAIFDRTDAVMLSGETAVGRYPTQSVMEMDRICRAAEGAIDYGRDI 345
>gi|91215534|ref|ZP_01252505.1| pyruvate kinase [Psychroflexus torquis ATCC 700755] >gi|91186486|gb|EAS72858.1| pyruvate kinase [Psychroflexus torquis ATCC 700755] (476 aa)
Score = 585, Expect = 3.1e-58, Identities = 158/455 (34%), Positives = 251/455 (55%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTI--ATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           MK  KKTKI +TLGP+ +                     K+ L  + DAGVN+ R NFSH D+++   R+ ++R++  E G N   + D +GP++RV    + EV +++  ++   T K+  GT  +  V  +  T+   +DV PG  I +DDGKL  EV++++  +  ++T       LR  K +NLP++N S+P +++KD  D IFA + + D++A SFV    ++++++K++K+H    I IISKIE   G+K++D II   D +MVARGDLG+EVP ++VP  +K ++   +     VI+ATQM++++   + PTRAEV DV  +V  G D  MLSGET+ G YP+  ++ M++I  S EN       I+V  +E P +K K     +    A L+A +        D S+I    N       +S  R A+ +   T  K   T+  L +GV
  S:     1 MKTSKKTKIVSTLGPATS--------------------KKEVLKDMLDAGVNIFRINFSHADHDDVRERVKMIRDLNDEYGYNAGILGDLQGPKLRV-GIMKDEVVVETGDEIIFATGKEFEGTKSR--VFMNYDTF--PQDVNPGEQILLDDGKLIFEVLTTD-RKSEVKTKVIQGGSLRSRKGVNLPNTNISLPALTEKDVKDAIFACELQVDWMALSFVRFASDLKQLQKLIKKHSKHKIPIISKIEKPEGVKNIDKIIAYCDGLMVARGDLGVEVPAHEVPLIQKQLVLKAKQARIPVIIATQMMETMIDSLTPTRAEVNDVANSVMDGADAVMLSGETSVGKYPVQVIQKMSQILKSVEN----SPLINVP-QEAPQIKTKRYMTKSICYHAALMANE-------IDASAICTLTNSGYTAFQISAWRPASHVLAFTSNKRILTQLSLLWGV 419
>gi|116624087|ref|YP_826243.1| pyruvate kinase [Solibacter usitatus Ellin6076] >gi|116227249|gb|ABJ85958.1| pyruvate kinase [Solibacter usitatus Ellin6076] (470 aa)
Score = 584, Expect = 3.8e-58, Identities = 161/449 (35%), Positives = 239/449 (53%)
  Q:     7 TKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGI-IETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           TKI ATLGP+              +  GV       L  L  AGV+V R N SHG  +    R++ VR  A+E  V+   +LD +GP+IR+ +     V + +D+   I TT++ +GTSE+     STG    AKDV+ G+ I + DG ++L  + S   +G+ ++T   N   + ++K INLP    SIP +++KD  D+ F +    D +A SFV T D+VR+++  L   GG  + I++KIE   G ++++ I+D +D +MVARGDLG+E+    VP  +K II+  R KG+ VI ATQML+S+    +PTRAEV+DV  A+  GTD  MLS ET+ G YP+ AV  MAKI   SE+       ID   +  P   E +   A   A                ++IVVF +     + +S  R    +F +T     A +  ++YGV
  S:     4 TKIVATLGPAT-------------DAPGV-------LRQLLAAGVDVFRLNASHGAQDAHAARIDAVRAAAREAHVHAGILLDLQGPKIRLGRFENGGVTLVTDAIFTI-TTEQVMGTSER----ASTGYSRFAKDVKAGDRILLADGIIELIALES---DGVSVQTRIVNGGPIGDHKGINLPGVQVSIPSLTEKDLADLHFGLNAGVDIVALSFVRTADDVRQLRDRL---GGRPVSIVAKIEKPEGYENIEPILDVTDGVMVARGDLGVEISLERVPRIQKSIIRRARRKGRFVITATQMLESMIENPRPTRAEVSDVANAIYDGTDAVMLSAETSVGKYPVEAVRYMAKIAAESEDSIRKKGYIDPPHQPQPSNAEILADAAHHAARDSGA-----------AAIVVFSSRGSSARLVSRYRPPVGVFAITPHDTTARQLSVSYGV 411
>gi|266429|sp|P30616|KPYK2_TRYBB Pyruvate kinase 2 (PK 2) >gi|10950|emb|CAA41019.1| pyruvate kinase [Trypanosoma brucei] (499 aa)
Score = 584, Expect = 4.2e-58, Identities = 137/323 (42%), Positives = 190/323 (58%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYT--TKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           L  L  +G++V R NFSHG +E     +N VR  A E G++I   LDTKGPEIR     + EV       V + T    +++GT EKF +        + K V  G +I+VDDG + L V+S   ++  ++    N   L + + INLP     +P +S+KDR D+ F +    D I ASF+ T + VRE++  L E G + I IISKIE   G++++D II+ S+ IMVARGDLG+E+P   V   +  II  C   GK VI ATQML+S+ +  +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I V +++
  S:    38 LKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVTFAPGDIVCVTTDPAYEKVGTKEKFYI----DYPQLTKAVPVGGSIYVDDGVMTLRVLSKE-DDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKD-ILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQS 356
>gi|169831218|ref|YP_001717200.1| pyruvate kinase [Candidatus Desulforudis audaxviator MP104C] >gi|169638062|gb|ACA59568.1| pyruvate kinase [Candidatus Desulforudis audaxviator MP104C] (585 aa)
Score = 583, Expect = 4.8e-58, Identities = 153/452 (33%), Positives = 240/452 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++ TKI  T+GP+                      + + L+ + ++G+N+ R NFSHG  EE   R+N VR  A   G  +  M+D +GP+IR+     + VE+K+  ++ + TT+   G   + SV        + ++V PGNTI + DG + LEV+     E +   +  N  +L   K +NLP    SIP +++KD  D+ FA++  FD++AASFV   +++  ++ IL++   E   I++KIET   +++LDDII  +D++MVARGDLGLE+   +VP  +K II  C   GK VI ATQML+S+    +PTRAE +DV  A+  GTD  MLS ETA G YP+ AVE M +I   +E    YG  +    ++   +  +  T A + AT      +        ++I+         + ++  R A PI  VT +++   R  L +GV
  S:     1 MRHTKIICTIGPA--------------------SESVEVLSRMVESGMNISRHNFSHGSREEHRRRINNVRTAAARTGRTVGIMVDLRGPKIRIGDLEPEPVELKAGDELTL-TTEVIKGNRRRISV----DYQPLPREVGPGNTILLGDGLVGLEVLRVEGSEVLCRVL--NDALLTSRKGVNLPGVRTSIPTVTEKDIRDLHFALELGFDFVAASFVRRAEDILSVRAILEKFESE-AHIVAKIETWEAVENLDDIIKVTDAVMVARGDLGLEIAAEEVPLVQKKIIARCNLAGKPVITATQMLESMIHNPRPTRAEASDVANAILDGTDAVMLSAETATGEYPVAAVETMDRIARRAEADLPYGMLLHQRHRD---ISRRTVTDAISYATCATAADLDA------AAIITATQTGYTARMVAKYRPARPIVAVTPREDVVRRLTLLWGV 415
>gi|6324923|ref|NP_014992.1| Pyruvate kinase that appears to be modulated by phosphorylation; PYK2 transcription is repressed by glucose, and Pyk2p may be active under low glycolytic flux; Pyk2p [Saccharomyces cerevisiae] >gi|1730063|sp|P52489|KPYK2_YEAST Pyruvate kinase 2 (PK 2) >gi|1199849|emb|CAA65034.1| O6342 [Saccharomyces cerevisiae] >gi|1420756|emb|CAA99675.1| PYK2 [Saccharomyces cerevisiae] (506 aa)
Score = 583, Expect = 5.0e-58, Identities = 157/455 (34%), Positives = 242/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIG--TSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           + +++T I  T+GP                       + + + AL  AG+N++R NFSHG YE  Q++  N V+   +  G  ++  LDTKGPEIR  +T +++++ I  D ++ I+TT       +++K   +D     N+ K + PG  I+VDDG L  +V+   ++E  +   A N+  +  +K +NLP+++  +P +S KD  D+ F ++N    + ASF+ T ++V  I+K L   G + I+IISKIE   G+ + D+I++ +D +M+ARGDLG+E+   +V   +K +I  C   GK VI ATQMLDS+    +PTRAEV+DV  AV  G DC MLSGETA G YP+NAV +MA   + +E+   +    D     TP       T+A      +  +        D  +IVV        + LS  R + PI  VT     A    L  GVF
  S:    18 QQLRRTSIIGTIGPKTN--------------------SCEAITALRKAGLNIIRLNFSHGSYEFHQSVIENAVKSEQQFPGRPLAIALDTKGPEIRTGRTLNDQDLYIPVDHQM-IFTTDASFANTSNDKIMYIDYA---NLTKVIVPGRFIYVDDGILSFKVLQI-IDESNLRVQAVNSGYIASHKGVNLPNTDVDLPPLSAKDMKDLQFGVRNGIHIVFASFIRTSEDVLSIRKALGSEG-QDIKIISKIENQQGLDNFDEILEVTDGVMIARGDLGIEILAPEVLAIQKKLIAKCNLAGKPVICATQMLDSMTHNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVNAVNIMAATALIAESTIAHLALYDDLRDATPKPTSTTETVAAAATAAILEQ--------DGKAIVVLSTTGNTARLLSKYRPSCPIILVTRHARTARIAHLYRGVF 442
>gi|151945424|gb|EDN63667.1| pyruvate kinase [Saccharomyces cerevisiae YJM789] >gi|190407640|gb|EDV10907.1| pyruvate kinase 2 [Saccharomyces cerevisiae RM11-1a] (506 aa)
Score = 583, Expect = 5.0e-58, Identities = 157/455 (34%), Positives = 242/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIG--TSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           + +++T I  T+GP                       + + + AL  AG+N++R NFSHG YE  Q++  N V+   +  G  ++  LDTKGPEIR  +T +++++ I  D ++ I+TT       +++K   +D     N+ K + PG  I+VDDG L  +V+   ++E  +   A N+  +  +K +NLP+++  +P +S KD  D+ F ++N    + ASF+ T ++V  I+K L   G + I+IISKIE   G+ + D+I++ +D +M+ARGDLG+E+   +V   +K +I  C   GK VI ATQMLDS+    +PTRAEV+DV  AV  G DC MLSGETA G YP+NAV +MA   + +E+   +    D     TP       T+A      +  +        D  +IVV        + LS  R + PI  VT     A    L  GVF
  S:    18 QQLRRTSIIGTIGPKTN--------------------SCEAITALRKAGLNIIRLNFSHGSYEFHQSVIENAVKSEQQFPGRPLAIALDTKGPEIRTGRTLNDQDLYIPVDHQM-IFTTDASFANTSNDKIMYIDYA---NLTKVIVPGRFIYVDDGILSFKVLQI-IDESNLRVQAVNSGYIASHKGVNLPNTDVDLPPLSAKDMKDLQFGVRNGIHIVFASFIRTSEDVLSIRKALGSEG-QDIKIISKIENQQGLDNFDEILEVTDGVMIARGDLGIEILAPEVLAIQKKLIAKCNLAGKPVICATQMLDSMTHNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVNAVNIMAATALIAESTIAHLALYDDLRDATPKPTSTTETVAAAATAAILEQ--------DGKAIVVLSTTGNTARLLSKYRPSCPIILVTRHARTARIAHLYRGVF 442
>gi|72546713|ref|XP_843113.1| pyruvate kinase, putative [Leishmania major strain Friedlin] >gi|70905592|gb|AAZ14231.1| pyruvate kinase, putative [Leishmania major strain Friedlin] (524 aa)
Score = 583, Expect = 5.1e-58, Identities = 147/405 (36%), Positives = 222/405 (54%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAID--VYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR  +    E  ++  +   + T     + GT +KF +       N++K V+PG+ I++DDG L L V  S+ +E  ++    N   + +   +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V +++K L   G + I II KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++      A++  V+F       +K+  +  +    V    V   +      +VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:     1 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKFYI----DYQNLSKVVRPGSYIYIDDGILILHV-QSHEDEQTLKCTVTNAHTISDRCGVNLPGCDVDLPAVSAKDCADLQFGVEQGVDMIFASFIRSAEQVGDVRKALGAKGHD-IMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQS------AVNEYVFFNSI----KKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 393
>gi|15596695|ref|NP_250189.1| pyruvate kinase [Pseudomonas aeruginosa PAO1] >gi|9947453|gb|AAG04887.1|AE004578_9 pyruvate kinase I [Pseudomonas aeruginosa PAO1] (477 aa)
Score = 583, Expect = 5.2e-58, Identities = 160/490 (32%), Positives = 253/490 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY--------NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPEVKKTVVV 490
           M   KK KI ATLGP+                      ++ ++ AL +AG N++R NFSHGDY +   R   VREV  E    I  ++D +GP++RV + +   V+++              G +    + D+ G           +   ++PG ++ +DDGK++LEV+  N     IET       L + K +N+P++   +  ++DKDR D+ F ++   D++A SFV   +++ E + ++    G+   +++KIE  + + +++ I + +D+IMVARGDLG+EVP   VP  +K I++ CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP  AVE+MAKI    E   DY   ++V   +         + A    + + P  V+ N+          GN T  ++A +  R  API  +T     A R  + +GV+  V + + H     +  +D A+  ++     TVVV
  S:     1 MTADKKAKILATLGPATR--------------------SRDDIRALVEAGANLLRLNFSHGDYADHAQRFAWVREVEAELNYPIGVLMDLQGPKLRVGRFAAGAVQLQR-------------GQTFTLDLSDAPGDERRVNLPHPEIIHALEPGMSLLLDDGKIRLEVV--NCHSDAIETRVAVGGELSDRKGVNVPEAVLQLSPLTDKDRRDLAFGLELGVDWVALSFVQRPEDIDEARGLI----GDKAFLMAKIEKPSAVSAIEAIAERADAIMVARGDLGVEVPAESVPGIQKRIVQVCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVATAVGAGADAVMLSAETASGQYPREAVEMMAKIVRQVEAEPDYHVQLEVNRPQPDATVSDAISCAIRRVSRILPVAVLVNY-------TESGNST--LRA-ARERPKAPILSLTPNLRTARRLTVAWGVYSVVNEQLAHVDEICSTALDIALAQRMARRGDTVVV 450
>gi|150015375|ref|YP_001307629.1| pyruvate kinase [Clostridium beijerinckii NCIMB 8052] >gi|149901840|gb|ABR32673.1| pyruvate kinase [Clostridium beijerinckii NCIMB 8052] (472 aa)
Score = 583, Expect = 5.3e-58, Identities = 156/489 (31%), Positives = 252/489 (51%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVIN 492
           ++KTK+  T+GP+   +                ET +K      + G++  R NFSHG +E    ++ L++ ++KE     + +LD KGP+IR +      V +           ++ +G  ++ S+     +Y+ + +D++ G  I VDDG LK +V  + VE   I T       ++ +K +N+P+    +P +++KD  DI F  K   D+IAASF+    ++ ++KK+LKE+ GEHI++I+KIE   G+ ++D II+ +D++MVARGD+G+E+P   VP  +K II+ C   GK VI ATQMLDS+     PTRAE +D+  A+  GTD  MLSGE+A+G +PI A + M+KI   +E + DY          T  ++E   T      +  A +     H     +    G   RL   LS  R  API  +T  ++      LN+G+F               ++ ++ +  L E K TV  +N
  S:     1 MQKTKMIFTIGPASDNE----------------ETLRK----FIEIGMSAARLNFSHGTHETHKEKIELIQRLSKEMNSATAIVLDIKGPKIRTHNFVNDGVTLNDGDDFDFICGEEILGDEKRCSI-----SYDVLYQDIKVGGKILVDDGLLKFKV--TGVEGKTIHTKVVVGGEIKNHKGVNVPNVVIKLPSITEKDIEDIKFGCKMGVDFIAASFIRKASDILDVKKVLKENHGEHIKVIAKIENQEGVDNIDSIIEVTDAVMVARGDMGVEIPIQKVPIIQKMIIRKCNEAGKVVITATQMLDSMIRNSLPTRAEASDICNAIFDGTDAIMLSGESASGCFPIEAAKTMSKIAQEAEEYLDYNHL-------TARLREPSLTDYAAAISYSACRTANILHAKAIVAATKSGATARL---LSRYRSKAPIIAITPYEQVRKGLSLNFGIF-----------PMPCKMFNSTDEILTEAKNTVFSLN 442
>gi|71667353|ref|XP_820627.1| pyruvate kinase 2, putative [Trypanosoma cruzi strain CL Brener] >gi|70885978|gb|EAN98776.1| pyruvate kinase 2, putative [Trypanosoma cruzi] (499 aa)
Score = 583, Expect = 5.4e-58, Identities = 133/323 (41%), Positives = 193/323 (59%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTK--KEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           L  L  +G++V R NFSHG +E     +N +R  A E G +I   LDTKGPEIR     +  + +     V + +    ++IGT EKF +      Y  ++  V+PG  I++DDG L L+V+S   ++  ++    N   L + K  NLP     +P +S+KDR D+ F ++   D + ASF+ T + V+E+++ L E G + I IISKIE   G++++D II+ SD IMVARGDLG+E+P   V   +  +I  C   GK VI ATQML+S+ T  +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++
  S:    38 LKGLIRSGMSVARMNFSHGSHEYHQTTINNLRAAATEIGAHIGLALDTKGPEIRTGLFKDGGIALAPGDTVLVTSDPAFEKIGTKEKFYI-----EYPRLSITVRPGGFIYIDDGVLSLKVLSKE-DDYTLKCYVNNAHFLTDRKGCNLPGCEVDLPAVSEKDREDLKFGVEQGIDMVFASFIRTAEQVQEVREALGEKGKD-ILIISKIENHQGVQNIDAIIEASDGIMVARGDLGVEIPAEKVVVAQMILISKCNVAGKPVICATQMLESMTTNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQS 356
>gi|156741673|ref|YP_001431802.1| pyruvate kinase [Roseiflexus castenholzii DSM 13941] >gi|156233001|gb|ABU57784.1| pyruvate kinase [Roseiflexus castenholzii DSM 13941] (479 aa)
Score = 583, Expect = 5.7e-58, Identities = 163/464 (35%), Positives = 247/464 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYK-TSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI-DVS--SENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVF---GNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV------FVKVVDNVEHAI 467
           +++TKI AT+GP                    + ++ + +  L  AG++V R NFSHG +EE   R+ ++R++A  K   ++ + D +GP+IR       K V +++  +  I TT+   GT+     L ST    + +DV PG+ I + DG ++ +V+  +  E   E +      LREN+ INLP    S P ++DKDR+D+ F + +  DY+A SFV    ++ EIK  +    G    +I+KIE    ++  + I++ +D IMVARGDLG+E+P   VP  +K +I+     GK VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGETA G YP+ AV +MA+I DV+  S    D+       F E P           T+A  ++            +SIV F   GN  RLI   +  R   PIF  T  +    R  L +GV      +V  +D++E+A+
  S:     7 MRRTKIVATIGP--------------------VSSSPEMIERLLTAGMDVARLNFSHGTHEEHAQRIQVLRDIAARKERPLALLQDLQGPKIRTGPLVDRKPVMLRAGDRFTI-TTRNVPGTAS----LVSTTYAALPRDVHPGDRILISDGLIEAQVVRVSGSEVETEIVVGGE--LRENQGINLPGVEVSAPALTDKDRSDLRFGLAHGVDYVALSFVRRASDLLEIKAQITA-AGASTPVIAKIEKPEALREFEAILEAADGIMVARGDLGVEMPPEQVPIVQKQLIEAANMAGKPVITATQMLDSMIRNPRPTRAEASDVANAIIDGTDAVMLSGETATGAYPVEAVRMMARIADVTEASGRRGDHSHESIWRFHEQP-----------TVAAAISAAVHAIVQTLPVTSIVAFTMSGNTARLI---ARQRPKTPIFAFTPSEVVCRRLNLIWGVTPILSPYVDRLDDLENAV 441
>gi|88711760|ref|ZP_01105848.1| pyruvate kinase [Flavobacteriales bacterium HTCC2170] >gi|88710701|gb|EAR02933.1| pyruvate kinase [Flavobacteriales bacterium HTCC2170] (480 aa)
Score = 583, Expect = 6.0e-58, Identities = 141/365 (38%), Positives = 210/365 (57%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           M  IKKTKI ATLGP+ +                     K+ +  +  AGV+V R NFSH DYE+ T R+ ++REV +E   NI+ + D +GP++RV   S  EV +    ++   T +   G SE+  +          KDV PG  I +DDGKL  EV+S+N ++ +   + +    L+  K +NLP++N S+P +++KD  D  FAI    D+IA SFV    ++ +++ I+KEH    I II+KIE    ++++D I+   D +MVARGDLG+EVP ++VP  +K ++   +     VI+ATQM++++ T + PTRAEV DV  +V  G D  MLSGET+ G YP+  +E MA I  S EN
  S:     1 MPNIKKTKIVATLGPATS--------------------KKEVIIDMIKAGVDVFRINFSHADYEDVTARVKMIREVNEEIDSNIAILGDLQGPKLRVGVMS-GEVVVTPGDEIDFVTGEPFEGNSERVYM----NYAAFPKDVNPGERILLDDGKLMFEVVSTNKKDKVRAKVIQGG-PLKSKKGVNLPNTNISLPALTEKDVKDAKFAISLDVDWIALSFVRHSQDIIDLQNIIKEHAEHKIPIIAKIEKPEAVENIDKIVSYCDGLMVARGDLGVEVPAHEVPLIQKKLVLRAKKARIPVIIATQMMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGNYPVQVIEKMASILESVEN 339
>gi|86131055|ref|ZP_01049654.1| Pyruvate kinase [Cellulophaga sp. MED134] >gi|85818466|gb|EAQ39626.1| Pyruvate kinase [Dokdonia donghaensis MED134] (475 aa)
Score = 583, Expect = 6.0e-58, Identities = 136/359 (37%), Positives = 212/359 (59%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSN----VEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M   KKTKI ATLGP+ +                     ++ L  + +AGV+V R NFSH DYE+   R+ ++RE+++E G N S + D +GP++RV K  E EV +     +   T K+  GT E+  +          +DV+ G  I +DDGKL  EVI ++    VE  +I+        LR  K +NLP++N S+P ++ KD  D IFA+  K D++A SFV   +++++++K++KEH    + II+KIE    ++++D I+   D++MVARGDLG+E+P ++VP  +K ++   +     VI+ATQM++++ + + PTRAEV DV  +V  G D  MLSGET+ G YP+  +E MA I
  S:     1 MSKRKKTKIVATLGPATS--------------------KREVLLDMMNAGVDVFRINFSHADYEDVKERVAMIRELSEETGFNTSILADLQGPKLRVGKMKE-EVIVNPGDIITFSTEKEFEGTKERVYM----NYKQFPRDVKAGERILLDDGKLMFEVIKTDGKTEVEAKVIQGGP-----LRSKKGVNLPNTNISLPALTKKDVKDAIFALGLKVDWMALSFVRHAEDLQQLQKLIKEHSDHKVPIIAKIEKPEAVENIDKIVAYCDALMVARGDLGVEIPAHEVPLVQKQLVLRAKKARIPVIIATQMMETMISSLTPTRAEVNDVANSVMDGADAVMLSGETSVGKYPVQVIEKMASI 333
>gi|159485208|ref|XP_001700638.1| pyruvate kinase [Chlamydomonas reinhardtii] >gi|158272070|gb|EDO97876.1| pyruvate kinase [Chlamydomonas reinhardtii] (432 aa)
Score = 582, Expect = 6.2e-58, Identities = 147/380 (38%), Positives = 216/380 (56%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTG------TY-NMAKDVQPGNTIFVDDGKLKL---EVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETP 381
           ++ +KTKI  T GP+                      +++ L  L DAG NV+RFNFSHGD++     L   R+ A     +   +LDTKGPEIR     + K++E+ +   + I     +    E +   ++TG      +Y  +   VQ GN I + DG + +   EV S+N+  G +     N+  L + K  NLP     IP +++KD +D+  F  K++ DY+AASFV +  +V+ I+++L E GG  ++IISKIE   G+ + D+I+ ESD IMVARGDLG+E+P   VP  +K +I      GK +I ATQML+S+ +  +PTRAE+TDV  AV  GTDC MLSGETANG +P  AV  MA I +++E   +  +        TP
  S:     8 ELARKTKIICTAGPACW--------------------SEEGLGKLLDAGCNVLRFNFSHGDHDGHYSVLERFRKGAPS-APHWGCLLDTKGPEIRTAMLKDGKDIELVAGQTIFIEAVGADYVKWEGYKD-EATGETRIGLSYGKLCSSVQQGNKILLADGSISIVVEEVCSANLLRGTV----LNSKKLGQRKNCNLPGVKVDIPVLTEKDIDDLQNFCAKHEMDYVAASFVQSAADVQFIRRVLDEAGGHRVKIISKIENAEGLVNYDEILRESDGIMVARGDLGMEIPAEKVPLAQKMMITKANIAGKFIITATQMLESMISNPRPTRAEMTDVANAVLDGTDCVMLSGETANGSFPEAAVSTMAAICLNAEQMVEVNKRFRFLRNHTP 373
>gi|68535876|ref|YP_250581.1| pyruvate kinase [Corynebacterium jeikeium K411] >gi|68263475|emb|CAI36963.1| pyk [Corynebacterium jeikeium K411] (472 aa)
Score = 582, Expect = 6.2e-58, Identities = 156/479 (32%), Positives = 250/479 (52%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQL 481
           M ++TKI  TLGP++                     +K+ +  L DAG+NV R NFSHG++ +     N VR+   E G  +  + D +GP+IR+ + +E      +   VRI T     GT ++ S    T    +A+D +PG+ + VDDGK+ L     +  + + E I      +  NK ++LP  N S+P +S+KD  D+ FA++   D+IA SFV +  +V  ++ I+ E G   + +I+K+E    + +L+ +I   D+IMVARGDLG+EVP  DVP  +K  I+  R   K VIVATQMLDS+    +PTRAE +DV  AV  G D  MLSGET+ G +PI  VE MA+I  ++E        ID    E P +  +  T    I+   A K + +    +  ++V F +     + ++ +R   P+   T  +   ++  L +GV   ++++V+    +  E++D ++  L
  S:     1 MNRRTKIVCTLGPAVA--------------------SKEQIRGLVDAGMNVARLNFSHGEHADHEQNYNWVRQATDESGKAVGILADLQGPKIRLGRFAEGATVWATGETVRI-TVDDVQGTHDRVS----TTYKGLARDARPGDRLLVDDGKIALVCKEVDGNDVVCEVIEGGP--VSNNKGVSLPGMNISVPALSEKDTEDLRFALQLGVDFIALSFVRSPSDVELVRDIMDEVG-RRVPVIAKLEKPEAVDALEPVILAFDAIMVARGDLGVEVPLEDVPLVQKRAIQIARENAKPVIVATQMLDSMIENSRPTRAEASDVANAVLDGADAVMLSGETSIGKHPITTVETMARIVRAAE--------ID---GEVPPLTHRPRTRRGVIS--YAAKDIGER--LNAKALVAFTSSGDTAKRVARLRSHLPLLVFTPSQAVRSQLALTWGVETFLIEDVK----STDEMMDTVDHHL 432
>gi|33865832|ref|NP_897391.1| pyruvate kinase [Synechococcus sp. WH 8102] >gi|33633002|emb|CAE07813.1| pyruvate kinase [Synechococcus sp. WH 8102] (484 aa)
Score = 582, Expect = 7.7e-58, Identities = 144/451 (31%), Positives = 239/451 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-GRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++TKI AT+GP+                      + + +  L  AG    R NFSHGD+ E   R++ +R+V++E G+NI  + D +GP+IR+ + +E  + + +     +  T + +  ++  +    T TY+ +A +V  G+ I +DDG+++++V   +  E  +        +L  NK +N PD   S+  ++DKD+ D+ F +    D++A SFV    ++ EI+ +++EHG E   +++KIE    I  +D I+   D +MVARGDLG+E+P  +VP  +K +I+     G  +I ATQMLDS+ +  +PTRAEV+DV  A+  GTD  MLS ETA G +P+ AV+ MA I    E   DY  R++D +   T  +   +    +TIA+ +           + S+I+         + +S  R A+PI  +T     A R  L +GV
  S:     8 RRTKIVATIGPATE--------------------SSERIKELVQAGATTFRLNFSHGDHSEHAARISTIRQVSEELGINIGILQDLQGPKIRLGRFAEGPITLANGDSFSL--TSRPVSCNQSIA----TVTYDKLADEVTAGSRILLDDGRVEMKVEQVDQAEQTLHCTVTVGGVLSNNKGVNFPDVQLSVRALTDKDKVDLEFGLSQGVDWVALSFVRNPSDMEEIRGLIREHGHE-TPVVAKIEKFEAIDQIDAILPLCDGVMVARGDLGVEMPAEEVPLLQKELIRKANSLGIPIITATQMLDSMASSPRPTRAEVSDVANAILDGTDAVMLSNETAVGDFPVEAVQTMATIACRIEK--DYPQRSVDSHLAST--VPNALSGAVSTIASQL-----------NASAILPLTKSGATAKNVSKFRPASPILAITPDPTVACRLQLVWGV 418
>gi|154344359|ref|XP_001568121.1| pyruvate kinase, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134065458|emb|CAM43223.1| pyruvate kinase, putative [Leishmania braziliensis] (424 aa)
Score = 582, Expect = 7.8e-58, Identities = 148/405 (36%), Positives = 222/405 (54%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTK--KEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAID--VYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR          ++ D+   + T       GT +KF +       N+ K V PG  I++DDG L L+V  S+ +E  ++    N + + + + +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V E++K L   GG+ I +I KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++      AI+  V+F       +K+  +  ++   V    V   +     ++ V  N  R  + ++  R   PI  VT + +   +  +  GV
  S:     1 MSVARKNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCCVTTDPAFSGKGTKDKFYI----DYANLPKVVSPGGYIYIDDGILILQV-QSHEDEQTLKCTVTNAYTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQGVDIIFASFIRSAEQVVEVRKALGAKGGD-IMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQS------AINEYVFFNSI----KKLQPIPMSVEEAVCSSAVNSVYETKAKALAVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 393
>gi|29832759|ref|NP_827393.1| pyruvate kinase [Streptomyces avermitilis MA-4680] >gi|29609879|dbj|BAC73928.1| putative pyruvate kinase [Streptomyces avermitilis MA-4680] (478 aa)
Score = 582, Expect = 7.8e-58, Identities = 152/452 (33%), Positives = 231/452 (51%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +++ KI  TLGP+                      +   + AL +AG++V RFN SHG Y E   R   VR+ + E G ++  + D +GP+IR+ + +E  V ++       +T   E G         +T    +A DV PG  I VDDGK+ LEV S  V+   + T      ++ ++K +NLP    S+P +SDKD  D+ +A++  FD IA SFV +G +++++ +I+ E G   + +I+K+E    ++++DDI+   D IMVARGDLG+E+P   VP  +K  IK  R   K VIVATQMLDS+    +PTRAE +DV  AV  GTD  MLSGET+ G YP+  V  M++I  ++E         D+     P + E+        A   A   + D  G  +  +V F      ++ LS  R   P+   T      ++  L +GV
  S:     1 MRRAKIVCTLGPATD--------------------SYDQIKALVEAGMDVARFNLSHGTYAEHEERYQHVRKASDETGRSVGVLGDLQGPKIRLGRFNEGPVLLERGDT---FTITVEEGVEGDRQTCGTTYA-GLAADVTPGERILVDDGKVCLEVTS--VDGPRVHTTVVEGGMVSDHKGLNLPGVAVSVPALSDKDEADLRWALRQGFDVIALSFVRSGKDIKDVHRIMDEEG-RRLPVIAKVEKPQAVENIDDIVAAFDGIMVARGDLGVEMPLEQVPIVQKRAIKLARRNAKPVIVATQMLDSMIDNSRPTRAEASDVANAVIDGTDAVMLSGETSVGKYPVETVRTMSRIVEAAEE--------DILATGLPPLTERNKPRTQGGAVARAAAEMGDFLGAKF--LVAFTQSGDTVRRLSRYRSPIPLLAFTPMPATRSQLNLTWGV 415
>gi|107100932|ref|ZP_01364850.1| hypothetical protein PaerPA_01001962 [Pseudomonas aeruginosa PACS2] >gi|194545580|ref|YP_002080608.1| pyruvate kinase I [Pseudomonas aeruginosa C3719] >gi|194550832|ref|YP_002085859.1| pyruvate kinase I [Pseudomonas aeruginosa 2192] >gi|126166526|gb|EAZ52037.1| pyruvate kinase I [Pseudomonas aeruginosa C3719] >gi|126193225|gb|EAZ57288.1| pyruvate kinase I [Pseudomonas aeruginosa 2192] (477 aa)
Score = 581, Expect = 9.0e-58, Identities = 160/490 (32%), Positives = 252/490 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY--------NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPEVKKTVVV 490
           M   KK KI ATLGP+                      ++ ++ AL +AG N+ R NFSHGDY +   R   VREV  E    I  ++D +GP++RV + +   V+++              G +    + D+ G           +   ++PG ++ +DDGK++LEV+  N     IET       L + K +N+P++   +  ++DKDR D+ F ++   D++A SFV   +++ E + ++    G+   +++KIE  + + +++ I + +D+IMVARGDLG+EVP   VP  +K I++ CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP  AVE+MAKI    E   DY   ++V   +         + A    + + P  V+ N+          GN T  ++A +  R  API  +T     A R  + +GV+  V + + H     +  +D A+  ++     TVVV
  S:     1 MTADKKAKILATLGPATR--------------------SRDDIRALVEAGANLFRLNFSHGDYADHAQRFAWVREVEAELNYPIGVLMDLQGPKLRVGRFAAGAVQLQR-------------GQTFTLDLSDAPGDERRVNLPHPEIIHALEPGMSLLLDDGKIRLEVV--NCHSDAIETRVAVGGELSDRKGVNVPEAVLQLSPLTDKDRRDLAFGLELGVDWVALSFVQRPEDIDEARGLI----GDKAFLMAKIEKPSAVSAIEAIAERADAIMVARGDLGVEVPAESVPGIQKRIVQVCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVATAVGAGADAVMLSAETASGQYPREAVEMMAKIVRQVEAEPDYHVQLEVNRPQPDATVSDAISCAIRRVSRILPVAVLVNY-------TESGNST--LRA-ARERPKAPILSLTPNLRTARRLTVAWGVYSVVNEQLAHVDEICSTALDIALAQRMARRGDTVVV 450
>gi|17549667|ref|NP_523007.1| pyruvate kinase [Ralstonia solanacearum GMI1000] >gi|17431921|emb|CAD18599.1| probable pyruvate kinase II protein [Ralstonia solanacearum] (472 aa)
Score = 581, Expect = 9.3e-58, Identities = 152/463 (32%), Positives = 236/463 (50%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETP---FMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNV 463
           M+     KI ATLGP+              ++   IE       AL  AG +V R NFSHG + +   RL  +R V    G  +  +LD +GP++RV   +E  V +   +  R+       G + + ++        +   ++PG  + +DDGKL+LEV++   +    ET   N  +L + K +N+P     +  +++KDR D+ F +    D+IA SFV    ++ EI++++    G    I++K+E    I SLD I+ E+D++MVARGDLG+E+P   VP  +K I++ CR  GK VIVATQML+S+     PTRAE +DV  AV  G D  MLS ETA+G +P+ AV +M +I   +E    Y  AID     TP      + +G  A ++A L+           D +++V + +       ++  R  A I  +T + E A R  L +GV   + D V
  S:     1 MQRSSHAKIVATLGPA-------------SDDHATIE-------ALARAGADVFRLNFSHGAHADHQRRLERIRAVEAALGRPLGVLLDLQGPKLRVGTFAEGRVRLDDGAPFRLDLETGRPGDATRVALPHP----EIFAAIRPGVALLLDDGKLRLEVVACGPDHA--ETRVVNGGMLSDRKGVNVPGVVLPLSALTEKDRADLAFGLALGVDWIALSFVQRAADIAEIRQLVHGRAG----IVAKLEKPAAIDSLDAILAETDAVMVARGDLGVELPAEQVPAIQKRIVRACRRLGKPVIVATQMLESMIGAPVPTRAEASDVATAVYDGADAVMLSAETASGQFPVEAVAMMRRIIAQTEADPHYRAAIDA--SHTPPGANTPDAIGCAAHSVAGLL-----------DVAAMVAYTSSGASALRMARERPRAAILGMTPRPETARRLALVWGVHPVICDGV 423
>gi|146100276|ref|XP_001468823.1| pyruvate kinase [Leishmania infantum] >gi|134073192|emb|CAM71912.1| pyruvate kinase, putative [Leishmania infantum] (454 aa)
Score = 580, Expect = 1.0e-57, Identities = 145/405 (35%), Positives = 222/405 (54%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++V R NFSHG +E     +N VR+ A E GVNI+  LDTKGPEIR  +    E  ++  +   + T     + GT +KF +       N++K V+PG+ I++DDG L L V  S+ +E  ++    N   + + + +NLP  +  +P +S KD  D+ F ++   D I ASF+ + + V E+++ L   G + I II KIE   G++++D II+ESD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G YP   V+ MA+I + +++  +     +   K  P  M  +    ++ + ++   K  +         +VV  N  R  + ++  R   PI  VT + +   +  +  GV
  S:     1 MSVARMNFSHGSHEYHRTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKFYI----DYQNLSKVVRPGSYIYIDDGILILHV-QSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQGVDMIFASFIRSAEQVGEVREALGAKGRD-IMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFNSIKKLQPIPMSAEEAVCSSAVNSVYETKAKV---------MVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGV 393
>gi|50555574|ref|XP_505195.1| YlPYK1 [Yarrowia lipolytica] >gi|49651065|emb|CAG78002.1| YlPYK1 [Yarrowia lipolytica CLIB122] (476 aa)
Score = 580, Expect = 1.2e-57, Identities = 154/413 (37%), Positives = 229/413 (55%)
  Q:    44 AALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKE-KGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTT--KKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGI-IETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           A L  AG+N+VR NFSHG YE     +   RE  ++ +G  ++  LDTKGPEIR   T + K+ ++K+   V +++T  K +    +K   +D T   N+ K +  G  IFVDDG L  +V+     E + +ET+  N   +   K +NLP ++  +P +S+KD+ D+ F +++  D I ASFV T ++V+ I+ +L E G + IQ+ISKIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQMLDS+    +PTRAEV+DV  AV  G DC MLSGETA G YPI +V++M +  + +E    Y    +     T    E V T+A +  +    ++          +I+V        +  S  R   PI  VT   + A    L  GV+
  S:    10 AILTTAGLNIVRMNFSHGSYEYHQSVIENARESEQQFQGRPLAIALDTKGPEIRTGVTKDDKDWDVKA-GHVMLFSTNPKYKDQCDDKIMYIDYT---NIVKQIDIGKIIFVDDGVLSFKVLEKIDGETLKVETL--NNGKISSRKGVNLPGTDVDLPALSEKDKADLKFGVEHGVDMIFASFVRTANDVQAIRDVLGEKG-KGIQVISKIENQQGVNNFDEILKETDGVMVARGDLGIEIPAPQVFIAQKQLIAKCNLAGKPVICATQMLDSMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGTYPIESVKMMHETCLVAEKAIAYAPLFNEMRTLTVRPTETVETIAISAVSASFEQQA--------RAIIVLSTSGTSARLCSKYRPNCPILMVTRNAQAARFSHLYRGVY 412
>gi|149278310|ref|ZP_01884448.1| pyruvate kinase I [Pedobacter sp. BAL39] >gi|149231076|gb|EDM36457.1| pyruvate kinase I [Pedobacter sp. BAL39] (476 aa)
Score = 580, Expect = 1.2e-57, Identities = 135/354 (38%), Positives = 211/354 (59%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           +TKI ATLGP+            KPE           L ++F+AG++V R NFSHG   +  + L+ +R + ++   N+  + D +GP+IR+    +  + + + +K  I TTK+ IG  E+  +   T      KDV+ G  I +DDGKL++ V+ +N E+ ++  +     IL   K +NLP++  SIP ++ +DR ++ F ++N  ++I  SFV   +++ E+K I+KE G +  ++I+KIE    I ++D+II  SD IMVARGDLG+E+P  +VP  +K I++ CR   K VI+ATQML+S+ T  +PTRAEV DV  +V  G D  MLSGET+ G +P+  +E M KI
  S:     7 RTKIVATLGPASA----------KPEV----------LYSMFNAGLDVCRLNFSHGSQADHQVVLDTIRNLNEKHNYNVGILADLQGPKIRIGMVKDGGIHLVNGNKT-IITTKECIGNEERIYITYET----FPKDVKAGEIILLDDGKLQMRVVETNFEDEVVCEVVHGG-ILTSRKGVNLPNTKVSIPSLTIEDRKNLEFVLQNDVEWIGLSFVRNAEDITELKDIIKERG-KTARVIAKIEKPEAIANIDEIIAVSDGIMVARGDLGVEMPMEEVPLLQKMIVQKCRAASKPVIIATQMLESMITTPRPTRAEVNDVANSVLDGADAVMLSGETSVGEFPLIVIETMQKI 333
>gi|152987424|ref|YP_001349188.1| pyruvate kinase [Pseudomonas aeruginosa PA7] >gi|150962582|gb|ABR84607.1| pyruvate kinase [Pseudomonas aeruginosa PA7] (477 aa)
Score = 580, Expect = 1.2e-57, Identities = 160/490 (32%), Positives = 250/490 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY--------NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPEVKKTVVV 490
           M   KK KI ATLGP+                      ++ ++ AL +AG N+ R NFSHGDY +   R   VREV  E    I  ++D +GP++RV + +   V ++              G +    + D+ G           +   ++PG ++ +DDGK++LEV+  N     IET       L + K +N+P++   +  ++DKDR D+ F ++   D++A SFV   +++ E + ++    G+   +++KIE  + + +++ I + +D+IMVARGDLG+EVP   VP  +K I++ CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP  AVE+MAKI    E   DY   ++V   +         + A    + + P  V+ N+          GN T  ++A    R  API  +T     A R  + +GV+  V + + H     +  +D A+  ++     TVVV
  S:     1 MTADKKAKILATLGPATR--------------------SRDDIRALVEAGANLFRLNFSHGDYADHAQRFAWVREVEAELNYPIGVLMDLQGPKLRVGRFAAGAVHLQR-------------GQTFTLDLSDAPGDERRVNLPHPEIIHALEPGMSLLLDDGKIRLEVV--NCHSDAIETRVAVGGELSDRKGVNVPEAVLQLSPLTDKDRRDLAFGLELGVDWVALSFVQRPEDIDEARGLI----GDKAFLMAKIEKPSAVSAIEAIAERADAIMVARGDLGVEVPAESVPGIQKRIVQVCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVATAVGAGADAVMLSAETASGQYPREAVEMMAKIVRQVEAEPDYHVQLEVNRPQPDATVSDAISCAIRRVSRILPVAVLVNY-------TESGNST--LRAARE-RPKAPILSLTPNLRTARRLTVAWGVYSVVNEQLAHVDEICSTALDIALAQRMARRGDTVVV 450
>gi|196235399|ref|ZP_03134202.1| pyruvate kinase [Thermus aquaticus Y51MC23] >gi|196220661|gb|EDY15277.1| pyruvate kinase [Thermus aquaticus Y51MC23] (474 aa)
Score = 579, Expect = 1.3e-57, Identities = 153/455 (33%), Positives = 238/455 (52%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYF-KETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M   K+TKI ATLGP+                      + + + AL +AG +V R NFSHG  E+   R   VR+V++E G  ++ + D +GP+IR+ +  E  VE+K      +     E G   + S+     TY  +  DV PG  + +DDG+++L V     +E  I T+     +L +NK IN+P ++ SIP +S+KD  D+    +   D++A SFV T D++   +  L  +G    ++++KIE  + ++  ++I++E+D IMVARGDLG+E+P  +VP  +K II  C   GK VI ATQML+S+     PTRAE +DV  A+  GTD  MLS ETA G YP+ AV +MA+I  + E   ++ + ++V     TP  ++ +   A  I   V  +           +IVVF       + ++  R   PI  +T   E   +  L +GV
  S:     1 MGPFKRTKIVATLGPATD--------------------SLEAIRALAEAGADVFRMNFSHGAPEDHKRRAAWVRQVSEELGRTLALLQDLQGPKIRIGRFKEGRVELKPGQPFVLTRVPLE-GDETRVSL-----TYRGLPDDVVPGQVLLLDDGRIRLRVERVVGDE--IHTVVEVGGVLSDNKGINVPGADLSIPALSEKDIQDLALGAEIGVDWVAVSFVRTRDDLLLARHYLARYGSR-ARLMAKIEKPSAVERFEEILEEADGIMVARGDLGVEMPLEEVPIVQKRIILRCIAAGKPVITATQMLESMVQNPSPTRAEASDVANAIFDGTDAVMLSAETAAGAYPMEAVAMMARIARTVEASPEFIQKLNVLRPAPTPTTQDAIAQAADDIVEAVGAR-----------AIVVFTATGGSARRIARTRPQVPILALTPNPEVRNQLALVWGV 417
>gi|71029198|ref|XP_764242.1| pyruvate kinase [Theileria parva strain Muguga] >gi|68351196|gb|EAN31959.1| pyruvate kinase, putative [Theileria parva] (513 aa)
Score = 579, Expect = 1.5e-57, Identities = 144/361 (39%), Positives = 208/361 (57%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKE-KGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           K+T I  T+GP+                 G +ET  K    +  +G+N+ RFNFSHG++E  T  LNLV+E  K     NI  MLDTKGPEIR  +  +   + +++   ++I T      T E    + S     + + V+ GN I + DG L  EV++  V +  IE    N   + E K +NLP     +P ++D D++ I+ F I N+ D+IA SF  T D VR ++++L E G +HI+II KIE + G+ + D+I++ SD IMVARGDLG+E+P   V   +K +IK     GK +I ATQML+S+    +PTRAE  DV  AV  G+DC MLSGETA G +P+  V++MAK+   +EN
  S:    38 KRTHIVCTMGPAC----------------GNVETIVK----MIKSGMNICRFNFSHGNHETHTKTLNLVKEALKSVPEANIGLMLDTKGPEIRTGFLKNHTPITLEAGKTLKITTDY----TIEGDESIISCSYKKLPQSVKVGNIILIADGSLSCEVLA--VFDDYIEVKVLNNAKIGEYKNMNLPGVKVELPVLTDSDKDYILNFGIPNQMDFIALSFTQTADEVRYVRELLGEKG-KHIKIIPKIENIEGLANYDEILEASDGIMVARGDLGMEMPIEKVCLAQKMMIKRANMCGKPIITATQMLESMVNNPRPTRAESADVINAVLDGSDCVMLSGETAGGKFPVECVKIMAKLCFEAEN 374
>gi|195572840|ref|XP_002104403.1| GD20940 [Drosophila simulans] >gi|194200330|gb|EDX13906.1| GD20940 [Drosophila simulans] (754 aa)
Score = 579, Expect = 1.6e-57, Identities = 148/356 (41%), Positives = 206/356 (57%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREV----AKEKGV--NISTMLDTKGPEIRVYKTS----EKEVEIKSDSKVRIYTTKKEIG---TSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           I  + I  T+GPS           N PE           L  L  AG+ VVR NFSHG +E     +   R+      ++ G+   ++  LDTKGPEIR  K +      E+E+K+  KV + +TKKE+    T E   V        + + V+PGN IFVDDG + L V  +  +E I +    N   L  +K INLP     +P +++KD+ D+ F  + K D I ASF+   + ++EI++IL    G  I+IISKIE   G+ ++DDII ESD IMVARGD+G+E+P  DVP  +K I+  C   GK VI ATQM++S+  K +PTRAE +DV  A+  G+D  MLSGETA G YP+  V+ MA+I
  S:    84 IPLSSIICTIGPSS----------NSPEK----------LMELIRAGMRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTVAIALDTKGPEIRTGKLAGGNDRAEIELKTGGKVTL-STKKELADKSTQENIYV----DYQRLPELVKPGNRIFVDDGLIALIVKEAKGDEVICQV--ENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDIIFASFIRDANALKEIRQILGP-AGACIKIISKIENHQGLINIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTNKPRPTRAEASDVANAIFDGSDAVMLSGETAKGKYPVECVQCMARI 424
>gi|196000056|ref|XP_002109896.1| hypothetical protein TRIADDRAFT_35480 [Trichoplax adhaerens] >gi|190588020|gb|EDV28062.1| hypothetical protein TRIADDRAFT_35480 [Trichoplax adhaerens] (486 aa)
Score = 579, Expect = 1.7e-57, Identities = 152/414 (36%), Positives = 230/414 (55%)
  Q:    43 LAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGV--NISTMLDTKGPEIR---VYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           L  L   G+N+ R NFSHG  DY  +TI  N +RE  +   +   ++  LDTKGPEIR   +  +   EVE+K+ +  ++  ++ +           + GTY    N+ K +  G+ I++DDG + L V  + +    + T   N   L  +K +NLP++   +P +S++D+ND+ F ++ + D + ASF+  G +VR ++  + E+G + ++IISKIE   G+ ++DDII  SD IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+ +K +PTRAEV+DV  AV  G DC MLSGETA G YP+ AV++M K+ + +E    +    D     TP          T  A   A   V  +     S+I+V     R  + LS  R  +PI  VT   +   +  L  G+F
  S:    21 LVQLIRNGMNIARLNFSHGTHDYHRETI--NNIREAIRRSPLFRTVAIALDTKGPEIRTGLIAGSGTGEVELKTGNAFKLSLSESDYKNGS------TAGTYVDYKNLTKVLSLGSKIYIDDGLISLLV--TEIGPDFVMTKIENGGSLGSHKGVNLPNAIVDLPAVSERDKNDLRFGVEMEVDMVFASFIRKGADVRAVRAAMGEYG-DRVRIISKIENHEGVSNIDDIITASDGIMVARGDLGIEIPPEKVIIAQKMMIGRCNRIGKPVICATQMLESMISKPRPTRAEVSDVANAVLDGADCVMLSGETAKGAYPVEAVKIMHKVCLEAEAAIFHRILFDELRASTP--------TPTITAETCAIAAVDASFKQCASAIIVLTTTGRSAELLSRFRPRSPIIAVTRSPQAGKQLHLYRGLF 426
>gi|116049442|ref|YP_791755.1| pyruvate kinase [Pseudomonas aeruginosa UCBPP-PA14] >gi|115584663|gb|ABJ10678.1| pyruvate kinase I [Pseudomonas aeruginosa UCBPP-PA14] (477 aa)
Score = 578, Expect = 1.9e-57, Identities = 159/490 (32%), Positives = 254/490 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY--------NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIID-AINSQLPEVKKTVVV 490
           M   KK KI ATLGP+                      ++ ++ AL +AG N+ R NFSHGDY +   R   VREV  E    I  ++D +GP++RV + +   V+++              G +    + D+ G           +   ++PG ++ +DDGK++LEV++ + +   IET       L + K +N+P++   +  ++DKDR D+ F ++   D++A SFV   +++ E + ++    G+   +++KIE  + + +++ I + +D+IMVARGDLG+EVP   VP  +K I++ CR  GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP  AVE+MAKI    E   DY   ++V   +         + A    + + P  V+ N+          GN T  ++A +  R  API  +T     A R  + +GV+  V + + H     +  +D A+  ++     TVVV
  S:     1 MTADKKAKILATLGPATR--------------------SRDDIRALVEAGANLFRLNFSHGDYADHAQRFAWVREVEAELNYPIGVLMDLQGPKLRVGRFAAGAVQLQR-------------GQTFTLDLSDAPGDERRVNLPHPEIIHALEPGMSLLLDDGKIRLEVVNGHSDA--IETRVAVGGELSDRKGVNVPEAVLQLSPLTDKDRRDLAFGLELGVDWVALSFVQRPEDIDEARGLI----GDKAFLMAKIEKPSAVSAIEAIAERADAIMVARGDLGVEVPAESVPGIQKRIVQVCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVATAVGAGADAVMLSAETASGQYPREAVEMMAKIVRQVEAEPDYHVQLEVNRPQPDATVSDAISCAIRRVSRILPVAVLVNY-------TESGNST--LRA-ARERPKAPILSLTPNLRTARRLTVAWGVYSVVNEQLAHVDEICSTALDIALAQRMARRGDTVVV 450
>gi|192814036|ref|ZP_03042686.1| pyruvate kinase [Geobacillus sp. Y412MC10] >gi|192797158|gb|EDV73688.1| pyruvate kinase [Geobacillus sp. Y412MC10] (474 aa)
Score = 578, Expect = 2.0e-57, Identities = 153/455 (33%), Positives = 237/455 (52%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYF-KETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M   K+TKI ATLGP+                      + + + AL +AG +V R NFSHG  E+   R   VR+V++E G  ++ + D +GP+IR+ +  E  VE+K      +     E G   + S+     TY  +  DV PG  + +DDG+++L V     +E  I T+     +L +NK IN+P ++ SIP +S+KD  D+    +   D++A SFV T D++   +  L  +G    ++++KIE  + +   ++I++E+D IMVARGDLG+E+P  +VP  +K II  C   GK VI ATQML+S+     PTRAE +DV  A+  GTD  MLS ETA G YP+ AV +MA+I  + E   ++ + ++V     TP  ++ +   A  I   V  +           +IVVF       + ++  R   PI  +T   E   +  L +GV
  S:     1 MGPFKRTKIVATLGPATD--------------------SLEAIRALAEAGADVFRMNFSHGAPEDHKRRAAWVRQVSEELGRTLALLQDLQGPKIRIGRFKEGRVELKPGQPFVLTRVPLE-GDETRVSL-----TYRGLPDDVVPGQVLLLDDGRIRLRVERVVGDE--IHTVVEVGGVLSDNKGINVPGADLSIPALSEKDIQDLALGAEVGVDWVAVSFVRTRDDLLLARHYLARYGSR-ARLMAKIEKPSAVDRFEEILEEADGIMVARGDLGVEMPLEEVPIVQKRIILRCIAAGKPVITATQMLESMVQNPSPTRAEASDVANAIFDGTDAVMLSAETAAGKYPVEAVAMMARIARTVEASPEFIQKLNVLRPAPTPTTQDAIAQAADDIVEAVGAR-----------AIVVFTATGGSARRIARTRPQVPILALTPNLEVRNQLALVWGV 417
>gi|194911133|ref|XP_001982294.1| GG11124 [Drosophila erecta] >gi|190656932|gb|EDV54164.1| GG11124 [Drosophila erecta] (727 aa)
Score = 578, Expect = 2.0e-57, Identities = 161/442 (36%), Positives = 247/442 (55%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREV----AKEKGV--NISTMLDTKGPEIRVYKTS----EKEVEIKSDSKVRIYTTKKEIG---TSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD-------NVEHAIANKTEIIDAINSQLPEVKKTVVVIN 492
           + VVR NFSHG +E     +   R+      ++ G+   ++  LDTKGPEIR  K +      E+E+K+  KV + +TKKE+    T+E   V        + + V+PGN IFVDDG + L V  S   E I +    N   L  +K INLP     +P +++KD+ D+ F  + K D I ASF+   + ++EI+++L     E I+IISKIE   G+ ++DDII ESD IMVARGD+G+E+P  DVP  +K I+  C   GK VI ATQM++S+ TK +PTRAE +DV  A+  G+D  MLSGETA G YP+  V+ MA+I    E    Y    +   +E   ++       + + T +A    +        +IVV    + + Q +S++R   PI  +T  +  A +  L  GV+  +V+       N    + +  +++  ++   P  K +VV++N
  S:     1 MRVVRMNFSHGTHEYHCQTIQAARKAIAMYVEQTGLPRTLAIALDTKGPEIRTGKLAGGDDRAEIELKAGDKVTL-STKKELADKSTNENIYV----DYQRLPELVKPGNRIFVDDGLIALVVKESKGGEVICQV--ENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDIIFASFIRDANALKEIRQVLGP-AAECIKIISKIENQQGLANIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTTKPRPTRAEASDVANAIFDGSDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLKRE---IRTSAADHISAVTTAIAEAATVGQA----RAIVVASPCSMVAQMVSHMRPPCPIVMLTGSQSEAAQSLLFRGVYPLLVEEMVIGSFNFRRIMQSGLKLMGKMDILEPGQKGSVVLVN 447
>gi|29840433|ref|NP_829539.1| pyruvate kinase [Chlamydophila caviae GPIC] >gi|29834782|gb|AAP05417.1| pyruvate kinase [Chlamydophila caviae GPIC] (481 aa)
Score = 577, Expect = 2.5e-57, Identities = 152/465 (32%), Positives = 243/465 (52%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVY-----FKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAI 467
           MI +TKI  T+GP+           N PE           L  L DAG+NV R NFSHG +E     + L++E+ ++KG  ++ MLDTKGPEIR+       +++    K+ +   + E G++E    L     +     V+ G  + +DDG +  + + ++V E  +E    N+  L+ +K +++ + + ++PFM+DKD ND+ F +    D IAASFV   +++  ++K L + G   + II+KIE   G+++   I   SD IM+ARGDLG+E+   +VP  +K++ K  R  G+  I ATQML+S+   + PTRAEV+DV  A+  GT   MLSGETA+G YP+ AV++M  +   +E   +Y   +++       K +P++K  +G     IA              D  +I+V+         LS  R   PI  VT       R  L +GV+  +    + A+
  S:     1 MIARTKIICTIGPAT----------NTPEM----------LEKLLDAGMNVARLNFSHGTHESHGETIRLLKELREKKGAPLAIMLDTKGPEIRLGNIP-TPIQVSRGQKITLVGKEVE-GSAEGGVTLHPQCVFPY---VREGVDVLIDDGYI--QAVVTSVGEDHLELEFINSGELKSHKSLSIREIDLALPFMTDKDINDLQFGVAQGVDVIAASFVRYAEDIESMRKCLADAGRPDMPIIAKIENRLGVENFSQIAKASDGIMIARGDLGIELSVVEVPNLQKFMAKMSREMGRFCITATQMLESMIRNVLPTRAEVSDVANAIYDGTSAVMLSGETASGSYPVAAVKIMRSVIQETEKNLNYKSFLELSDSECAVKVSPYLKS-IGLSGIQIAEKA-----------DAKAIIVYTESGGSPIFLSKYRPRFPIIAVTPNLSVYYRLALEWGVYPMLTQESDRAV 431
>gi|156408764|ref|XP_001642026.1| predicted protein [Nematostella vectensis] >gi|156229167|gb|EDO49963.1| predicted protein [Nematostella vectensis] (556 aa)
Score = 577, Expect = 2.7e-57, Identities = 149/419 (35%), Positives = 230/419 (54%)
  Q:    43 LAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD 461
           +A L + G+N+ R NFSHG  +Y  +TI +N+ R    E    +   LDTKGPEIR       E++++   K+++ T K   + G +E   V       N+ K VQ G T++VDDG + L+V+       I E +  N  +L   K +NLP+    +P +S++D+ DI FA++ + D I ASF+   +++ EI+K+L++H  ++I+I++KIE   G++  ++I++ +D IMVARGDLG+E+P   V   +K +I  C  KG  VI ATQML+S+    +PTRAE +DV  A+  G DC MLSGETA G+YP+ AV +M +I   +E    + ++ D             G   T I+T +A        G D  +I+   +  R    ++  R   PI  VT     A +  L  G F  V D
  S:    64 VAQLIENGMNIARLNFSHGTHEYHRETI-MNIRRAALLEWPHAVGIALDTKGPEIRTGLLKAGEIKLEKGQKLKVSTDKAMYDQGHTECIFV----DYENIVKVVQIGGTVYVDDGLISLKVLEKGDNFLITEVL--NDALLGSKKGVNLPNCAVDLPAVSEQDKKDIAFAVEMEVDMIFASFIRKPEDIAEIRKLLEKHA-KNIKIVAKIENHEGVRRFNEILEVADGIMVARGDLGIEIPAEKVFLAQKMMIARCNMKGVPVICATQMLESMVQNPRPTRAETSDVANAILDGADCVMLSGETAKGLYPVQAVAMMHRISREAEAAIFHKQSFD------ELRHNLEGYADTHISTAIAAVAASFTAGAD--AIICLTHTGRTAAVVARFRPRCPIVVVTRDPRVARQMHLWRGCFPIVYD 470
>gi|145619567|ref|ZP_01775615.1| Pyruvate kinase [Geobacter bemidjiensis Bem] >gi|144944138|gb|EDJ79215.1| Pyruvate kinase [Geobacter bemidjiensis Bem] >gi|197086930|gb|ACH38201.1| pyruvate kinase [Geobacter bemidjiensis Bem] (481 aa)
Score = 577, Expect = 2.7e-57, Identities = 160/487 (32%), Positives = 248/487 (50%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI--DVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVV 489
           M + TKI AT+GP+                      +++ L AL  AGV+V R NFSHGD+  ++  +  +R++  +   +++ + D +GP+IR        +++ + ++V I TT++ +G       L  T    +  DV+P + I +DDG ++L V+   VE G +  +     +L++ K INLP +  S P M+ KDR+D+ F ++ + DY+A SFV    +V+E++ I+   G + ++IISKIE    + +   I+  SD +MVARGDLG+E+    VP  +K II+ C   GK VI ATQML+S+    +PTRAE +DV  A+  GTD  MLS ETA+G YP+ AV +M ++  DV ++             +  P + E +G  A   A  V             S+I+ F         +S  R A PI  VT  +E      L  GV    VD     I   TE      SQ+  V+K V+
  S:     1 MFRHTKIVATVGPA--------------------SESEEMLGALIKAGVDVFRLNFSHGDHAAKSAVIRSIRKLCDQHEHSVAILGDLQGPKIRTGLMKGGGMQLTAGTEV-IVTTRELLGEGS----LIPTIYQGLPGDVKPDDRILLDDGLMELRVLG--VEGGDVRCLVVTGGLLKDRKGINLPGAKVSAPAMTGKDRDDLEFCMEQRLDYVALSFVREASDVQELRSIIDSRGSQ-LRIISKIEKPEAVLNFGAILQASDGVMVARGDLGVELNPEKVPLIQKRIIRSCNDAGKPVITATQMLESMVNNPRPTRAETSDVANAILDGTDAIMLSAETASGKYPVEAVSMMVQVARDVEADPQLMAQSCHIAQTEAEPNLSEVIGLAACHAAESVKA-----------SAILAFTQTGGTAALVSKCRPAQPIIAVTPSEEVRRVLALYAGVHSLRVD-----IEGDTE------SQIISVEKAVL 439
>gi|158293892|ref|XP_315228.4| AGAP004596-PA [Anopheles gambiae str. PEST] >gi|157016521|gb|EAA10555.5| AGAP004596-PA [Anopheles gambiae str. PEST] (472 aa)
Score = 577, Expect = 2.7e-57, Identities = 153/414 (36%), Positives = 220/414 (53%)
  Q:    43 LAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKE------KGVNISTMLDTKGPEIR---VYKTSEKEVEIKSDSKVRIYTTKK--EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           L  +   G+N+ R NFSHG +E     +  +RE          K   ++  LDTKGPEIR   +  +   EVE+K   K+++ T K+  E GT +K  V       N+ K V+PG+ +FVDDG + L V S  +    +     N  +L   K +NLP     +P +S+KD++D+ F ++   D I ASF+     ++EI+ IL E G +HI+IISKIE   G+++LD II+ +D IMVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+  K +PTRAE++DV  A+  G DC MLSGETA G YP+  V  MAK    +E    +          TP   +   ++A   A      R         ++I+V     R    +S  R   PI  VT   + A +  L  G+ 
  S:     2 LEKMMATGMNIARLNFSHGSHEYHANTIKNIREAVDNYSKKLGKPFPLAIALDTKGPEIRTGLIEGSGTGEVELKKGEKIQLTTDKEHLEKGTKDKIYV----DYVNIVKVVKPGDHVFVDDGLISLVVES--ISGDTLTCTVENGGMLGSRKGVNLPGVPVDLPAVSEKDKSDLAFGVEQGVDVIFASFIRNAAALKEIRTILGEKG-KHIKIISKIENQQGMQNLDKIIEATDGIMVARGDLGIEIPAEKVFLAQKSMIARCNRAGKPVICATQMLESMIKKPRPTRAEISDVANAIIDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHRNLFKDLVDTTPTPLDTAASIAIAGAEASIKSRA--------AAIIVITTSGRSAHLISKYRPRCPIIAVTRFAQTARQCHLYRGIL 411
>gi|194476657|ref|YP_002048836.1| pyruvate kinase [Paulinella chromatophora] >gi|171191664|gb|ACB42626.1| pyruvate kinase [Paulinella chromatophora] (585 aa)
Score = 576, Expect = 3.0e-57, Identities = 149/455 (32%), Positives = 241/455 (52%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-GRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + + ++TKI AT+GPS                    E+A + L  L  AG    R NFSHGD+ E   R+  +R+VA+E  ++I  + D +GP+IR+ +  +  + ++     R   T + +  S+    +    TY+ +A D++ G+ I +DDG++++EV S +  E  +  I     +L  NK +N P ++ S+  +++KD  D+ F ++   D++A SFV +  +++EIK ++++  G  I +I+KIE    I+ +D+I+   D +MVARGDLG+E+P  +VP  +K +I+     G  +I ATQMLDS+ +  +PTRAEV+DV  A+  GTD  MLS ETA G YP+ AV  MA+I    E   DY  R+ D +             LA TI   ++          D ++I+           +S  R + PI  VT +   A R  L +GV
  S:     4 IDLSRRTKIVATIGPST-------------------ESADR-LKELIIAGATTFRLNFSHGDHSEHAARIKTIRQVAQELNIHIGILQDLQGPKIRLGRFEKGPITVRKGD--RFSLTSRPVLCSQSIGAV----TYDSLANDIEKGSRIMLDDGRVEMEVESIDRNEDTLHCIVICGGVLSNNKGVNFPGADLSVKALTNKDCEDLAFGLEQGIDWVALSFVKSPSDIKEIKNLIRK-CGYQIPVIAKIEKFEAIQQIDEILPLCDGVMVARGDLGVEMPAEEVPLLQKELIRKANSLGIPIITATQMLDSMVSIPRPTRAEVSDVANAILDGTDAIMLSNETAVGDYPVEAVATMAQIARRIEK--DYPQRSTDTH-------------LACTIPNAISHAVSTIARQLDAAAILPLTKSGATAYNVSKFRPSTPILAVTSEVAVARRLQLIWGV 418
>gi|94984114|ref|YP_603478.1| pyruvate kinase [Deinococcus geothermalis DSM 11300] >gi|94554395|gb|ABF44309.1| Pyruvate kinase [Deinococcus geothermalis DSM 11300] (482 aa)
Score = 576, Expect = 3.4e-57, Identities = 155/451 (34%), Positives = 234/451 (51%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + TKI AT+GP+             PE           L  + DAG+NVVR NFSHGD E+    + LVRE+A +KGV I  + D +GP+IRV +  E  V+++   K  I  T  ++   E       + TY  +A DV PG  + +DDG L L+V     +E I+ T+     +L+ NK IN+P ++ ++P +SDKD  D+ F  +   D++A SFV + D++   +  L   G    ++++KIE    +   +DI+ E D IMVARGDLG+E+    VPT +K +I+ CR  GK VI ATQML+S+    +PTRAE +DV  A+  GTD  MLS E+A G YP+ AV +M +I   +E    Y         ET   ++ +   A +I               + S+IV F +       ++  R    I  +T  ++   +  L++GV
  S:     6 RATKIVATIGPAS----------RNPET----------LGRMIDAGLNVVRMNFSHGDPEDHRQTVQLVRELAAKKGVTIGILQDLQGPKIRVGRFREGAVKLEPGQKFTI--TMDDVEGDET----HVSSTYKGLALDVHPGMILLLDDGNLALKVDQVRGQE-ILTTVVIGG-VLKNNKGINVPQADLAVPALSDKDVQDMEFGAQLGVDWVALSFVRSRDDLLLARHYLARFG-SRAKLMAKIEKPQAVDRFEDILREVDGIMVARGDLGVEMRPEQVPTIQKRLIRLCREAGKPVITATQMLESMINLPRPTRAEASDVANAIYDGTDAVMLSAESAAGQYPVEAVAMMDRIAREAEASEHYELMQRQLVVETELAQDSIAFAACSIG-----------EKLEASAIVTFTSTGGAAMRVAKYRPPLAILALTPNEQTRNQLALSWGV 417
>gi|52547722|gb|AAU81896.1| pyruvate kinase [Achlya bisexualis] (506 aa)
Score = 576, Expect = 3.7e-57, Identities = 153/406 (37%), Positives = 227/406 (55%)
  Q:    41 KNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVRE-VAKEKGVNISTMLDTKGPEIRV--YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATL-VAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYA 446
           + L  L DAG+NV RFNFSHGD++  +  LN +R  +A     +++ MLDTKGPEIR     T +K+V I+ DS +   T  + +G   K +        ++   V+ G  I V DG L LEV  + + E  ++  A N+  L E K +NLP +  ++P ++++D +D+I + +    D+IAASFV  G ++  I+ +L   G   I+II+KIE   G+++ DDI++++D IMVARGDLG+E+    V   +K +I+     GK V+ ATQML+S+    +PTRAE TDV  AV  G+D  MLSGETANG YP+ AV +M K  + +E    Y    ++Y      + E  G ++T  A    A K  ID        IVV        + ++  R A PI  +T   E A
  S:    42 EKLTELIDAGMNVARFNFSHGDHKTHSEVLNRLRTAIASRPHRHVAIMLDTKGPEIRTGFLATEDKKVHIEKDSIIEFTTDYEFLGDETKLAC----SYEDLPTSVKVGGPILVADGSLVLEV--TEILETGVKARALNSATLGERKNMNLPGAKVTLPTLTERDEDDLINWGLVQGVDFIAASFVRCGQDIDNIRAVLGPRG-RAIKIIAKIENQEGLENFDDILEKTDGIMVARGDLGMEIAPEKVFLAQKMMIRKANIAGKPVVTATQMLESMIHNPRPTRAECTDVANAVLDGSDAVMLSGETANGDYPVEAVRMMHKTCLQAEGAIHYD---ELYQALRNSVLETNGKMSTQEAIASSAVKTAID---MGAKMIVVLTETGTTARLIAKYRPACPILVLTALGETA 439
>gi|163786800|ref|ZP_02181248.1| hypothetical protein FBALC1_16482 [Flavobacteriales bacterium ALC-1] >gi|159878660|gb|EDP72716.1| hypothetical protein FBALC1_16482 [Flavobacteriales bacterium ALC-1] (479 aa)
Score = 576, Expect = 3.9e-57, Identities = 136/361 (37%), Positives = 209/361 (57%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           KKTKI ATLGP+ + K                      L A+ D G NV R NFSH DY++   R+ ++RE+ +E G N + + D +GP++RV  T + EV +    ++   T K+  GT E+  +     TY N  +D + G  I +DDGKL  EV+S++ +  +   + +    L+  K +NLP++N S P +++KD  D IFAI  K D+IA SFV   +++ +++K++ EH    I II+KIE    ++++D I+   D +MVARGDLG+E+P  +VP  +K ++   +     VI+ATQM++++ T + PTRAEV DV  +V  G D  MLSGET+ G YP+  +  MA I  S E+
  S:     4 KKTKIVATLGPATSSKTV--------------------LKAMLDEGANVFRINFSHADYKDVEERIKMIRELNEEFGYNAAILGDLQGPKLRV-GTMKGEVIVSEGDEIIFATGKRFEGTKERVYM-----TYDNFPQDAKQGERILLDDGKLIFEVVSTDKKSEVKAKVIQGG-PLKSKKGVNLPNTNISQPALTEKDIEDAIFAIGQKVDWIALSFVRHAEDLMQLEKLINEHSDHKIPIIAKIEKPEAVENIDKIVAYCDGLMVARGDLGVEIPAEEVPLIQKKLVLRAKKARIPVIIATQMMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGQYPVQVIRQMANIIRSVED 338
>gi|86143649|ref|ZP_01062025.1| pyruvate kinase [Flavobacterium sp. MED217] >gi|85829692|gb|EAQ48154.1| pyruvate kinase [Leeuwenhoekiella blandensis MED217] (478 aa)
Score = 575, Expect = 4.3e-57, Identities = 138/365 (37%), Positives = 212/365 (58%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEI-GTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           M   KKTKI ATLGP+ +                     K+ L  +  AGV+V R NFSH DY+    R++++R +++E G N + + D +GP++RV    + EV +    K+ +++TK+E  GT E+  +       +  +DV  G  I +DDGKL  EV+ ++  E  +ET+      L+  K +NLP++N S+P +++KD  D IFAIK   D+IA SFV    ++ +++ ++KEH    I IISKIE    ++++D I+  SD +MVARGDLG+EVP  +VP  +K ++   +     VI+ATQM++++   + PTRAEV DV  +V  G D  MLSGET+ G YP+  +E MA I    E+
  S:     1 MSNTKKTKIVATLGPATS--------------------KKEVLHNMIKAGVDVFRINFSHADYDAVKERIDMIRSLSEEFGYNTAILADLQGPKLRV-GIMKDEVVVNPGDKI-VFSTKEEFEGTKERVYM----NYEHFPRDVNKGERILLDDGKLIFEVLKTD-NENEVETVVIQGGPLKSRKGVNLPNTNISLPALTEKDIEDAIFAIKQNVDWIALSFVRHEGDLIQLQDLIKEHSAHKIPIISKIEKPEAVQNIDKIVAYSDGLMVARGDLGVEVPAEEVPLIQKQLVLSAKKARIPVIIATQMMETMIDSLTPTRAEVNDVANSVMDGADAVMLSGETSVGKYPVQVIERMASILAKVED 339
>gi|195450549|ref|XP_002072531.1| GK18960 [Drosophila willistoni] >gi|194168616|gb|EDW83517.1| GK18960 [Drosophila willistoni] (593 aa)
Score = 575, Expect = 4.4e-57, Identities = 165/462 (35%), Positives = 255/462 (55%)
  Q:    34 GVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVRE----VAKEKGV--NISTMLDTKGPEIRVYKTS--EKEVEIKSDSKVRIYTTKK-EIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEV------KKTVVVINDSI 495
           G     K+ +  L  +GV ++R NFSHG + E    +  +RE    + KE GV  +++  LDTKGPEIR    +    E+++K    V + T K+ E   ++    +D     ++ K   PGN +F+DDG + L+V    + + II     N  +L   K +NLP     +P +S+KD +D+ FA++ K D+I ASF+     + EI++IL  +G  HI+II+KIE   G+ ++D+II  SD IMVARGDLG+E+   +V   +K II  C   GK VI ATQML+S+  K +PTRAE +DV  A+  G DC MLSGETA GMYP+  V+ MA+I    E    Y  +I    K    MK K     +T++  +A   ++     D  +I++      + Q +S+ R + PI  +T     A +  +  G++  V+  ++    +  EI+ A   QL ++      K   VVI D++
  S:    26 GPASNNKECIINLIKSGVRIMRLNFSHGTHHEHCSTIQAIREAITHITKEMGVYKSVAIALDTKGPEIRTGNIALDNSEIKLKKGDIVHLSTNKEVENNCTKDLIYVDYKSISDILK---PGNDVFLDDGLILLKV--QQINDDIIICNVANGGLLGSRKGVNLPGVPIDLPTVSEKDISDLKFAVEKKLDFIFASFIRNAKALAEIRQILGPNG-SHIKIIAKIENQQGLHNIDEIITASDGIMVARGDLGIEILTEEVVIAQKAIIAKCNKIGKPVICATQMLESMINKPRPTRAEASDVANAIFDGADCVMLSGETAKGMYPVECVKCMARICSKVETALWY-ESIQNEVKNV--MKTKSSDQLSTVSFAIAETALLG----DAKAILIASPCDLIPQLVSHFRASCPIIMLTGSAVQARQTLIYRGIYPLVLKEMKDGSNDFEEILQAGIKQLSKLQMLEGEKSGTVVIVDAL 489
>gi|182419784|ref|ZP_02951024.1| pyruvate kinase [Clostridium butyricum 5521] >gi|182376332|gb|EDT73914.1| pyruvate kinase [Clostridium butyricum 5521] (472 aa)
Score = 575, Expect = 4.4e-57, Identities = 145/452 (32%), Positives = 235/452 (51%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           ++KTK+  T+GP+   +                ET +K      + G++  R NFSHG +E    +++L++ +  E     + +LD KGP+IR +      VE+K  +        + +G   + S+        + +D++ G  I VDDG LK +V  + VE   I T       ++ +K +N+P+    +P +++KD  DI F  +   D+IAASF+    ++ ++KKIL+E+ G HI++I+KIE   G+ ++D II+ +D++MVARGD+G+E+P   VP  +K IIK C   GK VI ATQMLDS+     PTRAE +D+  A+  GTD  MLSGE+A+G++PI A + M+KI   +E + DY   +   F+E            T  A  ++       +  D  +IV         + LS  +  AP+  +T          LN+G+
  S:     1 MQKTKMIFTIGPASDNE----------------ETLRK----FIEIGMSAARLNFSHGTHESHKEKIDLIKRLRSEMNSPTAIVLDIKGPKIRTHNFINDGVELKEGNDFTFICGDEILGDETQCSI----SYTELCEDIKVGGNILVDDGLLKFKV--TGVEGNKIHTKVTVGGEIKNHKGVNVPNVIIKLPSITEKDIEDIKFGCEMGVDFIAASFIRKASDILDVKKILQENNGNHIKVIAKIENQEGVDNIDSIIEVTDAVMVARGDMGVEIPIEKVPINQKMIIKKCNEAGKIVITATQMLDSMIRNSLPTRAEASDICNAIFDGTDAIMLSGESASGLFPIEAAKTMSKIAQEAEQYLDYNH-LTARFREPSL---------TDYAAAISYSACRTANLLDAKAIVAATKSGATAKLLSRYKAKAPVIAITPYDHVRRGLNLNFGL 416
>gi|30724884|dbj|BAC76684.1| pyruvate kinase [Microbispora rosea subsp. aerata] (474 aa)
Score = 575, Expect = 4.4e-57, Identities = 135/357 (37%), Positives = 199/357 (55%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           M ++ KI  TLGP+ +           PE           L  L  AG+NV RFN SHG +E      + VR  A E G  +  + D +GP+IRV + +   V +       I TT+   G  +    + ST    +  DV+PG+TI VDDG+L LEV + +    + + +     ++ +NK +NLP    S P +++KD  D+ +A++  FD IA SFV   D +  ++ I++E G   + +++KIE    ++ L++I+D  D +MVARGDLG+E+P   VP  ++ II  CR K   VIVATQMLDS+ +  +PTRAE +DV +AV  G D  MLSGET+ G YP+ AV  MA+I
  S:     1 MSRRAKIVCTLGPATS----------SPER----------LRELIKAGMNVARFNLSHGSHELHKEVFDRVRAAADELGCAVGVLADLQGPKIRVGRFASGPVRLGYGDVFTI-TTEDVPGDRD----IVSTTYEGLPGDVKPGDTILVDDGRLNLEVTAVDGPRVVTKVVIGG--MISDNKGLNLPGVAVSAPALTEKDEEDLRWALRTGFDMIALSFVRCPDAL--VRAIMEEEG-VRLPLLAKIEKPQAVERLEEIVDTFDGVMVARGDLGVELPLEQVPIVQRRIIDLCREKAHPVIVATQMLDSMMSSPRPTRAEASDVAYAVMDGADAVMLSGETSVGNYPVEAVSTMARI 327
>gi|150424227|gb|EDN16165.1| pyruvate kinase II [Vibrio cholerae AM-19226] (486 aa)
Score = 575, Expect = 4.5e-57, Identities = 134/354 (37%), Positives = 203/354 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+   +E  +++ + DS +      ++ GT E+   LD      +  D++ GN + +DDG+++LEV + + +  ++ TIA N+  L   K INL     S P +++KD+ DII A + + D++A SF    +++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P+ +K +I   +H GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G YP+ AV+ M +I
  S:     3 KTKIVATLGPA--------------------SQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQQLNVSVGVLVDLQGPKIRIACFAEGAIQLTAGDSFILDGHLDRQAGTQERVG-LDYP---ELIDDLKMGNILLLDDGRIQLEVTAVDTQARLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDIITAAELQADFLAVSFPRNAEDI-EYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRASDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVLDVANAVIDGTDAIMLSAESAAGRYPVEAVQAMVRI 335
>gi|54041236|sp|P30614|KPYK_YARLI Pyruvate kinase (PK) (515 aa)
Score = 575, Expect = 4.8e-57, Identities = 159/455 (34%), Positives = 242/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKE-KGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTT--KKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGI-IETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           K  +K+ I  T+GP+                      + + ++ L  AG+N+VR NFSHG YE     +   RE  ++ +G  ++  LDTKGPEIR   T + K+ ++K+   V +++T  K +    +K   +D T   N+ K +  G  IFVDDG L  +V+     E + +ET+  N   +   K +NLP ++  +P +S+KD+ D+ F +++  D I ASFV T ++V+ I+ +L E G + IQ+ISKIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQMLDS+    +PTRAEV+DV  AV  G DC MLSGETA G YPI +V++M +  + +E    Y    +     T    E V T+A +  +    ++          +I+V        +  S  R   PI  VT   + A    L  GV+
  S:    27 KNYRKSSIIGTIGPNTN--------------------SAEMISKLRQAGLNIVRMNFSHGSYEYHQSVIENARESEQQFQGRPLAIALDTKGPEIRTGVTKDDKDWDVKA-GHVMLFSTNPKYKDQCDDKIMYIDYT---NIVKQIDIGKIIFVDDGVLSFKVLEKIDGETLKVETL--NNGKISSRKGVNLPGTDVDLPALSEKDKADLKFGVEHGVDMIFASFVRTANDVQAIRDVLGEKG-KGIQVISKIENQQGVNNFDEILKETDGVMVARGDLGIEIPAPQVFIAQKQLIAKCNLAGKPVICATQMLDSMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGTYPIESVKMMHETCLVAEKAIAYAPLFNEMRTLTVRPTETVETIAISAVSASFEQQA--------RAIIVLSTSGTSARLCSKYRPNCPILMVTRNAQAARFSHLYRGVY 451
>gi|77457821|ref|YP_347326.1| pyruvate kinase [Pseudomonas fluorescens PfO-1] >gi|77381824|gb|ABA73337.1| pyruvate kinase [Pseudomonas fluorescens PfO-1] (471 aa)
Score = 574, Expect = 5.3e-57, Identities = 154/472 (32%), Positives = 244/472 (51%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD---NVEHAIANKTEIIDA 476
           KK KI ATLGP++ G                IE  ++    L +AGVN+ R NFSHGD+ +   R   +REV ++    +  ++D +GP++RV K ++ +V++      R+       G   + ++        +   ++ G  + +DDGKL+L V++   +   I+T   N   L + K +N+P +   +  ++ KDR D+ F ++   D++A SFV    ++ E ++++    G+   +++KIE  + ++ L +I + SD+IMVARGDLG+EVP   VP  +K II  CRH GK V+VATQML+S+     PTRAEVTDV  AV  G D  MLS ETA+G YP+ AV++M+KI    EN  DY   +DV   +         + A    + V P  V+ N+    +S +    +          R  API  +T   + A R  + +G+   V D    V+   +   EI  A
  S:     5 KKVKILATLGPAVDG----------------IEDIRE----LVEAGVNIFRLNFSHGDHADHAKRYQWIREVERQLNYPLGILMDLQGPKLRVGKFADGKVQLHRGQAFRL-DLDATPGDERRVNLPHP----EIIAALEAGMDLLLDDGKLRLRVVTKYSDA--IDTTVLNGGELSDRKGVNVPQAVLDLSPLTTKDRRDLSFGLELGVDWVALSFVQRPQDILEARELI----GDKAFLMAKIEKPSAVEQLREIAELSDAIMVARGDLGVEVPAESVPQIQKNIITTCRHLGKPVVVATQMLESMRFSPAPTRAEVTDVANAVAEGADAVMLSAETASGEYPLEAVQMMSKIIRQVENGPDYQTQLDVSRPKAEATVSDAISCAIRRISNVLPVAVLVNYSESGASSLRAARE----------RPKAPILNLTPNLQTARRLSVAWGIHSVVNDRLRQVDEVCSTALEIAQA 438
>gi|37522892|ref|NP_926269.1| pyruvate kinase [Gloeobacter violaceus PCC 7421] >gi|35213894|dbj|BAC91264.1| pyruvate kinase [Gloeobacter violaceus PCC 7421] (473 aa)
Score = 574, Expect = 5.4e-57, Identities = 128/391 (32%), Positives = 211/391 (53%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIA 395
           ++TK+ AT+GP+                     ++ + L  L  AG+NV R NFSHG YE+    + L+REV++E    I+ + D +GP+IRV +  E  + +    ++ +    +  G     S+        + ++  PG  + +DDG L+  V+   V+   +        +L+  K +NLP  +  +P M++KD+ D+ F ++   D+++ SFV  G+++R +K +L EHG   + +I+KIE    I +L++I+DE   IMVARGDLG+E+    VP  +K II+ C  +G  VI ATQMLDS+    +PTRAE +DV  A+  G+D  MLSGE+A G +P+ +VE++ +I    E  F +         E   + E +GT+   +A
  S:     6 RRTKVVATIGPA--------------------SSSPEVLRQLVKAGINVARLNFSHGSYEDHARMVKLLREVSEELDTPITLLQDLQGPKIRVGQMPEGGLALGEGDELTLLPVAEFAGEPGTVSI----DYPYLVEEATPGTQVLLDDGLLEFAVVE--VKGNAVRCRVVRGGVLKSRKGVNLPSLDLRLPSMTEKDKQDLEFGLEQGVDWVSLSFVRRGEDIRVLKGLLAEHGAADVPVIAKIEKPQAIANLEEILDEVQGIMVARGDLGVEMSPEKVPLLQKRIIRLCNRRGIPVITATQMLDSMIRNPRPTRAEASDVANAILDGSDAVMLSGESAVGDFPVQSVEMLVRIAKEVEREFTFDNNPPAKSDEIHALCESLGTIDKILA 370
>gi|84997059|ref|XP_953251.1| pyruvate kinase, putative [Theileria annulata] >gi|65304247|emb|CAI76626.1| pyruvate kinase, putative [Theileria annulata] (513 aa)
Score = 573, Expect = 7.0e-57, Identities = 162/463 (34%), Positives = 244/463 (52%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKE-KGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEK--VGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD-------NVEHAI 467
           K+T I  T+GP+                 G +ET    +  +  +G+N+ RFNFSHG++E  T  LNLV+E  K     NI  MLDTKGPEIR  +  +   + ++  S ++I T      T E    + S     + + V+ GN I + DG L  EV++  V +  IE    N   + E K +NLP     +P +++ D++ I+ F I N+ D+IA SF  T + V+ ++++L E G +HI+II KIE + G+ + D+I++ SD IMVARGDLG+E+P   V   +K +IK     GK +I ATQML+S+    +PTRAE  DV  AV  G+DC MLSGETA G +P+  V++MAK+   +EN                 M E   + +   T+   +A   V  +   +   I+VF    R  + +S  R    I  +++         ++  V   +VD       NVEHAI
  S:    38 KRTHIVCTMGPAC----------------GNVET----IIQMVKSGMNICRFNFSHGNHETHTKTLNLVKEALKSVPEANIGLMLDTKGPEIRTGFLKNHTPITLEEGSTLKITTDY----TIEGDETIISCSYKKLPQSVKVGNIILIADGSLSCEVLA--VFDDYIEVKVLNNAKIGEYKNMNLPGVKVELPVLTESDKDYILNFGIPNQMDFIALSFTQTAEEVKYVRELLGEKG-KHIKIIPKIENIEGLANYDEILEASDGIMVARGDLGMEMPIEKVCLAQKMMIKRANMCGKPIITATQMLESMVNNPRPTRAESADVINAVLDGSDCVMLSGETAGGRFPVECVKIMAKLCFEAENC----------LSTRDLMAESLLLNSSQFTVQESIARSAVFLSIDIEAKMILVFTQTGRASRLVSKYRPRCLILSLSEDIHVVKSLSISRAVISVLVDSLEDTDRNVEHAI 475
>gi|29829367|ref|NP_824001.1| pyruvate kinase [Streptomyces avermitilis MA-4680] >gi|29606474|dbj|BAC70536.1| putative pyruvate kinase [Streptomyces avermitilis MA-4680] (476 aa)
Score = 573, Expect = 7.4e-57, Identities = 152/483 (31%), Positives = 245/483 (50%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI-DVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKK 486
           ++++KI  TLGP++                     + + L  L +AG+NV RFNFSHG + E   R + VR  A E G  I  + D +GP+IR+   +E  VE+    +  I TT+   G       +  T    +  DV  G+ I ++DG ++L V+   V+   ++T+     ++ ++K INLP +  ++P +SDKD  D+ FA+K   D +A SFV    +V+++ K++ E G   + +I+K+E    +++++ ++   D +MVARGDL +E P   VP  +K +++ CR   K VIVATQM++S+ T  +PTRAE +DV  A+  G D  MLS E++ G YPI  V+ M+KI   + E     G    V  K+       V   A  IA  +  K            +V F       + LS  R A PI   T  +    +  L++GV   VV  V     +  E++D ++S+L  +K+
  S:     1 MRRSKIVCTLGPAVD--------------------SHEQLVTLIEAGMNVARFNFSHGTHAEHQGRYDRVRAAAAETGKAIGVLADLQGPKIRLETFAEGPVELVRGDEF-IITTEDVPGDKH----ICGTTYKGLPGDVSKGDQILINDGNVELRVVE--VDGPRVKTVVIEGGVISDHKGINLPGAAVNVPALSDKDIEDLRFALKMGCDLVALSFVRDASDVKDVHKVMDEEG-RRVPVIAKVEKPQAVENMEAVVAAFDGVMVARGDLAVEYPLEKVPMVQKRLVELCRRNAKPVIVATQMMESMITNSRPTRAEASDVANAILDGADAVMLSAESSVGAYPIETVKTMSKIVTAAEEELLSKGLQPLVPGKKPRTQGGSVARAACEIADFLGGK-----------GLVAFTKSGDTARRLSRYRAAQPILAFTTDEGTRNQLALSWGVESHVVPFVN----STDEMVDLVDSELQNLKR 441
>gi|424047|gb|AAA18520.1| pyruvate kinase (542 aa)
Score = 572, Expect = 8.9e-57, Identities = 159/455 (34%), Positives = 242/455 (53%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSE-KEVEIKSDSKVRIYTT--KKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGI-IETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           K  +K+ I  T+GP+                      + + ++ L  AG+N+VR NFSHG YE  Q++  N      + +G  ++  LDTKGPEIR   T + K+ ++K+   V +++T  K +    +K   +D T   N+ K +  G  IFVDDG L  +V+     E + +ET+  N   +   K +NLP ++  +P +S+KD+ D+ F +++  D I ASFV T ++V+ I+ +L E G + IQ+ISKIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQMLDS+    +PTRAEV+DV  AV  G DC MLSGETA G YPI +V++M +  + +E    Y    +     T    E V T+A +  +    ++          +I+V        +  S  R   PI  VT   + A    L  GV+
  S:    27 KNYRKSSIIGTIGPNTN--------------------SAEMISKLRQAGLNIVRMNFSHGSYEYHQSVIENARESEQRFRGRPLAIALDTKGPEIRTGVTKDDKDWDVKA-GHVMLFSTNPKYKDQCDDKIMYIDYT---NIVKQIDIGKIIFVDDGVLSFKVLEKIDGETLKVETL--NNGKISSRKGVNLPGTDVDLPALSEKDKADLKFGVEHGVDMIFASFVRTANDVQAIRDVLGEKG-KGIQVISKIENQQGVNNFDEILKETDGVMVARGDLGIEIPAPQVFIAQKQLIAKCNLAGKPVICATQMLDSMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGTYPIESVKMMHETCLVAEKAIAYAPLFNEMRTLTVRPTETVETIAISAVSASFEQQA--------RAIIVLSTSGTSARLCSKYRPNCPILMVTRNAQAARFSHLYRGVY 451
>gi|40353193|gb|AAR84383.1| GH09258p [Drosophila melanogaster] (679 aa)
Score = 572, Expect = 9.1e-57, Identities = 155/442 (35%), Positives = 243/442 (54%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREV----AKEKGV--NISTMLDTKGPEIRVYKTS----EKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD-------NVEHAIANKTEIIDAINSQLPEVKKTVVVIN 492
           + VVR NFSHG +E     +   R+      ++ G+   ++  LDTKGPEIR  K +      E+E+K+  KV + T K+    S K ++        + + V+PGN +FVDDG + L V  S  +E I +    N   L  +K INLP     +P +++KD+ D+ F  + K D I ASF+   + ++EI+++L    G  I+IISKIE   G+ ++DDII ESD IMVARGD+G+E+P  DVP  +K I+  C   GK VI ATQM++S+  K +PTRAE +DV  A+  G D  MLSGETA G YP+  V+ MA+I    E    Y    +   +E   ++       + + T +A    +        +IVV    + + Q +S++R   PI  +T  +  A +  L  G++  +V+       N    + +  +++  ++   P  K +VV++N
  S:     1 MRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTLAIALDTKGPEIRTGKLAGGNDRAEIELKTGDKVTLSTKKEMADKSNKDNIY--VDYQRLPQLVKPGNRVFVDDGLIALIVKESKGDEVICQV--ENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDMIFASFIRDANALKEIRQVLGP-AGACIKIISKIENHQGLVNIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTNKPRPTRAEASDVANAIFDGCDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLKRE---IRTSAADHISAVTTAIAEAATVGQA----RAIVVASPCSMVAQMVSHMRPPCPIVMLTGNESEAAQSLLFRGIYPLLVEEMVIGSFNFRRIMQSGLKLMGKMDILEPGQKGSVVLVN 447
>gi|163754632|ref|ZP_02161754.1| pyruvate kinase I [Kordia algicida OT-1] >gi|161325573|gb|EDP96900.1| pyruvate kinase I [Kordia algicida OT-1] (476 aa)
Score = 572, Expect = 9.4e-57, Identities = 137/365 (37%), Positives = 215/365 (58%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           M   KKTKI ATLGP+                 G  ET K+ +A     GV+V R NFSH +YE+   R+ ++R+++++ G N S + D +GP++RV   SE +V ++   +++  T K+  GTS+K  +       N  +DV+ G  I +DDGKL  EV+ S+ ++ +   + +    L+  K +NLP+++ S+P +++KD ND IFAI  + D+IA SFV    ++ +++ I+ EH    I II+KIE    + ++D I+   D +MVARGDLG+EVP  +VP  +K ++   +     VI+ATQM++++ T + PTRAEV DV  +V  G D  MLSGET+ G YP+  ++ M KI  S E+
  S:     1 MPKRKKTKIVATLGPA----------------SGSRETIKEMIAQ----GVDVFRINFSHANYEDVKERIAIIRDLSEKHGYNTSILADLQGPKLRVGIMSE-DVIVEPGDQIKFCTGKEFKGTSKKVYM----NYENFPRDVKAGERILLDDGKLIFEVVESDGKQEVTAKVIQGG-PLKSKKGVNLPNTDISLPALTEKDVNDAIFAIGQEVDWIALSFVRHSQDLMDLQAIINEHSEHKIPIIAKIEKPEAVANIDKIVAYCDGLMVARGDLGVEVPAQEVPLIQKQLVLRAKKARIPVIIATQMMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGKYPVQVIQQMTKIIKSVED 339
>gi|153829213|ref|ZP_01981880.1| pyruvate kinase II [Vibrio cholerae 623-39] >gi|148875326|gb|EDL73461.1| pyruvate kinase II [Vibrio cholerae 623-39] (486 aa)
Score = 572, Expect = 9.8e-57, Identities = 133/354 (37%), Positives = 203/354 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+   +E  +++ + D+ +      ++ GT E+   LD      +  D++ GN + +DDG+++LEV + + +  ++ TIA N+  L   K INL     S P +++KD+ DII A + + D++A SF    +++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P+ +K +I   +H GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G YP+ AV+ M +I
  S:     3 KTKIVATLGPA--------------------SQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQQLNVSVGVLVDLQGPKIRIACFAEGAIQLSAGDTFILDGHLDRQAGTQERVG-LDYP---ELIDDLKVGNILLLDDGRIQLEVTAVDTQTRLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDIITAAELQADFLAVSFPRNAEDI-EYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRASDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVLDVANAVIDGTDAIMLSAESAAGRYPVEAVQAMVRI 335
>gi|153211913|ref|ZP_01947760.1| pyruvate kinase II [Vibrio cholerae 1587] >gi|124116989|gb|EAY35809.1| pyruvate kinase II [Vibrio cholerae 1587] (486 aa)
Score = 572, Expect = 1.1e-56, Identities = 133/354 (37%), Positives = 203/354 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+   +E  +++ + D+ +      ++ GT E+   LD      +  D++ GN + +DDG+++LEV + + +  ++ TIA N+  L   K INL     S P +++KD+ DII A + + D++A SF    +++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P+ +K +I   +H GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G YP+ AV+ M +I
  S:     3 KTKIVATLGPA--------------------SQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQDLNVSVGVLVDLQGPKIRIACFAEGAIQLSAGDTFILDGHLDRQAGTQERVG-LDYP---ELIDDLKVGNILLLDDGRIQLEVTAVDTQARLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDIITAAELQADFLAVSFPRNAEDI-EYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRASDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVLDVANAVIDGTDAIMLSAESAAGRYPVEAVQAMVRI 335
>gi|153824374|ref|ZP_01977041.1| pyruvate kinase II [Vibrio cholerae MZO-2] >gi|149741928|gb|EDM55957.1| pyruvate kinase II [Vibrio cholerae MZO-2] (486 aa)
Score = 571, Expect = 1.1e-56, Identities = 134/354 (37%), Positives = 203/354 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+   +E  +++ + DS +      ++ GT E+   LD      +  D++ GN + +DDG+++LEV + + +  ++ TIA N+  L   K INL     S P +++KD+ DII A + + D++A SF    +++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P+ +K +I   +H GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G YP+ AV+ M +I
  S:     3 KTKIVATLGPA--------------------SQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQQLNVSVGVLVDLQGPKIRIACFAEGAIQLAAGDSFILDGHLDRQAGTQERVG-LDYP---ELIDDLKMGNILLLDDGRIQLEVTAVDTQTRLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDIITAAELQADFLAVSFPRNVEDI-EYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRASDVIMVARGDLGVEIGDARLPSVQKALISRAKHLGKPVITATQMMESMIENPLPTRAEVLDVANAVIDGTDAIMLSAESAAGRYPVEAVQAMVRI 335
>gi|191162647|ref|ZP_03024526.1| pyruvate kinase [Geobacter sp. M21] >gi|190996201|gb|EDV71650.1| pyruvate kinase [Geobacter sp. M21] (481 aa)
Score = 571, Expect = 1.2e-56, Identities = 162/487 (33%), Positives = 249/487 (51%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI--DVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVV 489
           M + TKI AT+GP+                      +++ L AL  AGV+V R NFSHGD+  ++  +  +R+++ +   +++ + D +GP+IR        + + S ++V I TT++ +G       L  T    +  DV+P + I +DDG ++L+V+   VE   +  +     +L++ K INLP +  S P M+DKDR+D+ F ++ + D++A SFV    +V+E++ I+   G   ++IISKIE    + +   I+  SD +MVARGDLG+E+    VP  +K II+DC   GK VI ATQML+S+    +PTRAE +DV  A+  GTD  MLS ETA+G YPI AV +M ++  DV ++             +  P + E +G  A   A  V             S+I+ F         +S  R A PI  VT  +E      L  GV    VD     I   TE      SQ+  V+K V+
  S:     1 MFRHTKIVATVGPA--------------------SESEEMLGALIKAGVDVFRLNFSHGDHAAKSAVIRSIRKLSDQHEHSVAILGDLQGPKIRTGLMKGGGMPLTSGTEV-IVTTRELLGEGN----LIPTIYQGLPGDVRPDDRILLDDGLMELKVLG--VEGDDVRCLVVTGGLLKDRKGINLPGAKVSAPAMTDKDRDDLEFCMEQRLDFVALSFVREASDVQELRSIIDSRG-SRLRIISKIEKPEAVINFGAILRVSDGVMVARGDLGVELNPEKVPLIQKRIIRDCNDAGKPVITATQMLESMVNNPRPTRAETSDVANAILDGTDAIMLSAETASGKYPIEAVSMMVQVARDVEADPQLMSQSCHIAQTEAEPNLSEVIGLAACRAAESVKA-----------SAILAFTQTGGTAALVSKCRPAQPIIAVTPSEEVRRVLALYAGVHSLRVD-----IEGDTE------SQIISVEKAVL 439
>gi|7271955|gb|AAF44707.1| cytosolic pyruvate kinase [Lilium longiflorum] (510 aa)
Score = 571, Expect = 1.2e-56, Identities = 137/390 (35%), Positives = 210/390 (53%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATT 393
           + KTK+  TLGPS                      +   L  L  AG+N  RFNFSHG +E     L+ +R   +   +  + +LDTKGPEIR  +    K V+ K   ++ + T     G     ++        +  D++PG TI   DG + L V+S + + G +     NT +L E K +NLP     +P +++KD+ DI+ + + N  D IA SFV  G ++  ++++L  H  ++I+++SK+E   G+ + D+I+ E+D+ MVARGDLG+E+P   +   +K +I  C   GK V+ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGE+A G Y   AV+VMAKI + +E+  DY        +  P     + +LA++
  S:    19 VPKTKLVCTLGPS--------------------SRSVPMLEKLLRAGMNTARFNFSHGTHEYHQETLDNLRIAMQNTQILCAVVLDTKGPEIRTGFLKDGKAVQPKEGQEIIVSTDYDLKGGGNTITM----SYKKLPVDMKPGGTILCADGSISLTVLSCDPDAGTVRCRCENTALLGERKNVNLPGVVVDLPTLTEKDKEDILEWGVPNNIDMIALSFVRKGSDLVNVRQVLGSHA-KNIKLMSKVENQEGVVNFDEILKETDAFMVARGDLGMEIPVEKIFLAQKLMIYICNLAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYLEIAVKVMAKICIEAESSLDYDAIFKEMIRSAPLPMSPLESLASS 385
>gi|153800733|ref|ZP_01955319.1| pyruvate kinase [Vibrio cholerae MZO-3] >gi|153800871|ref|ZP_01955457.1| pyruvate kinase II [Vibrio cholerae MZO-3] >gi|124123581|gb|EAY42324.1| pyruvate kinase II [Vibrio cholerae MZO-3] >gi|124123708|gb|EAY42451.1| pyruvate kinase [Vibrio cholerae MZO-3] (486 aa)
Score = 571, Expect = 1.3e-56, Identities = 132/354 (37%), Positives = 204/354 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+   +E  +++ + ++ +      ++ GT E+   LD      +  D++ GN + +DDG+++LEV++ + +  ++ TIA N+  L   K INL     S P +++KD+ DII A + + D++A SF    +++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P+ +K +I   +H GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G YP+ AV+ M +I
  S:     3 KTKIVATLGPA--------------------SQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQQLNVSVGVLVDLQGPKIRIACFAEGAIQLSAGNTFILDGHLDRQAGTQERVG-LDYP---ELIDDLKVGNILLLDDGRIQLEVMAVDTQARLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDIITAAELQADFLAVSFPRNAEDI-EYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRASDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVLDVANAVIDGTDAIMLSAESAAGRYPVEAVQAMVRI 335
>gi|66810966|ref|XP_639190.1| pyruvate kinase [Dictyostelium discoideum AX4] >gi|74897099|sp|Q54RF5|KPYK_DICDI Pyruvate kinase (PK) >gi|60467847|gb|EAL65862.1| pyruvate kinase [Dictyostelium discoideum AX4] (507 aa)
Score = 571, Expect = 1.4e-56, Identities = 163/435 (37%), Positives = 235/435 (54%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHG--DYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEK--EVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVT 440
           +TKI  T+GP                       +++ L  L + G+NV R NFSHG  DY  Q I+   VR   ++ G  I+ MLDTKGPEIR  K  ++   V++    ++ + T   + GTS + S+ D  G   +   V+ G  I + DG + L + +   E+G +     N   L ENK ++LP +  ++P +S+KD  DI F ++   D+IAASF+   D+V EI++IL E G + IQIISKIE + G+ + ++I++ SD IMVARGDLG+EV    +   +K I+  C   GK VI ATQML+S+    +PTRAE TDV  AV  G+DC MLSGETA+G YP  AV++MAKI   +E   +        F        K  ++A T+A+  A    ID       ++   G   RL+   S  R + PI  VT
  S:    21 RTKIVCTIGPKTM--------------------SEEALIKLIETGMNVCRLNFSHGTHDYHGQVIKN--VRSAMEKTGKIIAIMLDTKGPEIRTGKIEDRCGYVDLFVGQEILVDTNMNQPGTSFRISI-DYKG---LLDSVKVGGYILIADGVISLSITAVEKEKGHVVCRVNNNSRLGENKNVHLPGAIVNLPAVSEKDILDIKFGVEQNVDFIAASFIRKADDVNEIREILGEKGKD-IQIISKIENVEGVDNFNEILEVSDGIMVARGDLGVEVQMEKIFVAQKMIVSKCNAAGKPVITATQMLESMIKNPRPTRAEATDVANAVLDGSDCVMLSGETASGDYPYEAVDIMAKICREAE-LVESSTDYQTLFAALKLSSAKPVSIAETVASY-AVATAIDLKADLIITLTETGLTARLV---SKYRPSIPIIAVT 427
>gi|50420809|ref|XP_458945.1| hypothetical protein DEHA0D12122g [Debaryomyces hansenii CBS767] >gi|54036103|sp|Q6BS75|KPYK_DEBHA Pyruvate kinase (PK) >gi|49654612|emb|CAG87106.1| unnamed protein product [Debaryomyces hansenii CBS767] (504 aa)
Score = 571, Expect = 1.5e-56, Identities = 163/469 (34%), Positives = 247/469 (52%)
  Q:     2 KMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKT-SEKEVEIKSDSKVRIYTTKKEIGTS--EKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKE--KVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF-----VKVVDNVEHAIANK 470
           K+++++ I  T+GP             K  N  V+   +K       AG+N+VR NFSHG YE  Q++  N  +     KG  ++  LDTKGPEIR   T  +K+  I  + ++ I+TT +       +K   +D     N+ K ++ G  I++DDG +  EV+   V++  ++  + N+  +  +K +NLP ++  +P +S+KD+ DI F +KN    I ASF+ TGD+++EI+K+L E G + IQII+KIE   G+ + D+I+ E+D +MVARGDLG+E+P   V   +K +I  C    K VI ATQML+S+    +PTRAEV+DV  A+  G DC MLSGETA G YP  AV +M    + +E    Y           P   E   +    T      A   V   +  D  +IVV        + +S  +   P+  VT     A    L  GV+      K VDN +  + N+
  S:    20 KVLRRSSIIGTIGP-------------KTNNVDVLVKLRK-------AGLNIVRMNFSHGSYEYHQSVIDNAKQSEEIYKGRPLAIALDTKGPEIRTGTTIDDKDYPILPNHEM-IFTTDEAYAKKCDDKVMFIDYK---NITKVIEAGKIIYIDDGVVSFEVLQI-VDDKTLKVRSVNSGKICSHKGVNLPGTDVDLPALSEKDKADIKFGVKNGVHMIFASFIRTGDDIKEIRKVLGEEGKD-IQIIAKIENQQGVNNFDEILVETDGVMVARGDLGIEIPAPQVFVVQKQLIAKCNLAAKPVICATQMLESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPFEAVSMMHNTAIIAEKAIAY----------QPLHNEIRSLANRPTPTTETCAMASVSAAYEQDAKAIVVLSTSGFTSRLVSKYKPNVPVMMVTRNHRAARYCHLYRGVYPFVYEKKTVDNWQEDVENR 463
>gi|160881029|ref|YP_001559997.1| pyruvate kinase [Clostridium phytofermentans ISDg] >gi|160429695|gb|ABX43258.1| pyruvate kinase [Clostridium phytofermentans ISDg] (474 aa)
Score = 570, Expect = 1.9e-56, Identities = 142/366 (38%), Positives = 214/366 (58%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFD 368
           M KKTKI  TLGP+ +                     ++ +  L  +G+++ R NFSHG++E     +  +++V +E G+ I+ +LDTKGPEIR    +E   E   +   ++  T +++  +   S + S    N+ +DV  G +I + DG ++L+V     +E +I  +  N   L   K +NLP+    +P ++++DR DIIF I    D+IAASF+   + +REI+ I+ +   + I II+KIE M G+++LD+II E+D IMVARGDLG+EV    +P  +K +I+ C    K VI ATQMLDS+    +PTRAEVTDV  A+  GTD  MLSGETA G YPI AV++MAKI   +E  ++
  S:     1 MQKKTKIVCTLGPATS--------------------TEEMIKELCLSGMDIARLNFSHGNHEGHGEMIAKIKKVREELGLPIAILLDTKGPEIRT-GLAENGREFTLEKGEQVIVTTEDVPCN---SSIISVTYKNLPEDVVVGGSILIADGLIELKVKKVEDDEKVICEVV-NGGELGSRKGVNLPNVKLKLPAITEQDRADIIFGINEGVDFIAASFIRNAEAIREIRGIIHDCNSD-IAIIAKIENMEGMENLDEIIAETDGIMVARGDLGVEVEPETLPYIQKTMIQKCNAAFKPVITATQMLDSMIRNPRPTRAEVTDVANAIYDGTDAIMLSGETAAGKYPIEAVQMMAKIAKETETHYE 340
>gi|94312383|ref|YP_585593.1| pyruvate kinase [Ralstonia metallidurans CH34] >gi|93356235|gb|ABF10324.1| pyruvate kinase [Ralstonia metallidurans CH34] (488 aa)
Score = 569, Expect = 1.9e-56, Identities = 156/464 (33%), Positives = 238/464 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDV-----------QPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           M+  +K KI ATLGP+ T             +  VI         LFDAG +V R NFSHG +E+   R + VR+V  E G  I+ + D +GP++R+   +  +V + +                    VLDS  T   AK V             G ++ +DDGK++L + S  V  G I T   N   L + K +N+PD+   IP +++KDR D+ FA++   D+IA SFV    ++ E ++++    G    ++SKIE    ++ L++I+  SD++MVARGDLG+E+P   VP  +K I++ CR  GK +++ATQML+S+     PTRAE +DV  A+  G D  MLS E+ANG +P+ AV +M +I    EN   Y   ID    E P        L+T    + A  R +       +++    +    ++A     C API  +T   E A R  + +GV   V  +V+
  S:     1 MRRQRKAKIVATLGPAST-------------DIAVIRQ-------LFDAGADVFRLNFSHGTHEDHRARYDAVRQVEAETGRPIAILADLQGPKLRIGTFAAGKVAVSAGDTF----------------VLDSDPTPGDAKRVYLPHPELFKAANAGQSLLIDDGKVRLNIES--VASGSITTRVANNGTLSDRKGVNVPDAVIPIPALTEKDRKDLAFALELGADWIALSFVQRPSDILEARELIGTRAG----VLSKIEKPAALQQLEEIVRVSDAVMVARGDLGVELPPERVPGVQKRILRICRQLGKPIVIATQMLESMIDSPVPTRAEASDVASAIYDGADAVMLSAESANGRHPVAAVSIMNRIITEVENDPLYRNMIDAQ-HEAP--------LSTRQDAICAALREVTQIIGAKATVTYTSSGATALRAARERPC-APIVSITPNLEIARRLAITWGVHSTVSPDVQ 423
>gi|15229214|ref|NP_187055.1| pyruvate kinase, putative [Arabidopsis thaliana] >gi|6223649|gb|AAF05863.1|AC011698_14 putative pyruvate kinase [Arabidopsis thaliana] >gi|91806377|gb|ABE65916.1| pyruvate kinase [Arabidopsis thaliana] (510 aa)
Score = 569, Expect = 2.0e-56, Identities = 137/364 (37%), Positives = 204/364 (56%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDII-FAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY 369
           KTKI  TLGP+                   +E  +K    L  AG+NV RFNFSHG +      L+ +R   +   +  + MLDTKGPEIR  +    K VE+    ++ I T     G S   S+        +A+D++ G+ I   DG + L V+S +   G++     N+ +L E K +NLP     +P +++KD+ DI+ + + NK D IA SFV  G ++ E++K+L E+  + I ++SK+E   G+ + D I++ SD+ MVARGDLG+E+P   +   +K +I+     GK ++ ATQML+S+    +PTRAE TDV  AV  GTDC MLSGETA G +P  AV  M++I   +E+F DY
  S:    17 KTKIVCTLGPASRS----------------VEMVEK----LLKAGMNVARFNFSHGSHSYHQETLDNLRTAMENTCIPCAVMLDTKGPEIRTGFLKEGKPVELIQGQEITISTDYTMEGDSNTISM----SYKKLAEDLKSGDVILCSDGTISLTVLSCDKNLGLVRARCENSAVLGERKNVNLPGIVVDLPTLTEKDQEDILQWGVPNKIDIIALSFVRKGSDLVEVRKLLGENA-KSIMLMSKVENQEGVMNFDKILEYSDAFMVARGDLGMEIPIEKMFLAQKMMIQKANALGKPIVTATQMLESMTKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAHPETAVLTMSRICKEAEDFIDY 357
>gi|194537673|ref|YP_002072813.1| pyruvate kinase II [Vibrio cholerae V51] >gi|125622286|gb|EAZ50607.1| pyruvate kinase II [Vibrio cholerae V51] (486 aa)
Score = 569, Expect = 2.1e-56, Identities = 133/354 (37%), Positives = 203/354 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+   +E  +++ + D+ +      ++ GT E+   LD      +  D++ GN + +DDG+++LEV + + +  ++ TIA N+  L   K INL     S P +++KD+ DII A + + D++A SF    +++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P+ +K +I   +H GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G YP+ AV+ M +I
  S:     3 KTKIVATLGPA--------------------SQTRETLTQLIQAGVNVVRLNFSHGSSEEHIARAEMVREIAQQLNVSVGVLVDLQGPKIRIACFAEGAIQLSAGDTFILDGHLDRQAGTQERVG-LDYP---ELIDDLKVGNILLLDDGRIQLEVTAVDTQTRLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDIITAAELQADFLAVSFPRNAEDI-EYARQLAVQAGCHAHIVAKVERAEVVASEEAMDRVIRASDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVLDVANAVIDGTDAIMLSAESAAGRYPVEAVQAMVRI 335
>gi|169829562|ref|YP_001699720.1| pyruvate kinase [Lysinibacillus sphaericus C3-41] >gi|168994050|gb|ACA41590.1| pyruvate kinase [Lysinibacillus sphaericus C3-41] (510 aa)
Score = 569, Expect = 2.2e-56, Identities = 137/352 (38%), Positives = 204/352 (57%)
  Q:   104 EVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY-NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPF-MKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           E+ + +   + I  T+ E GT   FSV     TY  + +DV+  + I +DDG ++L V++++VE+G+I TI  N  +L+  K +N+P  +  +P +++KD  DI+F I+   D+IAASFV    +V EI+++L+++GG HIQII KIE   G+ ++D+II  SD +MVARGDLG+E+P  +VP  +K +I  C   GK VI ATQMLDS++   +PTRAE +DV  A+  GTD  MLSGETA G+YP+ +V+ M KI   +EN  DY   +    +E    M E +       +  +  K V+        +    GN  R+I   +  R   PI  VT     A    L +GV
  S:     5 ELHLTAGQVIDISMTEVE-GTETSFSV-----TYEQLVEDVEQNSIILLDDGLIQLRVLATDVEKGLIHTIVENAGVLKNKKGVNVPGVSVQLPGITEKDAQDILFGIEQGVDFIAASFVRRAKDVLEIRELLEQNGGGHIQIIPKIENQEGVDNIDEIILVSDGLMVARGDLGVEIPAEEVPLVQKKLILKCNQVGKPVITATQMLDSMQRNPRPTRAEASDVANAIIDGTDAIMLSGETAAGLYPVESVQTMNKIAQRTENSLDYKSIVSTRSREKEANMTEAISQAVAYTSINLGVKAVL--------APTESGNTARMI---AKYRPGVPIVAVTGSTNTAQTLTLVWGV 341
>gi|194536657|ref|YP_002071814.1| pyruvate kinase II [Vibrio cholerae RC385] >gi|150421451|gb|EDN13732.1| pyruvate kinase II [Vibrio cholerae RC385] (486 aa)
Score = 569, Expect = 2.3e-56, Identities = 133/354 (37%), Positives = 202/354 (57%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKS-DSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKS---LDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI 359
           KTKI ATLGP+                       ++ L  L  AGVNVVR NFSHG  EE   R  +VRE+A++  V++  ++D +GP+IR+   +E  +++ + D+ +       + GT E+   LD      +  D++ GN + +DDG+++LEV + + +  ++ TIA N+  L   K INL     S P +++KD+ DII A + + D++A SF    +++ E  + L    G H  I++K+E    + S   +D +I  SD IMVARGDLG+E+    +P+ +K +I   +H GK VI ATQM++S+     PTRAEV DV  AV  GTD  MLS E+A G YP+ AV+ M +I
  S:     3 KTKIVATLGPA--------------------SQTRETLTQLIQAGVNVVRLNFSHGSAEEHIARAEMVREIAQQLNVSVGVLVDLQGPKIRIACFAEGAIQLSAGDTFILDGHLDGQAGTQERVG-LDYP---ELIDDLKVGNILLLDDGRIQLEVTAVDTQARLVHTIALNSGKLSNRKGINLLGGGLSAPALTEKDKLDIITAAELQADFLAVSFPRNAEDI-EYARQLATQAGCHAHIVAKVERAEVVASEEAMDSVIRASDVIMVARGDLGVEIGDARLPSVQKALIARAKHLGKPVITATQMMESMIENPLPTRAEVLDVANAVIDGTDAIMLSAESAAGRYPVEAVQAMVRI 335
>gi|87124415|ref|ZP_01080264.1| Pyruvate kinase [Synechococcus sp. RS9917] >gi|86167987|gb|EAQ69245.1| Pyruvate kinase [Synechococcus sp. RS9917] (588 aa)
Score = 569, Expect = 2.4e-56, Identities = 145/455 (31%), Positives = 238/455 (52%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-GRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           + + ++TKI AT+GP+             PE           +  L  AG    R NFSHGD+ E   R+  +R+VA E   +I  + D +GP+IR+ + +   + +       +  T + +   ++ +    T TY+ +A +V  G+ I +DDG+++++V   +  E  +        +L  NK +N PD   S+  +++KDR D+ F ++   D++A SFV    +++EI++++++HG     +++KIE    I  +D I+   D +MVARGDLG+E+P  +VP  +K +I+     G  +I ATQMLDS+ +  +PTRAEV+DV  A+  GTD  MLS ETA G YPI AVE MA I    E   DY  R+ID +   T  +   + +  +TIA+ +           + ++I+           +S  R AAPI  +T +   A +  L +GV
  S:     4 IDLTRRTKIVATIGPAT----------ESPER----------IRELIQAGATTFRLNFSHGDHSEHATRIATIRQVASELSQHIGILQDLQGPKIRLGRFALGPITLAKGDAFAL--TSRSVSCDQQIA----TVTYDKLAAEVSAGSRILLDDGRVEMKVERVDQAEQTLHCTVTVGGVLSNNKGVNFPDVQLSVRALTEKDRIDLAFGLQQGVDWVALSFVRNPSDMQEIRELIRQHGFS-TPVVAKIEKFEAIDQIDAILPLCDGVMVARGDLGVEMPAEEVPLLQKELIQKANSLGIPIITATQMLDSMASSPRPTRAEVSDVANAILDGTDAVMLSNETAVGDYPIEAVETMATIARRIER--DYPQRSIDSHLPST--IPNAISSAVSTIASQL-----------NAAAILPLTKSGATAHNVSKFRPAAPILAITSEVAVARKLQLVWGV 418
>gi|89889947|ref|ZP_01201458.1| pyruvate kinase [Flavobacteria bacterium BBFL7] >gi|89518220|gb|EAS20876.1| pyruvate kinase [Flavobacteria bacterium BBFL7] (476 aa)
Score = 568, Expect = 2.7e-56, Identities = 134/365 (36%), Positives = 209/365 (57%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           M   KKTKI ATLGP+ +                    +K+ L  +  AGVNV R NFSH D+E+   R+ ++R++ +E G     + D +GP++RV    E EV +     + I T +   GT+E+  +       +  +DV+ G  I +DDGKL  EV+S++  + ++  + +    LR  K +NLP ++ S+P +++KD  D IFA + + D++A SFV    ++ E++ ++KEH    I II+KIE    + ++D I+   D +MVARGDLG+EVP ++VP  +K ++   +     VI+ATQM++++ T + PTRAEV DV  +V  G D  MLSGET+ G YPI  +E M  I +S EN
  S:     1 MPKTKKTKIVATLGPATS--------------------SKEVLLGMMKAGVNVFRINFSHADHEDVKERVQMIRDLNEEHGFATGILGDLQGPKLRVGVMKE-EVVVNPGDIITISTGEPFKGTAERVYM----NYEHFPRDVKAGERILLDDGKLMFEVVSTDGVKDVVTKVIQGG-PLRSKKGVNLPQTDISLPALTEKDVVDAIFACELQVDWMALSFVRHSRDLMELQDLIKEHSEHKIPIIAKIEKPEAVTNIDKIVAYCDGLMVARGDLGVEVPAHEVPLIQKQLVLKAKQARIPVIIATQMMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGQYPIQVIEKMTSICLSVEN 339
>gi|15618021|ref|NP_224305.1| pyruvate kinase [Chlamydophila pneumoniae CWL029] >gi|16752947|ref|NP_445219.1| pyruvate kinase [Chlamydophila pneumoniae AR39] >gi|33241432|ref|NP_876373.1| pyruvate kinase [Chlamydophila pneumoniae TW-183] >gi|13629390|sp|Q9Z984|KPYK_CHLPN Pyruvate kinase (PK) >gi|4376358|gb|AAD18250.1| Pyruvate Kinase [Chlamydophila pneumoniae CWL029] >gi|7189591|gb|AAF38488.1| pyruvate kinase [Chlamydophila pneumoniae AR39] >gi|33235940|gb|AAP98030.1| pyruvate kinase [Chlamydophila pneumoniae TW-183] (484 aa)
Score = 568, Expect = 2.7e-56, Identities = 143/465 (30%), Positives = 244/465 (52%)
  Q:     3 MIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDV-----YFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAI 467
           MI +TKI  T+GP+           N PE           LA L DAG+NV R NFSHG +E     +  ++E+ ++K V ++ MLDTKGPEIR+    +  + +    K+R+ ++  + G++E    L   G +     V  G  + +DDG +   V+SS  +   +E +  N+ +L+ +K +++   + ++PFM++KD  D+ F ++   D +AASFV  G+++  ++K L + G   + II+KIE   G+++   I   +D IM+ARGDLG+E+   +VP  +K + K  R  G   + ATQML+S+   + PTRAEV+D+  A+  G+   MLSGETA+G +P+ AV++M  + + +E    +   + +       + +P++       A  +A +   +R       D  +++V+         LS  R   PI  VT       R  L +GV+  +    + A+
  S:     1 MITRTKIICTIGPAT----------NSPEM----------LAKLLDAGMNVARLNFSHGSHETHGQAIGFLKELREQKRVPLAIMLDTKGPEIRLGNIPQP-ISVSQGQKLRLVSSDID-GSAEGGVSLYPKGIFPF---VPEGADVLIDDGYIHAVVVSSEADSLELEFM--NSGLLKSHKSLSIRGVDVALPFMTEKDIADLKFGVEQNMDVVAASFVRYGEDIETMRKCLADLGNPKMPIIAKIENRLGVENFSKIAKLADGIMIARGDLGIELSVVEVPNLQKMMAKVSRETGHFCVTATQMLESMIRNVLPTRAEVSDIANAIYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLSHDSFLKLDDSNSALQVSPYLS------AIGLAGIQIAERA------DAKALIVYTESGSSPMFLSKYRPKFPIIAVTPSTSVYYRLALEWGVYPMLTQESDRAV 431
>gi|45188241|ref|NP_984464.1| ADR368Wp [Ashbya gossypii ATCC 10895] >gi|54036120|sp|Q759A9|KPYK_ASHGO Pyruvate kinase (PK) >gi|44983085|gb|AAS52288.1| ADR368Wp [Ashbya gossypii ATCC 10895] (501 aa)
Score = 568, Expect = 2.8e-56, Identities = 162/453 (35%), Positives = 237/453 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTS--EKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVF---GNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           +++T I  T+GP            N PE           L  L  AG+N+VR NFSHG YE  Q++  N  +      G  ++  LDTKGPEIR   T +        +   I+TT  +   S  +K   +D     N+ K ++ G  I+VDDG L  EV+   V++  ++  + N   +  +K +NLP ++  +P +S+KD++D+ F +KN    + ASF+ T  ++  I++IL E G + I+II+KIE   G+ + D+I+  +D +MVARGDLG+E+P   V   +K +I  C   GK VI ATQML+S+    +PTRAEV+DV  AV  G DC MLSGETA G+YPINAV+ MA+  + +E    Y    D     TP       T+A         ++          +IVV    G+ TRL+   S  +   PI  VT     A    L+ GVF
  S:    19 LRRTSIIGTIGPKT----------NNPET----------LVELRKAGLNIVRMNFSHGSYEYHQSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTVDNVDYPIPPNHEMIFTTDDQYAKSCDDKVMFVDYK---NITKVIEKGRVIYVDDGVLSFEVLEV-VDDKTLKVKSLNAGKICSHKGVNLPGTDVDLPALSEKDKSDLRFGVKNGVHMVFASFIRTAGDILTIREILGEDGKD-IKIIAKIENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPQVFAVQKMLIAKCNLAGKPVICATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGIYPINAVKTMAETALIAEQAIPYVPTYDDLRNLTPKPTPTSETIAAAAVAATFEQKA--------KAIVVLSTSGDTTRLV---SKYKPNVPIVMVTRNPRAARYCHLHRGVF 441
>gi|163795210|ref|ZP_02189178.1| Pyruvate kinase [alpha proteobacterium BAL199] >gi|159179608|gb|EDP64137.1| Pyruvate kinase [alpha proteobacterium BAL199] (471 aa)
Score = 568, Expect = 2.9e-56, Identities = 147/455 (32%), Positives = 232/455 (50%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           M+  + TKI ATLGP+                     +++ ++ ALF+AGV+V RFNFSHG + +   R ++VR +  E G  IS M D +GP++RV    +  V++++    R+  T    GT+++ ++        + K + PG  + +DDGK++L V+     +G  +T       L + K +N+P++   +  ++DKDR D+ FA+    D+IA SFV   ++V E ++++         ++ K+E    I  L+ I++ +D++MVARGDLG+E+P   VP+ +K II+ CR  GK VIVATQMLDS+     PTRAE +DV  AV    D  MLS ETA G YP+ AV +M KI  + E         D Y+      +        + A  +A + V +    D   I+ +          S  R   PI  +T     A R  + +GV
  S:     1 MRRYRYTKIVATLGPA--------------------SSSEASIRALFEAGVDVFRFNFSHGSHADHQERFDIVRRLEAEAGRPISVMADLQGPKLRVGTFPDGPVKLEAGGTFRLELTDAP-GTAKRATLPHP----EIFKAIGPGTDLLLDDGKIRLRVVKCG--KGYADTEIITGGPLSDRKGVNVPNAVLPLSALTDKDRKDLRFALDMGADWIALSFVQRPEDVSEARRLIAGRAA----VLVKLEKPAAIDELEAIVEIADAVMVARGDLGVELPPERVPSLQKRIIRTCRALGKPVIVATQMLDSMVHSPAPTRAEASDVATAVYDSADAVMLSAETAAGDYPVEAVTMMNKIIQNVEG--------DSYYLAHAHAEHPTPEGTVSDAITLAAREVAE--AIDARCIITYTTSGSTTLRASRERPTVPILCITSSLSTARRLAMAWGV 414
>gi|124025674|ref|YP_001014790.1| pyruvate kinase [Prochlorococcus marinus str. NATL1A] >gi|123960742|gb|ABM75525.1| Pyruvate kinase [Prochlorococcus marinus str. NATL1A] (485 aa)
Score = 568, Expect = 2.9e-56, Identities = 153/478 (32%), Positives = 256/478 (53%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYN-MAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDY-GRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAIN 478
           + + ++TKI AT+GP+                    E+A + ++ L +AG    R NFSHGD+EE   R+  +R+V+ + G++I  + D +GP+IR+ +     V +K+  K  I T+K      ++ +V     TY+ +A++V  GN I +DDG+++++V   +++E  +        +L  NK +N PD   SI  ++DKD+ D+ F +K   D++A SFV    ++ EIK +++ HG +   +++KIE    I  +D ++   D +MVARGDLG+E+P  +VP  +K +IK     G  +I ATQMLDS+ +  +PTRAEV+DV  A+  GTD  MLS ETA G YPI AV  MA I    E   DY  +A++ +   T  +   +    ++IA  +           + ++I+         + +S  R   P+  VT++K  A+   L +GV   +++N     +     +DA+N
  S:     4 LDLARRTKIVATIGPAT-------------------ESASQ-ISKLVEAGATTFRLNFSHGDHEEHAQRIKTIRKVSDDLGIHIGILQDLQGPKIRLGRFKNGPVNVKNGDKF-ILTSKNIECNQDQANV-----TYDKLAEEVNVGNRILLDDGRVEMKVEEVDIKEQRLICSITVGGVLSNNKGVNFPDVQLSIRALTDKDKKDLAFGLKQGVDWVALSFVRNPSDLIEIKDLIRNHGYD-TPVVAKIEKFEAIDQIDAVLKLCDGVMVARGDLGVEMPAEEVPLLQKQLIKKANSLGIPIITATQMLDSMASSPRPTRAEVSDVANAILDGTDAVMLSNETAVGDYPIEAVATMATIAKRIER--DYPQKALESHLPST--IPNAISAAVSSIARQI-----------NAAAIIPLTKSGATAKNVSKFRPPTPVLAVTNEKSVASTLQLVWGVTPLLIEN---QTSTSKTFVDAMN 438
>gi|113869539|ref|YP_728028.1| pyruvate kinase [Ralstonia eutropha H16] >gi|113528315|emb|CAJ94660.1| pyruvate kinase [Ralstonia eutropha H16] (487 aa)
Score = 568, Expect = 3.0e-56, Identities = 155/464 (33%), Positives = 237/464 (51%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTY----NMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           M+  +K KI ATLGP+ T             +  VI         LF+AG +V R NFSHG +E+   R + VR++  E G  I+ + D +GP++R+   +  +V +++   V +  +    G        D T  Y     +    QPG ++ +DDGK++L +    V  G I T   N   L + K +N+PD+   IP +++KDR D+ FA+    D+I  SFV    ++ E ++I+    G    I+SKIE    ++ L++I+  SDS+MVARGDLG+E+P   VP  +K I++ CR  GK V++ATQML+S+     PTRAE +DV  A+  G D  MLS E+ANG YP+ AV +M +I    E    Y   +D    ETP        L T    + A  R +       +++    +    ++A     C API  +T   E A R  + +GV   V  +V+
  S:     1 MRRQRKAKIVATLGPAST-------------DIAVIRE-------LFEAGADVFRLNFSHGTHEDHRARYDAVRKIEAETGRPIAILADLQGPKLRIGTFAAGKVAVRA-GDVFVLDSDPTPG--------DGTRVYLPHPELFAAAQPGQSLLIDDGKVRLSI--EAVTTGTITTRVVNNGTLSDRKGVNVPDAVIPIPALTEKDRKDLDFALSLGADWIGLSFVQRPSDIVEAREIVGTRAG----ILSKIEKPAALQQLEEIVRVSDSVMVARGDLGVELPPERVPGVQKRILRVCRQLGKPVVIATQMLESMIDSPVPTRAEASDVASAIYEGADAVMLSAESANGRYPVPAVSMMNRIVTEVERDPLYRNLLDAQ-HETP--------LNTRQDAICAALREVTQIIGAVATVTYTSSGATALRAARERPC-APIVSITPNLEIARRLAIAWGVHSTVSPDVQ 423
>gi|19115258|ref|NP_594346.1| pyruvate kinase (predicted) [Schizosaccharomyces pombe] >gi|1730066|sp|Q10208|KPYK_SCHPO Pyruvate kinase (PK) >gi|1184023|emb|CAA93349.1| pyruvate kinase (predicted) [Schizosaccharomyces pombe] (509 aa)
Score = 567, Expect = 3.4e-56, Identities = 154/416 (37%), Positives = 220/416 (52%)
  Q:    41 KNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGT--SEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           + L  L DAG+N+VR NFSHG YE  Q++  N  +  A      ++  LDTKGPEIR   T        S     I+TT        ++K   +D     N+ K +QPG  I+VDDG L   VI   V++  ++    N   +   K +NLP ++  +P +S+KD+ D+ F +KN  D I ASF+   ++V  I+++L E G ++I+II KIE   G+ + D I+D +D IMVARGDLG+E+P   V   +K +I  C   GK V  ATQML+S+    +PTRAEV+DV  AV  G D  MLSGET  G YP+ AV  MA+    +E    YG      ++E   +  +    AT    + A    I++   D  +IVV        +  S  R + PI  VT   + A +  LN GV+
  S:    42 ETLCKLRDAGMNIVRMNFSHGSYEYHQSVIDNARKASATNPLFPLAIALDTKGPEIRTGLTVGGTDYPISSGHEMIFTTDDAYAEKCNDKVMYIDYK---NITKVIQPGRIIYVDDGILSFTVIE-KVDDKNLKVRVNNNGKISSKKGVNLPKTDVDLPALSEKDKADLRFGVKNGVDMIFASFIRRAEDVIHIREVLGEEG-KNIKIICKIENQQGVNNFDSILDVTDGIMVARGDLGIEIPASQVFVAQKMMIAKCNIAGKPVACATQMLESMTYNPRPTRAEVSDVGNAVLDGADLVMLSGETTKGSYPVEAVTYMAETARVAEASIPYGS----LYQEMFGLVRRPLECATETTAVAAIGASIES---DAKAIVVLSTSGNTARLCSKYRPSIPIVMVTRCPQRARQSHLNRGVY 448
>gi|24648966|ref|NP_651030.1| CG7069 CG7069-PA [Drosophila melanogaster] >gi|10726696|gb|AAF55980.2| CG7069-PA [Drosophila melanogaster] (744 aa)
Score = 567, Expect = 3.6e-56, Identities = 155/442 (35%), Positives = 243/442 (54%)
  Q:    51 VNVVRFNFSHGDYEEQTIRLNLVREV----AKEKGV--NISTMLDTKGPEIRVYKTS----EKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVD-------NVEHAIANKTEIIDAINSQLPEVKKTVVVIN 492
           + VVR NFSHG +E     +   R+      ++ G+   ++  LDTKGPEIR  K +      E+E+K+  KV + T K+    S K ++        + + V+PGN +FVDDG + L V  S  +E I +    N   L  +K INLP     +P +++KD+ D+ F  + K D I ASF+   + ++EI+++L    G  I+IISKIE   G+ ++DDII ESD IMVARGD+G+E+P  DVP  +K I+  C   GK VI ATQM++S+  K +PTRAE +DV  A+  G D  MLSGETA G YP+  V+ MA+I    E    Y    +   +E   ++       + + T +A    +        +IVV    + + Q +S++R   PI  +T  +  A +  L  G++  +V+       N    + +  +++  ++   P  K +VV++N
  S:     1 MRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTLAIALDTKGPEIRTGKLAGGNDRAEIELKTGDKVTLSTKKEMADKSNKDNIY--VDYQRLPQLVKPGNRVFVDDGLIALIVKESKGDEVICQV--ENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDMIFASFIRDANALKEIRQVLGP-AGACIKIISKIENHQGLVNIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTNKPRPTRAEASDVANAIFDGCDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLKRE---IRTSAADHISAVTTAIAEAATVGQA----RAIVVASPCSMVAQMVSHMRPPCPIVMLTGNESEAAQSLLFRGIYPLLVEEMVIGSFNFRRIMQSGLKLMGKMDILEPGQKGSVVLVN 447
>gi|120437707|ref|YP_863393.1| pyruvate kinase [Gramella forsetii KT0803] >gi|117579857|emb|CAL68326.1| pyruvate kinase [Gramella forsetii KT0803] (476 aa)
Score = 567, Expect = 3.9e-56, Identities = 135/365 (36%), Positives = 211/365 (57%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEK-FSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           M   KKTKI ATLGP+ +                    +K  L  +   GVNV R NFSH +Y++   R+ ++RE+ +E G N + + D +GP++RV    E EV +     +   T K+  GT+E+ +   DS       KDV+ G  I +DDGKL  EV+ +N ++ +   + +    L+  K +NLP++N S+P +++KD  D IFA +   D++A SFV   +++ E++ I+K+H    I I++KIE   G+ ++D I+   D +MVARGDLG+E+P  +VP  +K ++   +     VI+ATQM++++ T + PTRAEV DV  +V  G D  MLSGET+ G YP+  ++ MA+I  S EN
  S:     1 MPTNKKTKIVATLGPATS--------------------SKDILKKMLQEGVNVFRINFSHANYDDVRERIKMIRELNEEDGFNAAILGDLQGPKLRVGVMKE-EVVVNEGDHIVFATGKEFKGTAERVYMNYDS-----FPKDVKAGERILLDDGKLIFEVVKTNKKDEVKTKVIQGG-PLKSKKGVNLPNTNISLPALTEKDVKDAIFACEMGVDWMALSFVRHAEDLIELQNIIKQHSKYKIPIVAKIEKPEGVANIDKIVAYCDGLMVARGDLGVEIPAQEVPLIQKKLVLTAKKARIPVIIATQMMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGQYPVQVIQKMAQILQSVEN 339
>gi|126662620|ref|ZP_01733619.1| pyruvate kinase I [Flavobacteria bacterium BAL38] >gi|126625999|gb|EAZ96688.1| pyruvate kinase I [Flavobacteria bacterium BAL38] (476 aa)
Score = 567, Expect = 4.3e-56, Identities = 138/365 (37%), Positives = 205/365 (56%)
  Q:     1 MKMIKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           M   KKTKI ATLGP+ +                     K+ +  + DAGVNV R NFSH DY + + R+ ++RE+  E G   S + D +GP++RV    E  V  K D K+   T +  +GT+ +  +          KDV PG  I +DDGKL  EV  ++ +   +E +      L+  K +NLP++  S+P +++KD  D  FAI+N+ D+IA SFV T  ++ +++ ++ EH    I II+KIE    + ++D I+   D +MVARGDLG+EVP  +VP  +K +I   +     VIVATQM++++ T + PTRAEV DV  +V  G D  MLSGET+ G YP+  +E M +I  S E+
  S:     1 MPTNKKTKIVATLGPACS--------------------TKEVIKNMIDAGVNVFRINFSHADYTDVSERIKIIRELNDEYGYTTSILGDLQGPKLRVGVMKEDVVVSKGD-KITFTTAEDILGTASRVYM----NYKEFPKDVNPGERILLDDGKLIFEVTKTD-KNTEVEAVVVQGGPLKSKKGVNLPNTKVSLPALTEKDIRDAKFAIENQVDWIALSFVRTSQDLEDLQDLISEHSDHKIPIIAKIEKPEAVANIDKIVAFCDGLMVARGDLGVEVPAEEVPLIQKKLIHRAKTARIPVIVATQMMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGNYPVEVIETMTRIIESVED 339
>gi|91776596|ref|YP_546352.1| pyruvate kinase [Methylobacillus flagellatus KT] >gi|91710583|gb|ABE50511.1| pyruvate kinase [Methylobacillus flagellatus KT] (480 aa)
Score = 566, Expect = 4.3e-56, Identities = 149/453 (32%), Positives = 237/453 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           ++KTKI ATLGP+ +              + VIE        L DAG++VVR NFSHG  ++   R  LVR++++  G  +  + D +GP+IR+ K     + +K+  +  I     ++G  E+  +   T    +  +V+PG  + +DDG++ L V + N   G +        +L  NK IN      S P ++ KD+ DI  A+  + DYIA SF  +G ++   + +++E GG H  I++KIE    I +L++IID +D IMVARGDLG+EV    VP  +K +I+  R + K VI ATQML+S+ +   PTRAEV+DV  AV  GTD  MLSGETA G YP+ +++ M ++ + +E  +D          E  F+ E     A  +A++ A + +      +  +I         +  LS      PI+ +T +++   +  L  GV+
  S:     3 LRKTKIVATLGPASS-------------EEAVIER-------LVDAGMDVVRLNFSHGSAQDHIARAELVRDISRRSGRPVGVLCDLQGPKIRIGKFENDRILLKAGDRF-ILDAACKLGNQERVGLDYKT----LPSEVEPGAVLLLDDGRIVLNVEAVN--GGEVHCTVAAGGVLSNNKGINRKGGGLSAPALTLKDQEDIRTAVALEADYIAVSFPRSGADIELARHLVREAGG-HAAIVAKIERAEAIDALEEIIDAADVIMVARGDLGVEVGDAAVPGLQKRMIRTARMRNKLVITATQMLESMISSPIPTRAEVSDVANAVLDGTDAVMLSGETAVGHYPVESIQAMHRVCLEAEKEYDSHHLQAPINDEFEFIDE-----AIAMASVYAAEHL------NVKAIAALTKSGSSVTWLSRSNTNVPIYALTTERDTRRKLTLYRGVY 416
>gi|126648062|ref|ZP_01720556.1| pyruvate kinase [Algoriphagus sp. PR1] >gi|126575655|gb|EAZ79965.1| pyruvate kinase [Algoriphagus sp. PR1] (476 aa)
Score = 566, Expect = 4.4e-56, Identities = 152/450 (33%), Positives = 245/450 (54%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSE-NFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           KTKI AT+GP+                        + +++L  AG NV R NFSHG ++     + ++R++ KE+ +N+  + D +GP+IRV +     VEIK   K+ I T    +GTS     L ST   N+ +DV  G+ I +DDG L  EV+ ++ +   +     +  IL+  K INLP++  S P +++KD  D+ F +  + D+IA SFV + +++ ++++ + E  G+H +I++KIE    ++++D II+ +D+IMVARGDLG+EVP   VP ++K I++ C+   K VI+ATQM++S+    +PTRAE  DV  AV  G D  MLS ETA+G YP+NAV+ M+ I    E N   Y     +   +  F+   +  +A+ ++  V  K ++   G   S    F         +++ R  A IF  T  K   T+  L +G+
  S:     8 KTKILATIGPA--------------------SNNYETISSLAAAGANVFRLNFSHGSHDIHQEVIEIIRKINKEQNLNLGILQDLQGPKIRVGEVENNGVEIKPGEKITI-TNDPVVGTS----TLVSTVYQNLPQDVVSGDRILIDDGNL--EVVVNDTDGKNVNCTVIHGGILKSRKGINLPNTKVSAPSLTEKDIEDLAFGLSKEVDWIALSFVRSAEDIEDLRERI-EAKGKHCKIVAKIEKPEALENIDGIIEATDAIMVARGDLGVEVPMEIVPLWQKRIVEKCKLACKPVIIATQMMESMIVNPRPTRAETNDVANAVLDGADAVMLSAETASGKYPVNAVKAMSSIIGYLEANAEIYHNLYKIPEDDDTFLSNNLILMASRLSRNVKAKAIV---GITSSGFTGF--------RIASHRPLANIFVFTSNKTLITQMSLVWGI 419
>gi|1200144|emb|CAA62490.1| pyruvate kinase [Schizosaccharomyces pombe] >gi|1586497|prf||2204219A pyruvate kinase (509 aa)
Score = 566, Expect = 4.6e-56, Identities = 154/416 (37%), Positives = 220/416 (52%)
  Q:    41 KNLAALFDAGVNVVRFNFSHGDYE-EQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGT--SEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVF 456
           + L  L DAG+N+VR NFSHG YE  Q++  N  +  A      ++  LDTKGPEIR   T        S     I+TT        ++K   +D     N+ K +QPG  I+VDDG L   VI   V++  ++    N   +   K +NLP ++  +P +S+KD+ D+ F +KN  D I ASF+   ++V  I+++L E G ++I+II KIE   G+ + D I+D +D IMVARGDLG+E+P   V   +K +I  C   GK V  ATQML+S+    +PTRAEV+DV  AV  G D  MLSGET  G YP+ AV  MA+    +E    YG      ++E   +  +    AT    + A    I++   D  +IVV        +  S  R + PI  VT   + A +  LN GV+
  S:    42 ETLCKLRDAGMNIVRMNFSHGSYEYHQSVIDNARKASATNPLFPLAIALDTKGPEIRTGLTVGGTDYPISSGHEMIFTTDDAYAEKCNDKVMYIDYK---NITKVIQPGRIIYVDDGILSFTVIE-KVDDKNLKVRVNNNGKISSKKGVNLPKTDVDLPALSEKDKADLRFGVKNGVDMIFASFIRRAEDVIHIREVLGEEG-KNIKIICKIENQQGVNNFDSILDVTDGIMVARGDLGIEIPASQVFVAQKMMIAKCNIAGKPVACATQMLESMTYNPRPTRAEVSDVGNAVLDGADLVMLSGETTKGSYPVEAVTYMAETARVAEASIPYGS----LYQEMFGLVRRPLECATETTRVAAIGASIES---DAKAIVVLSTSGNTARLCSKYRPSIPIVMVTRCPQRARQSHLNRGVY 448
>gi|172040841|ref|YP_001800555.1| hypothetical protein cu1161 [Corynebacterium urealyticum DSM 7109] >gi|171852145|emb|CAQ05121.1| unnamed protein product [Corynebacterium urealyticum DSM 7109] (465 aa)
Score = 566, Expect = 4.7e-56, Identities = 148/425 (34%), Positives = 230/425 (54%)
  Q:    40 KKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVE 464
           K ++  L DAG+NV R NFSHG++ +       VR+ + E G  +  + D +GP+IR+ + +E +    +   VRI     E GT ++ S    T    +A+D QPG+ + VDDGK+ L  I   VE+  +         +  NK ++LP  N S+P +S+KDR D+ FA+K   D+IA SFV +  +V  + +I+ E G   + +I+K+E    + +L+ II   D+IMVARGDLG+EVP  DVP  +K  I+  R   K VIVATQMLDS+    +PTRAE +DV  AV  G D  MLSGET+ G +PI  VE M++I V++E   D G        E P +  +  T    I+   A K + +    +  ++V F +     + ++ +R   P+   T  ++   +  L +G    + ++V+
  S:    11 KDSIRGLIDAGMNVARLNFSHGEHADHQQNYQWVRDASAETGKPVGILADLQGPKIRLGRFAEDKTYWATGETVRITVEDIE-GTHDRVS----TTYKGLARDAQPGDRLLVDDGKVAL--ICKAVEDDDVVCEVVEGGPVSNNKGVSLPGMNISVPALSEKDREDLRFALKMGVDFIALSFVRSPADVELVHEIMDEVG-RRVPVIAKLEKPEAVDALEPIILAFDAIMVARGDLGVEVPLEDVPLVQKRAIQIARENAKPVIVATQMLDSMIENSRPTRAEASDVANAVLDGADAVMLSGETSVGKHPIATVETMSRIVVAAE---DDG--------EAPPLTHRPRTRRGVIS--YAAKDIGER--LNARALVAFTSSGDTAKRVARLRSYLPLLVFTPSQDVRNQLSLTWGTETLLTNDVD 412
>gi|196183058|gb|EDX78042.1| pyruvate kinase [Microcoleus chthonoplastes PCC 7420] (477 aa)
Score = 566, Expect = 4.7e-56, Identities = 156/490 (31%), Positives = 252/490 (51%)
  Q:     6 KTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYS-IPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKI--DVSSE-NFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGVFVKVVDNVEHAIANKTEIIDAINSQLPEVKKTVVVINDSI 495
           +TKI AT+GP+           N P+           L  +  AG+NV R NFSHG Y++    ++L+R + +E    I+ + D +GP+IRV K  +  + +     + +     E     K   +D     ++A++ +PG  I +DDG L+L V   ++E   ++       IL+  K +NLP  + + +P M+DKD+ D+ F I    D+++ SFV + +++R +K  L++H    + +I+KIE    I +L+ II+ESD IMVARGDLG+E+    VP  +K II+ C  KG  VI ATQMLDS+    +PTRAE +DV  A+  GTD  MLSGE+A G YP+ AV ++A+I  DV  E  F +Y           P    +   L+  + T+        +   D   I  F +     +  +  R   P+  +T  ++      L +GV   +   +E  + +  E+++   +QL  +K+ +VV  D I
  S:     7 RTKIVATIGPAS----------NSPDV----------LKQMVQAGMNVARLNFSHGSYDDHAHTISLLRSIEEELDTPITLLQDLQGPKIRVGKLPDAGLNLVQGESISLVPVS-EFNHQPKTVAIDYP---HLAQEAEPGVQILLDDGLLELRV--EDIEGNTVKCQVVEGGILKSRKGVNLPGLSLNRLPSMTDKDKQDLEFGIAQGVDWVSLSFVRSAEDIRTLKGFLQQHNASSLPVIAKIEKPQAIANLEAIINESDGIMVARGDLGVEMSPEKVPFLQKKIIRICNQKGIPVITATQMLDSMINNPRPTRAEASDVANAIIDGTDAVMLSGESAVGKYPLKAVTMLARIATDVEPEIKFVNY----------PPAATNEANALSEALNTI--------DKILDLRCIAAFTSTGHTAKLAAAERPGVPVISLTPNRKVYHNLNLVWGVKPLL---LEQEVESFEELVNQAQTQL--LKRNLVVEGDKI 451
>gi|21220496|ref|NP_626275.1| pyruvate kinase [Streptomyces coelicolor A3(2)] >gi|5689907|emb|CAB52070.1| pyruvate kinase [Streptomyces coelicolor A3(2)] (478 aa)
Score = 566, Expect = 4.8e-56, Identities = 148/452 (32%), Positives = 236/452 (52%)
  Q:     4 IKKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRVYKTSEKEVEI-KSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSENFFDYGRAIDVYFKETPFMKEKVGTLATTIATLVAPKRVIDNHGFDYSSIVVFGNDTRLIQALSNIRCAAPIFFVTDKKEYATRFGLNYGV 455
           +++ KI  TLGP+                      +   +  L DAG+++ RFNFSHG + E   R + VR+ + E G ++  + D +GP+IR+    E  V + + DS    +T   E G      +  +T    +A+DV PG  + VDDGK+ LEV  + V+   + T      ++ ++K +NLP    S+P +S KD +D+ +A++  FD +A SFV +G ++ ++ +I+ E G   + +I+K+E    +++++DI+   D IMVARGDLG+E+P   VPT +K  +K  +   K VIVATQMLDS+    +PTRAE +DV  AV  GTD  MLSGET+ G +P + V  MA+I  ++E         D+  K  P + E+        A   A   + D  G  +  +V F      ++ LS  R   P+   T +    ++  L +GV
  S:     1 MRRAKIVCTLGPATD--------------------SYDQIKDLVDAGMDIARFNFSHGTHAEHEERYHRVRKASDETGRSVGALADLQGPKIRLGHFGEGPVLLERGDS----FTITVEEGVEGDRYICGTTYA-GLAEDVTPGERVLVDDGKVCLEV--TGVDGTRVRTRVIEGGMVSDHKGLNLPGVAVSVPALSKKDEDDLRWALRAGFDVVALSFVRSGRDILDVHRIMDEEG-RRLPVIAKVEKPQAVENIEDIVAAFDGIMVARGDLGVEMPLEQVPTVQKRAVKLAKRNAKPVIVATQMLDSMIDNARPTRAEASDVANAVIDGTDAVMLSGETSVGKHPTDTVRTMARIVEAAEE--------DILAKGLPPLTERNKPRTQGGAVARAAAEMGDFLGAKF--LVAFTQSGDTVRRLSRYRSPIPLLAFTPEPATRSQLSLTWGV 415
>gi|94971695|ref|YP_593743.1| pyruvate kinase [Acidobacteria bacterium Ellin345] >gi|94553745|gb|ABF43669.1| pyruvate kinase [Acidobacteria bacterium Ellin345] (509 aa)
Score = 565, Expect = 5.8e-56, Identities = 133/361 (36%), Positives = 212/361 (58%)
  Q:     5 KKTKITATLGPSITGKIFTLADFNKPENKGVIETAKKNLAALFDAGVNVVRFNFSHGDYEEQTIRLNLVREVAKEKGVNISTMLDTKGPEIRV-YKTSEKEVEIKSDSKVRIYTTKKEIGTSEKFSVLDSTGTYNMAKDVQPGNTIFVDDGKLKLEVISSNVEEGIIETIARNTWILRENKRINLPDSNYSIPFMSDKDRNDIIFAIKNKFDYIAASFVNTGDNVREIKKILKEHGGEHIQIISKIETMTGIKSLDDIIDESDSIMVARGDLGLEVPYYDVPTYEKYIIKDCRHKGKTVIVATQMLDSLETKIQPTRAEVTDVFFAVERGTDCTMLSGETANGMYPINAVEVMAKIDVSSEN 365
           ++ KI  T+GP+                       +  +  L  AG++V R NFSHG ++E  + +  +R+VA E+  +I  + D +GP+IR       K V +++ + V I T +  +G +     L +T    +A DVQPG+ I + DGK++L V  S +E   +E    N   L+E++ IN+P +  SIP +++KD  D+ F +KN  D +A SFV T +++++++  + EH G ++ +I+K+E    I+ L++I +E+D +MVARGDLG+EVP   VP  +K+IIK  + +   VI ATQML+S+    +PTRAE +DV  A+  GTD  MLSGETA+G YP  AV +MA+I   +E+
  S:    20 RRAKIVCTIGPACN--------------------TEAAMQELMRAGMDVARLNFSHGTHDEHLVVIQRLRKVAAEEQRSICILQDLQGPKIRTGLLKDHKPVMLETGNTVTI-TPRDIVGDAS----LLATTFQTLALDVQPGSRILLSDGKI