>gi|26553531|ref|NP_757465.1| DNA-directed RNA polymerase subunit beta [Mycoplasma penetrans HF-2] >gi|41017736|sp|Q8EWX1|RPOB_MYCPE DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|26453537|dbj|BAC43869.1| DNA-directed RNA polymerase subunit beta [Mycoplasma penetrans HF-2] (1375 aa)
Score = 6689, Expect = 0.0e+00, Identities = 1375/1375 (100%), Positives = 1375/1375 (100%)
  Q:     1 MSKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEEMDI 1375
           MSKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEEMDI
  S:     1 MSKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEEMDI 1375
>gi|31544417|ref|NP_852995.1| DNA-directed RNA polymerase subunit beta [Mycoplasma gallisepticum R] >gi|31541261|gb|AAP56563.1| RpoB [Mycoplasma gallisepticum R] (1396 aa)
Score = 3871, Expect = 0.0e+00, Identities = 805/1355 (59%), Positives = 1028/1355 (75%)
  Q:     6 FIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSS--DSNRSYGVDTKLRELFKKYSSLKSQ----LEAEGKNAEKQKELNE----VINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNL--DERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEP--------KKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANN-NNFKDINEYISNITNNA 1360
           F + + S  V+RRDYSK+   +N  NL  +Q NA+ +F++ ELE  I S FPIKS  G+YS+E+ GMK+  P+ +++EA  E KTYD  LYV+L++V++++G VKK +K S    S  +GI+FA IP++TE G FIVNGIEKFV++QIVRSPGAYIL KSQ+KLSNSRKR QEGYICE+ P+KGTL   ++AENKDF+Q + RD  GES     IT  LKA GL++ +I  IF N+  I  SL++E YNEK +    ++  L +++ S      +S  +D K + L   +  L  +    L +   N  K + LN     V+  +I EKAAK ++  LSIST+++D+  +   +E +YQSI+  HFF  K +DLS AGR K  RK+R+SERLYQR +A+D+KD++G VVIK+ TL+ K +LD  K+L+KE +L I+  ++    E  ++  +V  YE++ +Y +ND ++E   IIG D S +   TL+++D++SI SY++NL ++IG YDDIDHLGNKRLKLI+ELLK++ Q G++RIEK+I DKL  ADG NK  +Q  E +P           LTVKS+IN KPFQI  K+FFN+HQLTQFLDQQNPL+ELTNKRRISAMGPGGISREDPNLDIRDVHYSHYG+ICPIETPEGMNIGLIMSLA YA+ D+NGFL+TPY  V+NG ITD++  LTAL EDEYIIA   S ++V K+     +K++ RYRSS + +D K VD+ID+SPKQVVS+AAS IPFLENDD++RALMGANMQRQATPL+ P +P+VGTG EYKIA DSGM  +   +  GTV+YVD   I +K    +   Y L KF KSN+NTC NQ PIV+VG+K+     +ADGP+M NGELALGQNVLV FTTWSGYNYEDA+I+S RLF +D+++SIHI EY+++CL+TKNGDEEITRDIPN+SES+K+YLD+EG+IMVGAEVKEGD+LVGK SPKGQVELT EEKL+QAI GDK K  +E+SLKVP+GG+G VA +KRF + +  EL  DV+E +KVYVVQKRKIQIGDK+AGRHGNKGIISKIV  EDMPHLEDGT +DI+LNPLGVPSRMNIGQI ELHLG A ++L  +K++E  +DKK A      FG+ +  +++LIKNL + +    + SL Q        D+ + L + G++ + L +K ATPVFEGVN  DLK  M+EAGIDP      +   GKF LIDGRTGE F+  +SVGIMYMLKLDHMVDDKIH+RAVGPYSKITQQPLGGKSQNGGQRFGEMEVWAL+AYGAAHNLRE+LTIKSDDV+GRN TYNAI+KG  IPE G+PESFKLLTK+LQGLG+ +++  +     N NN   ++E +    ++A
  S:    13 FHNTQYSPKVVRRDYSKVHNKYNPLNLPGIQVNAYKQFLEKELEEIIGSYFPIKSPNGKYSVEFHGMKILDPQITKEEASAESKTYDASLYVNLSLVNHQTGTVKKISKKSA--KSKAEGIYFADIPLMTENGAFIVNGIEKFVVAQIVRSPGAYILNKSQVKLSNSRKRNQEGYICEVFPSKGTLMLFYIAENKDFVQAVVRDVGGESAKVFSITTLLKAFGLSEIKIKEIFNNNDYILRSLESEFYNEKQILNEADIAQLIRDIESDRISKVKSLPIDQKWKNLVLDWYKLNQEKQELLNSSNPNPTKIESLNTHIGVVLRKLICEKAAKHVIQELSISTRSLDNVSQ--KEEISYQSILLQHFFQKKRYDLSSAGRHKFVRKLRVSERLYQRTIAQDIKDLDGNVVIKQGTLMLKEQLDLFKRLSKEKRLDIIKQIDFINPELNTQFTDVNTYEEVQIYVNNDLRNETTQIIGIDGSNESIETLTLADLISIVSYIVNLPFNIGLYDDIDHLGNKRLKLINELLKSKVQTGMMRIEKYIKDKLQTADGNNKLADQDAENDPDSDLGTKSSNDLTVKSVINPKPFQIVIKDFFNTHQLTQFLDQQNPLSELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGRICPIETPEGMNIGLIMSLAFYATIDKNGFLMTPYLKVENGKITDKVEHLTALREDEYIIAEASSYMDVAKDGTINNEKIIARYRSSQDLYDPKQVDYIDVSPKQVVSVAASLIPFLENDDSSRALMGANMQRQATPLLKPYSPLVGTGVEYKIAQDSGM--LVTAKNPGTVTYVDASKITVKGEDNKSTDYNLLKFVKSNKNTCYNQSPIVAVGDKIETNQALADGPSMKNGELALGQNVLVGFTTWSGYNYEDAVIISDRLFKDDVYSSIHIDEYTIECLRTKNGDEEITRDIPNISESAKRYLDEEGVIMVGAEVKEGDILVGKTSPKGQVELTPEEKLIQAILGDKVKQVRESSLKVPNGGDGIVAGIKRFSIANGDELEDDVLELVKVYVVQKRKIQIGDKVAGRHGNKGIISKIVAQEDMPHLEDGTPLDILLNPLGVPSRMNIGQIFELHLGYAARELAKAKLIEACFDKKLADQLDTVFGLEKSKTQSLIKNLVEHMKSIGVTSLAQTKNRVRTIDIDIVLKQLGLTYDDLAFKIATPVFEGVNMEDLKAIMSEAGIDP------DKTEGKFKLIDGRTGEPFEKPISVGIMYMLKLDHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALQAYGAAHNLREILTIKSDDVRGRNMTYNAIVKGLSIPEPGVPESFKLLTKELQGLGMTLNVLYDDDSIENINNISVVDESLEPKIHDA 1381
>gi|33860205|sp|P47715|RPOB_MYCGA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1390 aa)
Score = 3867, Expect = 0.0e+00, Identities = 805/1355 (59%), Positives = 1028/1355 (75%)
  Q:     6 FIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSS--DSNRSYGVDTKLRELFKKYSSLKSQ----LEAEGKNAEKQKELNE----VINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNL--DERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEP--------KKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANN-NNFKDINEYISNITNNA 1360
           F + + S  V+RRDYSK+   +N  NL  +Q NA+ +F++ ELE  I S FPIKS  G+YS+E+ GMK+  P+ +++EA  E KTYD  LYV+L++V++++G VKK +K S    S  +GI+FA IP++TE G FIVNGIEKFV++QIVRSPGAYIL KSQ+KLSNSRKR QEGYICE+ P+KGTL   ++AENKDF+Q + RD  GES     IT  LKA GL++ +I  IF N+  I  SL++E YNEK +    ++  L +++ S      +S  +D K + L   +  L  +    L +   N  K + LN     V+  +I EKAAK ++  LSIST+++D+  +   +E +YQSI+  HFF  K +DLS AGR K  RK+R+SERLYQR +A+D+KD++G VVIK+ TL+ K +LD  K+L+KE +L I+  ++    E  ++  +V  YE++ +Y +ND ++E   IIG D S +   TL+++D++SI SY++NL ++IG YDDIDHLGNKRLKLI+ELLK++ Q G++RIEK+I DKL  ADG NK  +Q  E +P           LTVKS+IN KPFQI  K+FFN+HQLTQFLDQQNPL+ELTNKRRISAMGPGGISREDPNLDIRDVHYSHYG+ICPIETPEGMNIGLIMSLA YA+ D+NGFL+TPY  V+NG ITD++  LTAL EDEYIIA   S ++V K+     +K++ RYRSS + +D K VD+ID+SPKQVVS+AAS IPFLENDD++RALMGANMQRQATPL+ P +P+VGTG EYKIA DSGM  +   +  GTV+YVD   I +K    +   Y L KF KSN+NTC NQ PIV+VG+K+     +ADGP+M NGELALGQNVLV FTTWSGYNYEDA+I+S RLF +D+++SIHI EY+++CL+TKNGDEEITRDIPN+SES+K+YLD+EG+IMVGAEVKEGD+LVGK SPKGQVELT EEKL+QAI GDK K  +E+SLKVP+GG+G VA +KRF + +  EL  DV+E +KVYVVQKRKIQIGDK+AGRHGNKGIISKIV  EDMPHLEDGT +DI+LNPLGVPSRMNIGQI ELHLG A ++L  +K++E  +DKK A      FG+ +  +++LIKNL + +    + SL Q        D+ + L + G++ + L +K ATPVFEGVN  DLK  M+EAGIDP      +   GKF LIDGRTGE F+  +SVGIMYMLKLDHMVDDKIH+RAVGPYSKITQQPLGGKSQNGGQRFGEMEVWAL+AYGAAHNLRE+LTIKSDDV+GRN TYNAI+KG  IPE G+PESFKLLTK+LQGLG+ +++  +     N NN   ++E +    ++A
  S:     7 FHNTQYSPKVVRRDYSKVHNKYNPLNLPGIQVNAYKQFLEKELEEIIGSYFPIKSPNGKYSVEFHGMKILDPQITKEEASAESKTYDASLYVNLSLVNHQTGTVKKISKKSA--KSKAEGIYFADIPLMTENGAFIVNGIEKFVVAQIVRSPGAYILNKSQVKLSNSRKRNQEGYICEVFPSKGTLMLFYIAENKDFVQAVVRDVGGESAKVFSITTLLKAFGLSEIKIKEIFNNNDYILRSLESEFYNEKQILNEADIAQLIRDIESDRISKVKSLPIDQKWKNLVLDWYKLNQEKQELLNSSNPNPTKIESLNTHIGVVLRKLICEKAAKHVIQELSISTRSLDNVSQ--KEEISYQSILLQHFFQKKRYDLSSAGRHKFVRKLRVSERLYQRTIAQDIKDLDGNVVIKQGTLMLKEQLDLFKRLSKEKRLDIIKQIDFINPELNTQFTDVNTYEEVQIYVNNDLRNETTQIIGIDGSNESIETLTLADLISIVSYIVNLPFNIGLYDDIDHLGNKRLKLINELLKSKVQTGMMRIEKYIKDKLQTADGNNKLADQDAENDPDSDLGTKSSNDLTVKSVINPKPFQIVIKDFFNTHQLTQFLDQQNPLSELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGRICPIETPEGMNIGLIMSLAFYATIDKNGFLMTPYLKVENGKITDKVEHLTALREDEYIIAEASSYMDVAKDGTINNEKIIARYRSSQDLYDPKQVDYIDVSPKQVVSVAASLIPFLENDDSSRALMGANMQRQATPLLKPYSPLVGTGVEYKIAQDSGM--LVTAKNPGTVTYVDASKITVKGEDNKSTDYNLLKFVKSNKNTCYNQSPIVAVGDKIETNQALADGPSMKNGELALGQNVLVGFTTWSGYNYEDAVIISDRLFKDDVYSSIHIDEYTIECLRTKNGDEEITRDIPNISESAKRYLDEEGVIMVGAEVKEGDILVGKTSPKGQVELTPEEKLIQAILGDKVKQVRESSLKVPNGGDGIVAGIKRFSIANGDELEDDVLELVKVYVVQKRKIQIGDKVAGRHGNKGIISKIVAQEDMPHLEDGTPLDILLNPLGVPSRMNIGQIFELHLGYAARELAKAKLIEACFDKKLADQLDTVFGLEKSKTQSLIKNLVEHMKSIGVTSLAQTKNRVRTIDIDIVLKQLGLTYDDLAFKIATPVFEGVNMEDLKAIMSEAGIDP------DKTEGKFKLIDGRTGEPFEKPISVGIMYMLKLDHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALQAYGAAHNLREILTIKSDDVRGRNMTYNAIVKGLSIPEPGVPESFKLLTKELQGLGMTLNVLYDDDSIENINNISVVDESLEPKIHDA 1375
>gi|600226|gb|AAB40951.1| RNA polymerase beta subunit [Mycoplasma gallisepticum] (1390 aa)
Score = 3856, Expect = 0.0e+00, Identities = 802/1355 (59%), Positives = 1026/1355 (75%)
  Q:     6 FIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSS--DSNRSYGVDTKLRELFKKYSSLKSQ----LEAEGKNAEKQKELNE----VINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNL--DERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPK--------KSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANN-NNFKDINEYISNITNNA 1360
           F + + S  V+RRDYSK+   +N  NL  +Q NA+ +F++ ELE  I S FPIKS  G+YS+E+ GMK+  P+ +++EA  E KTYD  LYV+L++V++++G VKK +K S    S  +GI+FA IP++TE G FIVNGIEKFV++QIVRSPGAYIL KSQ+KLSNSRKR QEGYICE+ P+KGTL   ++AENKDF+Q + RD  GES     IT  LKA GL++ +I  IF N+  I  SL++E YNEK +    ++  L +++ S      +S  +D K + L   +  L  +    L +   N  K + LN     V+  +I EKAAK ++  LSIST+++D+  +   +E +YQSI+  HFF  K +DLS AGR K  RK+R+SERLYQR +A+D+KD++G VVIK+ TL+ K +LD  K+L+KE +L I+  ++    E  ++  +V  YE++ +Y +ND ++E   IIG D S +   TL+++D++SI SY++NL ++IG YDDIDHLGNKRLKLI+ELLK++ Q G++RIEK+I DKL  ADG NK  +Q  E +P           LTVKS+IN KPFQI  K+FFN+HQLTQFLDQQNPL+ELTNKRRISAMGPGGISREDPNLDIRDVHYSHYG+ICPIETPEGMNIGLIMSLA YA+ D+NGFL+TPY  V+NG ITD++  LTAL+EDEYIIA   S ++V K+     +K++ RYRSS + +D K VD+I +SPKQVVS+AAS IPFLENDD++RALMGANMQRQATPL+ P +P+VGTG EYKIA DSGM  +   +  GTV+YVD   I +K    +   Y L KF KSN+NTC NQ PIV+VG+K+     +ADGP+M NGELALGQNVLV FTTWSGYNYEDA+I+S RLF +D+++SIHI EY+++CL+TKNGDEEI RDIPN+SES+K+YLD+EG+IMVGAEVKEGD+LVGK SPKGQVELT EEKL+Q I GDK K  +E+SLKVP+GG+G VA +KRF + +  EL  DV+E +KVYVVQKRKIQIGDK+AGRHGNKGIISKIV  EDMPHLEDGT +DI+LNPLGVPSRMNIGQI ELHLG A ++L  +K++E  +DKK A      FG+ +  +++LIKNL + +    + SL Q        D+ + L + G++ + L +K ATPVFEGVN  DLK  M+EAGIDP      +   GKF LIDGRTGE F+  +SVGIMYMLKLDHMVDDKIH+RAVGPYSKITQQPLGGKSQNGGQRFGEMEVWAL+AYGAAHNLRE+LTIKSDDV+GRN TYNAI+KG  IPE G+PESFKLLTK+LQGLG+ +++  +     N NN   ++E +    ++A
  S:     7 FHNTQYSPKVVRRDYSKVHNKYNPLNLPGIQVNAYKQFLEKELEEIIGSYFPIKSPNGKYSVEFHGMKILDPQITKEEASAESKTYDASLYVNLSLVNHQTGTVKKISKKSA--KSKAEGIYFADIPLMTENGAFIVNGIEKFVVAQIVRSPGAYILNKSQVKLSNSRKRNQEGYICEVFPSKGTLMLFYIAENKDFVQAVVRDVGGESAKVFSITTLLKAFGLSEIKIKEIFNNNDYILRSLESEFYNEKQILNEADIAQLIRDIESDRISKVKSLPIDQKWKNLVLDWYKLNQEKQELLNSSNPNPTKIESLNTHIGVVLRKLICEKAAKHVIQELSISTRSLDNVAQ--KEEISYQSILLQHFFQKKRYDLSSAGRHKFVRKLRVSERLYQRTIAQDIKDLDGNVVIKQGTLMLKEQLDLFKRLSKEKRLDIIKQIDFINPELNTQFTHVNTYEEVQIYVNNDLRNETTQIIGIDGSNESIETLTLADLISIVSYIVNLPFNIGLYDDIDHLGNKRLKLINELLKSKVQTGMMRIEKYIKDKLQTADGNNKLADQDAENDPDSDLGTKSGNDLTVKSVINPKPFQIVIKDFFNTHQLTQFLDQQNPLSELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGRICPIETPEGMNIGLIMSLAFYATIDKNGFLMTPYLKVENGKITDKVEHLTALTEDEYIIAEASSYMDVAKDGTINNEKIIARYRSSQDLYDPKQVDYIVVSPKQVVSVAASLIPFLENDDSSRALMGANMQRQATPLLKPYSPLVGTGVEYKIAQDSGM--LVTAKNPGTVTYVDASKITVKGEDNKSTDYNLLKFVKSNKNTCYNQSPIVAVGDKIETNQALADGPSMKNGELALGQNVLVGFTTWSGYNYEDAVIISDRLFKDDVYSSIHIDEYTIECLRTKNGDEEIIRDIPNISESAKRYLDEEGVIMVGAEVKEGDILVGKTSPKGQVELTPEEKLIQVILGDKVKQVRESSLKVPNGGDGIVAGIKRFSIANGDELEDDVLELVKVYVVQKRKIQIGDKVAGRHGNKGIISKIVAQEDMPHLEDGTPLDILLNPLGVPSRMNIGQIFELHLGYAARELAKAKLIEACFDKKLADQLDTVFGLEKSKTQSLIKNLVEHMKSIGVTSLAQTKNRVRTIDIDIVLKQLGLTYDDLAFKIATPVFEGVNMEDLKAIMSEAGIDP------DKTEGKFKLIDGRTGEPFEKPISVGIMYMLKLDHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALQAYGAAHNLREILTIKSDDVRGRNMTYNAIVKGLSIPEPGVPESFKLLTKELQGLGMTLNVLYDDDSIENINNISVVDESLEPKIHDA 1375
>gi|12045200|ref|NP_073011.1| DNA-directed RNA polymerase subunit beta [Mycoplasma genitalium G37] >gi|1350845|sp|P47583|RPOB_MYCGE DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|3844923|gb|AAC71566.1| DNA-directed RNA polymerase, beta subunit [Mycoplasma genitalium G37] >gi|166078792|gb|ABY79410.1| DNA-directed RNA polymerase, beta subunit [synthetic Mycoplasma genitalium JCVI-1.0] (1390 aa)
Score = 3630, Expect = 0.0e+00, Identities = 763/1343 (56%), Positives = 983/1343 (73%)
  Q:     3 KKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKD----FIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNLNSSDSN-RSYGV--DTKLRELFKKYSSLKSQLEAEGKNAEKQK-------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVK----YEKINVYQDNDSQDEFIPIIGTDTSLD-KPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEE-----QEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEK-NKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNN 1345
           K  F  K  S    RR Y KIE NF +PNL ++Q  ++ KF+D +LE  I S FPIKS   RY++ + G+   +P+R E ++R + KTY+  +Y DL +VDN+ G VKK  KS KN ASNT+G+F AS+P+IT  G FI+NGIEKFVISQI RSPG Y+LTKSQ+KLSNSRKR+QEGY+CE+LPA G++  I+++  K     F+Q++ RDA+ E     PIT  LKA GLN  EIL IF N++ IK SL+ EIYN KD       E+ NL K      ++ R  G+  D KLR L  +Y +L+ Q  A  + +           E+   ++++I+E+AAK +V  LSIS ++I++       E ++ +++   FF NK ++LS AGR+K++RK+RL+ER+YQ+ LA DL   +GK+++KK TL+ K E+D IKQ  K  ++  V+ + L     K  ++ K    YE I+VY  ND+    +P+IG     D    +++SD ++  SYVINL Y IG YDDIDHLGNKR+KLI+EL+  + ++G  R+E+F+ +KL IADG N+ Q+ +EE     Q  KK LT+KS+IN+KP QI  K+FFN+HQLTQFLD QNPL+EL+NKRRISAMGPGGISREDPNLDIRDVHYS YG+ICPIETPEGMNIGLIMSLA++A  DENGFL+ PYR +K GVITDE+ +LTAL EDE+IIA   S +N+   NK  + +++ RYRS    +D   +D+ID++P QVVSI +S IPFLENDD+ RALMG NMQRQA PLI P AP VGTG E+KIA DSG+         G VSYVD   I I S S +K    L KF +SNQNTC N  PIV +G++V K   I DGPA++  ELALGQNVLVAFTTW+GYNYEDAI++S+RL  EDI TS+ I EY   CL TKNGDE+ITRDIPNVS+++K+YLD+ GIIMVGAEVKEGDVLVGK+SPKGQVE++ EEKL +AIF +  +N +++SLKV HGG+G V+ VKRF + +  ELN  VIE IKVYVVQKRKIQIGDK+AGRHGNKG+ISK+VP+EDMPHLEDGT +DI+LNPLGVPSRMNIGQI E HLG A  KL +  ++   +D+  A +F++     +     LIK L+  +N++ IKS  +A ++  + D+SL L   G+S + LIYK ATP+F+GVN  DL++ M EAG+DP      +   GKF LIDGR+G  F+  +S+GIMYM+KL+HMVDDKIH+RAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL+ELLTIKSDDV+GRN  Y AI+KG   PE G+PESFKLLTK+LQGL L VS   +     ++N
  S:     4 KSNFFQKRYSPTATRRYYGKIETNFIQPNLADIQIKSYQKFLDHDLEKLIASYFPIKSPNDRYTINFRGLHRTEPERDEAQSRAQSKTYEVGIYADLELVDNDKGTVKKARKSKKNIASNTNGVFLASMPLITHDGVFIINGIEKFVISQITRSPGIYMLTKSQLKLSNSRKRVQEGYVCEVLPANGSVMLIYISNKKKIEDAFVQILLRDAVREGAKIFPITTLLKAFGLNNREILKIFKNNEFIKRSLEAEIYNAKDFLSNVDPEIKNLLKEFRDGKTDLRRKGIASDQKLRSLVNEYVTLEKQYNALKQTSPNDSSLTALELEMENKMDSVITERAAKHIVNELSISLRDIENTEEC--HEVSFHALLCARFFRNKRYNLSNAGRYKVSRKLRLTERIYQKTLACDLFLKDGKLLLKKGTLLLKEEIDKIKQAAKNNEISFVNKMQLTTD-GKAVDLAKESLFYETIDVYITNDNLSVSVPVIGIHNENDLNKAMTLSDFIASISYVINLPYGIGKYDDIDHLGNKRVKLINELITAKLESGFTRMERFLKEKLTIADGVNRGQQINEEGQVIEQGEKKELTIKSLINSKPIQIVIKDFFNTHQLTQFLDHQNPLSELSNKRRISAMGPGGISREDPNLDIRDVHYSQYGRICPIETPEGMNIGLIMSLASFAKIDENGFLMAPYRKIKAGVITDEVEYLTALREDEHIIAEISSLVNISNDNKILDKEIIGRYRSMQGLYDPLKIDYIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPAVGTGQEHKIASDSGLTM--SSPCSGVVSYVDNSKIIITSDSSKKETVNLVKFERSNQNTCYNHKPIVEIGQRVNKDEIIVDGPAVNKSELALGQNVLVAFTTWNGYNYEDAIVISERLVKEDILTSLTINEYVAQCLSTKNGDEQITRDIPNVSDANKRYLDENGIIMVGAEVKEGDVLVGKVSPKGQVEVSPEEKLFKAIFPESVQNVRDSSLKVSHGGDGIVSAVKRFSIANGDELNDGVIEMIKVYVVQKRKIQIGDKLAGRHGNKGVISKVVPIEDMPHLEDGTPVDILLNPLGVPSRMNIGQIFETHLGYAAHKLAVRSLISSCFDQNKAKEFAIEINQPQARVERLIKGLKNQINDRNIKSEKEALEKLDNSDISLVLKEIGMSFDDLIYKIATPIFQGVNFLDLQDVMQEAGLDP------QKNQGKFKLIDGRSGMPFERPISLGIMYMMKLNHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLQELLTIKSDDVQGRNRAYAAIVKGAAFPEPGIPESFKLLTKELQGLALSVSFIYDDNTQQDSN 1365
>gi|13508255|ref|NP_110204.1| DNA-directed RNA polymerase subunit beta [Mycoplasma pneumoniae M129] >gi|2500606|sp|P78013|RPOB_MYCPN DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|1674000|gb|AAB95974.1| RNA polymerase beta subunit [Mycoplasma pneumoniae M129] (1391 aa)
Score = 3607, Expect = 0.0e+00, Identities = 734/1343 (54%), Positives = 983/1343 (73%)
  Q:     3 KKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKA-SNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKD----FIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNLNSSDSN-RSYGV--DTKLRELFKKYSSLKSQLEA-------EGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLD---ERISKMANVVKYEKINVYQDNDSQDEFIPIIG--TDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEE-----QEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNN 1345
           K  F  K+ S    RR Y KI  +F +PNL ++Q  ++  F+D +LE  I + FPIKS   RY++ + G++   P+R+E ++R+E KTY+  +Y DL ++D+ +G +KK  KS KN A S+ DG+F  ++P+IT  G FIVNGIEKFVI+QI RSPG Y+LTKSQ+KLS+SRKR+QEGY+CE+LPA G++  I+++  K     F+Q++ RDA+ E     PIT  LKA G++ +EIL +F N++ I  SL+ E+YN KD       E+ NL +      ++ R  G+  D K+R L   Y  L+ + +A       + K  + + +++E+++ II+E+AAK +V  LSIS + +++       E +Y +++ + FF  + ++LS AGR+K++RK+R++ER+YQ+ LA DL   NG++++KK TL+ K E+D IKQ  +  ++  V  + L      ++     + YE ++VY +ND+ D  +P++G   D  L+K  +++SD ++  SYVIN+   IG YDDIDHLGNKR+KLI+EL+ +R ++G+ R+E+F+ +KL IADG N+ Q+ +EE     Q  KK LT+KS+IN+KP QI  ++FFN+HQLTQFLD QNPL+EL+NKRRISAMGPGGISREDPNLDIRDVHYS YG+ICPIETPEGMNIGLIMSLA++A  DENGFL+ PYR +KNGVITDE+ +LTAL EDE+IIA   S +N+ E NK  + +++ RYRS    +D   +D+ID++P QVVSI +S IPFLENDD+ RALMG NMQRQA PLI P AP+VGTG EYKIA DSG+  +      GTV YVD   I I+S S E+   +L KF +SNQNTC N VP+V  G++VTK   IADGPA++  EL+LGQNVLVAFTTW+GYNYEDAI++S+RL  +D+ TS+ I EY   CL TKNGDE+ITRDIPNVS+++K+YLD+ GIIMVGAEVKEGDVLVGK+SPKGQVE++ EEKL +AIF +  +N +++SLK+PHGG+G V+ VKRF + +  ELN  VIE IKVYVVQKRKIQIGDK+AGRHGNKG+ISK+VPV DMPHLEDGT +DI+LNPLGVPSRMNIGQI E+HLG A   L    ++   +D K A   S      +     LI  L+  +  + +K    A  +  + D++L L   G+S + L +K ATP+F+GVN  DL++ M EAG+ P          GKF LIDGRTG  F+  +S+GIMY++KL+HMVDDKIH+RAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL+ELLTIKSDDV+GRN  Y AI+KG   PE G+PESFKLLTK+LQGL L VS   +     ++N
  S:     4 KPSFFQKKYSPTATRRYYGKIATDFVQPNLADIQIRSYQTFLDHDLENLIAAYFPIKSPNDRYTINFKGLRRTAPERNEAQSRSESKTYEIGIYADLELIDSATGTIKKPRKSKKNSATSSVDGVFLTNLPLITRDGVFIVNGIEKFVIAQITRSPGIYMLTKSQLKLSSSRKRVQEGYVCEVLPANGSVMLIYISNKKKIEDAFVQILLRDAVREGAKIFPITTLLKAFGMSGKEILKVFKNNEFITRSLEAEVYNAKDFLNNVDPEIKNLLREFRDGKTDLRRKGIASDQKIRSLVSDYVLLEKEHKALSEAKPNDPKVGQLEADMDELMDKIITERAAKHIVHELSISLRGLENTDECP--ENSYHALLCSRFFRQRRYNLSAAGRYKVSRKLRITERIYQKTLACDLHLKNGELLLKKGTLLVKEEIDKIKQAAQNNQIDFVQKIKLTTDGSAVNLSPESLLYESLDVYVNNDNFDVSVPVVGIHNDNDLNK-AITLSDFIASISYVINIPSAIGKYDDIDHLGNKRVKLINELISSRLESGITRMERFLKEKLTIADGVNRGQQINEEGQVIEQAEKKELTIKSLINSKPIQIVIRDFFNTHQLTQFLDHQNPLSELSNKRRISAMGPGGISREDPNLDIRDVHYSQYGRICPIETPEGMNIGLIMSLASFAKIDENGFLMAPYRKIKNGVITDEVEYLTALREDEHIIAEISSLVNIDENNKILDKEIIGRYRSMQGLYDPSKIDYIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPVVGTGQEYKIARDSGLTML--APCSGTVKYVDNSKITIESDSGEQHTLDLIKFERSNQNTCYNHVPLVEKGQRVTKDEVIADGPAVNKSELSLGQNVLVAFTTWNGYNYEDAIVISERLVKDDVLTSLTINEYVAQCLSTKNGDEQITRDIPNVSDANKRYLDENGIIMVGAEVKEGDVLVGKVSPKGQVEVSPEEKLFKAIFPESVQNVRDSSLKLPHGGDGIVSCVKRFSIANGNELNDGVIEMIKVYVVQKRKIQIGDKLAGRHGNKGVISKVVPVADMPHLEDGTPVDILLNPLGVPSRMNIGQIFEMHLGYAAHNLAKRMLISACFDDKKAQALSTEINQPQYKLDRLITGLKAQITNRGLKDEQAALAQLNNGDIALVLKEIGMSFDDLHFKVATPIFQGVNFQDLQDIMDEAGLKPAE------THGKFKLIDGRTGLPFEKPISLGIMYIMKLNHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLQELLTIKSDDVQGRNKAYAAIVKGAAFPEPGIPESFKLLTKELQGLALSVSFIYDDNTQQDSN 1366
>gi|188568698|ref|ZP_02828717.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 2] (1434 aa)
Score = 3557, Expect = 0.0e+00, Identities = 758/1371 (55%), Positives = 1014/1371 (73%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET---DELI--------NLRKNLNSSDSNRSYGVD---------TKLRELFKKYSSLKSQLEA---EGKNAEKQK----------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERI--SKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGA----------------NKSQEQSE--EQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDD--YELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEE 1372
           + K + +K I+  V RRDYSKI+ NF  PNLL +Q  +F +F++ +L   I  IFP+KS  G+Y+L + G+K+++P + E   R+EGKT++ P+Y+DL + DN +GEVK+  +++K   +  DGI+  +IP +TEKGTF++NGIEKFVISQIVRSPG Y+L KS IKL+ SRKR+ EG ICEI P+KGTL   ++ +++  IQ++ RD+ G++  T  IT  LKA GL   EIL IF N K I+ SL+ E Y+ + +FE    +E+I        ++ +  +  +SN     +         +KL+EL   Y     +++A   E K+ E             E  E+IN IISEKAAKD+V  L I+ KN+++   L   + +YQ  +  HFF+ + +D+S AGR+K  +K+ LSERLYQ+V+A D+ D    ++I K+TLI K  ++ IK+ +++  +     +NL      +++   ++YE I VY+DND +DE   I+G        TL+++D+++ TSY+ NL+Y+IG +DDIDHLGNKRLKLI ELL+ R    + RIEKFIN+KLAI+DG+                ++  E+S+  ++E KK+++VKSIINTK FQ   K+FFNSHQL QF+DQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVH+SHY +ICPIETPEGMNIGLIMSLA+ A  DENGF++ PY +V++GV+ +E ++LTA  +D YIIA S++ +++NK   +++V+ RYR S   F   +VDFIDI PKQVVSIAAS+IPF+ENDD  RALMG+NMQRQATPLI P APIVGTG E+KIAHDSGMA V   + DG V +VD   I IK+ +++   Y+L K+ KSNQ+TCNNQ+PIV +G+KV K  TI DGPAM NGELALG+N+LV +TTW GYN+EDAII+S+RL  +D+FTSIHI E+++ C+KTKNGDEEITRD+PNVS+++K++LD++GI++VGAEV EGDVLVGK +P+G VE   E++LLQ IFGDKSK  K++SLKV HG EG VA VKR K  D+   EL  DVIE IKVY+VQKRKIQ+GDKMAGRHGNKGI+SK+VP++DMP L+DGT +DIMLNPLGVPSRMNIGQILELHLG A  ++   +++++  D+     +   FGI+E  ++ L + +  ++  KQ K      K+    D+++ L   G+S + +  K +TPVF+G N  D+ + M EA ID  N K      GK  L DGRTGE FDG +SVG+ YMLKLDHMVDDKIHSR+VGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL E+LTIKSDDV+GRN  YNAIIKG  +   G+PESFKLLTKQ+QGLGL +++     +  ++   DINEY  N   N + ND+D+ I +E
  S:     3 NNKNYTEKFITDKVTRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLREVISGIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTDNYTGEVKRAQRNAK---TGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSITTLLKAFGLTSAEILKIFNNEKEIRESLEVEKYSPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLREEYIEQGSPLLSKLKELIFDYVEKSDEIDALLHENKDVEDANFIKNNKKLYDEREEIINCIISEKAAKDIVELLGINIKNVETLRHLG--KASYQLALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIARDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIKWTRKINLLPIALETEIEQFLEYESIAVYKDNDLRDETTEIVGLAPGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREVEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHYSRICPIETPEGMNIGLIMSLASLAKVDENGFIVAPYYVVEDGVVKEECKYLTAHEDDNYIIAESSVQLDENKRILDEQVVARYRGSTGLFSPHEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVV--AKNDGVVEFVDSQKIVIKNDNDKLDEYKLIKYRKSNQDTCNNQIPIVKIGQKVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIKSTDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGINEIIAKKLYEKITNLIKHKQAKQ----PKDIDLIDITIVLKELGLSYDDIGIKISTPVFDGANHDDIVDIMNEANIDIENNK------GKQVLYDGRTGEAFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDVVADGMPESFKLLTKQMQGLGLCITV-----ETKDDRMIDINEYTLN--QNRLNNDDDEVIFDE 1406
>gi|171920550|ref|ZP_02931821.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178845|ref|ZP_02554816.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024155|ref|ZP_02570055.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039537|ref|ZP_02528615.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 8] >gi|188039661|ref|ZP_02529017.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 8] >gi|188039674|ref|ZP_02529044.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 8] >gi|188518528|ref|ZP_02556765.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188592508|ref|ZP_02694055.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 10] >gi|195867734|ref|ZP_03079735.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903247|gb|EDT49536.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209481|gb|EDU06524.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018786|gb|EDU56826.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997915|gb|EDU67012.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660589|gb|EDX53845.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (1434 aa)
Score = 3556, Expect = 0.0e+00, Identities = 758/1371 (55%), Positives = 1015/1371 (74%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET---DELI--------NLRKNLNSSDSNRSYGVD---------TKLRELFKKYSSLKSQLEA---EGKNAEKQK----------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERI--SKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGA----------------NKSQEQSE--EQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDD--YELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEE 1372
           + K + +K I+  V RRDYSKI+ NF  PNLL +Q  +F +F++ +L+  I  IFP+KS  G+Y+L + G+K+++P + E   R+EGKT++ P+Y+DL + DN +GEVK+  +++K   +  DGI+  +IP +TEKGTF++NGIEKFVISQIVRSPG Y+L KS IKL+ SRKR+ EG ICEI P+KGTL   ++ +++  IQ++ RD+ G++  T  IT  LKA GL   EIL IF N K I+ SL+ E Y+ + +FE    +E+I        ++ +  +  +SN     +         +KL+EL   Y     +++A   E K+ E             E  E+IN IISEKAAKD+V  L I+ KN+++   L   + +YQ  +  HFF+ + +D+S AGR+K  +K+ LSERLYQ+V+A D+ D    ++I K+TLI K  ++ IK+ +++  +     +NL      +++   ++YE I VY+DND +DE   I+G        TL+++D+++ TSY+ NL+Y+IG +DDIDHLGNKRLKLI ELL+ R    + RIEKFIN+KLAI+DG+                ++  E+S+  ++E KK+++VKSIINTK FQ   K+FFNSHQL QF+DQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVH+SHY +ICPIETPEGMNIGLIMSLA+ A  DENGF++ PY +V++GV+ +E ++LTA  +D YIIA S++ +++NK   +++V+ RYR S   F   +VDFIDI PKQVVSIAAS+IPF+ENDD  RALMG+NMQRQATPLI P APIVGTG E+KIAHDSGMA V   + DG V +VD   I IK+ +++   Y+L K+ KSNQ+TCNNQ+PIV +G+KV K  TI DGPAM NGELALG+N+LV +TTW GYN+EDAII+S+RL  +D+FTSIHI E+++ C+KTKNGDEEITRD+PNVS+++K++LD++GI++VGAEV EGDVLVGK +P+G VE   E++LLQ IFGDKSK  K++SLKV HG EG VA VKR K  D+   EL  DVIE IKVY+VQKRKIQ+GDKMAGRHGNKGI+SK+VP++DMP L+DGT +DIMLNPLGVPSRMNIGQILELHLG A  ++   +++++  D+     +   FGI+E  ++ L + +  ++  KQ K      K+    D+++ L   G+S + +  K +TPVF+G N  D+ + M EA ID  N K      GK  L DGRTGE FDG +SVG+ YMLKLDHMVDDKIHSR+VGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL E+LTIKSDDV+GRN  YNAIIKG  +   G+PESFKLLTKQ+QGLGL +++     +  ++   DINEY  N   N + ND+D+ I +E
  S:     3 NNKNYTEKFITDKVTRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLKEVISGIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTDNYTGEVKRAQRNAK---TGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSITTLLKAFGLTSAEILKIFNNEKEIRESLEVEKYSPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLREEYIEQGSPLLSKLKELIFDYVEKSDEIDALLHENKDVEDANFIKNNKKLYDEREEIINCIISEKAAKDIVELLGINIKNVETLRHLG--KASYQLALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIARDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIKWTRKINLLPIALETEIEQFLEYESIAVYKDNDLRDETTEIVGLAPGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREVEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHYSRICPIETPEGMNIGLIMSLASLAKVDENGFIVAPYYVVEDGVVKEECKYLTAHEDDNYIIAESSVQLDENKRILDEQVVARYRGSTGLFSPHEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVV--AKNDGVVEFVDSQKIVIKNDNDKLDEYKLIKYRKSNQDTCNNQIPIVKIGQKVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIKSTDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGINEIIAKKLYEKITNLIKHKQAKQ----PKDIDLIDITIVLKELGLSYDDIGIKISTPVFDGANHDDIVDIMNEANIDIENNK------GKQVLYDGRTGEAFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDVVADGMPESFKLLTKQMQGLGLCITV-----ETKDDRMIDINEYTLN--QNRLNNDDDEVIFDE 1406
>gi|188524077|ref|ZP_02557312.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660012|gb|EDX53392.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (1434 aa)
Score = 3554, Expect = 0.0e+00, Identities = 758/1371 (55%), Positives = 1015/1371 (74%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET---DELI--------NLRKNLNSSDSNRSYGVD---------TKLRELFKKYSSLKSQLEA---EGKNAEKQK----------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERI--SKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGA----------------NKSQEQSE--EQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDD--YELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEE 1372
           + K + +K I+  V RRDYSKI+ NF  PNLL +Q  +F +F++ +L+  I  IFP+KS  G+Y+L + G+K+++P + E   R+EGKT++ P+Y+DL + DN +GEVK+  +++K   +  DGI+  +IP +TEKGTF++NGIEKFVISQIVRSPG Y+L KS IKL+ SRKR+ EG ICEI P+KGTL   ++ +++  IQ++ RD+ G++  T  IT  LKA GL   EIL IF N K I+ SL+ E Y+ + +FE    +E+I        ++ +  +  +SN     +         +KL+EL   Y     +++A   E K+ E             E  E+IN IISEKAAKD+V  L I+ KN+++   L   + +YQ  +  HFF+ + +D+S AGR+K  +K+ LSERLYQ+V+A D+ D    ++I K+TLI K  ++ IK+ +++  +     +NL      +++   ++YE I VY+DND +DE   I+G        TL+++D+++ TSY+ NL+Y+IG +DDIDHLGNKRLKLI ELL+ R    + RIEKFIN+KLAI+DG+                ++  E+S+  ++E KK+++VKSIINTK FQ   K+FFNSHQL QF+DQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVH+SHY +ICPIETPEGMNIGLIMSLA+ A  DENGF++ PY +V++GV+ +E ++LTA  +D YIIA S++ +++NK   +++V+ RYR S   F   +VDFIDI PKQVVSIAAS+IPF+ENDD  RALMG+NMQRQATPLI P APIVGTG E+KIAHDSGMA V   + DG V +VD   I IK+ +++   Y+L K+ KSNQ+TCNNQ+PIV +G+KV K  TI DGPAM NGELALG+N+LV +TTW GYN+EDAII+S+RL  +D+FTSIHI E+++ C+KTKNGDEEITRD+PNVS+++K++LD++GI++VGAEV EGDVLVGK +P+G VE   E++LLQ IFGDKSK  K++SLKV HG EG VA VKR K  D+   EL  DVIE IKVY+VQKRKIQ+GDKMAGRHGNKGI+SK+VP++DMP L+DGT +DIMLNPLGVPSRMNIGQILELHLG A  ++   +++++  D+     +   FGI+E  ++ L + +  ++  KQ K      K+    D+++ L   G+S + +  K +TPVF+G N  D+ + M EA ID  N K      GK  L DGRTGE FDG +SVG+ YMLKLDHMVDDKIHSR+VGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL E+LTIKSDDV+GRN  YNAIIKG  +   G+PESFKLLTKQ+QGLGL +++     +  ++   DINEY  N   N + ND+D+ I +E
  S:     3 NNKNYTEKFITDKVTRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLKEVISGIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTDNYTGEVKRAQRNAK---TGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSITTLLKAFGLTSAEILKIFNNEKEIRESLEVEKYSPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLREEYIEQGSPLLSKLKELIFDYVEKSDEIDALLHENKDVEDANFIKNNKKLYDEREEIINCIISEKAAKDIVELLGINIKNVETLRHLG--KASYQLALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIARDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIKWTRKINLLPIALETEIEQFLEYESIAVYKDNDLRDETTEIVGLAPGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREVEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHYSRICPIETPEGMNIGLIMSLASLAKVDENGFIVAPYYVVEDGVVKEEYKYLTAHEDDNYIIAESSVQLDENKRILDEQVVARYRGSTGLFSPHEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVV--AKNDGVVEFVDSQKIVIKNDNDKLDEYKLIKYRKSNQDTCNNQIPIVKIGQKVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIKSTDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGINEIIAKKLYEKITNLIKHKQAKQ----PKDIDLIDITIVLKELGLSYDDIGIKISTPVFDGANHDDIVDIMNEANIDIENNK------GKQVLYDGRTGEAFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDVVADGMPESFKLLTKQMQGLGLCITV-----ETKDDRMIDINEYTLN--QNRLNNDDDEVIFDE 1406
>gi|171920404|ref|ZP_02931726.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902844|gb|EDT49133.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] (1434 aa)
Score = 3554, Expect = 0.0e+00, Identities = 759/1371 (55%), Positives = 1018/1371 (74%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET---DELI--------NLRKNLNSSDSNRSYGVD---------TKLRELFKKYSSLKSQLEA---EGKNAEKQK----------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERI--SKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGA----------------NKSQEQSE--EQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDD--YELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEE 1372
           + K + +K I+  V+RRDYSKI+ NF  PNLL +Q  +F +F++ +L+  I SIFP+KS  G+Y+L + G+K+++P + E   R+EGKT++ P+Y+DL + DN +GEVK+  +++K   +  DGI+  +IP +TEKGTF++NGIEKFVISQIVRSPG Y+L KS IKL+ SRKR+ EG ICEI P+KGTL   ++ +++  IQ++ RD+ G++  T  +T  LKA GL   EIL IF N K I+ SL+ E Y  + +FE    +E+I        ++ +  +  +SN     +         +KL++L   Y     +++A   E K+ E             E  E+IN IISEKAAKD+V  L I+ KNI++   L   + +YQ  +  HFF+ + +D+S AGR+K  +K+ LSERLYQ+V+A D+ D    ++I K+TLI K  ++ IK+ +++  +     +NL      S++   ++YE I VY+DND +DE   I+G  +     TL+++D+++ TSY+ NL+Y+IG +DDIDHLGNKRLKLI ELL+ R    + RIEKFIN+KLAI+DG+                ++  E+S+  ++E KK+++VKSIINTK FQ   K+FFNSHQL QF+DQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVH+SHY +ICPIETPEGMNIGLIMSLA+ A  DENGF++ PY +V++GV+ +E ++LTA  +D YIIA S++ +++NK   +++V+ RYR S   F   +VDFIDI PKQVVSIAAS+IPF+ENDD  RALMG+NMQRQATPLI P APIVGTG E+KIAHDSGMA V   + DG V +VD   I I++ +++   Y+L K+ KSNQ+TCNNQ+PIV VG++V K  TI DGPAM NGELALG+N+LV +TTW GYN+EDAII+S+RL  +D+FTSIHI E+++ C+KTKNGDEEITRD+PNVS+++K++LD++GI++VGAEV EGDVLVGK +P+G VE   E++LLQ IFGDKSK  K++SLKV HG EG VA VKR K  D+   EL  DVIE IKVY+VQKRKIQ+GDKMAGRHGNKGI+SK+VP++DMP L+DGT +DIMLNPLGVPSRMNIGQILELHLG A  ++   +++++  D+     +   FGI+E  ++ L +N+  ++  KQ K      K+    D+++ L   G+S + +  K +TPVF+G N  D+   M EA ID  N K      GK  L DGRTGE FDG +SVG+ YMLKLDHMVDDKIHSR+VGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL E+LTIKSDDV+GRN  YNAIIKG  +   G+PESFKLLTKQ+QGLGL +++     +  ++   DINEY  N   N + ND+D+ I++E
  S:     3 NNKNYTEKFITDKVMRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLKEVISSIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTDNYTGEVKRAQRNTK---TGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSVTTLLKAFGLTSAEILKIFNNEKEIRESLEIEKYAPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLKEEYIEQGSPLLSKLKQLIFNYVEKNDEIDALLHENKDVEDASFIKNNKKLYDEREEIINCIISEKAAKDIVELLGINIKNIETLRHLG--KASYQIALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIANDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIKWTKKINLLPTALESEIEQFLEYESIAVYKDNDLRDETTEIVGLASGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREIEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHYSRICPIETPEGMNIGLIMSLASLAKVDENGFIVAPYYVVEDGVVKEEYKYLTAHEDDNYIIAESSVQLDENKRILDEQVVARYRGSTGLFSPHEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVV--AKNDGVVEFVDSQKIIIRNDNDKLDDYKLIKYRKSNQDTCNNQIPIVKVGQRVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIKSSDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGINEIIAKKLYENISNLIKHKQAKQA----KDIDLIDVTIILKELGLSYDDIGIKISTPVFDGANHDDIVSIMNEANIDIENNK------GKQVLYDGRTGEPFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDVVADGMPESFKLLTKQMQGLGLCITV-----ETKDDRMVDINEYTLN--QNRLNNDDDEVILDE 1406
>gi|188530835|ref|ZP_02546577.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] (1434 aa)
Score = 3550, Expect = 0.0e+00, Identities = 757/1371 (55%), Positives = 1014/1371 (73%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET---DELI--------NLRKNLNSSDSNRSYGVD---------TKLRELFKKYSSLKSQLEA---EGKNAEKQK----------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERI--SKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGA----------------NKSQEQSE--EQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDD--YELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEE 1372
           + K + +K I+  V RRDYSKI+ NF  PNLL +Q  +F +F++ +L+  I  IFP+KS  G+Y+L + G+K+++P + E   R+EGKT++ P+Y+DL + DN +GEVK+  +++K   +  DGI+  +IP +TEKGTF++NGIEKFVISQIVRSPG Y+L KS IKL+ SRKR+ EG ICEI P+KGTL   ++ +++  IQ++ RD+ G++  T  IT  LKA GL   EIL IF N K I+ SL+ E Y+ + +FE    +E+I        ++ +  +  +SN     +         +KL+EL   Y     +++A   E K+ E             E  E+IN IISEKAAKD+V  L I+ KN+++   L   + +YQ  +  HFF+ + +D+S AGR+K  +K+ LSERLYQ+V+A D+ D    ++I K+TLI K  ++ IK+ +++  +     +NL      +++   ++YE I VY+DND +DE   I+G        TL+++D+++ TSY+ NL+Y+IG +DDIDHLGNKRLKLI ELL+ R    + RIEKFIN+KLAI+DG+                ++  E+S+  ++E KK+++VKSIINTK FQ   K+FFNSHQL QF+DQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVH+ HY +ICPIETPEGMNIGLIMSLA+ A  DENGF++ PY +V++GV+ +E ++LTA  +D YIIA S++ +++NK   +++V+ RYR S   F   +VDFIDI PKQVVSIAAS+IPF+ENDD  RALMG+NMQRQATPLI P APIVGTG E+KIAHDSGMA V   + DG V +VD   I IK+ +++   Y+L K+ KSNQ+TCNNQ+PIV +G+KV K  TI DGPAM NGELALG+N+LV +TTW GYN+EDAII+S+RL  +D+FTSIHI E+++ C+KTKNGDEEITRD+PNVS+++K++LD++GI++VGAEV EGDVLVGK +P+G VE   E++LLQ IFGDKSK  K++SLKV HG EG VA VKR K  D+   EL  DVIE IKVY+VQKRKIQ+GDKMAGRHGNKGI+SK+VP++DMP L+DGT +DIMLNPLGVPSRMNIGQILELHLG A  ++   +++++  D+     +   FGI+E  ++ L + +  ++  KQ K      K+    D+++ L   G+S + +  K +TPVF+G N  D+ + M EA ID  N K      GK  L DGRTGE FDG +SVG+ YMLKLDHMVDDKIHSR+VGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL E+LTIKSDDV+GRN  YNAIIKG  +   G+PESFKLLTKQ+QGLGL +++     +  ++   DINEY  N   N + ND+D+ I +E
  S:     3 NNKNYTEKFITDKVTRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLKEVISGIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTDNYTGEVKRAQRNAK---TGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSITTLLKAFGLTSAEILKIFNNEKEIRESLEVEKYSPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLREEYIEQGSPLLSKLKELIFDYVEKSDEIDALLHENKDVEDANFIKNNKKLYDEREEIINCIISEKAAKDIVELLGINIKNVETLRHLG--KASYQLALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIARDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIKWTRKINLLPIALETEIEQFLEYESIAVYKDNDLRDETTEIVGLAPGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREVEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHYHYSRICPIETPEGMNIGLIMSLASLAKVDENGFIVAPYYVVEDGVVKEEYKYLTAHEDDNYIIAESSVQLDENKRILDEQVVARYRGSTGLFSPHEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVV--AKNDGVVEFVDSQKIVIKNDNDKLDEYKLIKYRKSNQDTCNNQIPIVKIGQKVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIKSTDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGINEIIAKKLYEKITNLIKHKQAKQ----PKDIDLIDITIVLKELGLSYDDIGIKISTPVFDGANHDDIVDIMNEANIDIENNK------GKQVLYDGRTGEAFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDVVADGMPESFKLLTKQMQGLGLCITV-----ETKDDRMIDINEYTLN--QNRLNNDDDEVIFDE 1406
>gi|170761945|ref|YP_001752269.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508740|ref|ZP_02689961.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186702007|ref|ZP_02554365.2| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189043874|sp|B1AIH5|RPOB_UREP2 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|168827522|gb|ACA32784.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675670|gb|EDT87575.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700787|gb|EDU19069.1| DNA-directed RNA polymerase, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (1434 aa)
Score = 3550, Expect = 0.0e+00, Identities = 758/1371 (55%), Positives = 1018/1371 (74%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET---DELI--------NLRKNLNSSDSNRSYGVD---------TKLRELFKKYSSLKSQLEA---EGKNAEKQK----------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERI--SKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGA----------------NKSQEQSE--EQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDD--YELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEE 1372
           + K + +K I+  V+RRDYSKI+ NF  PNLL +Q  +F +F++ +L+  I SIFP+KS  G+Y+L + G+K+++P + E   R+EGKT++ P+Y+DL + DN +GEVK+  +++K   +  DGI+  +IP +TEKGTF++NGIEKFVISQIVRSPG Y+L KS IKL+ SRKR+ EG ICEI P+KGTL   ++ +++  IQ++ RD+ G++  T  +T  LKA GL   EIL IF N K I+ SL+ E Y  + +FE    +E+I        ++ +  +  +SN     +         +KL++L   Y     +++A   E K+ E             E  E+IN IISEKAAKD+V  L I+ KNI++   L   + +YQ  +  HFF+ + +D+S AGR+K  +K+ LSERLYQ+V+A D+ D    ++I K+TLI K  ++ IK+ +++  +     +NL      S++   ++YE I VY+DND +DE   I+G  +     TL+++D+++ TSY+ NL+Y+IG +DDIDHLGNKRLKLI ELL+ R    + RIEKFIN+KLAI+DG+                ++  E+S+  ++E KK+++VKSIINTK FQ   K+FFNSHQL QF+DQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVH+SHY +ICPIETPEGMNIGLIMSLA+ A  DENGF++ PY +V++GV+ ++ ++LTA  +D YIIA S++ +++NK   +++V+ RYR S   F   +VDFIDI PKQVVSIAAS+IPF+ENDD  RALMG+NMQRQATPLI P APIVGTG E+KIAHDSGMA V   + DG V +VD   I I++ +++   Y+L K+ KSNQ+TCNNQ+PIV VG++V K  TI DGPAM NGELALG+N+LV +TTW GYN+EDAII+S+RL  +D+FTSIHI E+++ C+KTKNGDEEITRD+PNVS+++K++LD++GI++VGAEV EGDVLVGK +P+G VE   E++LLQ IFGDKSK  K++SLKV HG EG VA VKR K  D+   EL  DVIE IKVY+VQKRKIQ+GDKMAGRHGNKGI+SK+VP++DMP L+DGT +DIMLNPLGVPSRMNIGQILELHLG A  ++   +++++  D+     +   FGI+E  ++ L +N+  ++  KQ K      K+    D+++ L   G+S + +  K +TPVF+G N  D+   M EA ID  N K      GK  L DGRTGE FDG +SVG+ YMLKLDHMVDDKIHSR+VGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL E+LTIKSDDV+GRN  YNAIIKG  +   G+PESFKLLTKQ+QGLGL +++     +  ++   DINEY  N   N + ND+D+ I++E
  S:     3 NNKNYTEKFITDKVMRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLKEVISSIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTDNYTGEVKRAQRNTK---TGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSVTTLLKAFGLTSAEILKIFNNEKEIRESLEIEKYAPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLKEEYIEQGSPLLSKLKQLIFNYVEKNDEIDALLHENKDVEDASFIKNNKKLYDEREEIINCIISEKAAKDIVELLGINIKNIETLRHLG--KASYQIALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIANDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIKWTKKINLLPTALESEIEQFLEYESIAVYKDNDLRDETTEIVGLASGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREIEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHYSRICPIETPEGMNIGLIMSLASLAKVDENGFIVAPYYVVEDGVVKEDYKYLTAHEDDNYIIAESSVQLDENKRILDEQVVARYRGSTGLFSPNEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVV--AKNDGVVEFVDSQKIIIRNDNDKLDDYKLIKYRKSNQDTCNNQIPIVKVGQRVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIKSSDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGINEIIAKKLYENISNLIKHKQAKQA----KDIDLIDVTIILKELGLSYDDIGIKISTPVFDGANHDDIVSIMNEANIDIENNK------GKQVLYDGRTGEPFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDVVADGMPESFKLLTKQMQGLGLCITV-----ETKDDRMVDINEYTLN--QNRLNNDDDEVILDE 1406
>gi|13357745|ref|NP_078019.1| DNA-directed RNA polymerase subunit beta [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|14195189|sp|Q9PQV6|RPOB_UREPA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|11261129|pir||C82923 DNA-directed RNA polymerase beta subunit UU187 [imported] - Ureaplasma urealyticum >gi|6899151|gb|AAF30594.1|AE002118_4 DNA-directed RNA polymerase beta subunit [Ureaplasma parvum serovar 3 str. ATCC 700970] (1434 aa)
Score = 3540, Expect = 0.0e+00, Identities = 757/1371 (55%), Positives = 1017/1371 (74%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET---DELI--------NLRKNLNSSDSNRSYGVD---------TKLRELFKKYSSLKSQLEA---EGKNAEKQK----------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERI--SKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGA----------------NKSQEQSE--EQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDD--YELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEE 1372
           + K + +K I+  V+RRDYSKI+ NF  PNLL +Q  +F +F++ +L+  I SIFP+KS  G+Y+L + G+K+++P + E   R+EGKT++ P+Y+DL + DN +GEVK+  +++K   +  DGI+  +IP +TEKGTF++NGIEKFVISQIVRSPG Y+L KS IKL+ SRKR+ EG ICEI P+KGTL   ++ +++  IQ++ RD+ G++  T  +T  LKA GL   EIL IF N K I+ SL+ E Y  + +FE    +E+I        ++ +  +  +SN     +         +KL++L   Y     +++A   E K+ E             E  E+IN IISEKAAKD+V  L I+ KNI++   L   + +YQ  +  HFF+ + +D+S AGR+K  +K+ LSERLYQ+V+A D+ D    ++I K+TLI K  ++ IK+ +++  +     +NL      S++   ++YE I VY+DND +DE   I+G  +     TL+++D+++ TSY+ NL+Y+IG +DDIDHLGNKRLKLI ELL+ R    + RIEKFIN+KLAI+DG+                ++  E+S+  ++E KK+++VKSIINTK FQ   K+FFNSHQL QF+DQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVH+SH  +ICPIETPEGMNIGLIMSLA+ A  DENGF++ PY +V++GV+ ++ ++LTA  +D YIIA S++ +++NK   +++V+ RYR S   F   +VDFIDI PKQVVSIAAS+IPF+ENDD  RALMG+NMQRQATPLI P APIVGTG E+KIAHDSGMA V   + DG V +VD   I I++ +++   Y+L K+ KSNQ+TCNNQ+PIV VG++V K  TI DGPAM NGELALG+N+LV +TTW GYN+EDAII+S+RL  +D+FTSIHI E+++ C+KTKNGDEEITRD+PNVS+++K++LD++GI++VGAEV EGDVLVGK +P+G VE   E++LLQ IFGDKSK  K++SLKV HG EG VA VKR K  D+   EL  DVIE IKVY+VQKRKIQ+GDKMAGRHGNKGI+SK+VP++DMP L+DGT +DIMLNPLGVPSRMNIGQILELHLG A  ++   +++++  D+     +   FGI+E  ++ L +N+  ++  KQ K      K+    D+++ L   G+S + +  K +TPVF+G N  D+   M EA ID  N K      GK  L DGRTGE FDG +SVG+ YMLKLDHMVDDKIHSR+VGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAA+NL E+LTIKSDDV+GRN  YNAIIKG  +   G+PESFKLLTKQ+QGLGL +++     +  ++   DINEY  N   N + ND+D+ I++E
  S:     3 NNKNYTEKFITDKVMRRDYSKIKSNFEGPNLLEIQVESFKRFMEKDLKEVISSIFPLKSPQGKYTLAFKGLKIKQPTKDESACRDEGKTFETPIYIDLELTDNYTGEVKRAQRNTK---TGEDGIYLGAIPKMTEKGTFVINGIEKFVISQIVRSPGIYVLGKSSIKLNGSRKRLFEGKICEIYPSKGTLMLGYIPKDRHNIQIVARDSSGDNAQTFSVTTLLKAFGLTSAEILKIFNNEKEIRESLEIEKYAPEYIFENSQENEIIFKIYSDAHDIHEKADRRESNNKLKEEYIEQGSPLLSKLKQLIFNYVEKNDEIDALLHENKDVEDASFIKNNKKLYDEREEIINCIISEKAAKDIVELLGINIKNIETLRHLG--KASYQIALQQHFFNKRLYDISSAGRYKFEKKLLLSERLYQKVIANDIIDKKNNILIPKDTLITKEHIELIKKESRDKNIKWTKKINLLPTALESEIEQFLEYESIAVYKDNDLRDETTEIVGLASGCKLQTLTVADLVATTSYIYNLNYEIGEFDDIDHLGNKRLKLIHELLRARIATSMARIEKFINEKLAISDGSSNNITNVNDKGIDTELDREIEESDMSDEEKKKAISVKSIINTKQFQSLVKDFFNSHQLIQFIDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHHSHSSRICPIETPEGMNIGLIMSLASLAKVDENGFIVAPYYVVEDGVVKEDYKYLTAHEDDNYIIAESSVQLDENKRILDEQVVARYRGSTGLFSPNEVDFIDIVPKQVVSIAASAIPFIENDDGARALMGSNMQRQATPLIKPYAPIVGTGTEFKIAHDSGMAVV--AKNDGVVEFVDSQKIIIRNDNDKLDDYKLIKYRKSNQDTCNNQIPIVKVGQRVHKSETIGDGPAMQNGELALGRNILVGYTTWRGYNFEDAIIISERLVDQDVFTSIHIDEHTIQCMKTKNGDEEITRDMPNVSDTAKRFLDNQGIVLVGAEVHEGDVLVGKTTPRGNVETAPEDRLLQTIFGDKSKTVKDSSLKVKHGQEGIVAAVKRIKSSDENGSELPDDVIEIIKVYIVQKRKIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPLDIMLNPLGVPSRMNIGQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISLFGINEIIAKKLYENISNLIKHKQAKQA----KDIDLIDVTIILKELGLSYDDIGIKISTPVFDGANHDDIVSIMNEANIDIENNK------GKQVLYDGRTGEPFDGLISVGLTYMLKLDHMVDDKIHSRSVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAYNLLEILTIKSDDVQGRNQAYNAIIKGHDVVADGMPESFKLLTKQMQGLGLCITV-----ETKDDRMVDINEYTLN--QNRLNNDDDEVILDE 1406
>gi|98991114|gb|ABF60575.1| RNA polymerase beta subunit [Mycoplasma iowae] (755 aa)
Score = 3159, Expect = 0.0e+00, Identities = 617/757 (81%), Positives = 684/757 (90%)
  Q:   514 LIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEV 1270
           LI ELLK R+QAGL RIEKFINDKLAIADGANK QE++EE   +K++TVKSIINTKPFQ++FKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLA+YA  DENGFLITPYR+VKNGVITDEI+WLTAL EDEY+IACSNL+V+ NKF ED VLCRYRSSW++FDV  VD+IDI+PKQVVSIAASSIPFLENDDANRALMGANMQRQATPLI P APIVGTGNEYKIAHDSGMA VY+ ++ G V YVDG  I IK+   EK Y+L KFNKSNQNTCNN +PIV+VG+KV K  TIADGP+M+NGELALGQN LVAFTTWSGYNYEDAIILSKRLF ED+FTSIHIVEYS++CLKTKNGDEEITRD+PNVSESSK+YLDDEG+IMVGAEVKEGDVLVGKISPKGQVEL+ EEKLLQAIFGDKSKN+KETSLKVPHGGEGTVA++KRFKV+DDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVP+EDMPHLEDGT IDIMLNPLGVPSRMNIGQILELHLGLAM+K++L K LE+ ++K+    F+ WFGI  + S+ LI   +++L EK I +L+QA   FT+FD S+ LSR+GISR+++ YK +TPVFEGV R DL EAM EAGI P++ K   GK+GKF LIDGRTGEYFDG++SVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEV
  S:     1 LIHELLKARSQAGLARIEKFINDKLAIADGANKVQEENEEA--RKAVTVKSIINTKPFQMTFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLASYADADENGFLITPYRVVKNGVITDEIKWLTALREDEYVIACSNLHVKDNKFTEDSVLCRYRSSWDYFDVNKVDYIDIAPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLIRPTAPIVGTGNEYKIAHDSGMAIVYEEDEVGEVKYVDGKKIIIKNKKGEKQYDLLKFNKSNQNTCNNHMPIVNVGDKVKKYETIADGPSMNNGELALGQNALVAFTTWSGYNYEDAIILSKRLFNEDVFTSIHIVEYSIECLKTKNGDEEITRDVPNVSESSKRYLDDEGVIMVGAEVKEGDVLVGKISPKGQVELSPEEKLLQAIFGDKSKNYKETSLKVPHGGEGTVALIKRFKVQDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPIEDMPHLEDGTPIDIMLNPLGVPSRMNIGQILELHLGLAMRKISLKKQLEMIFNKEKPEAFTQWFGIDVDLSKILISKFKEVLKEKNITTLEQAENSFTEFDYSIVLSRAGISRDQVNYKVSTPVFEGVKRDDLIEAMNEAGIKPLDPKTTNGKNGKFKLIDGRTGEYFDGDISVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEV 755
>gi|98991110|gb|ABF60573.1| RNA polymerase beta subunit [Mycoplasma pirum] (750 aa)
Score = 2485, Expect = 0.0e+00, Identities = 496/747 (66%), Positives = 602/747 (80%)
  Q:   524 QAGLVRIEKFINDKLAIADGANKSQEQSEE-------QEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE---KNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEV 1270
           Q G+ R+E++I +KLAIADG NK+ E +EE        + K  LT+KS++N+KPFQ+  ++FFN+HQLTQFLDQQNPL+ELTNKRRISAMGPGGISREDPNLDIRDVHYSHYG+ICPIETPEGMNIGLIMSLA YA+ D NGFL++PYR VKNG ITDE+ +LTAL EDEYIIA S+ +++        +D+V+ RYRSS E ++ K VD+ID++P+QVVSIAA  IPFLENDD+ RALMGANMQRQATPL+ P AP VGTG EYKIAHDSGMA +   E  G V  V+   I IK+   +   Y L KF KSNQNTC N  PIV V +K+  G  +ADGP+M NGELALGQNVLVAFTTW GYNYEDAII+S RLF ED++TSI I EYSV C++T+NGDEEITRDIPN+SE++K+YLD++GIIMVGAEVKEGD+LVGKISPKGQV+L+ EEKLLQAIFG+K+KN +E+SLKVP+GG+G VA V+RF +  + EL+ DVIE +KVY+VQKRKIQIGDK+AGRHGNKGI+SKIVPVEDMPHLEDGT +DIMLNPLGVPSRMNIGQI E+HLGLA ++L   ++++  ++ K     S  FG++  +++ LI+N +  L E++I +   A  +    D+ + L +SG+S + L YK ATPVFEGVN  DLK+ M EA ID           GKF LIDGRTGE F+  ++VG+MYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEV
  S:     1 QTGMARMERYIREKLAIADGTNKNVEVNEETGEFVETDKQKTRLTIKSVVNSKPFQLVIRDFFNTHQLTQFLDQQNPLSELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGRICPIETPEGMNIGLIMSLAFYATIDNNGFLMSPYRKVKNGKITDEVEYLTALREDEYIIAGSSASMKVSADGSIGDDQVIARYRSSQELYNPKLVDYIDVAPRQVVSIAAGLIPFLENDDSARALMGANMQRQATPLLKPYAPTVGTGVEYKIAHDSGMAII--AENSGKVVSVNSDKIVIKNDDGKLDNYSLVKFEKSNQNTCYNHTPIVEVNQKINAGQVVADGPSMKNGELALGQNVLVAFTTWRGYNYEDAIIISDRLFREDVYTSITINEYSVQCVRTRNGDEEITRDIPNISENAKRYLDEDGIIMVGAEVKEGDILVGKISPKGQVDLSVEEKLLQAIFGEKTKNIRESSLKVPNGGDGIVAAVRRFSIAKNDELDDDVIELVKVYIVQKRKIQIGDKIAGRHGNKGIVSKIVPVEDMPHLEDGTPVDIMLNPLGVPSRMNIGQIFEIHLGLAARELAKKELIQATFEPKGDEYISELFGLNLRSAKTLIQNFKSHLKERKISNAIDAKNKVKTIDIDITLRQSGLSYDDLAYKIATPVFEGVNMGDLKDIMKEANIDT------NKNFGKFKLIDGRTGEAFEKPITVGVMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEV 750
>gi|169351744|ref|ZP_02868682.1| hypothetical protein CLOSPI_02525 [Clostridium spiroforme DSM 1552] >gi|169291966|gb|EDS74099.1| hypothetical protein CLOSPI_02525 [Clostridium spiroforme DSM 1552] (1224 aa)
Score = 2348, Expect = 0.0e+00, Identities = 566/1335 (42%), Positives = 792/1335 (59%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIV-HNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITD-EIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDP-INGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           RR+YS+I  +   PNL+ +Q N++  F +  ++   + I+PI +     SLE++    ++ K S +E+++    Y  P+   L +V++ +GE+K+              +F    P++T+ GTFI+NG E+ ++SQ+VRSPGAY        L  S K +  G    I+P++GT +  F  + KD + V       +    +P T  L+ALGL + +EI+ +F  H+ I N+L  +  N  ++ E   LI +   L   +     G +     LF K+   K    A+    + +K+L+ +++ I     A+DL+        +ID            Q +I      +    + +AG     R+++ + RL          + NG + I          LD     TK  K+ ++  +++LD +   +++++            +      ++    SLD   L+  D ++  S +  LD       DIDHLGN+R++ + EL++ + + GL R+E+ + +++++++                S+T +S+ N +P   + KEFF+S QL+QF+DQ NPLAELTNKRR+SA+GPGG+SR+    ++RDVH SHYG+ICPIETPEG NIGLI +LA+YA  +E GF+ TPYR V N +I + ++R+LTA  E  YIIA SN+  ++N    +++V+ R+         +++DFIDISPKQ+VS+A S IPFLENDDA RALMGANMQRQA PL++P  P VGTG E++ A DSG A V    +DG V YVD   I I+     E  Y L KF  SN  TC NQ PIV  GE V KG  IADGPAM  GELALGQNVLV F  W+GYNYEDA+I+S+RL  ED++TSIHI EY+++C  TK G EEITRDIPNV + ++K L+ +GIIM+GAEVKEGD+LVGK++PKGQ EL++EEKLL AIFG+KS+  K+ SL+VPHGG G V  +K F+ ++  EL   V + +KVY+VQKRKI  GDKMAGRHGNKG+ISKI+P+EDMPHLEDGT +DIMLNPLGVPSRMNIGQ+LELHLG A ++L L       Y   PA D     G+H         +LE I+ E                                                    M++ G  P I+G+ GE               YFD  +SVGIMYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+QNGGQRFGEMEVWALEAYGAA+ LRE+LT+KSDDV GR  TY AI+KG+P+PE GLPESF++L K+LQ L L V +  E    N  + ++I E
  S:    14 RRNYSRISGSLELPNLVEIQTNSYKWFKEVGIKEVFEDIYPITNFNETLSLEFVDCVFDEAKHSVEESKDRDANYAAPIRASLRLVNSTTGEIKEQE------------VFMGDFPLMTDSGTFIINGAERVIVSQLVRSPGAYFAD----ALDKSGKTVFNG---SIIPSRGT-WLEFENDAKDVLNVRI-----DRNRKMPGTVLLRALGLSSNDEIIKVFGEHEFILNTLAKD--NTTNMEEA--LIEIYNKLRPGEPATLEGANNL---LFAKFFDCKRYDLAKAGRFKFKKKLS-LLDRISGRVLAEDLI--------DIDGNVIYPEGTYITQEVI------DVIKPVLEAG--AHTREIKTNPRL----------ESNGVIQI----------LDVYVDDTKSKKMRVIGTDLSLDSKFVTISDMIA-----------AYSYMFNLVDIYNSLD---LTAEDRVNFMSRIGLLD-------DIDHLGNRRVRSVGELIQNQFRIGLSRMERVVKERMSLSE--------------VDSITPQSLTNIRPLTAAIKEFFSSSQLSQFMDQINPLAELTNKRRLSALGPGGLSRDRAGYEVRDVHASHYGRICPIETPEGPNIGLITTLASYAKINEYGFIETPYRKVNNCIIDENDVRYLTADEEKNYIIAQSNVKTDENGTILDEQVIARHLGENIMAKREEIDFIDISPKQIVSVATSCIPFLENDDATRALMGANMQRQAVPLLNPHTPFVGTGMEHQAARDSGAAVV--AREDGIVKYVDAKKIIIEDNEGVEHRYRLAKFKISNAGTCINQKPIVKDGEAVLKGQVIADGPAMEQGELALGQNVLVGFMEWNGYNYEDAVIMSERLVKEDVYTSIHIDEYAIECRDTKLGPEEITRDIPNVGDDARKNLNSDGIIMIGAEVKEGDILVGKVTPKGQAELSAEEKLLLAIFGEKSREVKDNSLRVPHGGAGIVHDIKVFERKNGDELQPGVNKVVKVYIVQKRKISEGDKMAGRHGNKGVISKILPIEDMPHLEDGTPLDIMLNPLGVPSRMNIGQVLELHLGYAARQLGL-------YIATPAFD-----GLHPS-------DLEDIMAEA--------------------------------------------------GMSKDGKQPVISGRTGE---------------YFDNNISVGIMYMIKLAHMVDDKLHARSVGPYSLVTQQPLGGKAQNGGQRFGEMEVWALEAYGAAYTLREILTVKSDDVVGRVKTYEAIVKGQPLPEPGLPESFRVLKKELQALALDVRLLDE--NDNEVDMRNIEE 1162
>gi|167757656|ref|ZP_02429783.1| hypothetical protein CLORAM_03206 [Clostridium ramosum DSM 1402] >gi|167702653|gb|EDS17232.1| hypothetical protein CLORAM_03206 [Clostridium ramosum DSM 1402] (1223 aa)
Score = 2337, Expect = 0.0e+00, Identities = 511/1026 (49%), Positives = 679/1026 (66%)
  Q:   326 AKDLVINLSISTKNIDSKFRLSNKETT--YQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL--DYD---------------IGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITD-EIRWLTALSEDEYIIACSNLNVEKNKFKED-KVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDP-INGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           AKD   N   +   I +K R     T     +++Y  FF  K +DL+KAGRFK  +K+ L +R+  R+LAEDL D++G VV  + T++ +   DTIK + + G     H   LD      +N V  + ++VY D D++ + + +IGTD SLD   ++ISD+++  SY+ NL   YD               IG  DDIDHLGN+R++ + EL++ + + GL R+E+ + +++++++                S+T +S+ N +P   + KEFF+S QL+QF+DQ NPLAELTNKRR+SA+GPGG+SR+    ++RDVH SHYG+ICPIETPEG NIGLI +LA+YA  ++ GF+ TPYR V N VI + ++R+LTA  E  YIIA +N+  +K+    D +V+ R+         ++VD+IDISPKQ+VS+A S IPFLENDDA RALMGANMQRQA PL++P  P VGTG E++ A DSG A V    +DG V+YVD   + ++     E  Y L+KF  SN  TC N  PIV  GEKV KG  +ADGPAM  GELALGQNVLV F  W+GYNYEDA+I+S+RL  +D++TS+HI EY+++C  TK G EEITRDIPNV + ++K L+ +GIIM+GAEVKEGD+LVGK++PKGQ EL++EEKLL AIFG+KS+  K+ SL+VPHGG G V  +K F+ ++  EL   V + +KVY+VQKRKI  GDKMAGRHGNKG+ISKI+P+EDMPHLEDGT +DIMLNPLGVPSRMNIGQ+LELHLG A ++L L       Y   PA D     G+H         +LE I+ E                                                    M++ G  P I+G+ GE               YFD  +SVGIMYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+QNGGQRFGEMEVWALEAYGAA+ LRE+LT+KSDDV GR  TY AI+KG+P+PE GLPESF++L K+LQ L L + +  E    N  + ++I E
  S:   222 AKDNTTNTEEALIEIYNKLRPGEPATLEGANNLLYTRFFDCKRYDLAKAGRFKFRKKLSLLDRIAGRILAEDLVDVDGNVVYPEGTVVTQEVSDTIKPIFEAG----AHTRELDTNPRLESNGV-IQVLDVYVD-DTKTKKMRVIGTDLSLDSKFVTISDMMAAYSYMFNLVDIYDALDLTAEDRVNLMARIGLLDDIDHLGNRRVRSVGELIQNQFRIGLSRMERVVKERMSLSE--------------VDSITPQSLTNIRPLTAAIKEFFSSSQLSQFMDQINPLAELTNKRRLSALGPGGLSRDRAGYEVRDVHASHYGRICPIETPEGPNIGLISTLASYAKINQYGFIETPYRKVNNCVIDEHDVRYLTADEEKNYIIAQANVRTDKDGTILDAQVIARHLGENIMAKREEVDYIDISPKQIVSVATSCIPFLENDDATRALMGANMQRQAVPLLNPHTPFVGTGMEHQAARDSGAAVV--SREDGIVTYVDAKKVIVEDNEGVEHRYRLSKFKISNNGTCINHKPIVKTGEKVLKGQVLADGPAMEQGELALGQNVLVGFMEWNGYNYEDAVIMSERLVKDDVYTSVHIDEYAIECRDTKLGPEEITRDIPNVGDEARKNLNSDGIIMIGAEVKEGDILVGKVTPKGQAELSAEEKLLLAIFGEKSREVKDNSLRVPHGGAGIVHDIKVFERKNGDELQPGVNKVVKVYIVQKRKISEGDKMAGRHGNKGVISKILPIEDMPHLEDGTPLDIMLNPLGVPSRMNIGQVLELHLGYAARQLGL-------YIATPAFD-----GLHPS-------DLEDIMAEA--------------------------------------------------GMSKDGKQPVISGRTGE---------------YFDNNISVGIMYMIKLAHMVDDKLHARSVGPYSLVTQQPLGGKAQNGGQRFGEMEVWALEAYGAAYTLREILTVKSDDVVGRVKTYEAIVKGQPLPEPGLPESFRVLKKELQALALDIRLLDE--NDNEVDMRNIEE 1162
Score = 304, Expect = 3.9e-25, Identities = 77/251 (30%), Positives = 134/251 (53%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSL--DNEIYNEKDVFE 260
           E    + RR+YS+I  +   PNL+ +Q N++  F +  ++   + I+PI +     SLE++    ++ K S +E+++    Y  P+   L +V++ +GE+K+              +F    P++T+ GTFI+NG E+ ++SQ+VRSPGAY        L  S K +  G    I+P++GT +  F  + KD + V       +    +P T  L+ALGL + +EI+++F  H+ I N+L  DN    E+ + E
  S:     7 EAKSKITRRNYSRISGSLELPNLVEIQTNSYKWFKEVGIKEVFEDIYPITNFNETLSLEFVDCTFDEAKYSVEESKDRDANYAAPIRASLRLVNSGTGEIKEQE------------VFMGDFPLMTDSGTFIINGAERVIVSQLVRSPGAYFAD----ALDKSGKTVFNG---SIIPSRGT-WLEFETDAKDVLNVRI-----DRNRKMPGTVLLRALGLSSNDEIIDVFGEHEYIINTLAKDNTTNTEEALIE 235
>gi|67937436|gb|AAY83285.1| RNA polymerase beta subunit [Mycoplasma imitans] (670 aa)
Score = 2270, Expect = 0.0e+00, Identities = 452/674 (67%), Positives = 545/674 (80%)
  Q:   591 QNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQR 1264
           QNPL+ELTNKRRISAMGPGGISREDPNLDIRDVHYSHYG+ICPIETPEGMNIGLIMSLA YA+ D+NGFL+TPY  V+NG ITD++  LTAL EDEYIIA   S +NV K+   + +K++ RYRSS + +D K VD+ID+SPKQVVS+AAS IPFLENDD++RALMGANMQRQATPL+ P +P+VGTG EYKIA DSGM  +   +K GTV+YVD   I IK    +K  Y L KF KSN+NTC NQ PIV+VG+KV     +ADGP+M NGE+ALGQNVLV FTTWSGYNYEDA+I+S RLF ED+++SIHI EY+++CL+TKNGDEEITRDIPN+SES+K+YLD+EG+IMVGAEVKEGD+LVGK SPKGQVEL+ EEKL+QAI GDK K  +E+SLKVP+GG+G VA +KRF + +  EL  DV+E +KVYVVQKRKIQIGDK+AGRHGNKGIISKIV  EDMPHLEDGT +DI+LNPLGVPSRMNIGQI ELHLG A ++L   +++E  +D K A++ +  FG+ +  + +LIKNL + +    + +L+QA        + + L + G++ + L +K ATPVFEGVN  DLK  M+EAGIDP      +   GKF LIDGRTGE F+  +SVGIMYMLKLDHMVDDKIH+RAVGPYSKITQQPLGGKSQNGGQR
  S:     1 QNPLSELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGRICPIETPEGMNIGLIMSLAFYATIDKNGFLMTPYLKVENGKITDKVEHLTALREDEYIIAEASSYMNVAKDGTIQNEKIIARYRSSQDLYDPKQVDYIDVSPKQVVSVAASLIPFLENDDSSRALMGANMQRQATPLLKPYSPLVGTGVEYKIAQDSGM--LVTAKKPGTVTYVDASKITIKDEDNKKTDYNLLKFVKSNKNTCYNQSPIVAVGDKVDANQALADGPSMKNGEIALGQNVLVGFTTWSGYNYEDAVIISDRLFKEDVYSSIHIDEYTIECLRTKNGDEEITRDIPNISESAKRYLDEEGVIMVGAEVKEGDILVGKTSPKGQVELSPEEKLIQAILGDKVKGVRESSLKVPNGGDGIVAGIKRFSIANGDELEDDVLELVKVYVVQKRKIQIGDKVAGRHGNKGIISKIVAQEDMPHLEDGTPLDILLNPLGVPSRMNIGQIFELHLGYAARELANKRLIEACFDDKLAAELNTIFGLDKSKTDSLIKNLVQHMKSIGVTNLNQAKNLVRTIHIDIVLKQLGLTYDDLAFKIATPVFEGVNMDDLKSIMSEAGIDP------DKTEGKFKLIDGRTGEPFEKPISVGIMYMLKLDHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQR 670
>gi|73697639|gb|AAZ81436.1| RNA polymerase beta subunit [Mycoplasma cavipharyngis] (668 aa)
Score = 2255, Expect = 0.0e+00, Identities = 453/674 (67%), Positives = 539/674 (79%)
  Q:   591 QNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYII--ACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQR 1264
           QNPL+ELTNKRRISAMGPGGI+R+DPNLDIRDVHYS+YG+ICPIETPEGMNIGLIMSLATY+  DE GF+ +PY  VKNG ITDEI WLTAL EDEY+I  A S  N EKN+     V  RYRS  E FD KDVD+ID++P QVVSI+ +SIPFLENDDANRALMGANMQRQATPL+ P AP VGTG EY IA DSGMA V   + DGTV  VDG ++ I+       K Y LTKF +SNQ+T N+Q PIV VGEKV K   + DGPAM NGELALGQNVL+AFTTWSGYNYEDAI+LS RL  +DIFTSIHI E++++CL+TKNGDEEITR IPNVS+ +K+YLD++GIIMVGAEV EGD+LVGK SPK QVE TSEEKLLQAIF +K +  K++SLKVPHGGEG VA VKRF V+   +LN DVIE IK+++ QKRKIQ+GDKMAGRHGNKGI+S+IVP+EDMPHLEDGT IDI+LNPLGVPSRMNIGQ+LE+HLGLA +KL L ++++ ++     S  S  FG+ E + + L+KN ++ L   +I + ++ANK+  + +L + L +SG++ E L YK  TPVF GVN+ DL E M EAGIDPI  K      GKF+L DGRTGE F+  ++VGI YMLKLDHMVDDKIH+R+VGPYSKITQQPLGGKSQNGGQ+
  S:     1 QNPLSELTNKRRISAMGPGGINRDDPNLDIRDVHYSNYGRICPIETPEGMNIGLIMSLATYSRIDELGFITSPYYKVKNGQITDEITWLTALREDEYVITEAISARN-EKNELLS-PVNARYRSFIESFDAKDVDYIDVNPSQVVSISTASIPFLENDDANRALMGANMQRQATPLLKPYAPTVGTGLEYAIARDSGMALV--AKADGTVVAVDGDSLSIRYDHAGVNKRYHLTKFKRSNQDTSNSQTPIVRVGEKVFKDQILVDGPAMQNGELALGQNVLIAFTTWSGYNYEDAIVLSSRLVEDDIFTSIHIDEHTIECLRTKNGDEEITRQIPNVSDDAKRYLDEDGIIMVGAEVYEGDILVGKTSPKAQVEQTSEEKLLQAIFAEKVRQVKDSSLKVPHGGEGVVAAVKRFSVQSGNDLNDDVIEIIKIFIAQKRKIQMGDKMAGRHGNKGIVSRIVPIEDMPHLEDGTPIDILLNPLGVPSRMNIGQVLEMHLGLAARKLVLKELIKAHFTNLDHSVISQMFGVRESSIKLLMKNFKEHLATLKIDTQEKANKKLNNLNLVIILQKSGLTIEDLNYKICTPVFSGVNQKDLVEIMQEAGIDPIKTK------GKFDLYDGRTGEKFEHPIAVGISYMLKLDHMVDDKIHARSVGPYSKITQQPLGGKSQNGGQK 668
>gi|163813884|ref|ZP_02205278.1| hypothetical protein COPEUT_00037 [Coprococcus eutactus ATCC 27759] >gi|158450754|gb|EDP27749.1| hypothetical protein COPEUT_00037 [Coprococcus eutactus ATCC 27759] (1293 aa)
Score = 2244, Expect = 0.0e+00, Identities = 539/1328 (40%), Positives = 774/1328 (58%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKP--KRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKIN--VYQDNDSQDEFIPIIGTDTSLDKPT-LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV-----KNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK--VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNN 1344
           R  Y+K +   + PN + +QKN+++ F+   L    + I PI    G+YSLE++  +  K   K S +E +    TY  PL V + +   ++ ++ +              IF   +P++TE GTF++NG E+ ++SQ+VRSPG Y      I      K++   Y C ++P +G  +  +  ++ D   V       + T  +P+T  ++ALGL   +EI+++F     I  SL+                         D  +SY     + EL+KK   ++    +  +NAE       +IN +  +    DL        K    KF   NK+   ++ I  H  +  + D S       A            V++E+L D      +    +IQ  E +   ++     + I + V+ D     +   V Y  +   + +  D  ++    +  D S   P  ++  DI +  +Y I+L+Y IGF DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               +S+T +S+IN KP   + KEFF S QL+QF+DQ NPL+ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI SLATYA  +E GF+  PYR +     KN V+TDE+ +LTA  ED Y +  +N  ++ +  F  + V  R+R+    F    VD +D+SPK V S+A S IPFL+NDDANRALMG+NMQRQA PL+   + +VGTG E K A DSG+  V   ++DG V Y +   I I++  + K  VY + KF +SNQ  C NQ PIV  G+ V  G  IADGP+ S GE+ALG+N L+ F TW GYNYEDA++LS+RL  +D++TSIHI +Y  +   TK G EEITRD+  +S    K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G V   K F   D  +L A V ++++VY+ QKRKIQ+GDKMAGRHGNKG++S+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HLGLA + L       ++     A++F            +++  LE         + D AN  + DF+          ++ K   K     F   NR    E     G+ PIN      ++GK  L DGRTGE FD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG+ IP  G+PESFK+L K+ Q LGL V + +E    + N
  S:    16 RMSYAKQKDVLDMPNFIEVQKNSYNWFLTDGLREAFRDISPITDYSGQYSLEFVDFQFCKNDLKYSIEECKERDATYAAPLRVKVRLRVKDAPDMPEYE------------IFMGDLPLMTETGTFVINGAERVIVSQLVRSPGIYY----DITHDKVGKKL---YACTVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPVTVLIRALGLGTDQEIIDLFGEEPKIMESLNK------------------------DPAKSY--SEGVVELYKK---IRPDEPSVVENAE------SLINAMFFDARRYDL-------AKVGRYKF---NKKLALKARIAGHVLAEDAIDPSTGEVIAEA----------GTVVSEELADTIQDAAVPY-VMIQTEERNV--KVLSNMMVNIANYVDFDPAELGIVERVYYPVLEGLLEEYGDDTEKLKAAVERDMSDLVPKHITKEDIFASINYNIHLEYGIGFDDDIDHLGNRRIRAVGELLQNQYRIGLSRLERVVRERMTTQDA--------------ESITPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLSELTHKRRLSALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPEGPNIGLINSLATYARINEYGFVEAPYRRLDKTDPKNPVVTDEVVYLTADEEDRYRVVQANEPIDADGHFVRNNVSGRFRADTTEFPKSKVDLMDVSPKMVFSVATSMIPFLQNDDANRALMGSNMQRQAVPLMMTESAVVGTGMEAKAAVDSGVCVV--AKRDGVVEYSNSTEICIRADEDGKKDVYHVIKFARSNQGNCMNQRPIVFKGDHVKAGDVIADGPSTSGGEIALGKNPLIGFMTWEGYNYEDAVLLSERLVRDDVYTSIHIEKYECEARDTKLGKEEITRDLAGLSNDVLKDLDENGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGAFGIVIDAKVFTRADGDDLPAGVDKKVRVYIAQKRKIQVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLGLASQVLGFKVSTPVF---NGATEF------------DIMDTLE--------MANDYANGTWEDFE----------AKYKDTVKPEVMDFLYKNRDHRAEW---KGV-PIN------RTGKVQLRDGRTGENFDAPVTIGYMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVIGRVKTYEAIIKGENIPAPGVPESFKVLLKEFQALGLDVRVVREEDDEDGN 1215
>gi|168334900|ref|ZP_02693021.1| DNA-directed RNA polymerase, beta subunit [Epulopiscium sp. 'N.t. morphotype B'] (1420 aa)
Score = 2228, Expect = 0.0e+00, Identities = 543/1337 (40%), Positives = 775/1337 (57%)
  Q:     1 MSKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLE-KPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKE-EILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPT-LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK---NG--VITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS--EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANK--EFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           M K K    E+ K V R  Y+   + F  PNL+ +Q +++  F++  L+   K I PI    G   LE+I   L+   K + +EA+ +   Y   L V + + + E+GE            S  + +F   +P++TE G+FI+NG E+ ++SQ+VRSPG Y       +     KR+   +   ++P +G  +  +  ++ D   V       + T  +P+T  ++AL L    EI+++F     I  S++ +  N  +    + LI + K +   +       +T L  +F  + S +  L   G+    +K     + N +      + V+N+       ++  ++S +      II N   SN   ++S                           D++  VV+  N ++   +   I ++    + GI  NV        +A ++        ++N   DE   +I    +   P  ++  DI +  +YVINL+Y IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++            ++  EP      ++ IN +P   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG+SRE    ++RDVHYSHYG++CPIETPEG NIGLI SLAT+A  +E GF+  PYRIVK   NG  V+T+E R++TA  E+ Y I  +   +  +  F   K+  R R     FD K++D +DIS +Q+VS+A + IPFLENDDANRALMGANMQRQA PLI   +PIVGTG E K A D+G+  +   ++DG    V    I I+       +VY LTKF +SNQ TC NQ P++S G+ V KG  IADGP+  NGELALGQN L+ F TW GYN+EDAI+LS+RL  ED++TS+HI EY V+   TK G EEITRDIPN +E S K LD+ GII +GAEV+ GD+LVG+++PKG+ ELT+EE+LL+AIFG+K +  ++TSL+VPHG  G +  VK F  E+D EL+  V   ++ Y+ QKRKI +GDKMAGRHGNKG+IS+++P EDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HLGLA K L   K+    +D     D                           +++L+ AN      DF+    L    +    L Y             +L+      G+ PI+      ++GK  L DGRTGE FD  V+VG M+ LKL H+VDDK+H+R+ GPY+ ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ LGL + +  +
  S:     1 MQKSKINPIEMGKQV-RMSYALSNEIFEIPNLIEIQTDSYKWFLEEGLDEVFKDISPIVDFNGNLMLEFINFSLDPHSKYTVEEAKEKDVNYAASLKVKVRLYNKETGE------------SMDNDVFMGDLPLMTETGSFIINGAERVIVSQLVRSPGIYY----NREFDKFGKRL---FSATVIPNRGA-WLEYETDSNDIFYVRV-----DRTRKVPVTVLMRALRLGTNVEIIDMFGEEPKILASIEKDGSNSYE----EGLIEIYKRVRPGEPPTVESAETLLANMF--FDSRRYDLAKVGRYKFNKK---LALKNRVKGFTLAEDVVNMVTGEVVAEAGDKISEE---LADIIQNTGTSNVKIEIS---------------------------DLDRPVVVLTNQMVDITQFVDIDKV----EFGIKENV----YYPVLAEII--------ENNSDIDEIKELIKQRMNELIPKHITSEDIFASMNYVINLEYGIGARDDIDHLGNRRIRAVGELLQNQFRIGLTRMERSVRERMT-----------TQTDEPANP---QTFINIRPVTAAIKEFFGSSQLSQFMDQNNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHYSHYGRMCPIETPEGPNIGLINSLATFARINEYGFIEAPYRIVKKDENGEPVVTEEFRYVTADEEESYTICQATEELTNDMHFVRKKITARRREEILEFDYKEIDMMDISSRQIVSVATAMIPFLENDDANRALMGANMQRQAVPLIKTNSPIVGTGMEAKAAKDAGVLII--AKEDGVAESVTSREIIIREDETMRRRVYTLTKFTRSNQGTCINQRPLISRGDFVRKGEIIADGPSTENGELALGQNPLIGFMTWEGYNFEDAILLSERLVKEDVYTSVHIEEYEVEARDTKVGTEEITRDIPNTNEESLKDLDERGIIRIGAEVRAGDILVGRVTPKGETELTAEERLLRAIFGEKVREVRDTSLRVPHGEAGIIVDVKIFTRENDDELSPGVNRMVRCYIAQKRKISVGDKMAGRHGNKGVISRVLPAEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEVHLGLAAKALGF-KIATPVFDGANEQDI--------------------------MQTLEMANDYVNLEDFEDFRDLWADKLKPSALQYL----------EDNLEHRQEWQGV-PID------RTGKIRLRDGRTGEEFDNPVTVGYMHYLKLHHLVDDKMHARSTGPYATITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGRVKAYEAIVKGENIPEPGIPESFKVLLKELQSLGLDIKVMTD 1209
>gi|167749850|ref|ZP_02421977.1| hypothetical protein EUBSIR_00818 [Eubacterium siraeum DSM 15702] >gi|167657162|gb|EDS01292.1| hypothetical protein EUBSIR_00818 [Eubacterium siraeum DSM 15702] (1261 aa)
Score = 2227, Expect = 0.0e+00, Identities = 535/1318 (40%), Positives = 762/1318 (57%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL-EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNK-EEILNIFANHKSIKNSLDNEIYNEKDVFETDE--LINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSN--KSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVN---LDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           R  +SKI +    PNL+ +QK+++  F+D  ++   K I  I    G+  L ++  +L E PK S +E +    TY  PL V   + +NE+GEV +            + IF    P++TE GTF++NG E+ ++SQ+VRSPG Y      K+  KL  S           ++P +G      M  N  F   +      +    IP T F++ALG++  ++++++F     I  ++      EKD  +  E  L+ + + L   +       +T +  LF  + + +  L   G+    +K    V + I   KAA+ ++                    TT + ++  + F N  K+  + +AG   +   +  SE    +VL   + DI G                 I +      LGI   V    L E + K  + V  E +     N  +D  IP            +++ DI +  SY INL   +G  DDIDHLGN+R++ + ELL+ + + G  R+E+ I +++ +         QS+E +    +T  ++IN +P   + KEFF S  L+QF+DQ NPLAELT+KRR+SA+GPGG+SR+  + ++RDVHYSHYG++CPIETPEG NIGLI  LA++A  ++ GF+  PYR V  + GV+ DE+ ++TA  ED Y++A +N  + E+ KF   +V  R+R      D   VD++D+SPK VVS+A + IPFLENDDANRALMGANMQRQA PL+    PIVGTG EYK A DSG  AV   ++DG V+      I +  G+  E  Y+L KF +SNQ TC NQ P V+ G ++  G  +ADGPA S GE++LG+N L+ F TW GYNYEDA++++++L   D++TSIHI EY ++C  TK G EEITR+IPNVSE + K LD+ GII +GAEV  GD++VGK++PKG+ ELT+EE+LL+AIFGDK++  ++ SL+VPHG  G +  VK F  ++  EL+  V   ++ Y+ QKRKI +GDKMAGRHGNKG++S+I+  EDMP L DGT +DI+LNPLGVPSRMNIGQ+LE+HLG A K L   +++   +D           G HE   R   +  E     +  K  D A  +F+   +                           R D K  +T                      DGRTGE FD  V+VG MY LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT+KSDD+ GR  TY AI+KG P+P++G+PESFK+L K+LQ LGL + +
  S:    14 RMSFSKINEVQKMPNLIEIQKDSYKWFLDEGIKEVFKDISSITDANGKLVLSFVDYRLDENPKYSIEECKERDTTYAAPLRVKAQLRNNETGEVVE------------NEIFMGDFPLMTESGTFVINGAERVIVSQLVRSPGVYYGFDYDKTGKKLFKS----------TVIPNRGAWLEYEMDSNDIFYVRI------DKNRKIPATTFIRALGISSDDDLIDLFGEDPRIVQTI-----QEKDATKNTEEALLEVYRKLRPGEPPTVDSANTHINNLF--FDAKRYDLARFGRYKYNKKL--GVASRIAGHKAAQPII------------------DPTTGEILVDENEFINAEKAQAVEQAG---VKECVIFSEEKIAKVLGNGMVDIAG----------------YIPESIDAESLGINEKVCFSVLREILDKCGDDV--EALTAELSNRVED-LIP----------KHITLDDIFATVSYFINLCEGVGEVDDIDHLGNRRIRSVGELLQNQFRIGFARMERVIRERMGL---------QSQEGD---KVTPNALINIRPVVAAIKEFFGSSPLSQFMDQNNPLAELTHKRRLSALGPGGLSRDRASFEVRDVHYSHYGRMCPIETPEGPNIGLISYLASFAKINKYGFIEAPYRKVDKETGVVLDEVTYMTADMEDNYVVAQANEPLDEQGKFARKRVNARFREEILEVDRDRVDYMDVSPKMVVSVATAMIPFLENDDANRALMGANMQRQAVPLMVTQNPIVGTGMEYKAAVDSG--AVVVAKEDGVVTKCSADEIVVTDGNGVEHSYKLIKFKRSNQGTCVNQRPAVTKGMEIKTGDVLADGPATSQGEISLGKNALIGFMTWEGYNYEDAVLINEKLVYNDVYTSIHIEEYELECRDTKLGPEEITREIPNVSEDALKDLDERGIIRIGAEVHSGDIMVGKVTPKGETELTAEERLLRAIFGDKAREVRDNSLRVPHGESGIIVDVKVFTRQNCDELSPGVNMVVRCYIAQKRKISVGDKMAGRHGNKGVVSRILKQEDMPFLPDGTPLDIVLNPLGVPSRMNIGQVLEVHLGYACKALDW-QIMTPVFD-----------GAHEADIRACFEKAEA--ERENYKDKDSAKIDFSKIPM---------------------------RPDCKTQLT----------------------DGRTGEKFDSPVTVGYMYYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDIVGRVKTYEAIVKGDPVPKAGVPESFKVLFKELQSLGLDIKV 1183
>gi|154503742|ref|ZP_02040802.1| hypothetical protein RUMGNA_01566 [Ruminococcus gnavus ATCC 29149] >gi|153795842|gb|EDN78262.1| hypothetical protein RUMGNA_01566 [Ruminococcus gnavus ATCC 29149] (1285 aa)
Score = 2214, Expect = 0.0e+00, Identities = 537/1321 (40%), Positives = 779/1321 (58%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNL--------NSSDS--------NRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTI-KQLTKEGKLG-IVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK-----NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           R  YS+ ++    PNL+ +QK+++  F+D  L+     I PI    G +SLE++   L  +  K + +E +    TY  PL V + + + E+ E+            N   IF   +P++T+ GTF++NG E+ ++SQ+VRSPG Y             K  +E Y   ++P +G  +  +  ++ D   V       + T  +PIT  ++ALG+    EI+++F     I  S        KD  E   + L+ L K +        +S++S         R Y +    R  F K  +LK++++ + K AE    +NE+   I++EK    +   ++ + +N  + F     E   ++I      SN   DL          ++ ++E++Y  VLA  L++  G V   K +LI++   D I K +TKE  L  I +N++L+ R                            +G D  +D                              HLGN+R++ + ELL+ + + GL R+E+ + +++   D              +  ++ +S+IN KP   + KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CPIETPEG NIGLI SLATYA  +E GF+  PYR +      N ++T+++ ++TA  ED Y +A +N  + E+  F    V  RYR   + ++    D++D+SP+ V S+A + IPFLENDDANRALMG+NMQRQA PL++  AP VGTG E K A DSG+  V   E+ G V      +I IK     +K Y+LTKF +SNQ+ C NQVPIV  GE+V  G  IADGP+ SNGE+ALG+N L+ F TW GYNYEDA++LS+RL  ED++TS+HI EY  +   TK G EEITRDIP V + + K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G +   K F  E+  EL+  V + +++Y+ QKRKI +GDKMAGRHGNKG++S+++PVEDMP+L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   +   A+ N I +   + N       D  N E+ DF+      + G   E+L+ +    + +      L + +      P++      + GK  L DGRTGEYFD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG+ IPE G+PESFK+L K+LQ L L V + ++
  S:    16 RMSYSRQKEVLEMPNLIEVQKDSYQWFLDEGLKEVFDDISPISDYAGHFSLEFVDFTLCEDDVKYTIEECKERDATYAAPLKVRVRLYNRETDEI------------NEHEIFMGDLPLMTKTGTFVINGAERVIVSQLVRSPGIYYGIAHD-------KLGKELYSSTVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPITVLIRALGIGTNAEIIDLFGEEPKILASFG------KDTAENYQEGLLELYKKIRPGEPLAVDSAESLITSMFFDPRRYDLAKVGRYKFNKKLALKNRIKGQ-KVAEDV--VNELTGEIVAEKGTL-ITAEIADAIQNSGAPFVWVEGEDESRNI---KILSNMMVDLQAVVDID-PEEVGVTEQVYYPVLAGLLEESAGDVEELK-SLIKRDIHDLIPKHITKEDILASINYNIHLEYR----------------------------MGNDDDID------------------------------HLGNRRIRAVGELLQNQYRIGLSRLERVVRERMTTQD--------------QDGVSPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPIETPEGPNIGLINSLATYARINEYGFIEAPYRKIDKTDPMNPIVTEDVVYMTADEEDNYHVAQANTPLDEEGHFLHKNVSGRYREETQEYERSKFDYMDVSPQMVFSVATALIPFLENDDANRALMGSNMQRQAVPLLTTEAPAVGTGMEVKAAVDSGVCMV--AERAGVVESSTSTSITIKHDDGTKKTYKLTKFLRSNQSNCYNQVPIVDKGERVEAGQVIADGPSTSNGEMALGKNPLIGFMTWEGYNYEDAVLLSERLVAEDVYTSVHIEEYEAEARDTKLGPEEITRDIPGVGDDALKDLDERGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGEYGIIVDAKVFTRENGDELSPGVNQSVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPYLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKAL----------------GFNVATPVFGGANENDIMDTLDLAN-------DYVNMEWEDFE-----KKHG---EELLPEVLQYLSDNREHRALWKGV------PLS------RDGKVRLRDGRTGEYFDSPVTIGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVVGRVKTYEAIIKGENIPEPGIPESFKVLLKELQSLALDVRVLRD 1209
>gi|160881805|ref|YP_001560773.1| DNA-directed RNA polymerase, beta subunit [Clostridium phytofermentans ISDg] >gi|160430471|gb|ABX44034.1| DNA-directed RNA polymerase, beta subunit [Clostridium phytofermentans ISDg] (1278 aa)
Score = 2210, Expect = 0.0e+00, Identities = 546/1365 (40%), Positives = 785/1365 (57%)
  Q:     1 MSKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGR-FKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDN-DSQDEFIPIIGTD-TSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV-----KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG---KANNNNFKDINEYISNITNNAIKNDE 1365
           M K +    ++ K V R  YSK ++    PNL+ +QK+++  F++  L      I PI+      SLE++  +L  +  K S +E +    TY  PL V + + + E+ E+            N   IF   +P++TE GTF++NG E+ ++SQ+VRSPG Y      I+     K +       ++P +G  +  +  ++ D   V       +    +PIT  L+A+G+ +  EI+ +F     I  S   +     D ++ D L+ L K L   +       ++ +  +F  +   +  L   G+    +K             A K+ V+   ++   +D++                         L++AG     A  +R+  R  + +L +  +     VV+  N ++   E  T+    +E  LGI                V Y  + +  D+  SQ+E    +    T L    ++  DI +  +Y ++L+Y IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               + ++ +S+IN KP   + KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CPIETPEG NIGLI SLA+YA  ++ GF+  PYR V     +N  +T+E+ +LTA  ED+Y++A +N  + E   F    V  RYR     +  + VD +D+SPK V S+A + IPFL+NDDANRALMG+NMQRQA PL+   AP+VGTG E K A DSG+  V   +K GTV       + IK+    K  Y L KF +SNQ TC NQ PIV  G+KV  G  IADGP+ +NGELALG++ L+ F TW GYNYEDA++LS+RL  ED++TS+HI EY  +   TK G EEITRD+P V + + K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G +   K F  E+  EL+  V + ++VY+ QKRKIQ+GDKMAGRHGNKG++S+++P EDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA      S+VL           F++   + + A+   I +  ++ N+     LD+   ++ D  L   +    +S E   Y+     +EGV               PIN      + GK  L DGRTGEYFD  V+VG M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LT+KSDDV GR  TY AIIKG  I E G+PESFK+L K+LQ L L V++  E G   K   N      E+   I  +  K DE
  S:     1 MDKNRIRPIKVGKGV-RMSYSKQKEVLEMPNLIEVQKDSYQWFLEEGLNEVFDDISPIEDYSDHLSLEFVSFQLCEDDVKYSIEECKERDATYAAPLKVKVRLRNKETEEI------------NEHDIFMGDLPLMTETGTFVINGAERVIVSQLVRSPGIYY----AIQHDKVGKTLHSS---TVIPNRGA-WLEYETDSNDVFYVRV-----DRNRKVPITVLLRAMGIGSNAEIVEMFGEEPKILASFSKD---PSDNYQ-DGLLELYKKLRPGEPLSVESAESLINSMF--FDPRRYDLAKVGRFKFNKK------------LALKNRVLGFPLAEDVVDTE---------------------TGEILAEAGTIITEALAIRIQNRAVKSILVQAEER---NVVVLSNMMVDFEEYATLDCDKEE--LGITEE-------------VYYPALRMILDSCSSQEEIKDAVAKHITDLIPKHITKDDIYASINYNMHLEYGIGNEDDIDHLGNRRIRAVGELLQNQYRIGLSRMERVVRERMTTQD--------------LEGISPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPIETPEGPNIGLINSLASYARINQYGFIEAPYRKVDRTDPENPRVTEEVVYLTADEEDKYVVAQANEPLDETGYFVNQSVSGRYREETSSYQKRKVDLMDVSPKMVFSVATAMIPFLQNDDANRALMGSNMQRQAVPLLFTEAPVVGTGMELKTAVDSGVCVV--SKKAGTVEKSTSREVIIKNDDGTKSSYRLVKFARSNQGTCINQRPIVVKGDKVEAGEVIADGPSTANGELALGKSPLIGFMTWEGYNYEDAVLLSERLVQEDVYTSVHIEEYEAEARDTKLGPEEITRDVPGVGDDALKDLDERGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGEYGIIVDAKVFTRENGDELSPGVNQTVRVYIAQKRKIQVGDKMAGRHGNKGVVSRVLPAEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLA------SRVL----------GFNVSTPVFDGANEYDIMDTLELANDYVNAPLDKFEAKYKDI-LDPEVMDYLVSNED--YRKQ---WEGV---------------PIN------RDGKVRLRDGRTGEYFDSAVTVGFMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAHILQEILTVKSDDVTGRVKTYEAIIKGDNISEPGIPESFKVLLKELQSLALDVTVLDENGDEVKMTENIDYGETEFTQYIEEDNFKYDE 1239
>gi|121534751|ref|ZP_01666572.1| DNA-directed RNA polymerase, beta subunit [Thermosinus carboxydivorans Nor1] >gi|121306771|gb|EAX47692.1| DNA-directed RNA polymerase, beta subunit [Thermosinus carboxydivorans Nor1] (1276 aa)
Score = 2163, Expect = 0.0e+00, Identities = 471/977 (48%), Positives = 629/977 (64%)
  Q:   361 FFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERIS---KMANVVKYEKINVYQDNDSQDEFIPIIGTDT-SLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS--GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           FF  K +DL+  GR+K+ +K+    R+  + L E         +I K T                G++ +     +DE+++   + + V  +E +  ++        I +I   +      T++  DI++  SY++NL    G  DDIDHLGN+RL+ + ELL+ + + GL R+E+ + +++ I D                 +T +++IN +P   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG+SRE    ++RDVH+SHYG++CPIETPEG NIGLI SL+T+A  +E GF+ TPYR V  +N  +TDE+ +LTA  EDE +IA +N  + E   F + +V  RY+        + VD++D+SPKQVVSIA + IPFLENDDANRALMGANMQRQA PL+   AP+VGTG EYK A DSG+  +   +  G V  V    I++++  GS +  Y+L K+ +SNQ TC NQ PIV  G++V KG  +ADGP+ +NGELALG NVLVAF  W GYNYEDAI+LS+ L  EDIFTSIHI EY  D   TK G EEITRDIPNVSE   + LD+ GII VGAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G +  VK F  E+  EL   V + ++VY+ QKRKI  GDKMAGRHGNKG++S+I+PVEDMP L DG  + I+LNPLGVPSRMNIGQ+LE HLG A   L L                           +N+  N+E+ L E              D    L    +G+         ATPVF+G    D+ + +  AG+          ++GK  L DGRTGE FD  V+VG +YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLT+KSDDV GR  TY AI+KG+ +PE G+PESFK+L K+LQ +GL V +  E
  S:   257 FFDPKRYDLAAVGRYKLTKKLGWRRRIMGKTLHEP--------IINKET----------------GEIIVPEGTVVDEKVAARIEASGVFNHEGLIEFKIRQKDGAVIKVIANPSLPYSHRTITREDIIAAISYLLNLMDGHGKVDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMTIQD--------------IDVITPQALINIRPVVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTFARINEFGFIETPYRKVDKENRRVTDEVHYLTADEEDEVVIAQANEEISEDGWFVQPRVTVRYKHDILVVPAEQVDYMDVSPKQVVSIATAMIPFLENDDANRALMGANMQRQAVPLLKTQAPLVGTGMEYKAACDSGVVVL--AKNAGVVEKVTATEIQVRTDKGSLD-TYKLLKYMRSNQGTCINQKPIVYKGQRVEKGQPLADGPSTNNGELALGYNVLVAFMPWEGYNYEDAILLSEELVKEDIFTSIHIEEYECDARDTKLGPEEITRDIPNVSEDVLRDLDERGIIRVGAEVRPGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGEAGKIVDVKVFTRENGDELPPGVNQLVRVYIAQKRKISEGDKMAGRHGNKGVVSRIMPVEDMPFLPDGRPVQIVLNPLGVPSRMNIGQVLETHLGWAAHALGLQ-------------------------IKNMDPNVEQRLREVGYD---------VDKHGMLKPGEAGV-------HLATPVFDGAREEDVFKTLKMAGLP---------ENGKSILYDGRTGEPFDNPVTVGYIYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQELLTVKSDDVVGRVKTYEAIVKGENVPEPGVPESFKVLIKELQSIGLDVKVLSE 1151
Score = 290, Expect = 1.8e-23, Identities = 78/275 (28%), Positives = 137/275 (49%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALG-LNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF 290
           +R  Y+KI +  + PNL+ +QKN+++ F+   L+   + I PI+   G   L + G  L +PK S +E +    TY  PL V + +++ E+GE+K+              +F    P++TE GTFI+NG E+ ++SQ+VRSPGAY        +  S K++   Y   I+P +G  +     +  D + V       + T  +P+T  ++ALG  +   IL++F +   I+ +L+ +  + K+    + L+ + K L   +          L  LF
  S:    11 VRYSYAKINEVLDMPNLIEIQKNSYNWFLKEGLQEIFRDISPIQDFTGNLVLSFEGFTLGEPKYSVEECKERDVTYSAPLRVSVRLINKETGEIKEQE------------VFMGDFPLMTENGTFIINGAERVIVSQLVRSPGAYYGE----TIDTSGKKL---YNATIIPNRGA-WLELETDANDVVSVRV-----DRTRKLPVTVLIRALGWASNGAILDLFNDDVRIRATLERDSTSSKE----EALVEIYKRLRPGEPPTVENATQLLESLF 257
>gi|66880050|ref|ZP_00405036.1| COG0085: DNA-directed RNA polymerase, beta subunit/140 kD subunit [Mycoplasma genitalium G-37] (899 aa)
Score = 2132, Expect = 0.0e+00, Identities = 466/871 (53%), Positives = 614/871 (70%)
  Q:     3 KKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKD----FIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNLNSSDSN-RSYGV--DTKLRELFKKYSSLKSQLEAEGKNAEKQK-------ELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVK----YEKINVYQDNDSQDEFIPIIGTDTSLD-KPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEE-----QEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEK-NKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTW 873
           K  F  K  S    RR Y KIE NF +PNL ++Q  ++ KF+D +LE  I S FPIKS   RY++ + G+   +P+R E ++R + KTY+  +Y DL +VDN+ G VKK  KS KN ASNT+G+F AS+P+IT  G FI+NGIEKFVISQI RSPG Y+LTKSQ+KLSNSRKR+QEGY+CE+LPA G++  I+++  K     F+Q++ RDA+ E     PIT  LKA GLN  EIL IF N++ IK SL+ EIYN KD       E+ NL K      ++ R  G+  D KLR L  +Y +L+ Q  A  + +           E+   ++++I+E+AAK +V  LSIS ++I++       E ++ +++   FF NK ++LS AGR+K++RK+RL+ER+YQ+ LA DL   +GK+++KK TL+ K E+D IKQ  K  ++  V+ + L     K  ++ K    YE I+VY  ND+    +P+IG     D    +++SD ++  SYVINL Y IG YDDIDHLGNKR+KLI+EL+  + ++G  R+E+F+ +KL IADG N+ Q+ +EE     Q  KK LT+KS+IN+KP QI  K+FFN+HQLTQFLD QNPL+EL+NKRRISAMGPGGISREDPNLDIRDVHYS YG+ICPIETPEGMNIGLIMSLA++A  DENGFL+ PYR +K GVITDE+ +LTAL EDE+IIA   S +N+   NK  + +++ RYRS    +D   +D+ID++P QVVSI +S IPFLENDD+ RALMG NMQRQA PLI P AP VGTG E+KIA DSG+         G VSYVD   I I S S +K    L KF +SNQNTC N  PIV +G++V K   I DGPA++  ELALGQNVLVAFTTW
  S:     4 KSNFFQKRYSPTATRRYYGKIETNFIQPNLADIQIKSYQKFLDHDLEKLIASYFPIKSPNDRYTINFRGLHRTEPERDEAQSRAQSKTYEVGIYADLELVDNDKGTVKKARKSKKNIASNTNGVFLASMPLITHDGVFIINGIEKFVISQITRSPGIYMLTKSQLKLSNSRKRVQEGYVCEVLPANGSVMLIYISNKKKIEDAFVQILLRDAVREGAKIFPITTLLKAFGLNNREILKIFKNNEFIKRSLEAEIYNAKDFLSNVDPEIKNLLKEFRDGKTDLRRKGIASDQKLRSLVNEYVTLEKQYNALKQTSPNDSSLTALELEMENKMDSVITERAAKHIVNELSISLRDIENTEEC--HEVSFHALLCARFFRNKRYNLSNAGRYKVSRKLRLTERIYQKTLACDLFLKDGKLLLKKGTLLLKEEIDKIKQAAKNNEISFVNKMQLTTD-GKAVDLAKESLFYETIDVYITNDNLSVSVPVIGIHNENDLNKAMTLSDFIASISYVINLPYGIGKYDDIDHLGNKRVKLINELITAKLESGFTRMERFLKEKLTIADGVNRGQQINEEGQVIEQGEKKELTIKSLINSKPIQIVIKDFFNTHQLTQFLDHQNPLSELSNKRRISAMGPGGISREDPNLDIRDVHYSQYGRICPIETPEGMNIGLIMSLASFAKIDENGFLMAPYRKIKAGVITDEVEYLTALREDEHIIAEISSLVNISNDNKILDKEIIGRYRSMQGLYDPLKIDYIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPAVGTGQEHKIASDSGLTM--SSPCSGVVSYVDNSKIIITSDSSKKETVNLVKFERSNQNTCYNHKPIVEIGQRVNKDEIIVDGPAVNKSELALGQNVLVAFTTW 899
>gi|160945277|ref|ZP_02092503.1| hypothetical protein FAEPRAM212_02796 [Faecalibacterium prausnitzii M21/2] >gi|158443008|gb|EDP20013.1| hypothetical protein FAEPRAM212_02796 [Faecalibacterium prausnitzii M21/2] (1287 aa)
Score = 2128, Expect = 0.0e+00, Identities = 468/988 (47%), Positives = 647/988 (65%)
  Q:   361 FFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQL--------------TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQ----------------DN-DSQDEFIPIIGTDTSL-DKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKN----------GVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS--GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGI-----HEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANN--NNFKD 1348
           FF  + +DLS+ GR+KM +K+ L+ R+   V AE++ D   G+++++ +  I +   + I                  +  K+ ++ N  +D +    +    ++ ++V +                DN  S +E +  +  D  L    T++I DILS  +Y+  L Y IG  DDIDHLGN+R++ + ELL+ + + G  R+E+ I +++ +     +SQ+QS        +T +++IN +P   + KEFF S  L+QF+DQ NPLAELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CPIETPEG NIGLI  LA+YA  +E GF+  PYR VK            V+TDE+ ++TA  EDEY++A +N  +++ K F   +V  R R      D + VD++D+SP+ +VS+A + IPFLENDD NRALMG+NMQRQA PL+    PIV TG EYK A DSG A +   + +G V  VD   + +++  G+ E  Y L KF +SN  TC NQ PIV VGE VT G  +ADGPAM NGE++LG+N L+ F TW GYNYEDA++L++++  ED++TSIHI EY  +   TK G EEITRDIPNVSE + K LD+ GII +GAEVK GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G +  VK F  E+  EL   V E ++ Y+ QKRKI +GDKMAGRHGNKG++S+I+P EDMP+L DGT +DI+LNPLGVPSRMNIGQ+LE++LG A K   + KV+   +D    +D    F       H E +      L KI+ EK             DF   + L R G                                             K  + DGRTGE FD  V+VG MY LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT+KSDDV+GR  TY AI+KG+PIP+ G+PESF+++ K+LQ LG+ V +  + G   +   NF D
  S:   260 FFDPRRYDLSRFGRYKMNKKLSLARRIMDHVAAENVVDPFTGEILVEADKKIDRKLAEQIDAAGVNLVVLKIDDPMKDQPHKVKVITNGCVDAQAIIDSYYPAFKGVDVKECGINERCCLKELRKILDNASSAEEVMESLKKDHDLLIGRTVTIDDILSSINYLNGLGYGIGTTDDIDHLGNRRIRSVGELLQNQFRIGFSRMERVIRERMTL-----QSQDQS-------VITPQALINIRPVVAAIKEFFGSSPLSQFMDQNNPLAELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPIETPEGPNIGLISYLASYAKINEYGFVEAPYRKVKKIYDENNNLIEQVVTDEVEYMTADVEDEYVVAQANEPLDEGKHFIRPRVSARRRDEILEIDAEKVDYMDVSPRMMVSVATACIPFLENDDCNRALMGSNMQRQAVPLMVTQQPIVATGMEYKAATDSGTAVL--AKSNGVVEKVDADHVVVRNEQGALED-YSLIKFARSNAGTCINQRPIVEVGETVTAGQVLADGPAMRNGEISLGKNALIGFMTWEGYNYEDAVLLNEKIVREDVYTSIHIEEYETESRDTKLGPEEITRDIPNVSEDALKDLDERGIIRIGAEVKSGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGAYGIIVDVKVFTPENSDELQPGVREVVRCYIAQKRKISVGDKMAGRHGNKGVVSRILPQEDMPYLPDGTPLDIVLNPLGVPSRMNIGQVLEVNLGYAAKACGI-KVMTPVFDSARENDIGDTFDTAREMWHGENAPAYPTKLPKIMGEK---------GHIIDFS-KIELDRDG---------------------------------------------KTTVYDGRTGEKFDNRVTVGYMYYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVEGRVKTYEAIVKGEPIPQPGIPESFRVMLKELQSLGMDVIVQDKDGNEIDMRQNFDD 1229
Score = 251, Expect = 6.1e-19, Identities = 70/241 (29%), Positives = 125/241 (51%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEK-PKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R  +S I++  + PNL+ +QKN++  F+D  L+     I  I+   G  +L ++  +L+K PK S KE +    T+  PL V   +++ E+GEVK               IF    P++T+ GTF++NG E+ ++SQ+VRSPG +    ++ K+ N      + Y   + P +G  L +   A N  ++++       +    +P+T   +ALGL + E+ILN F   + I  +L+ +    ++
  S:    14 RMSFSHIDEVISMPNLIEVQKNSYQWFLDEGLKEVFHDIGTIEDYTGNLALSFVDFRLDKEPKYSIKECKERDVTFAAPLRVTARLLNKETGEVKDQE------------IFMGDFPLMTDAGTFVINGAERAIVSQLVRSPGVF-YGHAKDKVGN------DLYSATMNPNRGAWLEYETDAANVFYVRI-------DKNRKLPVTVLCRALGLSSNEDILNYFGEDERILATLEKDTTKNRE 231
>gi|153815044|ref|ZP_01967712.1| hypothetical protein RUMTOR_01261 [Ruminococcus torques ATCC 27756] >gi|145847612|gb|EDK24530.1| hypothetical protein RUMTOR_01261 [Ruminococcus torques ATCC 27756] (1287 aa)
Score = 2126, Expect = 0.0e+00, Identities = 511/1322 (38%), Positives = 760/1322 (57%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKEL--NEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAED----LKDINGKVV-IKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV-----KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQ---ANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
            R  YS+ ++    PNL+ +QK+++  F+D  L+     I PI    G  SLE++   L  +  K +  E +    TY  PL V + + + E+ E+            N   IF   +P++T+ GTF++NG E+ ++SQ+VRSPG Y      I      K++   Y   ++P +G  +  +  ++ D   V       + T  +PIT  ++ALG+    EI+++F     I  S        KD  E+  + L+ L K +   +       ++ +  +F  +   +  L   G+    +K +  N +   I++E A   L                                 + K   +++    ++A K++ +   Y  V  ED    +K ++  +V ++  T I   E+   +Q+      GI+     D  I +M  ++K +  ++   + ++++ +  I  +  L+              Y +  D DI      DHLGN+R++ + ELL+ + + GL R+E+ + +++   D              ++ ++ +S+IN KP   + KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CPIETPEG NIGLI SLATYA  ++ GF+  PYR +     +N V+T+++ ++TA  ED Y +A +N  + E+  F    V  RYR   + ++    D++D+SPK V S+A + IPFLENDDANRALMG+NMQRQA PL++  AP+VGTG E K A DSG+  V   E+ GTV       I ++    +K  Y+LTKF +SNQ+ C NQ PIV+ G+ V  G  IADGP+ S GE+ALG+N L+ F TW GYNYEDA++LS+RL  +D++TS+HI EY  +   TK G EEITRDIP V + + K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G V   K F  E+  EL+  V + +++Y+ QKRKI +GDKMAGRHGNKG++S+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L  + +    +D     D      +  +      +  EK   ++ +  + Q    N+E  +    + LSR G  R                                   L +G++G          EYFD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG+ IPE G+PESFK+L K+LQ L L V + ++
  S:    15 FRMSYSRQKEVLEMPNLIEVQKDSYQWFLDEGLKEVFDDISPIADYSGHLSLEFVDFTLCEDDVKYTIDECKERDATYAAPLKVRVRLHNKETDEI------------NEHEIFMGDLPLMTKTGTFVINGAERVIVSQLVRSPGIYY----GIAHDKLGKKL---YSSTVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPITVLIRALGIGTNAEIVDLFGEEPKILASF------TKDTAESYQEGLLELYKKIRPGEPLAVDSAESLINSMF--FDPRRYDLAKVGRYKFNKKLMLKNRIAGCILAEDAVSQLT----------------------------GEIVAEKGTKITR----ELADKIQNNAVPYLWVEGEDEERNIKILSNMMVDLQAVTDIDPEEVGVTEQVYYPVLAGIIEESAGD--IEEMKALIKRDIHDLIPKHITKEDILASINYNMHLE--------------YGMGTDDDI------DHLGNRRIRAVGELLQNQYRIGLSRLERVVRERMTTQD--------------QEGISPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPIETPEGPNIGLINSLATYARINQYGFVEAPYRWIDKSDPENPVVTEKVVYMTADEEDNYHVAQANTPLDEEGHFIHKNVSGRYREETQEYERSKFDYMDVSPKMVFSVATALIPFLENDDANRALMGSNMQRQAVPLLTTEAPVVGTGMEVKAAVDSGVCVV--AERAGTVESSTSKEIVVREEDGKKTSYKLTKFQRSNQSNCYNQRPIVNKGDVVAAGQVIADGPSTSGGEMALGKNPLIGFMTWEGYNYEDAVLLSERLVQDDVYTSVHIEEYEAEARDTKLGPEEITRDIPGVGDDALKDLDERGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGEYGIVVDAKVFTRENGDELSPGVNQAVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKALGFN-ISTPVFDGANEIDIMDTLDLANDYVNLEWEEFEKKHGQELLPEVLQYLSDNREHRNLWKGVPLSRDGKVR-----------------------------------LRDGRTG----------EYFDSPVTIGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVVGRVKTYEAIIKGENIPEPGIPESFKVLLKELQSLALDVRVLRD 1209
>gi|167768221|ref|ZP_02440274.1| hypothetical protein CLOSS21_02777 [Clostridium sp. SS2/1] >gi|167709745|gb|EDS20324.1| hypothetical protein CLOSS21_02777 [Clostridium sp. SS2/1] (1265 aa)
Score = 2121, Expect = 0.0e+00, Identities = 470/984 (47%), Positives = 644/984 (65%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQL--------TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPII-----------GTDTSLDKPT-------LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV-----KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           +S+I + FF  + +DL+K GR+K  +K+ L  R+   +LAED+ D   G+V+ +  T +     D I+          T+EG   I+ N+ +        N+ +Y   N  +    +D F P++               +L K         ++  DIL+  +Y I+L+Y IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               +S++ +S+IN KP   + KEFF S QL+QF+D  NPL+ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI SLATYA  +E GF+  PYR++     +N V+TD++ +LTA  ED Y++A +N  V E   F    V  R+R     FD  ++D +D+SPK V S+A S IPFLENDDANRALMG+NMQRQA PL+S  AP+VGTG E K A+DSG+         G V       I +++   ++  Y + KF +SNQ  C NQ PIV VG++V KG  +ADG + SNGE+ALG+N L+ F TW GYNYEDA++LS+RL  +D++TS+HI EY  +   TK G EEITRD+  +SE   K LDD GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G V   K F  E+  EL   V + ++VY+ QKRKI +GDKMAGRHGNKG+IS+I+PVEDMP+L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   +   A  N I +  ++ N       D AN  + +FD   A  R  ++ + + Y     ++E  NR   KE     G+ PI+       +GK  L DGRTGE FD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR   Y AIIKG  IPE G+PESFK+L K+ Q L L V I  E
  S:   256 ESLINSMFFDPRRYDLAKVGRYKFNKKLALRNRISGFILAEDVLDPTTGEVLAEAGTNVDMELADKIQNAAVASVMIQTEEGATKILSNMEV--------NLAEYVDFNPEEIGVHEDVFYPVLEKILEEGYEGEELKEALKKNIHELIPKHITKEDILASINYNIHLEYGIGHDDDIDHLGNRRIRAVGELLQNQYRIGLSRLERVVRERMTTQD--------------IESISPQSLINIKPVTAAVKEFFGSSQLSQFMDHNNPLSELTHKRRLSALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPEGPNIGLINSLATYARINEYGFIEAPYRVLDKSDPENPVVTDKVVYLTADEEDNYVVAQANEPVDEDGHFVNTHVSGRFREDTSEFDKVNLDLMDVSPKMVFSVATSMIPFLENDDANRALMGSNMQRQAVPLLSTEAPVVGTGMESKAAYDSGVCIT--ARNGGVVERSTSTKIVVRNDDGQRDEYNVIKFARSNQGNCMNQRPIVFVGDRVEKGDILADGASTSNGEMALGKNPLIGFMTWEGYNYEDAVLLSERLVQDDVYTSVHIEEYEAEARDTKLGQEEITRDLAGLSEDVLKDLDDNGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGAYGVVMDTKIFTRENGDELPPGVNKSVRVYIAQKRKISVGDKMAGRHGNKGVISRILPVEDMPYLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKVL----------------GFNVATPVFNGADENDIADTLRMAN-------DYANTSWEEFD---AKWRDKVNDDVMDY-----LYE--NRDHRKEWQ---GV-PID------TTGKVRLRDGRTGEEFDSPVTIGFMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTFKSDDVVGRVKAYEAIIKGDNIPEPGVPESFKVLLKEFQSLALDVKILDE 1206
Score = 225, Expect = 5.6e-16, Identities = 72/256 (28%), Positives = 126/256 (49%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKP--KRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI-LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNL 271
           +R  Y++ +     PNL+ +QK+++  F+   L    + I PI+    + SLE++  +L K   K S +E +    TY  PL V + + + E+ E+K+              IF   +P++T  GTFI+NG E+ ++SQ+VRSPG Y  +   +I         +E Y   ++P +G  +  +  ++ D   V       + T  +PIT  ++ALG+    EI  +F     I  S++ +     D +E D L+ L K +
  S:    15 MRISYARQDDVLEVPNLIEIQKDSYDWFLREGLAEVFEDISPIEDYSDQLSLEFVDYQLCKDDVKYSIEECKERDATYAAPLKVKVRLHNKETDEIKQHE------------IFMGDLPLMTATGTFIINGAERVIVSQLVRSPGIYYGIAHDKIG--------KELYSSTVIPNRGA-WLEYETDSNDVFNVRV-----DRTRKVPITVLIRALGIGTNAEIKELFGEEPKILASIEKD---PSDNYE-DGLLELYKKI 244
>gi|160937581|ref|ZP_02084942.1| hypothetical protein CLOBOL_02472 [Clostridium bolteae ATCC BAA-613] >gi|158439650|gb|EDP17400.1| hypothetical protein CLOBOL_02472 [Clostridium bolteae ATCC BAA-613] (1309 aa)
Score = 2119, Expect = 0.0e+00, Identities = 456/986 (46%), Positives = 642/986 (65%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLT--------KEGKLGIVHN--------VNLDERISKMANVVKYEKI-NVYQDNDSQDEFI--PIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGV------ITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE--EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           +S++ + FF  + +DL+K GR+K  +K+    RL  +VLAED+ D   G+++ +  T + K     I+            + K  ++ N        V  D     +  +V Y  + ++ ++  + +E +   +      L    ++  DIL+  +Y ++L+  +G  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D                 +T +S+IN KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI SLATYA  ++ GF+  PYR+V          +TDE+ +LTA  ED +++A +N  + E+  F  + V  R+R+    F  K +D +D+SPK V S+A + IPFLENDDANRALMG+NMQRQA PL++  AP VGTG E K A DSG+  V   +  G V       I I+  S+    VY LTKF +SNQ+ C NQ PIV   + V  G  IADGP+ SNGE+ALG+N L+ F TW GYNYEDA++LS+RL  ED++TS+HI EY  +   TK G EEITRD+P V E + K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G +   K F  E+  EL+  V + +++Y+ QKRKI +GDKMAGRHGNKG++S+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   I + A+ N I +  ++ N+    S D+   ++ D      +   G   E         +++GV               PI+      + GK  L DGRTGEYFDG V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E++T+KSDDV GR  TY AIIKG+ IPE G+PESFK+L K++Q LGL V + ++ G
  S:   271 ESLLNSMFFDPRRYDLAKVGRYKFNKKLSFKYRLNGQVLAEDVVDTATGEILAEAGTKLDKESAMRIQNAAVPYVWVDGPDRKQKVLSNMMVELSAYVPFDPEEVGVTELVYYPALASILEEAGTDEESLKEAVRRNIHDLIPKHITKEDILASINYNMHLEEQVGNADDIDHLGNRRIRAVGELLQNQYRIGLSRMERVVRERMTTQD--------------MDGITPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLAELTHKRRLSALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPEGPNIGLINSLATYARVNQYGFIEAPYRVVDKTTDPSSPRVTDEVVYLTADEEDNFVVAQANEALDEEGHFIHNNVSGRFRTETSEFQKKTIDLMDVSPKMVFSVATAMIPFLENDDANRALMGSNMQRQAVPLLTTEAPAVGTGIEAKAAVDSGVCVV--AKNAGVVERSASNEIIIRRDSDGNRDVYHLTKFKRSNQSNCYNQKPIVYKNDHVEAGEVIADGPSTSNGEIALGKNPLIGFMTWEGYNYEDAVLLSERLVQEDVYTSVHIEEYEAEARDTKLGPEEITRDVPGVGEDALKDLDERGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGAYGIIVDAKVFTRENGDELSPGVNQTVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKAL----------------GFNVSTPIFDGANENDIMDTLEVANDYVNLSWDEFKAKYEDLLKPSVIDYLGAHLEH------RELWKGV---------------PIS------RDGKVRLRDGRTGEYFDGAVTIGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEIMTVKSDDVVGRVKTYEAIIKGENIPEPGVPESFKVLLKEMQSLGLDVQVLRDDG 1226
Score = 238, Expect = 1.9e-17, Identities = 105/431 (24%), Positives = 193/431 (44%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKP--KRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLKSQLEAEGKNAEKQKELN-EVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSI----IYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDING-----KVVIKKNT--LIQKHELDTIKQLTKEGKLG-IVHNVNLDERISKMANV 446
           +R  YS+ ++    PNL+ +QK+++  F+   L+     I PI    G  SLE++   L K   K + +E +    TY  PL V + + + +  E+            N   IF   +P++T+ G+F++NG E+ ++SQ+VRSPG Y             K  +E Y C ++P +G  +  +  ++ D   V       + T  +P+T  ++ALG     EIL +F     +  S   +  +       D L+ L K +   +       ++ L  +F   ++Y   K       K    +  LN +V+   + + A  +++          +S  R+ N    Y  +          SN   +LS    F    ++ ++E +Y   LA  L++        K  +++N   LI KH       +TKE  L  I +N++L+E++    ++
  S:    30 VRMSYSRQKEVLEMPNLIEIQKDSYQWFLKEGLKEAFDDISPIADFAGHLSLEFVDFTLCKDDIKYTIEECKERDATYAAPLKVKVRLYNKDKDEM------------NEHEIFMGDLPLMTDTGSFVINGAERVIVSQLVRSPGIYYGIGHD-------KVGKELYTCTVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPVTVLIRALGFGTNAEILELFGEEPKLLASFGKDTSDNYQ----DGLLELYKKIRPGEPLSVDSAESLLNSMFFDPRRYDLAKVGRYKFNKKLSFKYRLNGQVLAEDVVDTATGEILAEAGTKLDK-ESAMRIQNAAVPYVWVDGPDRKQKVLSNMMVELSAYVPFD-PEEVGVTELVYYPALASILEEAGTDEESLKEAVRRNIHDLIPKH-------ITKEDILASINYNMHLEEQVGNADDI 441
>gi|167629459|ref|YP_001679958.1| DNA-directed RNA polymerase subunit beta [Heliobacterium modesticaldum Ice1] >gi|167592199|gb|ABZ83947.1| DNA-directed RNA polymerase, beta subunit [Heliobacterium modesticaldum Ice1] (1154 aa)
Score = 2116, Expect = 0.0e+00, Identities = 450/859 (52%), Positives = 585/859 (68%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTD-LKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           L+  DI++    ++ L    G  DDIDHLGN+RL+ + ELL+ + + GL R+E+ + +++ I D               + +T + +IN +P   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG+SRE    ++RDVH+SHYG++CPIETPEG NIGLI SL+T+A  +E GF+ TPYR V  + GV+TD+I +LTA  ED+YI+A +N  + E+ +FKE +V  R+        V+ VD++D+SPKQVVSIA + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E+K A+DSG+ A+    K G V  V G  I I+   G+ E  ++L KF +SNQ TC NQ PI   G+++  G  IADGP+   GELALG+NVLVAF TW GYNYEDAI+++++L  ED FTSIHI EY  D   TK G EEITRDIPNV E   K LDD GII VGAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G +  VK F  E+  EL   V + ++VY+ QKRKI  GDKMAGRHGNKG+IS+I+P  DMP+L DGT ++I+LNPLGVPSRMNIGQILE HLG A K +    ++E     KP+                          EK I+         T+ D+   L+++G+ +   I  T T       RT+ L+E+M    +            GK  L DGRTGE FD  ++VG MYMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT+KSDDV GR  TY AI+KG+ IPE G+PESFK+L K+LQ LGL V I  E
  S:   289 LTKDDIIAAIRELLKLMQGDGRADDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQD--------------VEVITPQVLINIRPVVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTFARINEYGFIETPYRKVDKERGVVTDQIDYLTADEEDKYIVAQANAPLDEEGRFKEKRVNARHGHDILVVPVEKVDYMDVSPKQVVSIATALIPFLEHDDANRALMGANMQRQAVPLLRTDAPYVGTGMEFKAAYDSGVCAI--ARKAGYVERVTGDEILIRCDDGTTEH-HKLLKFLRSNQGTCINQKPICHKGQRIEAGQIIADGPSTDQGELALGRNVLVAFMTWEGYNYEDAILVNEKLVKEDYFTSIHIEEYECDSRDTKLGPEEITRDIPNVGEEVLKDLDDRGIIRVGAEVRPGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGEAGKIVDVKVFSRENGDELAPGVNQLVRVYIAQKRKISEGDKMAGRHGNKGVISRIMPEADMPYLPDGTPVEIVLNPLGVPSRMNIGQILETHLGWASKHMDRGVLIE----GKPSG-------------------------EKGIRVATPVFDGATEDDIFEFLTKAGLPKANEIALTDT-------RTESLRESMAAVPL------------GKSILYDGRTGEPFDNPITVGYMYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENIPEPGVPESFKVLIKELQSLGLDVKILSE 1088
Score = 264, Expect = 1.8e-20, Identities = 79/263 (30%), Positives = 135/263 (51%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE--LINLRKNLN-----SSDSNRS 279
           R  +++I++  + PNL+ +Q+N++  F++  L    + I PI+   G   LE+I   L +PK S +E +    T+  PL V + +++ E+GEVK+              +F    P++T+KGTFI+NG E+ ++SQ+VRSPG Y      I   + +K     +   I+P +G  +  F  +  D I V       + T  +P T  ++ALG  N  ++  +F   + I+ +L      E+D  E  E  L+ + K L      + DS RS
  S:    12 RWTFARIQEVMDMPNLIEIQQNSYRWFLEEGLREMFRDISPIQDFTGNLILEFIDYALGEPKYSVEECKERDVTFAAPLRVKVRLINKETGEVKEQE------------VFMGDFPLMTDKGTFIINGAERVIVSQLVRSPGVYY--NEAIDPPSGKKL----FGATIIPNRGA-WLEFETDINDNIFVRI-----DRTRKLPATVLIRALGYSNNAQVQELFDGDERIRITL------ERDNTENTEEALVEIYKRLRPGEPPTVDSARS 252
>gi|160894090|ref|ZP_02074868.1| hypothetical protein CLOL250_01644 [Clostridium sp. L2-50] >gi|156864123|gb|EDO57554.1| hypothetical protein CLOL250_01644 [Clostridium sp. L2-50] (1310 aa)
Score = 2111, Expect = 0.0e+00, Identities = 473/984 (48%), Positives = 651/984 (66%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQL--------TKEGKLGIVHNVNLDERISKM-----ANVVKYEKI---------NVYQDNDSQDEFIPIIGTDTSLDKPT-LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK-----NGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE--EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           +++I   FF  + +DL+K GR+K  +K+    R+  ++LAED  D   G+V+ +  T + + +   I+          T+E  + ++ N+ +D  +SK      A V  +E +         N Y D   ++E    I  D S   P  ++  DI++  +Y I+L+Y IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               +++T +S+IN KP   + KEFF S QL+QF+DQ NPL+ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI SLATYA  +E GF+  PYR +      N V+TDE+ +LTA  ED Y +A +N  ++ +  F  + V  RYR     F    VD +D+SPK V S+A S IPFLENDDANRALMG+NMQRQA PL+   + +VGTG E K A DSG+  V   ++DG V Y     I IK+  +  + +Y + KF +SNQ  C NQ PIV  GE V  G  IADGP+ S GE+ALG+N L+ F TW GYNYEDA++LS+RL  +D++TSIHI EY  +   TK G EEITRD+  +S  + K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G +   K F  E+  EL+  V + ++VY+ QKRKIQ+GDKMAGRHGNKG+IS+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HLGLA + L   KV    +D   A +F            +++  LE         + D AN E+ DF       +  +S E + Y     ++E  NR D +E      ID         ++GK  L DGRTGE FD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG+ IP  G+PESFK+L K+ Q LGL V + K+
  S:   287 ENLINAMFFDPRRYDLAKVGRYKFNKKLAFQNRITGQILAEDAIDPATGEVIAEAGTTLTRAQAKDIQDAAVPYVMIQTEERNVKVLSNMVVD--LSKYVGFDPAEVGIHEGVYYPVLETLLNEYSD---EEELKAAIARDASDLVPKHITKEDIIASINYNIHLEYGIGTKDDIDHLGNRRIRAVGELLQNQYRIGLSRLERVVRERMTTQD--------------VETITPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLSELTHKRRLSALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPEGPNIGLINSLATYARINEYGFVEAPYRKLDKSDPANPVVTDEVIYLTADEEDNYRVAQANEPLDADGHFVNNNVSGRYREDTTEFPKSRVDLMDVSPKMVFSVATSMIPFLENDDANRALMGSNMQRQAVPLMLTESAVVGTGMEAKAAVDSGVCIV--AKRDGVVEYSTSKEICIKADEDGTKDIYHVIKFARSNQGNCMNQRPIVFKGEHVKAGEVIADGPSTSGGEIALGKNPLIGFMTWEGYNYEDAVLLSERLVKDDVYTSIHIEEYECEARDTKLGPEEITRDLAGLSNDALKDLDENGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGAFGVIMDTKIFTRENGDELSPGVNKSVRVYIAQKRKIQVGDKMAGRHGNKGVISRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLGLASQVLGF-KVSTPVFDG--ADEF------------DIMDTLEM--------ANDYANTEWEDF---YEKYKDSVSEEVMNY-----LYE--NR-DHREEWKGVPID---------RTGKVQLRDGRTGEEFDSPVTIGYMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVIGRVKTYEAIIKGENIPTPGIPESFKVLLKEFQSLGLDVRVVKD 1238
Score = 250, Expect = 6.4e-19, Identities = 76/256 (29%), Positives = 128/256 (50%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNL 271
           +R  YS+ +     PN + +QKN++  F+   L+   K I PI    G+ SLE++  +L  +  K S +E +    TY  PL V + +  N++ E+ +              IF   +P++TE GTF++NG E+ ++SQ+VRSPG Y      I      K++   Y C ++P +G  +  +  ++ D   V       + T  +PIT  +++LG+    EI+++F     I  S+      EKD  ET  D L+ L K +
  S:    46 IRMSYSRQKDVLEMPNFIEVQKNSYQWFLTDGLKEAFKDISPITDYTGQLSLEFVDFQLCRDDVKYSIEECKERDATYAAPLKVKVRLHANDAKEMSEHE------------IFMGDLPLMTETGTFVINGAERVIVSQLVRSPGIYY----DIAHDKIGKKL---YSCTVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPITVLIRSLGIGTNAEIIDLFGEEPKILASI------EKDPSETYQDGLLELYKKI 275
>gi|167758507|ref|ZP_02430634.1| hypothetical protein CLOSCI_00847 [Clostridium scindens ATCC 35704] >gi|167663703|gb|EDS07833.1| hypothetical protein CLOSCI_00847 [Clostridium scindens ATCC 35704] (1291 aa)
Score = 2101, Expect = 0.0e+00, Identities = 454/984 (46%), Positives = 644/984 (65%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQLT----------KEGKLGIVHN--------VNLDERISKMANVVKYEKIN--VYQDNDSQDEFIPIIGTDT-SLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK-----NGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           +S+I + FF  + +DL+K GR+K  +K+ L  R+  ++LA+D+   + G+V+ +  T + +   D I+             +E  + ++ N        V++D +   +  +V Y  +   + +     DE    I  D   L    ++  DIL+  +Y I+L+Y +G  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               + ++ +S+IN KP   + KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CPIETPEG NIGLI SLATYA  ++ GF+  PYR +      N V+T+E+ ++TA  ED Y +A +N  ++ +  F    V  RYR   + ++ +  D++D+SPK V S+A + IPFLENDDANRALMG+NMQRQA PL+   AP+VGTG E K A DSG+  +   E  G V       I I+      K Y+L KF +SNQ+ C NQ PIV  G++V  G  IADGP+ SNGE+ALG+N L+ F TW GYNYEDA++LS+RL  ED++TS+HI EY  +   TK G EEITRDIP V + + K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G V   K F  ++  EL+  V + +++Y+ QKRKI +GDKMAGRHGNKG++S+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   + + A  N I +   + N       D  N  + +F+           +E+L+ +    + +      L + +      PI+      + GK  L DGRTGEYFD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG+ IPE G+PESFK+L K+LQ LGL V + ++
  S:   256 ESLITSMFFDPRRYDLAKVGRYKFNKKLALKNRITGQILAQDVASPLTGEVIAEAGTKVTRELADQIQNAAVPYVWIEREDEERNIKVLSNMMVDITSIVDVDPKEVGVTELVYYPVLAGILEETAGDIDELKDAIKRDIHDLIPKHITKEDILASINYNIHLEYGLGNDDDIDHLGNRRIRSVGELLQNQYRIGLSRLERVVRERMTTQD--------------LEGISPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPIETPEGPNIGLINSLATYARINQYGFIEAPYRKINHDDPANPVVTEEVVYMTADEEDNYHVAQANEPLDAEGHFIHKNVSGRYRDETQEYERRMFDYMDVSPKMVFSVATALIPFLENDDANRALMGSNMQRQAVPLLMTEAPVVGTGMEEKSAVDSGVCVI--AETGGVVERSTSTEITIRQDDGNLKRYKLIKFLRSNQSNCYNQRPIVFKGDRVEAGDVIADGPSTSNGEMALGKNPLIGFMTWEGYNYEDAVLLSERLVQEDVYTSVHIEEYEAEARDTKLGPEEITRDIPGVGDDALKNLDERGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGEYGIVVDAKVFTRDNGDELSPGVNQAVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKAL----------------GFNIATPVFDGADENDIMDTLDLAN-------DYVNLSWEEFEAK--------HKEELLPEVLQYLSDNREHRKLWKGV------PIS------RDGKVRLRDGRTGEYFDSPVTIGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVIGRVKTYEAIIKGENIPEPGIPESFKVLLKELQSLGLDVRVLRD 1209
Score = 230, Expect = 1.3e-16, Identities = 65/235 (27%), Positives = 113/235 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNE 251
           R  YS+ ++    PNL+ +QK+++  F+D  L+     I PI    G  SLE++   L  +  K + +E +    TY  PL V + + + E+ E+            N   IF   +P++T  GTF++NG E+ ++SQ+VRSPG Y      I      K++   Y   ++P +G  +  +  ++ D   V       + T  +PIT  ++A+G     EI+ +F     I  S + +
  S:    16 RMSYSRQKEVLQMPNLIEVQKDSYQWFLDEGLKEVFDDISPIADYSGHLSLEFVDFTLCEDDVKYTIEECKERDATYAAPLKVRVRLHNKETDEI------------NEHEIFMGDLPLMTSTGTFVINGAERVIVSQLVRSPGIYY----AIAHDKVGKKL---YSSTVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPITVLIRAMGFGTNPEIVELFGEEPKIIASFEKD 228
>gi|153812149|ref|ZP_01964817.1| hypothetical protein RUMOBE_02546 [Ruminococcus obeum ATCC 29174] >gi|149831804|gb|EDM86890.1| hypothetical protein RUMOBE_02546 [Ruminococcus obeum ATCC 29174] (1285 aa)
Score = 2097, Expect = 0.0e+00, Identities = 456/984 (46%), Positives = 652/984 (66%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLT--------KEGKLGIVH----------NVNLDERISKMANVVKYEKI-NVYQDNDSQDEFIPIIGTDT-SLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV-----KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIY----KTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           +S+I   FF  + +DL+K GR+K  +K+  ++R+    L E + D + G+++ ++ T +     D I+           +E K+ ++           +++ D +   +  +V Y  +  + ++ND+ ++    I  D   L    ++  DIL+  +Y ++L+Y IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               +S++ +S+IN KP   + KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CP+ETPEG NIGLI SLA+YA  +E GF+  PYR +      N ++TD++ ++TA  ED Y +A +N  + E+  F    V  R+R   + ++ +  D++D+SPK V S+A + IPFL+NDDANRALMG+NMQRQA PL++  AP+VGTG E K A DSG+  +   +K GTV       I IK+    K  Y LTKF +SNQ+ C NQ PIV  GE V  G  IADGP+ +NGELALG+N L+ F TW GYNYEDA++LS+RL   D++TS+HI EY  +   TK G EEITRD+P V + + K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G +   K F  E+  EL+  V + +++Y+ QKRKI +GDKMAGRHGNKG++S+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   + + AS   I++  ++ N       D  N E  DF+   A  +  ++ + + Y    K    +++GV               PI+      + GK  L DGRTGEYFDG V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG  IPE G+PESFK+L K+LQ LGL V + ++
  S:   256 ESLIMAMFFDPRRYDLAKVGRYKFNKKLHFNKRIVGHKLGEAVVDPSTGEILAEEGTNVTIELADKIQNAAVPFVWIQGEERKIKVLSSMMVDITAHVDLDCDPKELGVTELVYYPVLEKILEENDNLEDIKAAIKRDIHDLIPKHITKEDILASINYNMHLEYGIGNDDDIDHLGNRRIRSVGELLQNQYRIGLSRLERVVRERMTTQD--------------TESISPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPVETPEGPNIGLINSLASYARINEYGFIEAPYRKIDKTDPSNPIVTDDVVYMTADEEDNYHVAQANEPLDEEGHFLHKNVSGRFREETQEYEKRMFDYMDVSPKMVFSVATALIPFLQNDDANRALMGSNMQRQAVPLLTTEAPVVGTGMETKAAVDSGVCVL--AKKSGTVLRSTSTDISIKNDDGTKDDYHLTKFLRSNQSNCYNQKPIVFQGEHVEAGQVIADGPSTANGELALGKNPLIGFMTWEGYNYEDAVLLSERLVQNDVYTSVHIEEYEAEARDTKLGPEEITRDVPGVGDDALKDLDERGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGEYGIIVDAKVFTRENGDELSPGVNQAVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKAL----------------GFNVSTPVFDGASEIDIQDTLELAN-------DYVNIE--DFEEFRAKYQDTLAPDVMEYLDEHKDHRELWKGV---------------PIS------RDGKVQLRDGRTGEYFDGRVTIGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVVGRVKTYEAIIKGDNIPEPGIPESFKVLLKELQSLGLDVKVLRD 1209
Score = 240, Expect = 9.4e-18, Identities = 66/236 (27%), Positives = 116/236 (49%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLE--KPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNE 251
           +R  Y + ++    PNL+ +QK+++  F+D  L+     I PI   GG++SLE+I    +    K +  + +    TY  PL V + +++ E+ E+            N   IF   +P++TE GTF++NG E+ ++SQ+VRSPG Y      I      KR+   +   ++P +G  +  +  ++ D   V       + T  +PIT  ++ALG+    EI+ +F     I  S   +
  S:    15 MRMSYQRQKEVLEMPNLIEVQKDSYKWFLDEGLKEVFDDISPIADYGGKFSLEFIDFTYDAKDAKYTIAQCKERDVTYAAPLKVRVRLINKETEEI------------NEHEIFMGDLPLMTETGTFVINGAERVIVSQLVRSPGIYY----AIAHDKLGKRL---FSSTVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPITVLIRALGIGTNAEIVELFGEEPKILASFTKD 228
>gi|147676647|ref|YP_001210862.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Pelotomaculum thermopropionicum SI] >gi|189043861|sp|A5D5I2|RPOB_PELTS DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|146272744|dbj|BAF58493.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Pelotomaculum thermopropionicum SI] (1224 aa)
Score = 2097, Expect = 0.0e+00, Identities = 468/859 (54%), Positives = 602/859 (70%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS--GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKP----ASDFSLWFGIHEEASRN--LIKNLEKI-LNEKQ-IKSLDQANKEFTDFDLSLALSRSGISREKLIYK------TATPVFEGVNRTDLKEAMT----EAGI--DPING---KLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           L+  DI+    Y++ L    G  DDIDHLGN+RL+ + ELL+ + + GL R+E+ + +++ I D                 +T + +IN +P   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG+SRE    ++RDVH+SHYG++CPIETPEG NIGLI SL+TYA  +E GF+ TPYR V  +N  +TDEI +LTA  E+ Y+IA +N  + E+ +F E +V  R   S E   V    VD++D+SPKQV SIA + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG EYK A DSG+  +   ++ GTV  V    I+I++  G  ++ Y+L KF +SNQ TC NQ PIV  GE+V  G  IADGP+   GELALG+NVLVAF  W GYNYEDAI++S++   ED FTSIHI EY  D   TK G EEITRDIPNV E   K LDD GII VGAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G V  VK F  ++  EL   V + ++VY+ QKRKI  GDKMAGRHGNKG+I++I+P EDMP L DGT I+I+LNPLGVPSRMNIGQ+LE HLG A K L        YY   P    AS+ S++  + E A +   L   +EK  LNE++ I +++ A K            R+G SRE LI +      +   +   + RT L   M     EAG+    I G   KL   +SGK  L DGRTGE FD  ++VG +YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT+KSDDV GR  TY AI+KG+ +PE G+PESFK+L K+LQ LGL V +  E
  S:   313 LTKEDIIETIRYLLKLMNGEGQVDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQD--------------VDVITPQVLINIRPVVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTYARINEFGFIETPYRKVDKENRRVTDEIVYLTADEEEGYVIAQANAPLDEEGRFIEPRVNAR---SPEIVVVPADRVDYMDVSPKQVFSIATALIPFLEHDDANRALMGANMQRQAVPLLKAQAPLVGTGIEYKAARDSGVVVI--AKESGTVEKVTSTHIEIRNDRGYLDR-YKLLKFTRSNQGTCVNQKPIVKKGERVEAGQVIADGPSTDYGELALGRNVLVAFMPWEGYNYEDAILVSEKTVKEDYFTSIHIEEYECDARDTKLGPEEITRDIPNVGEEILKDLDDRGIIRVGAEVRPGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGESGKVVDVKVFSRDNGDELPPGVNQLVRVYIAQKRKISEGDKMAGRHGNKGVIARILPEEDMPFLPDGTPIEIVLNPLGVPSRMNIGQVLEAHLGWAAKVLG-------YYVSTPVFNGASEESIFEALKEAAFKESGLRSFMEKAGLNEEELIGAVETAEK------------RAG-SREALIKEVEGAESSGETIMAAIERTGLTAGMVNRLEEAGMTKKEILGAMKKLLFARSGKMTLYDGRTGEPFDSPITVGYVYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENVPEPGVPESFKVLIKELQSLGLDVKVLSE 1161
Score = 276, Expect = 7.5e-22, Identities = 74/245 (30%), Positives = 127/245 (51%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSL--DNEIYNEKDVFE 260
           +R ++ ++ +  + PNL+ +Q+N++  F++  L    + I PI+   G   LE++   L +PK + +E +    TY  PL V + +++ E+GEVK+              +F    P++TEKGTFI+NG E+ ++SQ+VRSPG Y        +  S K++   Y   I+P +G  +  F  +  D I V       + T  IP T  ++ALG   K ++  +F   K+I  +L  DN    E+ + E
  S:    11 VRYNFGRLREVLDLPNLIEVQRNSYKWFLEEGLREVFQDISPIQDFTGNLVLEFLDYTLGEPKYTVEECKERDVTYAAPLRVKVRLINKETGEVKE------------QDVFMGDFPLMTEKGTFIINGAERVIVSQLVRSPGVYF----DETIDPSGKKL---YTATIIPNRGA-WLEFETDVNDHIFVRI-----DRTRKIPATVLVRALGYGTKAQVAELFNEDKNILETLARDNTDSEEEALVE 233
>gi|153852611|ref|ZP_01994048.1| hypothetical protein DORLON_00021 [Dorea longicatena DSM 13814] >gi|149754253|gb|EDM64184.1| hypothetical protein DORLON_00021 [Dorea longicatena DSM 13814] (1292 aa)
Score = 2093, Expect = 0.0e+00, Identities = 458/984 (46%), Positives = 640/984 (65%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQLT----------KEGKLGIVHNV---------NLDERISKMANVVKYEKINVYQDNDSQ-DEFIPIIGTDT-SLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK-----NGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           +S+I + FF  + +DL+K GR+K  +K+ L  R+   VLAED+   + G+V+ +  T I +    TI+              E  + ++ N+            E +     V       + ++     DE    I  D   L    ++  DIL+  +Y ++L+Y IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               + ++ +S+IN KP   + KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CP+ETPEG NIGLI SLA+YA  +E GF+  PYR +      N V+TDE+ ++TA  ED Y +A +N  ++K   F    V  RYR   + ++ +  D++D+SPK V S+A + IPFL+NDDANRALMG+NMQRQA PL+   AP+VGTG E K A DSG+  V   E+ GTV       I ++    + K Y+LTKF +SNQ+ C NQ PIV  G++V KG  IADGP+ SNGEL LG+N L+ F TW GYNYEDA++LS+RL  +D++TSIHI EY  +   TK G EEITRDIP V + + K LD+ GII VGAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSLKVPHG  G V   K F  E   E++  V + +++Y+ QKRKI +GDKMAGRHGNKG++S+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   + + A+   I +   + N       D  N  + +F+           +E+L+ +    + +      L + +      PI+      + GK  L DGRTGEYFD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG+ IPE G+PESFK+L K+LQ LGL V + ++
  S:   256 ESLITSMFFDPRRYDLAKVGRYKFNKKLALKNRISGHVLAEDVASPMTGEVLAEAGTKITRELASTIQNNAVPYVWISVEETERPIKVLSNMMVDLDAVVDVDPEEVGVTEQVYYPVLAGILEETAGDIDELKDAIKRDIHDLIPKHITKEDILASINYNMHLEYGIGTDDDIDHLGNRRIRSVGELLQNQYRIGLSRLERVVRERMTTQD--------------MEGISPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPVETPEGPNIGLINSLASYARINEYGFIEAPYRKINHDDPTNPVVTDEVVYMTADEEDNYHVAQANEQLDKEGHFVRKNVSGRYREETQEYERRMFDYMDVSPKMVFSVATALIPFLQNDDANRALMGSNMQRQAVPLLFTEAPVVGTGMEEKAAVDSGVCVV--AEEGGTVERSTSTEITVRQDDGKLKKYKLTKFQRSNQSNCYNQRPIVFKGDRVEKGEVIADGPSTSNGELGLGKNPLIGFMTWEGYNYEDAVLLSERLVQDDVYTSIHIEEYEAEARDTKLGPEEITRDIPGVGDDALKNLDERGIIRVGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGEYGIVVDAKVFTREGGDEMSPGVNQSVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKAL----------------GFNIATPVFDGANEIDIMDTLDLAN-------DYVNLSWEEFEAK--------HKEELLPEVLQYLSDNREHRKLWKGV------PIS------RDGKVRLRDGRTGEYFDSPVTIGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVIGRVKTYEAIIKGENIPEPGIPESFKVLLKELQSLGLDVRVLRD 1209
Score = 217, Expect = 4.6e-15, Identities = 61/235 (25%), Positives = 112/235 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNE 251
           R  Y++ ++    PNL+ +Q +++  F++  L      I PI    G+ SL+++   L  ++ K +  E +    TY  PL V + + + E+ E+            N   IF   +P++T  GTF++NG E+ ++SQ+VRSPG Y             K  ++ Y   ++P +G  +  +  ++ D   V       + T  +PIT  ++ALG+    EI+ +F     I  S + +
  S:    16 RMSYARQKEVVQMPNLIEVQTDSYKWFLEEGLNEVFDDISPITDYSGKLSLDFVDFTLCEDEVKYTIDECKERDATYAAPLKVKVRLHNKETDEI------------NEHEIFMGDLPLMTRTGTFVINGAERVIVSQLVRSPGIYYAIAHD-------KLGKKLYSATVIPNRGA-WLEYETDSNDVFYVRV-----DRTRKVPITVLIRALGIGTNPEIIELFGEEPKILASFEKD 228
>gi|154484472|ref|ZP_02026920.1| hypothetical protein EUBVEN_02186 [Eubacterium ventriosum ATCC 27560] >gi|149734320|gb|EDM50237.1| hypothetical protein EUBVEN_02186 [Eubacterium ventriosum ATCC 27560] (1276 aa)
Score = 2086, Expect = 0.0e+00, Identities = 463/1019 (45%), Positives = 656/1019 (64%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDND------SQDEFIPIIG-------TDTSLDKPT-----------LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV-----KNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTV--SYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYIS--NITNNAIKND--------EDQQIIEE 1372
           +SI+   FF  + +DL++ GR+K  +K+    R+    LAED+ D+    V+ +   +   EL    Q      + I  ++  ++ +S +A       IN Y D D      +++ + P++        T+  L               ++  DI +  +Y +N++Y IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               + ++ +++IN KP   + KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI S A++A  +E GF+  PYR+V     +N  +TDE+ +LTA  ED Y +A +N  ++ +  F  + V  RYR     FD K +D +D+SP+ V S+A S IPFL+NDD+NRALMG+NMQRQA PLI+  AP+VGTG E K A DSG+  V   ++ G +  S     TI+     E++ Y+L KF +SNQ+ C NQ  IV  G+ V  G  IADG + SNGE+ALG+N L+ F TW GYNYEDA++LS+RL  +D++TSIHI EY  +   TK G EEIT D+P V + ++K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG +G +   K FK E+  EL   V E +++Y+ QKRKI +GDKMAGRHGNKG++S+++PVEDMP L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   + + A    I +  ++ N       D AN E+ DF            ++KL  +    + E ++  +  + +      PI       + GK  L DGRTG+YFD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG+ IP+ G+PESFK+L K+LQ L L V +  E     N+N  ++ E I       NAI ND        ED Q  E+
  S:   256 ESIVAGMFFDARRYDLARVGRYKYNKKLAYKNRIKGLPLAEDVVDMTTGEVLAEAGTVVTEELAIKIQNAAVPSVMIQTDIKNEKVLSNLA-----VDINAYVDFDCKELGINEEVYYPVLAEILAENETEEELKDAIKRNVHELIPKHITKEDIFATINYCMNIEYGIGSEDDIDHLGNRRIRAVGELLQNQYRIGLSRMERVVRERMTTQD--------------LEGVSPQTLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKRRLSALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPEGPNIGLINSFASFARLNEYGFVEAPYRVVDKSDPENPRVTDEVVYLTADEEDNYTVAQANEPLDAEGHFVHNNVSGRYREETSQFDKKRIDLMDVSPRMVFSVATSMIPFLQNDDSNRALMGSNMQRQAVPLITTEAPVVGTGMEAKAAVDSGVCVV--AKRAGVIERSTSKEITIRYDDNGEKETYKLLKFQRSNQSNCYNQRSIVFKGDHVEAGEVIADGASTSNGEIALGKNPLIGFMTWEGYNYEDAVLLSERLVQDDVYTSIHIEEYETEARDTKLGPEEITNDVPGVGDEARKDLDERGIIRIGAEVRAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEQGIIVDAKVFKRENGDELAPGVNESVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKVL----------------GFNIATPVFDGADEYDIMDTLEMAN-------DYANTEWEDFQAKY--------QDKLNPEVMEYLGEHLDHREEWKGV------PI------ARDGKVRLRDGRTGDYFDNPVTIGFMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVVGRVKTYEAIIKGENIPQPGIPESFKVLIKELQSLALDVKVLDE-----NDNEVELKESIDYGETNFNAILNDNKNYSQKKEDSQSFEQ 1247
Score = 241, Expect = 7.7e-18, Identities = 62/236 (26%), Positives = 120/236 (50%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNE 251
           +R  YS+ ++    PNL+ +Q++++  F+ T L+  ++ I PI+      SLE++  KL  ++ K + +E +    TY  PL V + + + E+GE  +              IF   +P++T  GTF++NG E+ ++SQ+VRSPG Y +           K  +E Y  +++P +G  +  +  ++ D   V       + T  +P+T  ++ALG+    EI  +F   + +  + + +
  S:    15 IRMSYSRQKEVLGMPNLIEVQRDSYEWFLSTGLKEVLEDISPIEDYAQNLSLEFVDFKLCEDEKKYTIEECKERDATYSAPLKVKVRLHNKETGEFTE------------HDIFMGDLPLMTATGTFVINGAERVIVSQLVRSPGIYYVIGHD-------KVGKELYTSQVIPNRGA-WLEYETDSNDIFYVRV-----DRTRKLPVTVLIRALGIGTNAEITELFGEEEKLTATFEKD 228
>gi|167748163|ref|ZP_02420290.1| hypothetical protein ANACAC_02907 [Anaerostipes caccae DSM 14662] >gi|167652155|gb|EDR96284.1| hypothetical protein ANACAC_02907 [Anaerostipes caccae DSM 14662] (1300 aa)
Score = 2076, Expect = 0.0e+00, Identities = 458/984 (46%), Positives = 637/984 (64%)
  Q:   354 QSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNT--------LIQKHELDTIKQLTKEGKLGIVHNVNLD---------ERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDT-SLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV-----KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE--EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSG----ISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           +S+I + FF  + +DL+K GR+K  +K+    R+   +LAED+ D + G+++ +  T         IQ   + ++   T+ G   ++ N+ ++         E +    NV       +  +  S DE    +  +   L    ++  DIL+  +Y ++L+Y+IG +DDIDHLGN+R++ + ELL+ + + GL R+E+ + +++   D               +++T +S+IN KP   + KEFF S QL+QF+D  NPL+ELT+KRR+SA+GPGG+SR+    ++RDVHYSHYG++CPIETPEG NIGLI SLATYA  +E GF+  PYR++     +N V+TD + +LTA  ED +++A +N  + E   F    V  R+R     FD  ++D +D+SPK V S+A S IPFLENDDANRALMG+NMQRQA PL+S  AP+VGTG E K A DSG+  V   + DG V       I ++  S+  + +Y + KF +SNQ  C NQ PIV  G++V K   +ADG +  +GE+ALG+N L+ F TW GYNYEDA++LS+RL  ED++TS+HI EY  +   TK G EEITRD+  +SE   K LD+ GII +GAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G V   K F  E+  EL   V + ++VY+ QKRKI +GDKMAGRHGNKG+IS+I+PVEDMP+L +G  +DI+LNPLGVPSRMNIGQ+LE+HL LA K L                 F++   +   A  + I    ++ N       D AN  + DF+        G      RE   +K     +EGV               PI+       +GK  L DGRTGE FD  V++G M+ LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT+KSDDV GR  TY AIIKG  IPE G+PESFK+L K+ Q L L V +  E
  S:   290 ESLINSMFFDPRRYDLAKVGRYKFNKKLAFRNRITGHMLAEDVIDTSTGEILAEAGTEVTLELADKIQNAAVQSVLIQTEFGNTKVLSNMTVNLAEYVDFDPEELGIHENVFYPVLEKILAEGLSGDELKAAVKKNIHDLIPKHITKEDILASINYNMHLEYNIGNHDDIDHLGNRRIRAVGELLQNQYRIGLSRLERVVRERMTTQD--------------IETITPQSLINIKPVTAAVKEFFGSSQLSQFMDHNNPLSELTHKRRLSALGPGGLSRDRAGFEVRDVHYSHYGRMCPIETPEGPNIGLINSLATYARINEYGFIEAPYRVLDKTDPENPVVTDNVVYLTADEEDNFVVAQANEPLDEDGHFVHAHVSGRFREDTSEFDKANLDLMDVSPKMVFSVATSMIPFLENDDANRALMGSNMQRQAVPLLSTEAPVVGTGMESKAAFDSGVCIV--AKNDGVVEKSTSTKIVVRRDSDGGKDIYNVIKFARSNQGNCMNQRPIVFEGDRVKKDDILADGASTKSGEMALGKNPLIGFMTWEGYNYEDAVLLSERLVQEDVYTSVHIEEYEAEARDTKLGQEEITRDLAGLSEDVLKDLDENGIIRIGAEVRAGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGAYGVVMDTKIFTRENGDELPPGVNKTVRVYIAQKRKISVGDKMAGRHGNKGVISRILPVEDMPYLPNGRPLDIVLNPLGVPSRMNIGQVLEIHLSLAAKVL----------------GFNVATPVFNGADEDDIAVTLEMAN-------DFANTSWEDFEAKWKDRVDGNVIEFLRENQDHKKD---WEGV---------------PID------STGKVRLRDGRTGEEFDSPVTIGFMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEILTVKSDDVIGRVKTYEAIIKGDNIPEPGIPESFKVLLKEFQSLALDVKVLDE 1241
Score = 238, Expect = 1.9e-17, Identities = 108/431 (25%), Positives = 205/431 (47%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKL--EKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKEL--NEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNK--ETTYQSIIYNHFF------SNKSFDLSKAGRFKMARKMRLSERLY----QRVLAEDLKDINGKVVIKKNT--LIQKHELDTIKQLTKEGKLG-IVHNVNLDERISKMANV 446
           +R  Y++ +     PNL+ +QK++++ F+   L+   + I PI     + SLE+I  KL  +  K S +E +    TY  P+ V + + + E+ E+K+              IF   +P++T+ GTF++NG E+ ++SQ+VRSPG Y      I      K++   Y   ++P +G  +  +  ++ D   V       + T  +PIT  ++ALG+    EI  +F     I  S++ +     D +E D L+ L K +   +       ++ +  +F  +   +  L   G+    +K    N +  ++++E    D      ++    +    L++K      QS++    F      SN + +L++   F    ++ + E ++    +++LAE L     K  +KKN   LI KH       +TKE  L  I +N++L+  I    ++
  S:    49 IRMSYARQDDVLEVPNLIEIQKDSYNWFLGEGLKEVFEDISPIGDYSDQLSLEFIDFKLCRDDIKYSIEECKERDATYAAPMKVKVRLHNKETDEIKQ------------HDIFMGDLPLMTDTGTFVINGAERVIVSQLVRSPGIYY----GIAHDKIGKKL---YSATVIPNRGA-WLEYETDSNDIFNVRV-----DRTRKVPITVLIRALGIGTNAEIKELFGEEPKILASMEKD---PSDNYE-DGLLELYKKIRPGEPLSVDSAESLINSMF--FDPRRYDLAKVGRYKFNKKLAFRNRITGHMLAEDVI-DTSTGEILAEAGTEVTLELADKIQNAAVQSVLIQTEFGNTKVLSNMTVNLAEYVDFD-PEELGIHENVFYPVLEKILAEGLSGDELKAAVKKNIHDLIPKH-------ITKEDILASINYNMHLEYNIGNHDDI 459
>gi|119511559|ref|ZP_01630667.1| DNA-directed RNA polymerase beta subunit [Nodularia spumigena CCY9414] >gi|119463794|gb|EAW44723.1| DNA-directed RNA polymerase beta subunit [Nodularia spumigena CCY9414] (1099 aa)
Score = 2071, Expect = 0.0e+00, Identities = 418/858 (48%), Positives = 576/858 (67%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSNLNVEKNKF-KEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI--KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L+  DIL+   Y+INL+YDIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ ++D               + LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SHYG+ICPIETPEG N GLI SLAT+A  +  GFL TP+R V+NG +  ++   ++TA  ED+   A  ++ +++N + K  +V  RYR  W     + VD++ +SP Q+VS+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V     DG V+YVD   I++  K G+ E  Y L+K+ +SNQ+TC NQ P+V +GE+V  G  +ADG +   GELALGQN+++A+  W GYNYEDAI++S++L  +D++TSIHI +Y ++  +TK G EEITR+IPNV E + + LD++GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+PVEDMP+L DG+T+DI+LNPLGVPSRMN+GQ+ E  LG A   L +         +   + F   +G  EE SR+       I++ K  ++ D+  K++                   +Y    P                               GK  + DGRTGE FD  ++VG+ Y+LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEA+GAA+ L+ELLT+KSDD++GRN   NAI+KGK IP  G PESFK+L ++LQ LGL +++ K
  S:   278 LTPGDILAAVDYLINLEYDIGNIDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSDA--------------EVLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIGSLATHARVNLYGFLETPFRPVENGRVRFDLPPVYMTADEEDDLRTATGDIPLDENGYIKGPQVPVRYRQDWATTTPEQVDYVAVSPVQIVSVATSMIPFLEHDDANRALMGSNMQRQAVPLLKPERPLVGTGLEAQGARDSGMVIV--SRTDGDVTYVDATEIRVRPKDGNSEIRYRLSKYQRSNQDTCLNQKPLVRIGERVVAGQVLADGSSTEGGELALGQNIVIAYMPWEGYNYEDAILISEKLVQDDVYTSIHIEKYEIEARQTKLGPEEITREIPNVGEDALRQLDEQGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRLFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPVEDMPYLADGSTVDIVLNPLGVPSRMNVGQVFECMLGWAAHTLGV---------RFKITPFDEMYG--EETSRS-------IVHGKLQEARDETGKDW-------------------VYNPDNP-------------------------------GKIMVFDGRTGEPFDRPITVGVAYILKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAFGAAYTLQELLTVKSDDMQGRNEALNAIVKGKSIPRPGTPESFKVLMRELQSLGLDIAVHK 1056
Score = 265, Expect = 1.3e-20, Identities = 87/327 (26%), Positives = 155/327 (47%)
  Q:    23 IEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYS-------SLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNK 349
           +E  F  P+L+ +Q+++F  F++  L   + S  PI    G+  L ++G   KL++PK S +E++    TY   +YV   +++ E+G++K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   KS+I  +  R      Y   ++P +G  +  F  +  D + V       + T  +     LKALGL+  EI +   + +  + +++     E    E + L+ L + L   +     G    L   F   K+Y         L  +L     +  +     +++       AA D +INL     NID    L N+
  S:     7 MESAFLLPDLIEIQRSSFRWFLEEGLIEELNSFSPITDYTGKLELHFLGNNYKLKEPKYSVEESKRRDSTYAVQMYVPTRLLNKETGDIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYY--KSEIDKNGRRT-----YSASLIPNRGA-WLKFETDRNDLVWVRI-----DKTRKLSAQVLLKALGLSDNEIFDALRHPEYFQKTIE----KEGQFSEEEALMELYRKLRPGEPPTVLGGQQLLDSRFFDPKRYDLGRVGRYKLNKKLRLSVPDTMRVLTPGDIL-------AAVDYLINLEYDIGNIDDIDHLGNR 309
>gi|157150595|ref|YP_001451193.1| DNA-directed RNA polymerase subunit beta [Streptococcus gordonii str. Challis substr. CH1] >gi|189043873|sp|A8AZI3|RPOB_STRGC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|157075389|gb|ABV10072.1| DNA-directed RNA polymerase, beta subunit [Streptococcus gordonii str. Challis substr. CH1] (1188 aa)
Score = 2071, Expect = 0.0e+00, Identities = 453/1109 (40%), Positives = 675/1109 (60%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++ +PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI +IF +   ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF    +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  TL+ +  +D+I +    G   I +  N D  +  +   V+ +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDE+I+A +N  + E+  F E  V+ R++ + + F    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + + LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKDFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIREPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKIGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSDLVRNTIEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPHRYDLAAVGRYKINKKLNIKTRLLNQTIAEPLVDAETGEILVEAGTLMTRSVIDSIAEQLDNGLNKITYIPN-DSAV--LTEPVELQKFKVVAPTDP-DRVVTIIGNANPSDKVRTVTPADILAEMSYFLNLAEGIGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKVDREAGVVTNEIVWLTADEEDEFIVAQANSKLNEEGGFAEPIVMGRHQGNNQEFPSDQVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQHDGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSDDLWDTVRE 1002
Score = 538, Expect = 2.6e-52, Identities = 109/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   973 GMAARNLGIHIATPVFDGASSDDLWDTVREAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSMVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1155
>gi|62720650|gb|AAX93861.1| RNA polymerase subunit B [Mycobacterium aubagnense] (1172 aa)
Score = 2070, Expect = 0.0e+00, Identities = 445/942 (47%), Positives = 606/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYE---KINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL-DYDIGF-----------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+   K+ ++  N +Q            +   TL+  DI++   Y++ L D D               DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++    F EDK+L R +    EF    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V  D  T+    GS    Y + KFN+SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP + DGT +DI+LN  GVP RMNIGQILE HLG   K                    + W             N+E             AN  + ++  +L        R+ ++   ATPVF+G    +L E +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    +++ +D+    +N+  N  +N+
  S:   278 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHDGNPAQ------------VTATTLTEEDIVATIEYLVRLHDGDTKMTAPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANSPLDDGGHFTEDKILVRRKGGEVEFVSANDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KSGVIEEVSADYVTVMADDGSRH-TYRMRKFNRSNHGTCANQRPIVDSGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPQEDMPFMPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAK--------------------AGW-------------NIEA-----------DANGAYPEWAANLPDGMHSAPRDSIV---ATPVFDGAREGEL-EGLLGSTLPNRDGDVMVDAEGKSQLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDSDDEDLERTAANLGINLSRNE 1164
Score = 250, Expect = 7.0e-19, Identities = 77/276 (27%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I ++                 LE  +  + PI+   G  SL +   + ++ K    E + + +TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + K+  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    28 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSDRWRAKAVDRGDINPVGGLEEVLAELSPIEDFAGTLSLSFSDPRFDEVKAPVDECKEKDQTYAAPLFVTAEFINNTTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKATEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTSEQIRERFGFSEIMMGTLEKDPTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 292
>gi|158513702|sp|A3CKD3|RPOB_STRSV DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1188 aa)
Score = 2068, Expect = 0.0e+00, Identities = 453/1104 (41%), Positives = 672/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTL-SISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++ +PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EIL+IF +   ++N+++ +I+                  N  DS      D  L+E++++          E K AE  + L E                                             FF    +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +D+I +    G   I +  N D  +  +   V  +K  V    D  D  + IIG     DK  + + +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDE+I+A +N  + EK  F E  V+ R++ + + F    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY++ KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + + LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:    10 KHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDHGLKEVFEDVLPISNFTNTMELEFVGYEIREPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEILDIFGDSDLVRNTIEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSRSLLEA-------------------------------------------RFFDPHRYDLAAVGRYKINKKLSVKTRLLNQTIAEPLVDAETGEILVEAGTVMTRSVIDSIAEQLDNGLNKITYIPN-DSAV--LTAPVDLQKFKVVAPTDP-DRVVTIIGNANPSDKVRIVTPADILAEMSYFLNLAEGIGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKVDREAGVVTNEIVWLTADEEDEFIVAQANSKLNEKGGFAEPIVMGRHQGNNQEFPSDQVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQHDGKVTYADADKVEVRREDGSLD-VYQIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWDTVRE 1002
Score = 538, Expect = 2.8e-52, Identities = 109/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   973 GMAARNLGIHIATPVFDGASSEDLWDTVREAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSMVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1155
>gi|41017746|sp|Q8GCR6|RPOB1_ENTFC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|27372991|gb|AAO00728.1| DNA-dependent RNA polymerase subunit beta [Enterococcus faecium] (1208 aa)
Score = 2067, Expect = 0.0e+00, Identities = 467/1104 (42%), Positives = 663/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +++I +    PNL+ +Q +++  F+D  L    + I PI    G  SLE++  +L++PK +  EAR     Y  PL+V L + + E+GE+K               +FF   P++TE+GTFI+NG E+ ++SQ+VRSPG Y   K         K  +EG+   ++P +G  +     + KD   V       + T  IP+T  ++ALG                                                   +G D  + E+F    +L++ +E         K+L++  ++  +E+  KD+   L     K  DS   L N            FF  K +DL+  GR+K+ +K+ L  RL    LAE L D   G+++++K T++    ++T+      G     +  + D  ++    V   + I V+   D + E   I          T+  +DI++  SY +NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D               ++LT + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHYSHYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  + G +TD+I +LTA  ED YI+A +N  LN E   F +D V+ R +S      +  VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EYK AHDSG A +   + DG V YVD   I+++  +G+ +K Y++TKF +SN  T  NQ PIV +GEKV KG T+ADGP+M  GE+ALGQNVLV F TW GYNYEDAII+S+RL  +D++TSIHI EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  VK F  E   EL+  V   ++VY+VQKRKI  GDKMAGRHGNKG++S+I+P EDMP L DGT IDIMLNPLGVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    13 KHRERRSFARISEVLELPNLIEIQTDSYQWFLDEGLREMFEDILPIDDFNGNLSLEFVDYELKEPKYTVAEARAHDANYSAPLHVTLRLTNRETGEIKAQE------------VFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFHGKVD-------KNGKEGFGSTVIPNRGA-WLEMETDAKDISYVRI-----DRTRKIPLTVLVRALG---------------------------------------------------FGSDDTIFEIFGDSETLRNTVE---------KDLHKNASDSRTEEGLKDVYERLRPGEPKTADSSRNLLNAR----------FFDPKRYDLANVGRYKVNKKLDLKTRLLNLTLAETLVDPETGEIIVEKGTVLTHQVMETLAPFIDNGLNSGTYYPSEDGVVTDPMTV---QVIKVFSPRDPEREVNVIGNGYPEAAVKTVRPADIIASMSYFLNLMEGIGNVDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------TETLTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNKFGFIETPYRRVDRETGRVTDQIDYLTADIEDHYIVAQANSPLN-EDGTFAQDVVMARAQSENLEVSIDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPWVGTGMEYKSAHDSGAALLC--KHDGVVEYVDASEIRVRRDNGALDK-YDVTKFRRSNSGTSYNQRPIVHLGEKVEKGVTLADGPSMEQGEMALGQNVLVGFMTWEGYNYEDAIIMSRRLVKDDVYTSIHIEEYESEARDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVQDGDLLVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVHDVKIFTREAGDELSPGVNMLVRVYIVQKRKIHEGDKMAGRHGNKGVVSRIMPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARQLGIHVATPVF---DGASDEDVWETVRE 1005
Score = 544, Expect = 6.3e-53, Identities = 105/177 (59%), Positives = 133/177 (75%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++  +L    ATPVF+G +  D+ E + EAG+             K  L DGRTGE FDG VSVG+MYM+KL HMVDDK+H+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   976 GMAARQLGIHVATPVFDGASDEDVWETVREAGM---------ASDAKTVLYDGRTGEPFDGRVSVGVMYMIKLAHMVDDKLHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQSLGLDMRV 1143
>gi|186900505|ref|ZP_02973462.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 7424] >gi|186692295|gb|EDU16914.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 7424] (1096 aa)
Score = 2066, Expect = 0.0e+00, Identities = 427/867 (49%), Positives = 576/867 (66%)
  Q:   470 TDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV--YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           TDT+     L+  DILS   Y+INL++DIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ +++                SLT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SH+G+ICP+ETPEG N GLI SLATYA  ++ GF+ TPY  V+NG    ++   +LTA  EDE+ +A  ++   E+     + V  RYR  +   + + VD+I +SP Q+VS+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V      G V++VD  TI+++   EE+V  YEL K+ +SNQ+TC NQ P+V  GE+V  G  +ADG A   GE+ALGQN+LVA+  W GYNYEDAI++S+RL  +D++TSIH+ +Y ++  +TK G EEITR+IPNV E + + LD+ GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG  +DI+LNPLGVPSRMN+GQ+ E  LG A + L +         +   + F   +G  EEASR  +  L           L+QA+             R G   +  ++ T  P                               GK  + DGRTGE FD  V+VG  YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLT+KSDD++GRN   NAI+KGKPIP  G PESFK+L ++LQ LGL +++ K
  S:   268 TDTT---RVLTSEDILSAIDYLINLEFDIGSTDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSEA--------------DSLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIGSLATYARVNQYGFIETPYYRVENGRARRDLEPVYLTADEEDEFRVAPGDVATDEEGHIIGESVPVRYRHEFSTTEPQQVDYIAVSPVQIVSVATSLIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQTARDSGMVIV--SRTHGIVTHVDATTIRVQVKGEERVIEYELQKYQRSNQDTCLNQRPLVYTGEEVVPGQVLADGSATEGGEIALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHVEKYEIEARQTKLGPEEITREIPNVGEDALRNLDERGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGRPVDIVLNPLGVPSRMNVGQVFECLLGWAGENLGV---------RFKITPFDEMYG--EEASRETVHGL-----------LEQASH------------RPG---KDWVFDTENP-------------------------------GKIMVYDGRTGEPFDRPVTVGQAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAYGAAYTLQELLTVKSDDMQGRNEALNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIAVHK 1052
Score = 252, Expect = 4.2e-19, Identities = 83/320 (25%), Positives = 150/320 (46%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGM--KLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGK---NAEKQKELNEVINNIISEK--AAKDLVINLSISTKNIDSKFRLSNK 349
           P+L+++Q+++F  F+   L   + S  PI    G+  L ++G   KL++PK +  EA+    TY   +YV   +++ E+G +K+              +F   +P++TE+GTFI+NG E+ +++QIVRSPG Y   +      N R+     Y   ++P +G  +  F  +    + V       + T  +     LKA+GL+  EIL+   +    + +LD     E +  E + L+ L + L   +     G    L   F  + + +  L   G+   N + +  + +    + SE   +A D +INL     + D    L N+
  S:    10 PDLISIQRSSFRWFLQEGLIEELDSFSPITDYTGKLELHFLGQDYKLKEPKYTVDEAKRRDSTYSVQMYVPTRLINKETGNIKEQE------------VFIGDLPLMTERGTFIINGAERVIVNQIVRSPGVYYKCEYD---KNGRRT----YSASLIPNRGA-WLKFETDKNGLVWVRI-----DKTRKLSAQVLLKAIGLSDNEILDALRHPDFYQKTLD----KEGNPSEEEALLELYRKLRPGEPPTVSGGQLLLESRF--FDNKRYDLGRVGRYKLNKKLRLNVTDTTRVLTSEDILSAIDYLINLEFDIGSTDDIDHLGNR 305
>gi|196257468|ref|ZP_03156004.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 7822] >gi|196201068|gb|EDX95887.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 7822] (1095 aa)
Score = 2064, Expect = 0.0e+00, Identities = 423/858 (49%), Positives = 574/858 (66%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV--YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L   DIL+   Y+INL++DIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ +++                SLT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SH+G+ICP+ETPEG N GLI SLATYA  ++ GF+ TPY  V+NG +  E+   +LTA  ED++ +A  ++   E      + V  RYR  +   + + VD++ +SP Q+VS+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V      G V++VD  TI++K  SEE+V  YEL K+ +SNQ+TC NQ P+V +GE+V  G  +ADG A   GE+ALGQN+LVA+  W GYNYEDAI++S+RL  +D++TSIH+ +Y ++  +TK G EEITR+IPNV E + + LD+ GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG  +DI+LNPLGVPSRMN+GQ+ E  LG A + L +         +   + F   +G  EEASR  +  L           L+QA+            +R G   ++ ++    P                               GK  + DGRTGE FD  V+VG  YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLT+KSDD++GRN   NAI+KGKPIP  G PESFK+L ++LQ LGL +++ K
  S:   274 LRQEDILAAIDYLINLEFDIGSTDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSEA--------------DSLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIGSLATYARVNQYGFIETPYYRVENGRVRRELAPVYLTADEEDDFRVAPGDVATDEAGVIVGESVPVRYRQEFSTTEPEQVDYVAVSPVQIVSVATSLIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQTARDSGMVIV--SRSHGVVTHVDATTIRVKVKSEERVIEYELQKYQRSNQDTCLNQRPLVYMGEEVVPGQVLADGSATEGGEIALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHVEKYEIEARQTKLGPEEITREIPNVGEDALRNLDERGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGRPVDIVLNPLGVPSRMNVGQVFECLLGWAGENLGV---------RFKITPFDEMYG--EEASRETVHGL-----------LNQAS------------NRPG---KEWVFSQDHP-------------------------------GKIMVYDGRTGEPFDRPVTVGQAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAYGAAYTLQELLTVKSDDMQGRNEALNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIAVHK 1052
Score = 254, Expect = 2.5e-19, Identities = 84/320 (26%), Positives = 151/320 (47%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGM--KLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGK---NAEKQKELNEVINNIISEK--AAKDLVINLSISTKNIDSKFRLSNK 349
           P+L+++Q+++F  F++  L   + S  PI    G+  L ++G   KL++PK +  EA+    TY   +YV   +++ E+G +K+              +F   +P++TE+GTFI+NG E+ +++QIVRSPG Y   +      N R+     Y   ++P +G  +  F  +    + V       + T  +     LKA+GL+  EIL+   +    + +LD     E +  E + L+ L + L   +     G    L   F  + + +  L   G+   N + +  + + I  +  E   AA D +INL     + D    L N+
  S:    10 PDLISIQRSSFRWFLEEGLIEELDSFSPITDYTGKLELHFLGQDYKLKEPKYAVDEAKRRDSTYSVQMYVPTRLINKETGNIKEQE------------VFIGDLPLMTERGTFIINGAERVIVNQIVRSPGVYYKCEYD---KNGRRT----YSASLIPNRGA-WLKFETDKNGLVWVRI-----DKTRKLSAQVLLKAIGLSDNEILDALRHPDFYQKTLD----KEGNPSEEEALLELYRKLRPGEPPTVSGGQLLLESRF--FDNKRYDLGRVGRYKLNKKLRLNVADTIRVLRQEDILAAIDYLINLEFDIGSTDDIDHLGNR 305
>gi|41017745|sp|Q8GCR5|RPOB3_ENTFC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|27372993|gb|AAO00729.1| DNA-dependent RNA polymerase subunit beta [Enterococcus faecium] (1208 aa)
Score = 2063, Expect = 0.0e+00, Identities = 466/1104 (42%), Positives = 669/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +++I +    PNL+ +Q +++  F+D  L    + I PI    G  SLE++  +L++PK +  EAR     Y  PL+V L + + E+GE+K               +FF   P++TE+GTFI+NG E+ ++SQ+VRSPG Y   K         K  +EG+   ++P +G  L     A++  ++++       + T  IP+T  ++ALG                                                   +G D  + E+F    +L++ +E         K+L++  ++  +E+  KD+   L     K  DS   L N            FF  K +DL+  GR+K+ +K+ L  RL    LAE L D   G+++++K T++    ++T+      G   + +  + D  ++    V   + I V+   D + E + +IG         T+  +DI++  SY +NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D               ++LT + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHYSHYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  + G +TD+I +LTA  ED YI+A +N  LN E   F +D V+ R +S      +  VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EYK AHDSG A +   + DG V +VD   I+++  +G+ +K Y +TKF +SN  T  NQ PIV +GEKV KG T+ADGP+M  GE+ALGQNVLV F TW GYNYEDAII+S+RL  +D++TSIHI EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  VK F  E   EL+  V   ++VY+VQKRKI  GDKMAGRHGNKG++S+I+P EDMP L DGT IDIMLNPLGVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    13 KHRERRSFARISEVLELPNLIEIQTDSYQWFLDEGLGEMFEDILPIDDFNGNLSLEFVDYELKEPKYTVAEARAHDANYSAPLHVTLRLTNRETGEIKAQE------------VFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFHGKVD-------KNGKEGFGSTVIPNRGAWLEMETSAKDISYVRI-------DRTRKIPLTVLVRALG---------------------------------------------------FGSDDTIFEIFGDSETLRNTVE---------KDLHKNASDSRTEEGLKDVYERLRPGEPKTADSSRNLLNAR----------FFDPKRYDLANVGRYKVNKKLDLKTRLLNLTLAETLVDPETGEIIVEKGTVLTHQVMETLAPFIDNGLNSVTYYPSEDGVVTDPMTV---QVIKVFSPKDPERE-VNVIGNGYPESAVKTVRPADIIASMSYFLNLMEGIGNVDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------TETLTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNKFGFIETPYRRVDRETGRVTDQIDYLTADIEDHYIVAQANSPLN-EDGTFAQDVVMARAQSENLEVSIDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPWVGTGMEYKSAHDSGAALLC--KHDGVVEFVDASEIRVRRDNGALDK-YAVTKFRRSNSGTSYNQRPIVHLGEKVEKGDTLADGPSMEQGEMALGQNVLVGFMTWEGYNYEDAIIMSRRLVKDDVYTSIHIEEYESEARDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVQDGDLLVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVHDVKIFTREAGDELSPGVNMLVRVYIVQKRKIHEGDKMAGRHGNKGVVSRIMPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARQLGIHVATPVF---DGASDEDVWETVRE 1005
Score = 543, Expect = 7.0e-53, Identities = 105/177 (59%), Positives = 133/177 (75%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++  +L    ATPVF+G +  D+ E + EAG+             K  L DGRTGE FDG VSVG+MYM+KL HMVDDK+H+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   976 GMAARQLGIHVATPVFDGASDEDVWETVREAGM---------ASDAKTILYDGRTGEPFDGRVSVGVMYMIKLAHMVDDKLHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQSLGLDMRV 1143
>gi|145596444|ref|YP_001160741.1| DNA-directed RNA polymerase subunit beta [Salinispora tropica CNB-440] >gi|145305781|gb|ABP56363.1| DNA-directed RNA polymerase, beta subunit [Salinispora tropica CNB-440] (1143 aa)
Score = 2063, Expect = 0.0e+00, Identities = 436/871 (50%), Positives = 575/871 (66%)
  Q:   471 DTSLDKPTLSISDILSITSYVINLDYDIGFY--DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKD--VDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKE--AMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           D S+D   L+  DI++   Y+  L      Y  DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLA LT++RR+SA+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI +L+T+A  +  GF+ TPYR V +G +TD+I +LTA  ED ++ A +N  +  +  F E++VL R R   E  DV    VD++D+SP+Q+ S+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG EY+ A D+G   V   E  G V  +    I + +     + Y L KF +SN  +C NQ P+V  G++V  G  IADGP   +GE+ALG+N+LVAF TW G+NYEDAIILS+RL  +D+ TSIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV  GDVLVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  GTV  V+ F  ED  EL   V E ++VYV QKRKIQ GDK+AGRHGNKG+ISKI+PVEDMP LEDGT +DI+LNPLGVPSRMNIGQ+LE HLG   K              K   D + W                    ++Q++++  A++   D ++                  ATPVF+G    ++    A T A  D   GK   G SGK  L DGR+GE     ++VG +Y+LKL+H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A
  S:   303 DLSIDTGVLTQDDIVATVEYLCRLHAGEEGYEADDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQTNPLAGLTHRRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGALSTFARVNPFGFIETPYRKVVDGRVTDQIDYLTADEEDRFVKAQANAPLRADGSFAEERVLVR-RKGGETEDVPPAAVDYMDVSPRQMTSVATAMIPFLEHDDANRALMGANMQRQAVPLVKAEAPLVGTGMEYRAAVDAGDVVV--AEFGGVVEDLCADYITVHQDDGHRRTYLLHKFRRSNAGSCVNQKPVVFEGDRVEAGQVIADGPCTDDGEMALGRNLLVAFMTWEGHNYEDAIILSQRLVQQDVLTSIHIEEHEVDARDTKLGPEEITRDIPNVSEEMLADLDERGIIRIGAEVVPGDVLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGTVIGVRTFSREDGDELPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVISKILPVEDMPFLEDGTPVDIVLNPLGVPSRMNIGQVLETHLGWVAKT-----------GWKVEGDDAEW--------------------KRQLQAI-SADESEPDSNV------------------ATPVFDGAREEEISGLLASTRANRD---GKQLIGSSGKAQLFDGRSGEPLPDPIAVGYIYILKLNHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYALQELLTIKSDDVLGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGVA 1111
Score = 229, Expect = 2.1e-16, Identities = 76/281 (27%), Positives = 132/281 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE---------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  + +I ++   PNLL +Q  +F   +  E               L   +  I PI+   G  SL +   + ++ K S +E + +  TY  PL+V     +N +GE+K  T            +F    PM+T KGTFI+NG E+ V+SQ+VRSPG Y   K   K S+     ++    +++P++G  +  F  + ++ + V       +      +T  LKA+G   E+I   F   + +  +L+ +    +D    + L+++ + L   +        T L  LF   K+Y   K
  S:    20 RVSFGRITEHLEVPNLLAIQTESFDWLVGNEAWQGRSADDPHARSGLAEILDEISPIEDFSGTMSLSFSAPRFDEVKASIEECKEKDLTYCAPLFVTAEFTNNTTGEIKSQT------------VFMGDFPMMTPKGTFIINGTERVVVSQLVRSPGVY-FDKQPDKTSD-----RDLSSVKVIPSRGA-WLEFDIDKRETVGVRI-----DRKRRQAVTVLLKAIGWTAEQIRERFGWSELMMTTLEKDHIASQD----EALLDIYRKLRPGEPPTRENAQTLLDNLFFNPKRYDVAK 290
>gi|171778937|ref|ZP_02919999.1| hypothetical protein STRINF_00860 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282583|gb|EDT48007.1| hypothetical protein STRINF_00860 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (1215 aa)
Score = 2062, Expect = 0.0e+00, Identities = 453/1107 (40%), Positives = 677/1107 (61%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKP-TLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L    + + PI +      LE++G +L++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF + + ++N++      EKD+ +           N +DS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE+L D   G+++++  T++ +  +D+I           V+  N    +++   + K++ I+        D  + I+G     DK   L+ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+TY   ++ GF+ TPYR V    GV+T+EI WLTA  EDEY +A +N  + E   F ED V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V + D   ++++   GS + VY +TKF +SN  T  NQ  +V VG+ V KG  IADGP+M  GE+ALGQN +VA+ TW GYNYEDAIILS+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S++VPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +  +    +D   + D  LW  ++E
  S:    33 QYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKDFLDNGLREVFEDVLPITNFTDTMELEFVGYELKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIMDIFGDSELVRNTI------EKDIHK-----------NPADSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNIKTRLLNQTIAENLVDAETGEILVEAGTVMTRDVIDSIADQLDGDLNKFVYTPNDYAVVTEPVVLQKFKVISPV----DPDRVVTIVGNANPDDKARALTPADILAEMSYFLNLAEGLGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSTYGHLNKYGFIQTPYRKVDRATGVVTNEIVWLTADEEDEYTVAQANSKLNEDGTFAEDIVMGRHQGNNQEFPSNIVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPHAPYVGTGMEYQAAHDSGAAVI--AKHDGRVVFSDAEKVEVRREDGSLD-VYHITKFRRSNSGTAYNQHTLVKVGDIVEKGDFIADGPSMEKGEMALGQNPIVAYMTWDGYNYEDAIILSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRVVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGI-HIATPVFDGATSED--LWDTVNE 1028
Score = 531, Expect = 1.6e-51, Identities = 108/194 (55%), Positives = 135/194 (69%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G    DL + + EAG+             K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   999 GMAARNLGIHIATPVFDGATSEDLWDTVNEAGM---------ASDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1181
>gi|29377682|ref|NP_816836.1| DNA-directed RNA polymerase subunit beta [Enterococcus faecalis V583] >gi|41017700|sp|Q82Z40|RPOB_ENTFA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|29345150|gb|AAO82906.1| DNA-directed RNA polymerase, beta subunit [Enterococcus faecalis V583] (1207 aa)
Score = 2062, Expect = 0.0e+00, Identities = 463/1104 (41%), Positives = 667/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSN-LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +++I +    PNL+ +Q +++  F+D  L    + I PI    G  SLE++  +L++PK + +EAR     Y  PL+V L + + E+GE+K            +  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  +EG+   ++P +G  +     + KD   V       + T  IP+T  ++ALG                                                   +G D  + E+F    SL++ +E         K+L++  ++  +E+  KD+   L     K  DS           +S++   FF  K +DL+  GR+K+ +K+ L  RL    LAE L D   G+++++K T++    ++T+ +    G   + +  + D  +++   +   + I V    D +   + +IG     D   T+  +DI++  SY  NL  DIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D               ++LT + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHYSHYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V    G +TD++ +LTA  ED YI+A +N L  E   F  D V+ R +S      V  VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P +P VGTG EYK AHDSG A +   + DG V +VD   I+++  +G+ +K Y +TKF +SN  T  NQ PIV +GEKV KG T+ADGP+M  GE+ALGQNVLVAF TW GYNYEDAII+S+RL  +D++TS+HI EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  VK F  E   EL+  V   ++VY+VQKRKI  GDKMAGRHGNKG++S+I+P EDMP L DGT +DIMLNPLGVPSRMNIGQ+LELHLG+A ++L +     ++     A+D  +W  + E
  S:    13 KHRERRSFARISEVLELPNLIEIQTDSYQWFLDEGLREMFEDILPIDDFQGNLSLEFVDYELKEPKYTVEEARAHDANYSAPLHVTLRLTNRETGEIK------------SQEVFFGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFHGKVD-------KNGKEGFGSTVIPNRGA-WLEMETDAKDISYVRI-----DRTRKIPLTVLVRALG---------------------------------------------------FGSDDTIFEIFGDSESLRNTIE---------KDLHKNASDSRTEEGLKDIYERLRPGEPKTADSS----------RSLLTARFFDPKRYDLANVGRYKVNKKLDLKTRLLNLTLAETLVDPETGEIIVEKGTVLTHQIMETLGEYIDNGLNSVTYYPSEDAVVTEPMTI---QVIQVLSPKDPE-RIVNVIGNGYPDDSVKTVRPADIVASMSYFFNLMEDIGNVDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------TETLTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNKFGFIETPYRRVDRATGRVTDQVDYLTADIEDHYIVAQANSLLNEDGTFANDVVMARLQSENLEVAVDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIQPRSPWVGTGMEYKSAHDSGAALLC--KHDGVVEFVDAKEIRVRRDNGALDK-YMVTKFRRSNSGTSYNQRPIVHLGEKVEKGDTLADGPSMEEGEMALGQNVLVAFMTWEGYNYEDAIIMSRRLVKDDVYTSVHIEEYESEARDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVQDGDLLVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVHDVKIFTREAGDELSPGVNMLVRVYIVQKRKIHEGDKMAGRHGNKGVVSRIMPEEDMPFLPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARQLGIHVATPVF---DGATDEDVWETVRE 1005
Score = 535, Expect = 5.8e-52, Identities = 103/177 (58%), Positives = 131/177 (74%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++  +L    ATPVF+G    D+ E + EAG+             K  L DGRTGE FD  +SVG+MYM+KL HMVDDK+H+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   976 GMAARQLGIHVATPVFDGATDEDVWETVREAGM---------ASDAKTVLYDGRTGEPFDNRISVGVMYMIKLAHMVDDKLHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQSLGLDMRV 1143
>gi|41017744|sp|Q8GCR4|RPOB2_ENTFC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|27372995|gb|AAO00730.1| DNA-dependent RNA polymerase subunit beta [Enterococcus faecium] (1208 aa)
Score = 2062, Expect = 0.0e+00, Identities = 466/1104 (42%), Positives = 666/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  R+ +++I +    PNL+ +Q +++  F+D  L    + I PI    G  SLE++  +L++PK +  EAR     Y  PL+V L + + E+GE+K               +FF   P++TE+GTFI+NG E+ ++SQ+VRSPG Y   K         K  +EG+   ++P +G  +     + KD   V       + T  IP+T  ++ALG                                                   +G D  + E+F    +L++ +E         K+L++  ++  +E+  KD+   L     K  DS   L N            FF  K +DL+  GR+K+ +K+ L  RL    LAE L D   G+++++K T++    ++T+      G   + +  + D  ++    V   + I V+   D + E + +IG         T+  +DI++  SY +NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D               ++LT + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHYSHYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  + G +TD+I +LTA  ED YI+A +N  LN E   F +D V+ R +S      +  VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EYK AHDSG A +   + DG V +VD   I+++  +G+ +K Y +TKF +SN  T  NQ PIV +GEKV KG T+ADGP+M  GE+ALGQNVLV F TW GYNYEDAII+S+RL  +D++TSIHI EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  VK F  E   EL+  V   ++VY+VQKRKI  GDKMAGRHGNKG++S+I+P EDMP L DGT IDIMLNPLGVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    13 KHRERKSFARISEVLELPNLIEIQTDSYQWFLDEGLREMFEDILPIDDFNGNLSLEFVDYELKEPKYTVAEARAHDANYSAPLHVTLRLTNRETGEIKAQE------------VFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFHGKVD-------KNGKEGFGSTVIPNRGA-WLEMETDAKDISYVRI-----DRTRKIPLTVLVRALG---------------------------------------------------FGSDDTIFEIFGDSETLRNTVE---------KDLHKNASDSRTEEGLKDVYERLRPGEPKTADSSRNLLNAR----------FFDPKRYDLANVGRYKVNKKLDLKTRLLNLTLAETLVDPETGEIIVEKGTVLTHQVMETLAPFIDNGLNSVTYYPSEDGVVTDPMTV---QVIKVFSPKDPERE-VNVIGNGYPESAVKTVRPADIIASMSYFLNLMEGIGNVDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------TETLTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNKFGFIETPYRRVDRETGRVTDQIDYLTADIEDHYIVAQANSPLN-EDGTFAQDVVMARAQSENLEVSIDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPWVGTGMEYKSAHDSGAALLC--KHDGVVEFVDASEIRVRRDNGALDK-YAVTKFRRSNSGTSYNQRPIVHLGEKVEKGDTLADGPSMEQGEMALGQNVLVGFMTWEGYNYEDAIIMSRRLVKDDVYTSIHIEEYESEARDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVQDGDLLVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVHDVKIFTREAGDELSPGVNMLVRVYIVQKRKIHEGDKMAGRHGNKGVVSRIMPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARQLGIHVATPVF---DGASDEDVWETVRE 1005
Score = 543, Expect = 7.0e-53, Identities = 105/177 (59%), Positives = 133/177 (75%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++  +L    ATPVF+G +  D+ E + EAG+             K  L DGRTGE FDG VSVG+MYM+KL HMVDDK+H+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   976 GMAARQLGIHVATPVFDGASDEDVWETVREAGM---------ASDAKTILYDGRTGEPFDGRVSVGVMYMIKLAHMVDDKLHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQSLGLDMRV 1143
>gi|116628547|ref|YP_821166.1| DNA-directed RNA polymerase subunit beta [Streptococcus thermophilus LMD-9] >gi|122266858|sp|Q03IK2|RPOB_STRTD DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|116101824|gb|ABJ66970.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Streptococcus thermophilus LMD-9] (1193 aa)
Score = 2060, Expect = 0.0e+00, Identities = 453/1109 (40%), Positives = 677/1109 (61%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++    PNL+ +Q ++F +F+DT L+   + + PI +      LE++G +L++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF + + ++N++      EKD+ +           N +DS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE+L D   G+++++  T + +  +D+I +         V+  N     + +   V  +K  V   ND  D  + I+G     DK   L+ +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               ++LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+TY   ++ GF+ TPYR V    G +T+E+ WLTA  EDEYI+A +N  + E   F E+ V+ R++   + +    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M  GE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ E+  +   TK G EEITR++PNVSE + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLGLPNLIEIQTDSFKEFLDTGLKEVFEDVLPISNFTDTMELEFVGYELKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGDSELVRNTI------EKDIHK-----------NPADSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKLNKKLNIKTRLLGQTIAENLVDPETGEILVEAGTEMTRDVIDSIAEHLDGDLNKFVYTPN---DYAVVTEPVVLQKFKVVAPNDP-DRVVTIVGNANPDDKVRALTTADILAEMSYFLNLAEGIGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NEALTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSTYGRLNKYGFIQTPYRKVDRATGKVTNEVVWLTADEEDEYIVAQANSKLNEDGTFAEEIVMGRHQGVNQEYPSHLVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPFVGTGMEYQAAHDSGAAVI--AKHDGKVVYSDADKVEVRREDGSLD-VYTIQKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMEGGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEFESETRDTKLGPEEITRELPNVSEEALKNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIYIATPVF---DGASSEDLWDTVRE 1002
Score = 532, Expect = 1.5e-51, Identities = 106/180 (58%), Positives = 131/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARNLGIYIATPVFDGASSEDLWDTVREAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNILQEILTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|24380333|ref|NP_722288.1| DNA-directed RNA polymerase subunit beta [Streptococcus mutans UA159] >gi|41018032|sp|Q8DS46|RPOB_STRMU DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|24378350|gb|AAN59594.1|AE015022_1 DNA-dependent RNA polymerase, beta subunit [Streptococcus mutans UA159] (1187 aa)
Score = 2060, Expect = 0.0e+00, Identities = 445/1081 (41%), Positives = 668/1081 (61%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPT-LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           +  K+  RR +S+I++  + PNL+ +Q ++F  F+DT L+   + + PI +      LE++G +L++PK + +EAR     Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF + + ++N+++ +I+               KN N S +      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  +V+AE+L D   G+++++  T + +  +D+I          IV+  N     + +   V  +K  V   ND  D  + +IG  +  DK   L+ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + G +T+EI WLTA  EDE+ +A +N  + E   F E+ V+ R++ + + F    V+++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + +G V Y D   I+++   GS + VY +TKF +SN  T  NQ  +V VG+ V KG  IADGP+M  GE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ E+  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L
  S:     7 QYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKDFLDTGLKEVFEDVLPISNFTDTMELEFVGYELKEPKYTLEEARAHDAHYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPLMTEMGTFIINGAERIIVSQLVRSPGVYFNDKVD-------KNGKIGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIIDIFGDSELVRNTIEKDIH---------------KNPNDSRT------DEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLIARFFDARRYDLAAVGRYKINKKLNVKTRLLNQVIAENLVDPETGEILVEAGTEMTRSVIDSIADYLDGDLNKIVYTPN---EYAVLTEPVVLQKFKVMAPNDP-DRTVTVIGNASPDDKVRHLTPADILAEMSYFLNLAEGLGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKVDRETGKVTNEIEWLTADEEDEFTVAQANSKLNEDGSFAEEIVMGRHQGNNQEFPASSVEYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPFVGTGMEYQAAHDSGAAII--AQHNGKVVYSDADKIEVRREDGSLD-VYHVTKFRRSNSGTAYNQRTLVRVGDSVEKGDFIADGPSMEKGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGVVCDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNL 979
Score = 536, Expect = 5.0e-52, Identities = 110/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G    DL E + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  +  K    + +D++E
  S:   973 GMAARNLGIHIATPVFDGATSDDLWETVKEAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTITQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDKDDK--EVDLRDLDE 1155
>gi|55821840|ref|YP_140282.1| DNA-directed RNA polymerase subunit beta [Streptococcus thermophilus LMG 18311] >gi|55823756|ref|YP_142197.1| DNA-directed RNA polymerase subunit beta [Streptococcus thermophilus CNRZ1066] >gi|81558888|sp|Q5LXV3|RPOB_STRT1 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|81560075|sp|Q5M2F5|RPOB_STRT2 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|55737825|gb|AAV61467.1| DNA-directed RNA polymerase beta subunit [Streptococcus thermophilus LMG 18311] >gi|55739741|gb|AAV63382.1| DNA-directed RNA polymerase beta subunit [Streptococcus thermophilus CNRZ1066] (1193 aa)
Score = 2060, Expect = 0.0e+00, Identities = 453/1109 (40%), Positives = 677/1109 (61%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++    PNL+ +Q ++F +F+DT L+   + + PI +      LE++G +L++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF + + ++N++      EKD+ +           N +DS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE+L D   G+++++  T + +  +D+I +         V+  N     + +   V  +K  V   ND  D  + I+G     DK   L+ +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               ++LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+TY   ++ GF+ TPYR V    G +T+E+ WLTA  EDEYI+A +N  + E   F E+ V+ R++   + +    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M  GE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ E+  +   TK G EEITR++PNVSE + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLGLPNLIEIQTDSFKEFLDTGLKEVFEDVLPISNFTDTMELEFVGYELKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGDSELVRNTI------EKDIHK-----------NPADSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKLNKKLNIKTRLLGQTIAENLVDPETGEILVEAGTEMTRDVIDSIAEHLDGDLNKFVYTPN---DYAVVTEPVVLQKFKVVAPNDP-DRVVTIVGNANPDDKVRALTTADILAEMSYFLNLAEGIGKVDDIDHLGNRRVRAVGELLANQFRIGLARMERNVRERMSVQD--------------NEALTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSTYGRLNKYGFIQTPYRKVDRATGKVTNEVVWLTADEEDEYIVAQANSKLNEDGTFAEEIVMGRHQGVNQEYPSHLVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPFVGTGMEYQAAHDSGAAVI--AKHDGKVVYSDADKVEVRREDGSLD-VYTIQKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMEGGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEFESETRDTKLGPEEITRELPNVSEEALKNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIYIATPVF---DGASSEDLWDTVRE 1002
Score = 532, Expect = 1.5e-51, Identities = 106/180 (58%), Positives = 131/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARNLGIYIATPVFDGASSEDLWDTVREAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNILQEILTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|41017743|sp|Q8GCR3|RPOB4_ENTFC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|27372997|gb|AAO00731.1| DNA-dependent RNA polymerase subunit beta [Enterococcus faecium] (1208 aa)
Score = 2060, Expect = 0.0e+00, Identities = 467/1104 (42%), Positives = 668/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKP--TLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +++I +    PNL+ +Q +++  F+D  L    + I PI    G  SLE++  +L++PK +  EAR     Y  PL+V L + + E+GE+K               +FF   P++TE+GTFI+NG E+ ++SQ+VRSPG Y   K         K  +EG+   ++P +G  +     + KD   V       + T  IP+T  ++ALG                                                   +G D  + E+F    +L++ +E         K+L++  ++  +E+  KD+   L     K  DS   L N            FF  K +DL+  GR+K+ +K+ L  RL    LAE L D   G+++++K T++    ++T+    + G   + +  + D  ++    V   + I V+   D + E + +IG     + P  T+  +DI++  SY +NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D               ++LT + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHYSHYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  + G +TD+I +LTA  ED YI+A +N  LN E   F +D V+ R +S      +  VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EYK AHDSG A +   + DG V +VD   I+++  +G+ +K Y++TKF +SN  T  NQ PIV +GEKV KG T+ADGP+M  GE+ALGQNVL    TW GYNYEDAII+S+RL  +D++TSIHI EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVK+GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  VK F  E   EL+  V   ++VY+VQKRKI  GDKMAGRHGNKG++S+I+P EDMP L DGT IDIMLNPLGVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    13 KHRERRSFARISEVLELPNLIEIQTDSYQWFLDEGLREMFEDILPIDDFNGNLSLEFVDYELKEPKYTVAEARAHDANYSAPLHVTLRLTNRETGEIKAQE------------VFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFHGKVD-------KNGKEGFGSTVIPNRGA-WLEMETDAKDISYVRI-----DRTRKIPLTVLVRALG---------------------------------------------------FGSDDTIFEIFGDSETLRNTVE---------KDLHKNASDSRTEEGLKDVYERLRPGEPKTADSSRNLLNAR----------FFDPKRYDLANVGRYKVNKKLDLKTRLLNLTLAETLVDPETGEIIVEKGTVLTHQVMETLAPFIENGLNSVTYYPSEDGVVTDPMTV---QVIKVFSPKDPERE-VNVIGNGYP-EAPVKTVRPADIIASMSYFLNLMEGIGNVDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------TETLTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNKFGFIETPYRRVDRQTGRVTDQIDYLTADIEDHYIVAQANSPLN-EDGTFAQDVVMARAQSENLEVSIDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPWVGTGMEYKSAHDSGAALLC--KHDGVVEFVDASQIRVRRDNGALDK-YDITKFRRSNSGTSYNQRPIVHLGEKVEKGDTLADGPSMEQGEMALGQNVLSVSMTWEGYNYEDAIIMSRRLVKDDVYTSIHIEEYESEARDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKDGDLLVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVHDVKIFTREAGDELSPGVNMLVRVYIVQKRKIHEGDKMAGRHGNKGVVSRIMPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARQLGIHVATPVF---DGASDEDVWETVRE 1005
Score = 543, Expect = 8.2e-53, Identities = 105/177 (59%), Positives = 133/177 (75%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++  +L    ATPVF+G +  D+ E + EAG+             K  L DGRTGE FDG VSVG+MYM+KL HMVDDK+H+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   976 GMAARQLGIHVATPVFDGASDEDVWETVREAGM---------ASEAKTVLYDGRTGEPFDGRVSVGVMYMIKLAHMVDDKLHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTSKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQSLGLDMRV 1143
>gi|159039844|ref|YP_001539097.1| DNA-directed RNA polymerase subunit beta [Salinispora arenicola CNS-205] >gi|157918679|gb|ABW00107.1| DNA-directed RNA polymerase, beta subunit [Salinispora arenicola CNS-205] (1143 aa)
Score = 2059, Expect = 0.0e+00, Identities = 440/891 (49%), Positives = 577/891 (64%)
  Q:   451 KINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY--DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKE--AMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           K+  Y+ N   D  +PI       D   L+  DI++   Y+  L      Y  DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLA LT++RR++A+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI +L+T+A  +  GF+ TPYR V +G +TD++ +LTA  ED ++ A +N  LN +   F ED+VL R R   E  DV    VD++DISP+Q+VS+  + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG EY+ A D+G   V   E  G +  +    + I +     + Y L KF +SN  +C NQ P+V  G++V  G  IADGP    GE+ALG+N+LVAF TW GYNYEDAIILS+RL  +D+ TSIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV  GDVLVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  GTV  V+ F  ED  EL   V E ++VYV QKRKIQ GDK+AGRHGNKG+ISKI+PVEDMP LEDGT +DI+LNPLGVPSRMNIGQ+LE HLG   K              K   D + W                    ++Q++++                   G    +     ATPVF+G    ++    A T +  D   GK   G SGK  L DGR+GE     ++VG +Y+LKL+H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A
  S:   290 KVGRYKFNKKLDLDLPI-------DTGVLTQDDIVATVEYLCRLHAGEEGYEADDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQTNPLAGLTHRRRLNALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGNLSTFARVNPFGFIETPYRKVVDGRVTDQVDYLTADDEDRFVKAQANAPLNAD-GSFAEDRVLVR-RKGGETEDVAPSAVDYMDISPRQMVSVGTAMIPFLEHDDANRALMGANMQRQAVPLVKAEAPLVGTGMEYRAAVDAGDVVV--AEVGGVIEDLCADYVTIHQDDGHRRTYLLHKFRRSNSGSCVNQKPVVFEGDRVEAGQVIADGPCTDEGEMALGRNLLVAFMTWEGYNYEDAIILSQRLVQQDVLTSIHIEEHEVDARDTKLGPEEITRDIPNVSEEMLADLDERGIIRIGAEVVPGDVLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGTVIGVRTFSREDGDELPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVISKILPVEDMPFLEDGTPVDIVLNPLGVPSRMNIGQVLETHLGWVAKT-----------GWKVEGDDAEW--------------------KRQLQAI-------------------GADESEPDSNVATPVFDGAREEEISGLLASTRSNRD---GKQLIGSSGKAQLFDGRSGEPLPDPIAVGYIYILKLNHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYALQELLTIKSDDVLGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGVA 1111
Score = 219, Expect = 2.5e-15, Identities = 76/281 (27%), Positives = 131/281 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE---------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  + +I ++   PNLL +Q  +F   +  E               L   +  I PI+   G  SL +   + ++ K S +E + +  TY  PL+V     +N +GE+K  T            +F    PM+T KGTFI+NG E+ V SQ+VRS G Y   K   K S+     ++    +++P++G  +  F  + +D + V       +      +T  LKA+G + E+I   F   + +  +L+ +    +D    + L+++ + L   +        T L  LF   K+Y   K
  S:    20 RVSFGRITEHLEVPNLLAIQTESFDWLVGNEAWQGRSADDPHARSGLAEILDEISPIEDFSGTMSLSFSAPRFDEVKASIEECKEKDLTYCAPLFVTAEFTNNTTGEIKSQT------------VFMGDFPMMTPKGTFIINGTERVVTSQLVRSSGVY-FDKQPDKTSD-----RDLSSVKVIPSRGA-WLEFDIDKRDTVGVRI-----DRKRRQAVTVLLKAIGWSAEQIREKFGWSELMMTTLEKDHIAGQD----EALLDIYRKLRPGEPPTRENAQTLLDNLFFNPKRYDVAK 290
>gi|163791691|ref|ZP_02186085.1| DNA-directed RNA polymerase subunit beta [Carnobacterium sp. AT7] >gi|159873039|gb|EDP67149.1| DNA-directed RNA polymerase subunit beta [Carnobacterium sp. AT7] (1188 aa)
Score = 2056, Expect = 0.0e+00, Identities = 460/1104 (41%), Positives = 667/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +S+I +    PNL+ +Q +++  F+D  L    K I PI    G  SLE+   +L++PK + +EAR+    Y  P+YV L +++ ESGEVK+              +FF   P++TE GTF++NG E+ ++SQ+VRSPG Y   K         K  +EG+   ++P +G  +  F  + KD   V       + T  IP+T  ++ALG                                                   +G D ++ E+F    SL+  +E         K+L++  ++  +E+A KD+   L     K  DS           +S++   FF  K +DL+  GR+K+ +K+ L+ RL+ + LAE L D   G+++++  T + + +++ +      G   + +  + D   S +   V+ + + V+   D +   + +IG     D+    + +DIL+  SY  NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D A              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHYSHYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  + GV+TD+I +LTA  ED Y++A +N  + E   F  D VL RY        +  VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P  P+VGTG E+  A DSG A +   + DG V YVD   I+++  +G+  K Y +TKF +SN  TC NQ PIV  G++V KG  +ADG +M NGE+ALGQN LVAF TW GYNYEDAII+S+RL  +D++TSIHI E+  +   TK G EEITR++PNV + + K LD+ GII +GAEVK+GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG GTV  VK F  E   EL+  V   ++VY+VQKRKI  GDKMAGRHGNKG++S I+P EDMP + DGT +DIMLNPLGVPSRMNIGQ+LELH+G+A ++L +     ++     ASD  +W  + E
  S:    10 KHRTRRSFSRIHEVLELPNLIEIQTDSYQWFLDEGLREMFKDISPIDDFAGNLSLEFTDYQLQEPKYTVEEARSHDANYSAPIYVKLRLINKESGEVKEQE------------VFFGDFPLMTEMGTFVINGAERVIVSQLVRSPGVYFHGKLD-------KNGKEGFGSTLIPNRGA-WLEFETDAKDLSYVRI-----DRTRKIPLTVLVRALG---------------------------------------------------FGSDDQILEIFGDNESLRLTME---------KDLHKNASDSRTEEALKDVYERLRPGEPKTADSS----------RSLLTARFFDPKRYDLANVGRYKVNKKLNLATRLFNQTLAETLVDPETGEIIVEAGTFLDRDQMNKLTPYLTAGLNSVTYYPSED---SVVPEPVELQVVKVFSQKDPE-RVVNMIGNKIIADETKNATPADILASMSYFFNLQEGIGNVDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQDMA--------------TVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNKFGFIETPYRRVDRETGVVTDQIDYLTADEEDNYVVAQANAPLNEDGTFTNDIVLARYVEENLEVPISRVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIHPQGPLVGTGMEHVAARDSGAALIC--KNDGIVEYVDANEIRVRQENGALNK-YAVTKFRRSNSGTCYNQRPIVEKGDRVEKGEILADGSSMENGEMALGQNPLVAFMTWEGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEITRELPNVGDDALKDLDEMGIIRIGAEVKDGDLLVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGTVHDVKIFTREAGDELSPGVNMLVRVYIVQKRKINEGDKMAGRHGNKGVVSLIMPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHIGMAARQLGIHIATPVF---DGASDEDVWDTVRE 1002
Score = 522, Expect = 1.9e-50, Identities = 102/180 (56%), Positives = 131/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++  +L    ATPVF+G +  D+ + + EAG+             K  L DGRTGE FD  +SVG+MYM+KL HMVDDK+H+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+ IP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARQLGIHIATPVFDGASDEDVWDTVREAGM---------AADAKTVLYDGRTGEPFDNRISVGVMYMIKLAHMVDDKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEKIPKPGVPESFRVLVKELQSLGLDMKVLNE 1143
>gi|69246466|ref|ZP_00603961.1| DNA-directed RNA polymerase, beta subunit [Enterococcus faecium DO] >gi|68195269|gb|EAN09722.1| DNA-directed RNA polymerase, beta subunit [Enterococcus faecium DO] (1182 aa)
Score = 2054, Expect = 0.0e+00, Identities = 463/1087 (42%), Positives = 655/1087 (60%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           PNL+ +Q +++  F+D  L    + I PI    G  SLE++  +L++PK +  EAR     Y  PL+V L + + E+GE+K               +FF   P++TE+GTFI+NG E+ ++SQ+VRSPG Y   K         K  +EG+   ++P +G  +     + KD   V       + T  IP+T  ++ALG                                                   +G D  + E+F    +L++ +E         K+L++  ++  +E+  KD+   L     K  DS   L N            FF  K +DL+  GR+K+ +K+ L  RL    LAE L D   G+++++K T++    ++T+      G   + +  + D  ++    V   + I V+   D + E   I          T+  +DI++  SY +NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D               ++LT + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHYSHYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  + G +TD+I +LTA  ED YI+A +N  LN E   F +D V+ R +S      +  VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EYK AHDSG A +   + DG V YVD   I+++  +G+ +K Y++TKF +SN  T  NQ PIV +GEKV KG T+ADGP+M  GE+ALGQNVLV F TW GYNYEDAII+S+RL  +D++TSIHI EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  VK F  E   EL+  V   ++VY+VQKRKI  GDKMAGRHGNKG++S+I+P EDMP L DGT IDIMLNPLGVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:     4 PNLIEIQTDSYQWFLDEGLREMFEDILPIDDFNGNLSLEFVDYELKEPKYTVAEARAHDANYSAPLHVTLRLTNRETGEIKAQE------------VFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFHGKVD-------KNGKEGFGSTVIPNRGA-WLEMETDAKDISYVRI-----DRTRKIPLTVLVRALG---------------------------------------------------FGSDDTIFEIFGDSETLRNTVE---------KDLHKNASDSRTEEGLKDVYERLRPGEPKTADSSRNLLNAR----------FFDPKRYDLANVGRYKVNKKLDLKTRLLNLTLAETLVDPETGEIIVEKGTVLTHQVMETLAPFIDNGLNSVTYYPSEDGVVTDPMTV---QVIKVFSPRDPEREVNVIGNGYPEAAVKTVRPADIIASMSYFLNLMEGIGNVDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------TETLTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYSHYGRMCPIETPEGPNIGLINSLSSYAKVNKFGFIETPYRRVDRETGRVTDQIDYLTADIEDHYIVAQANSPLN-EDGTFAQDVVMARAQSENLEVSIDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPWVGTGMEYKSAHDSGAALLC--KHDGVVEYVDASEIRVRRDNGALDK-YDVTKFRRSNSGTSYNQRPIVHLGEKVEKGDTLADGPSMEQGEMALGQNVLVGFMTWEGYNYEDAIIMSRRLVKDDVYTSIHIEEYESEARDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVQDGDLLVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVHDVKIFTREAGDELSPGVNMLVRVYIVQKRKIHEGDKMAGRHGNKGVVSRIMPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARQLGIHVATPVF---DGASDEDVWETVRE 979
Score = 544, Expect = 6.4e-53, Identities = 105/177 (59%), Positives = 133/177 (75%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++  +L    ATPVF+G +  D+ E + EAG+             K  L DGRTGE FDG VSVG+MYM+KL HMVDDK+H+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   950 GMAARQLGIHVATPVFDGASDEDVWETVREAGM---------ASDAKTVLYDGRTGEPFDGRVSVGVMYMIKLAHMVDDKLHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQSLGLDMRV 1117
>gi|15903819|ref|NP_359369.1| DNA-directed RNA polymerase subunit beta [Streptococcus pneumoniae R6] >gi|15459460|gb|AAL00580.1| DNA-dependent RNA polymerase subunit beta [Streptococcus pneumoniae R6] (1216 aa)
Score = 2053, Expect = 0.0e+00, Identities = 449/1109 (40%), Positives = 677/1109 (61%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +    +++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +++I+    +G L  +  +  D  +  +   V  +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDEY +A +N  + E   F E  V+ R++   + +    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:    18 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKAFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELESDSKDITYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTVEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNVKTRLLNQTIAEPLVDPETGEILVEAGTIMTRSVIESIESHL-DGDLNKIVYIPNDAAV--VTEPVVLQKFKVVAPTDP-DRVVTIIGNANPDDKVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFVQTPYRKVDRETGVVTNEIVWLTADEEDEYTVAQANSRLNEDGTFAEKIVMGRHQGVNQEYPANIVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPYVGTGMEYQAAHDSGAAVI--AQYDGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRVNGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARTLGIHIATPVF---DGASSEDLWSTVKE 1015
Score = 533, Expect = 9.9e-52, Identities = 105/180 (58%), Positives = 130/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDD+ GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   986 GMAARTLGIHIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDINGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1156
>gi|22536344|ref|NP_687195.1| DNA-directed RNA polymerase subunit beta [Streptococcus agalactiae 2603V/R] >gi|25010231|ref|NP_734626.1| DNA-directed RNA polymerase subunit beta [Streptococcus agalactiae NEM316] >gi|76788022|ref|YP_328891.1| DNA-directed RNA polymerase subunit beta [Streptococcus agalactiae A909] >gi|76798582|ref|ZP_00780812.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77406339|ref|ZP_00783402.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae H36B] >gi|77407917|ref|ZP_00784668.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae COH1] >gi|41018037|sp|Q8E239|RPOB_STRA5 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|41018040|sp|Q8E7J8|RPOB_STRA3 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|88909642|sp|Q3K3L2|RPOB_STRA1 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|22533169|gb|AAM99067.1|AE014199_3 DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae 2603V/R] >gi|23094583|emb|CAD45801.1| RNA polymerase beta-subunit [Streptococcus agalactiae NEM316] >gi|76563079|gb|ABA45663.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae A909] >gi|76586068|gb|EAO62596.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77173464|gb|EAO76582.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae COH1] >gi|77175044|gb|EAO77850.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae H36B] (1191 aa)
Score = 2052, Expect = 0.0e+00, Identities = 450/1107 (40%), Positives = 672/1107 (60%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G +L++PK + +EAR    +Y  P++V   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     + KD           + T  IP T  ++ALG +  +EI++IF + + ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ L  RL  + +AE+L D   G+++++  T++ +  +D+I +         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDE+ +A +N  + E   F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V + D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E S + LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     7 QYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDAGLKEVFEDVLPISNFTDTMDLEFVGYELKEPKYTLEEARIHDASYSAPIFVTFRLVNKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDAKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGDSELVRNTIEKDIHK-----------------NPSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNLKTRLLNQTIAENLVDGETGEILVEAGTVMTRDVIDSIAEHIDGDLNKFVYTPN---DYAVVTEPVILQKFKVVAPTDP-DRVVTIVGNSNPEDKVRALTPADILAEMSYFLNLAEGIGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRSTGAVTNEIVWLTADEEDEFTVAQANSKLNEDGTFAEEIVMGRHQGNNQEFPSSIVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AKHDGRVIFSDAEKVEVRREDGSLD-VYHVQKFRRSNSGTAYNQRTLVKVGDLVEKGDFIADGPSMENGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEDSLRDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWETVQE 1002
Score = 542, Expect = 1.0e-52, Identities = 112/216 (51%), Positives = 150/216 (69%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE-------YISNITNNAIKNDEDQQIIEEM 1373
           G++   L    ATPVF+G +  DL E + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E       ++ ++    +K + +++  E++
  S:   973 GMAARNLGIHIATPVFDGASSEDLWETVQEAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDEGEDDDVMHVDDLEKARVKQEAEEKQAEQV 1184
>gi|116516435|ref|YP_817182.1| DNA-directed RNA polymerase subunit beta [Streptococcus pneumoniae D39] >gi|148989960|ref|ZP_01821235.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP6-BS73] >gi|148998490|ref|ZP_01825931.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP11-BS70] >gi|168484260|ref|ZP_02709212.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|168487101|ref|ZP_02711609.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|168492064|ref|ZP_02716207.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|168576638|ref|ZP_02722504.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae MLV-016] >gi|122277972|sp|Q04IK6|RPOB_STRP2 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158518627|sp|Q8DNF0|RPOB_STRR6 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|116077011|gb|ABJ54731.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae D39] >gi|147755683|gb|EDK62729.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP11-BS70] >gi|147924620|gb|EDK75706.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP6-BS73] >gi|172042457|gb|EDT50503.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|183569961|gb|EDT90489.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|183573741|gb|EDT94269.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|183577612|gb|EDT98140.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae MLV-016] (1203 aa)
Score = 2051, Expect = 0.0e+00, Identities = 449/1109 (40%), Positives = 677/1109 (61%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +    +++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +++I+    +G L  +  +  D  +  +   V  +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDEY +A +N  + E   F E  V+ R++   + +    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKAFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELESDSKDITYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTVEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNVKTRLLNQTIAEPLVDPETGEILVEAGTIMTRSVIESIESHL-DGDLNKIVYIPNDAAV--VTEPVVLQKFKVVAPTDP-DRVVTIIGNANPDDKVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFVQTPYRKVDRETGVVTNEIVWLTADEEDEYTVAQANSRLNEDGTFAEKIVMGRHQGVNQEYPANIVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPYVGTGMEYQAAHDSGAAVI--AQYDGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRVNGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARTLGIHIATPVF---DGASSEDLWSTVKE 1002
Score = 533, Expect = 1.1e-51, Identities = 105/180 (58%), Positives = 130/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDD+ GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARTLGIHIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDINGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|148985540|ref|ZP_01818729.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP3-BS71] >gi|148993179|ref|ZP_01822745.1| DNA-directed RNA polymerase subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|149012450|ref|ZP_01833481.1| DNA-directed RNA polymerase subunit beta [Streptococcus pneumoniae SP19-BS75] >gi|149021911|ref|ZP_01835898.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP23-BS72] >gi|168489966|ref|ZP_02714165.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae SP195] >gi|168494799|ref|ZP_02718942.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC3059-06] >gi|147763506|gb|EDK70442.1| DNA-directed RNA polymerase subunit beta [Streptococcus pneumoniae SP19-BS75] >gi|147922260|gb|EDK73381.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP3-BS71] >gi|147928153|gb|EDK79171.1| DNA-directed RNA polymerase subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|147929949|gb|EDK80937.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP23-BS72] >gi|183571598|gb|EDT92126.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae SP195] >gi|183575332|gb|EDT95860.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae CDC3059-06] (1203 aa)
Score = 2051, Expect = 0.0e+00, Identities = 449/1109 (40%), Positives = 677/1109 (61%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +    +++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +++I+    +G L  +  +  D  +  +   V  +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDEY +A +N  + E   F E  V+ R++   + +    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKAFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELESDSKDITYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTVEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNVKTRLLNQTIAEPLVDPETGEILVEAGTIMTRSVIESIESHL-DGDLNKIVYIPNDAAV--VTEPVVLQKFKVIAPTDP-DRVVTIIGNANPDDKVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFVQTPYRKVDRETGVVTNEIVWLTADEEDEYTVAQANSRLNEDGTFAEKIVMGRHQGVNQEYPANIVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPYVGTGMEYQAAHDSGAAVI--AQYDGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRVNGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARTLGIHIATPVF---DGASSEDLWSTVKE 1002
Score = 533, Expect = 1.1e-51, Identities = 105/180 (58%), Positives = 130/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDD+ GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARTLGIHIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDINGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|149003618|ref|ZP_01828483.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP14-BS69] >gi|147758350|gb|EDK65350.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP14-BS69] (1203 aa)
Score = 2050, Expect = 0.0e+00, Identities = 449/1109 (40%), Positives = 677/1109 (61%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +    +++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +++I+    +G L  +  +  D  +  +   V  +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDEY +A +N  + E   F E  V+ R++   + +    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKAFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELESDSKDITYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTVEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNVKTRLLNQTIAEPLVDPETGEILVEAGTIMTRSVIESIESHL-DGDLNKIVYIPNDAAV--VTEPVVLQKFKVVAPTDP-DRVVTIIGNANPDDKVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFVQTPYRKVDRETGVVTNEIVWLTADEEDEYTVAQANSRLNEDGTFAEKIVMGRHQGVNQEYPANIVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPYVGTGMEYQAAHDSGAAVI--AQYDGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRVNGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARTLGIYIATPVF---DGASSEDLWSTVKE 1002
Score = 532, Expect = 1.5e-51, Identities = 105/180 (58%), Positives = 130/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDD+ GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARTLGIYIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDINGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|119714958|ref|YP_921923.1| DNA-directed RNA polymerase subunit beta [Nocardioides sp. JS614] >gi|158513097|sp|A1SEK1|RPOB_NOCSJ DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|119535619|gb|ABL80236.1| DNA-directed RNA polymerase, beta subunit [Nocardioides sp. JS614] (1166 aa)
Score = 2050, Expect = 0.0e+00, Identities = 451/919 (49%), Positives = 602/919 (65%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL------------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSG-------MAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKK---LTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           T+E    +++N   + +   +A V +Y KIN              +G   + D+ TL+I D+++   Y++ L              DI   DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NP+A LT+KRR+SA+GPGG+SR+   +++RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR V  G +TD+I +LTA  ED Y+IA +N  ++ K++F E++VL R R   E  +V   +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PLI   +P+VGTG EY+ A D+G          V +   D   +  D GT           Y L KF +SNQ TC NQ P+VS G+++  GT IADGP     E+ALG N+LVAF  W G+NYEDAIILS+RL  EDI TSIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV  GDVLVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  GTV  V+ F  ED  EL   V + ++VYV QKRKI +GDK+AGRHGNKG+I+KI+P+EDMP +EDGT +D++LNPLGVP RMNIGQILELHLG   K+   L L+       D K  +D+               + L KI  +K                     +  G        K ATPVF+G  R D    +  + I   +G      +GK +L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA+EAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+SG+PESFK+L K++Q L L V +  + G A
  S:   278 TREAAQTLLNNYYFNPKRYDLAKVGRY-KIN------------KKLGLLEAFDQQTLTIDDVVAAIKYIVALHDGREQIEAPQGTLDIS-ADDIDHFGNRRMRTVGELIQNQLRTGLARMERVVRERMTTQD--------------VEAITPQSLINIRPVVAALKEFFGTSQLSQFMDQTNPIAGLTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRINPFGFVETPYRKVTKGKVTDQIDYLTADDEDRYVIAQANAALDDKSRFVEERVLVRQRDG-EVSEVLADEVDYMDVSPRQMVSVATALIPFLEHDDANRALMGANMQRQAVPLIKSDSPLVGTGIEYRAAVDAGDVVVATAAGVVKEVSADVIETMNDDGTYS--------TYRLAKFKRSNQGTCINQRPLVSEGDRLEIGTPIADGPCTDEAEMALGTNLLVAFMPWQGHNYEDAIILSQRLVQEDILTSIHIEEHEVDARDTKLGPEEITRDIPNVSEEMLADLDERGIIRIGAEVTTGDVLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGESGTVIGVRVFDREDGDELPPGVNQLVRVYVAQKRKISVGDKLAGRHGNKGVIAKILPIEDMPFMEDGTPVDVVLNPLGVPRRMNIGQILELHLGWLAKQGWDLNLN-------DDKSGADWK--------------QRLIKIHADK---------------------AEPGT-------KVATPVFDGA-REDEITGLLGSTIPNRDGVRMIDNTGKASLFDGRSGEPFPEPVAVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMEAYGAAYALQELLTIKSDDVPGRVKVYEAIVKGENIPDSGIPESFKVLVKEMQSLCLNVEVLSQDGTA 1134
Score = 238, Expect = 1.6e-17, Identities = 77/281 (27%), Positives = 135/281 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE---------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  ++KI +    P LL+LQ ++F   +  +                     L+   + I PI+      SL +       PK +  E + +  TY  PLYV     +N++GE+K  T            +F    P++T+KGTFI+NG E+ V+SQ+VRSPG Y   ++  K S+     ++ Y  +++P++G  +  F  + +D + V       +      +T  LKALG   E+I   F  ++S+  +L+ +    +D    D L+++ + L   +        T L   +   K+Y   K
  S:    24 RISFAKITEPLEVPQLLSLQTDSFDWLVGNDKWNAAVERRRSEGEDVSSKSGLQEIFEEISPIEDFSETMSLSFENPVFYDPKYTVDECKEKDFTYSAPLYVSAEFTNNDTGEIKGQT------------VFMGDFPLMTDKGTFIINGTERVVVSQLVRSPGVY-FERTADKTSD-----KDIYTAKLIPSRGA-WLEFEIDKRDMVGVRL-----DRKRKQNVTVLLKALGWTNEQIREEFGEYESMMLTLEKDHTQGQD----DALLDIYRKLRPGEPPTREAAQTLLNNYYFNPKRYDLAK 300
>gi|77413372|ref|ZP_00789565.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae 515] >gi|77160542|gb|EAO71660.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae 515] (1191 aa)
Score = 2050, Expect = 0.0e+00, Identities = 450/1107 (40%), Positives = 672/1107 (60%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G +L++PK + +EAR    +Y  P++V   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     + KD           + T  IP T  ++ALG +  +EI++IF + + ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ L  RL  + +AE+L D   G+++++  T++ +  +D+I +         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDE+ +A +N  + E   F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V + D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E S + LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     7 QYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDAGLKEVFEDVLPISNFTDTMVLEFVGYELKEPKYTLEEARIHDASYSAPIFVTFRLVNKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDAKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGDSELVRNTIEKDIHK-----------------NPSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNLKTRLLNQTIAENLVDGETGEILVEAGTVMTRDVIDSIAEHIDGDLNKFVYTPN---DYAVVTEPVILQKFKVVAPTDP-DRVVTIVGNSNPEDKVRALTPADILAEMSYFLNLAEGIGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRSTGAVTNEIVWLTADEEDEFTVAQANSKLNEDGTFAEEIVMGRHQGNNQEFPSSIVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AKHDGRVIFSDAEKVEVRREDGSLD-VYHVQKFRRSNSGTAYNQRTLVKVGDLVEKGDFIADGPSMENGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEDSLRDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWETVQE 1002
Score = 542, Expect = 1.0e-52, Identities = 112/216 (51%), Positives = 150/216 (69%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE-------YISNITNNAIKNDEDQQIIEEM 1373
           G++   L    ATPVF+G +  DL E + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E       ++ ++    +K + +++  E++
  S:   973 GMAARNLGIHIATPVFDGASSEDLWETVQEAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDEGEDDDVMHVDDLEKARVKQETEEKQAEQV 1184
>gi|27262300|gb|AAN87431.1| DNA-directed RNA polymerase beta chain [Heliobacillus mobilis] (1150 aa)
Score = 2049, Expect = 0.0e+00, Identities = 437/859 (50%), Positives = 576/859 (67%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS--GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATP--VFEGVNRTDLKE----AMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           L+  DI++    ++ L    G  DDIDHLGN+RL+ + ELL+ + + GL R+E+ + +++ I D               + +T + +IN +P   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG+SRE    ++RDVH+SHYG++CPIETPEG NIGLI SL+T+A  +E GF+ TPYR V  + G +T++I +LTA  ED++I+A +N  + E+ +F + KV  R+        ++ VD++D+SPKQVVSIA + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG EYK A DSG+ A+   +K G +  V G  I I+S  G+ E+ ++L KF +SNQ TC NQ PI   G++V  G  IADGP+   GELALG+NVLVAF TW GYNYEDAI+++++L  ED FTSIHI EY  D   TK G EEITRDIPNV E   K LDD GII VGAEV+ GD+LVGK++PKG+ ELT+EE+LL+AIFG+K++  ++TSL+VPHG  G +  VK F  E+  EL   V + ++ Y+ QKRKI  GDKMAGRHGNKG+IS+I+   +MP+L DGT ++I+LNPLGVPSRMNIGQ+LE HLG A K +       L  D +P+ +                                                  GI     ++  AT   ++E + +  L E    AM++A  + +         GK  L DGRTGE FD  ++VG MY+LKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT+KSDDV GR  TY AI+KG+ IPE G+PESFK+L K+LQ LGL V I  E
  S:   284 LTKDDIIATVREMLKLMQGEGHADDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQD--------------VEVITPQVLINIRPVVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTFARINEFGFIETPYRKVDKERGAVTEQIDYLTADEEDKFIVAQANAPLDEEGRFIQKKVNARHGHDILVVPMEMVDYMDVSPKQVVSIATALIPFLEHDDANRALMGANMQRQAVPLLRTDAPYVGTGMEYKAAKDSGVVAI--AKKPGVIERVSGDEIIIRSDDGTLEQ-HKLLKFLRSNQGTCINQKPICHKGQRVEAGDIIADGPSTDQGELALGRNVLVAFMTWEGYNYEDAILVNEKLVREDYFTSIHIEEYECDSRDTKLGPEEITRDIPNVGEEVLKDLDDRGIIRVGAEVRPGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGEAGKIVDVKVFSRENGDELAPGVNQLVRCYIAQKRKISQGDKMAGRHGNKGVISRIMAEAEMPYLPDGTPVEIVLNPLGVPSRMNIGQVLECHLGWASKNIDRG----LLADGEPSGE-------------------------------------------------RGIRVATPVFDGATEEDIYEFLTQARLPELAETAMSDARTEHMREIFPSIPLGKTILFDGRTGEPFDNPITVGYMYVLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENIPEPGVPESFKVLIKELQSLGLDVKILSE 1083
Score = 235, Expect = 3.5e-17, Identities = 76/256 (29%), Positives = 128/256 (50%)
  Q:    24 EKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE--LINLRKNLN-----SSDSNRS 279
           +K +    L+ +  N+   F+D  L    + I PI+   G   LE+I   L +PK S +E +    T+  PL V + +++ E+GEVK+              +F    P++TEKGTFI+NG E+ ++SQ+VRSPG Y    ++     S K++   Y   ++P +G  +  F ++  D + V       + T  +P T  ++ALG  N  ++  +F   + I+ +L      E+D  E  E  L+ + K L      + DS RS
  S:    14 QKFWELAQLVKIPTNSELWFLDEGLREMFRDISPIQDFTGNLILEFIDYSLGEPKYSVEECKERDVTFAAPLRVKVRLINKETGEVKEQE------------VFMGDFPLMTEKGTFIINGAERVIVSQLVRSPGVYF---NETTDPTSGKKV---YGATMIPNRGA-WLEFESDANDNVYVRI-----DRTRKLPATVLIRALGYSNNVQVHELFDGDERIRITL------ERDNTENTEEALVEIYKRLRPGEPPTVDSARS 247
>gi|34595753|gb|AAQ76599.1| RpoB [Mycobacterium chelonae] (1171 aa)
Score = 2048, Expect = 0.0e+00, Identities = 442/942 (46%), Positives = 605/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSL-DKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + G + +L    TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V  GV+TDEI +LTA  ED +++A +N  V+ + +F EDK+L R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V  D  T+    G+ +  Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG   K                        G + E +    +NL +                    DL  A + +         +TATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +  + G A    + + +D+    +N+  N  +N+
  S:   282 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGANPALVTATTLTEEDVVATIEYLVRLHEGQTTMTAPGGLEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVSEGVVTDEIHYLTADEEDRHVVAQANSPVDADGRFTEDKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKAGVIEEVSADYVTVMADDGTRQS-YRLRKFARSNHGTCANQKPIVDEGQRVEVGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKT-----------------------GWNIEGNPEWAQNLPE--------------------DLQSAPADT---------RTATPVFDGAREEELT-GLLSSTLPNRDGEVMVDGDGKARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLERAAANLGINLSRNE 1163
Score = 233, Expect = 6.2e-17, Identities = 74/276 (26%), Positives = 129/276 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   + +                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+ GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    32 RLSFAKLREPLAVPGLLDVQTESFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDMGTFIINGTERVVVSQLVRSPGVYFDENIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 296
>gi|34391545|gb|AAN65350.1| RpoB [Mycobacterium chelonae] (1171 aa)
Score = 2048, Expect = 0.0e+00, Identities = 442/942 (46%), Positives = 605/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSL-DKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + G + +L    TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V  GV+TDEI +LTA  ED +++A +N  V+ + +F EDK+L R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V  D  T+    G+ +  Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG   K                        G + E +    +NL +                    DL  A + +         +TATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +  + G A    + + +D+    +N+  N  +N+
  S:   282 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGANPALVTATTLTEEDVVATIEYLVRLHEGQTTMTAPGGLEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVSEGVVTDEIHYLTADEEDRHVVAQANSPVDADGRFTEDKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKAGVIEEVSADYVTVMADDGTRQS-YRLRKFARSNHGTCANQKPIVDEGQRVEVGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKT-----------------------GWNIEGNPEWAQNLPE--------------------DLQSAPADT---------RTATPVFDGAREEELT-GLLSSTLPNRDGEVMVDGDGKARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLERAAANLGINLSRNE 1163
Score = 239, Expect = 1.5e-17, Identities = 75/276 (27%), Positives = 130/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + +                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TE GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    32 RLSFAKLREPLAVPGLLDVQTDSFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEMGTFIINGTERVVVSQLVRSPGVYFDENIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 296
>gi|77410922|ref|ZP_00787278.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae CJB111] >gi|77162977|gb|EAO73932.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae CJB111] (1191 aa)
Score = 2048, Expect = 0.0e+00, Identities = 450/1107 (40%), Positives = 671/1107 (60%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKD-INGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G +L++PK + +EAR    +Y  P++V   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     + KD           + T  IP T  ++ALG +  +EI++IF + + ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ L  RL  + +AE+L D   G+++ +  T++ +  +D+I +         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDE+ +A +N  + E   F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V + D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E S + LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     7 QYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDAGLKEVFEDVLPISNFTDTMDLEFVGYELKEPKYTLEEARIHDASYSAPIFVTFRLVNKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDAKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGDSELVRNTIEKDIHK-----------------NPSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNLKTRLLNQTIAENLVDGETGEILAEAGTVMTRDVIDSIAEHIDGDLNKFVYTPN---DYAVVTEPVILQKFKVVAPTDP-DRVVTIVGNSNPEDKVRALTPADILAEMSYFLNLAEGIGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRSTGAVTNEIVWLTADEEDEFTVAQANSKLNEDGTFAEEIVMGRHQGNNQEFPSSIVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AKHDGRVIFSDAEKVEVRREDGSLD-VYHVQKFRRSNSGTAYNQRTLVKVGDLVEKGDFIADGPSMENGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEDSLRDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWETVQE 1002
Score = 542, Expect = 1.0e-52, Identities = 112/216 (51%), Positives = 150/216 (69%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE-------YISNITNNAIKNDEDQQIIEEM 1373
           G++   L    ATPVF+G +  DL E + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E       ++ ++    +K + +++  E++
  S:   973 GMAARNLGIHIATPVFDGASSEDLWETVQEAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDEGEDDDVMHVDDLEKARVKQEAEEKQAEQV 1184
>gi|62720646|gb|AAX93859.1| RNA polymerase subunit B [Mycobacterium bolletii] (1171 aa)
Score = 2047, Expect = 0.0e+00, Identities = 442/942 (46%), Positives = 607/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTS-LDKPTLSISDILSITSYVINLD---------------YDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + GT+ + +   TL+  D+++   Y++ L                 D+   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TDEI +LTA  ED +++A +N  V+ N +F E+K+L R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V  D  T+    G+ +  Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG   K                        G + E      +NL +                  D   + A +R+           ATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +  + G A    + + +D+    +N+  N  +N+
  S:   282 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGTNPAQVTTTTLTEEDVVATIEYLVRLHEGQTTMTAPGGVEVPVDV---DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVSDGVVTDEIHYLTADEEDRHVVAQANSPVDANGRFTEEKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKAGVIEEVSADYVTVMADDGTRQS-YRLRKFARSNHGTCANQKPIVDEGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWIAKT-----------------------GWNIEGDPEWAQNLPE------------------DLQSAPADTRT-----------ATPVFDGAREEELT-GLLSSTLPNRDGEVMVDGDGKARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLERAAANLGINLSRNE 1163
Score = 233, Expect = 6.4e-17, Identities = 74/276 (26%), Positives = 129/276 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   + +                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+ GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    32 RLSFAKLREPLAVPGLLDVQTESFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDMGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 296
>gi|81096693|ref|ZP_00875028.1| DNA-directed RNA polymerase, beta subunit [Streptococcus suis 89/1591] >gi|146317779|ref|YP_001197491.1| DNA-directed RNA polymerase subunit beta [Streptococcus suis 05ZYH33] >gi|146319971|ref|YP_001199682.1| DNA-directed RNA polymerase subunit beta [Streptococcus suis 98HAH33] >gi|158514126|sp|A4VSK2|RPOB_STRSY DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158514143|sp|A4VYU3|RPOB_STRS2 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|80977255|gb|EAP40803.1| DNA-directed RNA polymerase, beta subunit [Streptococcus suis 89/1591] >gi|145688585|gb|ABP89091.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Streptococcus suis 05ZYH33] >gi|145690777|gb|ABP91282.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Streptococcus suis 98HAH33] (1190 aa)
Score = 2047, Expect = 0.0e+00, Identities = 443/1107 (40%), Positives = 669/1107 (60%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAED-LKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + P+ +      LE++G +L++PK + +EAR     Y  P+YV   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N +DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ L  RL  + LAE  +    G++V++  T++ +  L+ ++    E  L +V  +  D  +  +   V  +K  +    D +     I   + + +  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR +    G +T+EI WLTA  ED YI+A S   + E N+F +  V+ R++ + + F     DF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V Y D   ++++   GS + VY ++KF +SN  T  NQ  +V +G+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + + LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     7 QYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDYGLKEVFEDVLPVSNFTDTMELEFVGYELKEPKYTLEEARAHDANYSAPIYVTFRLVNKETGEIK------------TQEVFFGEFPIMTEMGTFIINGAERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTIEKDIHK-----------------NPADSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLTARFFDPRRYDLAPVGRYKINKKLNLRTRLLNQTLAEHVINGETGEIVLEAGTVLSRDVLEKVEAQFDE--LNLVEYIPNDNAV--LLEPVLLQKFKIVAPKDPERVVTVIGNANPAENVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRIGLTRMERNLRERMSVQD--------------NEVLTPQQIINIRPVTAAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKIDRATGTVTNEIVWLTADEEDAYIVAQSTSPLDENNRFVDKIVMGRHQGNNQEFPADSADFMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAII--AQHDGKVVYADADKVEVRREDGSLD-VYHISKFRRSNSGTAYNQRTLVKLGDIVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWSTVKE 1001
Score = 536, Expect = 5.0e-52, Identities = 109/194 (56%), Positives = 136/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   972 GMAARNLGIHIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DNNEVELRDLDE 1154
>gi|194396940|ref|YP_002038544.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae G54] >gi|194356607|gb|ACF55055.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae G54] (1203 aa)
Score = 2047, Expect = 0.0e+00, Identities = 448/1109 (40%), Positives = 677/1109 (61%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +    +++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +++I+    +G L  +  +  D  +  +   V  +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDEY +A +N  + E   F E  V+ R++   + +    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EY+ AHDSG A +   + +G V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKAFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELESDSKDITYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTVEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNVKTRLLNQTIAEPLVDPETGEILVEAGTIMTRSVIESIESHL-DGDLNKIVYIPNDAAV--VTEPVVLQKFKVVAPTDP-DRVVTIIGNANPDDKVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFVQTPYRKVDRETGVVTNEIVWLTADEEDEYTVAQANSRLNEDGTFAEKIVMGRHQGVNQEYPANIVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPYVGTGMEYQAAHDSGAAVI--AQYNGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRVNGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARTLGIHIATPVF---DGASSEDLWSTVKE 1002
Score = 533, Expect = 1.1e-51, Identities = 105/180 (58%), Positives = 130/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDD+ GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARTLGIHIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDINGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|162286182|gb|AAT86005.2| RpoB [Mycobacterium massiliense] (1171 aa)
Score = 2045, Expect = 0.0e+00, Identities = 441/942 (46%), Positives = 607/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTS-LDKPTLSISDILSITSYVINLD---------------YDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + GT+ + +   TL+  D+++   Y++ L                 D+   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TDEI +LTA  ED +++A +N  V+ N +F E+K+L R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V  D  T+    G+ +  Y L KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG   K                        G + E      +NL +                  D   + A +R+           ATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +  + G A    + + +D+    +N+  N  +N+
  S:   282 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGTNPAQVTTTTLTEEDVVATIEYLVRLHEGQTTMTAPGGVEVPVDV---DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVSDGVVTDEIHYLTADEEDRHVVAQANSPVDANGRFTEEKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKAGVIEEVSADYVTVMADDGTRQS-YRLRKFARSNHGTCANQKPIVDEGQRVEAGQVVADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWIAKT-----------------------GWNIEGDPEWAQNLPE------------------DLQSAPADTRT-----------ATPVFDGAREEELT-GLLSSTLPNRDGEVMVDGDGKARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLERAAANLGINLSRNE 1163
Score = 233, Expect = 6.4e-17, Identities = 74/276 (26%), Positives = 129/276 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   + +                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+ GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    32 RLSFAKLREPLAVPGLLDVQTESFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDMGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 296
>gi|15901784|ref|NP_346388.1| DNA-directed RNA polymerase subunit beta [Streptococcus pneumoniae TIGR4] >gi|111658849|ref|ZP_01409470.1| hypothetical protein SpneT_02000020 [Streptococcus pneumoniae TIGR4] >gi|149007435|ref|ZP_01831078.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP18-BS74] >gi|41018113|sp|Q97NQ7|RPOB_STRPN DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|14973467|gb|AAK76028.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae TIGR4] >gi|147761007|gb|EDK67976.1| DNA-directed RNA polymerase beta subunit [Streptococcus pneumoniae SP18-BS74] (1203 aa)
Score = 2044, Expect = 0.0e+00, Identities = 448/1109 (40%), Positives = 676/1109 (60%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++++PK + +EAR    +Y  P++V   +++ E+ E+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +    +++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +++I+    +G L  +  +  D  +  +   V  +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDEY +A +N  + E   F E  V+ R++   + +    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKAFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIKEPKYTLEEARIHDASYSAPIFVTFRLINKETSEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELESDSKDITYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTVEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNVKTRLLNQTIAEPLVDPETGEILVEAGTIMTRSVIESIESHL-DGDLNKIVYIPNDAAV--VTEPVVLQKFKVIAPTDP-DRVVTIIGNANPDDKVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFVQTPYRKVDRETGVVTNEIVWLTADEEDEYTVAQANSRLNEDGTFAEKIVMGRHQGVNQEYPANIVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPYVGTGMEYQAAHDSGAAVI--AQYDGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRVNGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARTLGIHIATPVF---DGASSEDLWSTVKE 1002
Score = 533, Expect = 1.2e-51, Identities = 105/180 (58%), Positives = 130/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDD+ GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARTLGIHIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDINGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|34595751|gb|AAQ76598.1| RpoB [Mycobacterium immunogenum] (1171 aa)
Score = 2043, Expect = 0.0e+00, Identities = 441/942 (46%), Positives = 607/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTS-LDKPTLSISDILSITSYVINLD---------------YDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + GT+ + +   TL+  D+++   Y++ L                 D+   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TDEI +LTA  ED +++A +N  V+ N +F E+K+L R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V  D  T+    G+ +  Y L KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG   K                        G + E      +NL +                  D   + A +R+           ATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +  + G A    + + +D+    +N+  N  +N+
  S:   282 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGTNPAQVTTTTLTEEDVVATIEYLVRLHEGQTTMTAPGGVEVPVDV---DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVSDGVVTDEIHYLTADEEDRHVVAQANSPVDANGRFTEEKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKAGVIEEVSADYVTVMADDGTRQS-YRLRKFARSNHGTCANQKPIVDEGQRVEVGQVLADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWIAKT-----------------------GWNIEGDPEWAQNLPE------------------DLQSAPADTRT-----------ATPVFDGAREEELT-GLLSSTLPNRDGEVMVDGDGKARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLERAAANLGINLSRNE 1163
Score = 235, Expect = 4.2e-17, Identities = 74/276 (26%), Positives = 130/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + +                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+ GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    32 RLSFAKLREPLAVPGLLDVQTDSFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDMGTFIINGTERVVVSQLVRSPGVYFDENIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 296
>gi|169833177|ref|YP_001695315.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|168995679|gb|ACA36291.1| DNA-directed RNA polymerase, beta subunit [Streptococcus pneumoniae Hungary19A-6] (1203 aa)
Score = 2042, Expect = 0.0e+00, Identities = 448/1109 (40%), Positives = 676/1109 (60%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D  L+   + + PI +      LE++G ++++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +    +++KD           + T  IP T  ++ALG +  +EI +IF + + ++N+++ +I+                  N  DS      D  L+E++++          E K AE  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +++I+    +G L  +  +  D  +  +   V  +K  V    D  D  + IIG     DK  T++ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + +  L R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDEY +A +N  + E   F E  V+ R++   + +    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI+P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY + KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFKAFLDHGLKEVFEDVLPISNFTDTMELEFVGYEIKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELESDSKDITYTRI-----DRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTVEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSR-------------------------------------------SLLVARFFDPRRYDLAAVGRYKINKKLNVKTRLLNQTIAEPLVDPETGEILVEAGTIMTRSVIESIESHL-DGDLNKIVYIPNDAAV--VTEPVVLQKFKVVAPTDP-DRVVTIIGNANPDDKVRTVTPADILAEMSYFLNLAEGLGRVDDIDHLGNRRIRAVGELLANQVRLELSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFVQTPYRKVDRETGVVTNEIVWLTADEEDEYTVAQANSRLNEDGTFAEKIVMGRHQGVNQEYPANIVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLINPQAPYVGTGMEYQAAHDSGAAVI--AQYDGKVTYADADKVEVRREDGSLD-VYHIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRVNGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARTLGIHIATPVF---DGASSEDLWSTVKE 1002
Score = 533, Expect = 1.2e-51, Identities = 105/180 (58%), Positives = 130/180 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           G++   L    ATPVF+G +  DL   + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDD+ GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E
  S:   973 GMAARTLGIHIATPVFDGASSEDLWSTVKEAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSTVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDINGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE 1143
>gi|186685076|ref|YP_001868272.1| DNA-directed RNA polymerase, beta subunit RpoB [Nostoc punctiforme PCC 73102] >gi|186467528|gb|ACC83329.1| DNA-directed RNA polymerase, beta subunit RpoB [Nostoc punctiforme PCC 73102] (1099 aa)
Score = 2042, Expect = 0.0e+00, Identities = 417/868 (48%), Positives = 576/868 (66%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEI--RWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI--KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNF 1346
           L+  DIL+   Y+INL+YDIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ ++D               + LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SHYG+ICPIETPEG N GLI SLAT+A  +  GFL TP+R V+NG +  ++   ++TA  ED+  +A  ++ V E        V  RYR  +     + VD++ +SP Q+VS+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V     DG V+YVD   I++  K  + E  Y L+K+ +SNQ+TC NQ P+V +GE+V  G  +ADG +   GELALGQN++VA+  W GYNYEDAI++S+RL  +D++TSIHI +Y ++  +TK G EEITR+IPNV E + + LD++GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P EDMP+L DG+ +DI+LNPLGVPSRMN+GQ+ E  LG A + L +         +   + F   +G  EE+SR       +I++ K  ++ D+  K++                   +Y    P                               GK  + DGRTGE FD  +++G+ YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEA+GAA+ L+ELLT+KSDD++GRN   NAI+KGK IP  G PESFK+L ++LQ LGL +++ K   +A+ ++ 
  S:   278 LTAGDILAAVDYLINLEYDIGNIDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSDA--------------EVLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIGSLATHARVNLYGFLETPFRPVENGRVRFDLPPAYMTADEEDDLRVAPGDIPVDETGHIIGPLVPVRYRQEFSTTTPEQVDYVAVSPVQIVSVATSMIPFLEHDDANRALMGSNMQRQAVPLLKPERPLVGTGLEAQGARDSGMVIV--SRTDGDVTYVDATEIRVRPKPNTPEIKYTLSKYQRSNQDTCLNQKPLVRIGERVVAGQVLADGSSTEGGELALGQNIVVAYMPWEGYNYEDAILISERLVQDDVYTSIHIEKYEIEARQTKLGPEEITREIPNVGEDALRQLDEQGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRLFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPAEDMPYLPDGSPVDIVLNPLGVPSRMNVGQVFECLLGWAGQTLGV---------RFKITPFDEMYG--EESSR-------RIVHGKLQEARDETGKDW-------------------VYNPDNP-------------------------------GKIMVYDGRTGEPFDRAITIGVAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAFGAAYTLQELLTVKSDDMQGRNEALNAIVKGKAIPRPGTPESFKVLMRELQSLGLDIAVHKVETQADGSSL 1066
Score = 274, Expect = 1.2e-21, Identities = 89/327 (27%), Positives = 155/327 (47%)
  Q:    23 IEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYS-------SLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNK 349
           +E  F  P+L+ +Q+++F  F++  L   + S  PI    G+  L ++G   KL++PK S +EA+    TY   +YV   +++ E+GE+K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   KS+I  +  R      Y   ++P +G  +  F  +  D + V       + T  +     LKALGL+  EI +   + +  + +++     E    E + L+ L + L   +     G    L   F   K+Y         L  +L     +  +     +++       AA D +INL     NID    L N+
  S:     7 MEPAFLLPDLIEIQRSSFRWFLEEGLIEELNSFSPITDYTGKLELHFLGHNYKLKEPKYSVEEAKRRDSTYAVQMYVPTRLINKETGEIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYY--KSEIDKNGRRT-----YSASLIPNRGA-WLKFETDRNDLVWVRI-----DKTRKLSAQVLLKALGLSDNEIFDALRHPEYFQKTIE----KEGQFSEEEALMELYRKLRPGEPPTVLGGQQLLDSRFFDPKRYDLGRVGRYKLNKKLRLSVPDTMRVLTAGDIL-------AAVDYLINLEYDIGNIDDIDHLGNR 309
>gi|62720652|gb|AAX93862.1| RNA polymerase subunit B [Mycobacterium conceptionense] (1170 aa)
Score = 2042, Expect = 0.0e+00, Identities = 441/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G  E AS+     L + L    + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   280 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHASHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANSPIDADGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--SEKAGVVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKAGWNIDVAAGTPEWASK-----LPEQLYSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVDSDGKATLFDGRSGEPFPYPVTVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1162
Score = 253, Expect = 3.2e-19, Identities = 77/276 (27%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    30 RVSFAKLREPLEVPGLLDVQTDSFDWLVGSDEWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 294
>gi|34391563|gb|AAN65359.1| RpoB [Mycobacterium fortuitum] (1208 aa)
Score = 2042, Expect = 0.0e+00, Identities = 440/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++D+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G  E ASR     L + L    + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   318 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDQIDYLTADEEDRHVVAQANSPIDADGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVIV--SEKAGVVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKAGWNIDVAAGTPEWASR-----LPEQLYSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1200
Score = 252, Expect = 3.8e-19, Identities = 77/276 (27%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   +  +                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    68 RVSFAKLREPLEVPGLLDVQTDSFDWLVGADGWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 332
>gi|15674321|ref|NP_268495.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes M1 GAS] >gi|71909897|ref|YP_281447.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS5005] >gi|41018125|sp|Q9A1U1|RPOB_STRP1 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|13621404|gb|AAK33216.1| putative DNA-dependent RNA polymerase subunit beta [Streptococcus pyogenes M1 GAS] >gi|71852679|gb|AAZ50702.1| DNA-directed RNA polymerase beta chain [Streptococcus pyogenes MGAS5005] (1188 aa)
Score = 2038, Expect = 0.0e+00, Identities = 448/1104 (40%), Positives = 672/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +S+I++  + PNL+ +Q ++F  F+D+ L+   + + PI +      LE++G + ++PK + +EAR    +Y  P++V   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF     ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  +++AE+L D   G+++++  T + +  +++I++         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D                 LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDEY +A +N  + E   F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   +++G V + D   ++I+   GS + VY +TKF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:    10 KHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGLKEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIEKDIHK-----------------NPSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLIARFFDARRYDLAAVGRYKVNKKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPN---DYAVVTEPVVLQKFKVVSPIDP-DRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGLGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NDVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGTVTNEIVWLTADEEDEYTVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQQNGKVVFSDAEKVEIRRQDGSLD-VYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWDTVRE 1002
Score = 535, Expect = 6.7e-52, Identities = 109/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   973 GMAARNLGIHIATPVFDGASSEDLWDTVREAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1155
>gi|34595757|gb|AAQ76601.1| RpoB [Mycobacterium farcinogenes] (1170 aa)
Score = 2038, Expect = 0.0e+00, Identities = 440/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G  E AS+     L + L    + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   280 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANTPIDTDGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVIV--SEKAGVVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKAGWNIDVAAGTPEWASK-----LPEQLYSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1162
Score = 250, Expect = 6.5e-19, Identities = 77/276 (27%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    30 RVSFAKLREPLEVPGLLDVQTDSFDWLVGSDEWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMVTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 294
>gi|34595747|gb|AAQ76596.1| RpoB [Mycobacterium porcinum] (1169 aa)
Score = 2037, Expect = 0.0e+00, Identities = 440/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++D+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G  E AS+     L + L    + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   279 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHASHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVIDGVVSDQIDYLTADEEDRHVVAQANSPIDNDGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--SEKAGVVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKAGWNIDVAAGTPEWASK-----LPEQLYSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVDSDGKATLFDGRSGEPFPYPVTVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1161
Score = 253, Expect = 3.4e-19, Identities = 77/276 (27%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    29 RVSFAKLREPLEVPGLLDVQTDSFDWLVGSDEWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 293
>gi|34391551|gb|AAN65353.1| RpoB [Mycobacterium peregrinum] (1169 aa)
Score = 2036, Expect = 0.0e+00, Identities = 441/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++D+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP + DGT +DI+LN  GVP RMNIGQILE HLG   K      V E               G  E ASR     L   L+   + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D++   +N+  N  +N+
  S:   279 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTSMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDQIDYLTADEEDRHVVAQANSPIDTDGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVIV--SEKAGVVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFMPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIDVAE---------------GTPEWASR-----LPDGLHSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLDRAAANLGINLSRNE 1161
Score = 251, Expect = 5.0e-19, Identities = 77/276 (27%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   +  +                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    29 RVSFAKLREPLEVPGLLDVQTDSFDWLVGADGWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTSEQITERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 293
>gi|191639439|ref|YP_001988605.1| DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) [Lactobacillus casei] >gi|190713741|emb|CAQ67747.1| DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) [Lactobacillus casei BL23] (1199 aa)
Score = 2036, Expect = 0.0e+00, Identities = 454/1104 (41%), Positives = 672/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSI--SDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR Y++I++  + PNL+ +Q N++  F+D  L+     I PI    G+ SLE++G +L +PK + +EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y  +++     NSR      Y   ++P +G  +  +  + KD   V       + T  IP+T  ++ALG  + ++I+N+F ++ S+  +L      EKDV +           N+ DS      D  L++++++          E K A+  +                                           S++Y  FF  K +DL+  GR+K+ +K+ L  RL  +VLAE L D + G+V+ +K T + +  +D +           +     D+ +  + + ++ + I VY    + D+ I +IG +  + K    I  +D+L+  +Y +NL   +G  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D A              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V      +TD+I +LTA  ED YI+A +N  LN +   F ++ VL R++ +        VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PL++P AP+VGTG EYK AHDSG A + +    GTV YVD   I+++        Y L KF +SN     NQ PIV++G+ V     IADGPAM NGELALGQN ++AF TW+ YNYEDAI+LS+RL  +D++TSIHI EY  +   TK G EE+TR+IPNV E + K LD+ G++ VGAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G +  VK F  E   EL+  V   ++VY+ QKRKIQ+GDKMAGRHGNKG +S +VP EDMP+L DGT +DI L+P+GVPSRMNIGQ+LELHLG+A + L +     ++     A+D  LW  + E
  S:    10 KHRTRRSYARIKEVLDLPNLIKIQTNSYQWFLDEGLKEMFDDIMPIDDFQGKLSLEFVGYQLLEPKYTVEEARQHDANYSAPLHVTLRLTNHETGEIK------------SQDVFFGDFPLMTKQGTFIINGAERVIVSQLVRSPGVYFHSETD---KNSRVT----YGTTVIPNRGA-WLEYETDAKDIAYVRI-----DRTRKIPLTELVRALGFGSDQDIINMFGDNDSLMLTL------EKDVHK-----------NTDDSR----TDEALKDIYERLRP------GEPKTADSSR-------------------------------------------SLLYARFFDPKRYDLASVGRYKVNKKLSLKTRLLNQVLAETLADPDTGEVIAQKGTKVDRQVMDKLAPYLDRDDFKTITYQPSDQGV--VTDPIELQSIKVYS-QVTPDKEINLIG-NGHIGKKVKHIVPADVLASMNYFLNLQEGLGSIDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQDTA--------------TVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLASYAVVNPYGFIETPYRRVSWDTHKVTDKIDYLTADEEDNYIVAQANSPLN-DDGSFVDETVLARHKDNNIEISPDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLVNPHAPLVGTGMEYKAAHDSGTAVLANNA--GTVEYVDAKQIRVRREDGALDAYNLMKFKRSNAGKNYNQRPIVTIGDHVDVDEIIADGPAMQNGELALGQNPIIAFMTWNMYNYEDAIVLSERLVKDDVYTSIHIEEYESEARDTKLGPEEVTREIPNVGEEALKDLDEFGVVRVGAEVRDGDILVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIIQDVKIFTREAGDELSPGVNMMVRVYITQKRKIQVGDKMAGRHGNKGTVSVVVPEEDMPYLPDGTPVDICLSPMGVPSRMNIGQVLELHLGMAARNLGIHVATPVF---DGANDKDLWATVKE 1003
Score = 540, Expect = 1.6e-52, Identities = 106/177 (59%), Positives = 130/177 (73%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++   L    ATPVF+G N  DL   + EAG+            GK  L DGRTGE F+  VSVGIMY +KL HMVDDKIH+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   974 GMAARNLGIHVATPVFDGANDKDLWATVKEAGM---------ASDGKSVLYDGRTGEPFENRVSVGIMYYMKLSHMVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQALGLDMKV 1141
>gi|116495960|ref|YP_807694.1| DNA-directed RNA polymerase subunit beta [Lactobacillus casei ATCC 334] >gi|122262640|sp|Q034X0|RPOB_LACC3 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|116106110|gb|ABJ71252.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Lactobacillus casei ATCC 334] (1199 aa)
Score = 2036, Expect = 0.0e+00, Identities = 454/1104 (41%), Positives = 672/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSI--SDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR Y++I++  + PNL+ +Q N++  F+D  L+     I PI    G+ SLE++G +L +PK + +EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y  +++     NSR      Y   ++P +G  +  +  + KD   V       + T  IP+T  ++ALG  + ++I+N+F ++ S+  +L      EKDV +           N+ DS      D  L++++++          E K A+  +                                           S++Y  FF  K +DL+  GR+K+ +K+ L  RL  +VLAE L D + G+V+ +K T + +  +D +           +     D+ +  + + ++ + I VY    + D+ I +IG +  + K    I  +D+L+  +Y +NL   +G  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D A              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V      +TD+I +LTA  ED YI+A +N  LN +   F ++ VL R++ +        VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PL++P AP+VGTG EYK AHDSG A + +    GTV YVD   I+++        Y L KF +SN     NQ PIV++G+ V     IADGPAM NGELALGQN ++AF TW+ YNYEDAI+LS+RL  +D++TSIHI EY  +   TK G EE+TR+IPNV E + K LD+ G++ VGAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G +  VK F  E   EL+  V   ++VY+ QKRKIQ+GDKMAGRHGNKG +S +VP EDMP+L DGT +DI L+P+GVPSRMNIGQ+LELHLG+A + L +     ++     A+D  LW  + E
  S:    10 KHRTRRSYARIKEVLDLPNLIEIQTNSYQWFLDEGLKEMFDDIMPIDDFQGKLSLEFVGYQLLEPKYTVEEARQHDANYSAPLHVTLRLTNHETGEIK------------SQDVFFGDFPLMTKQGTFIINGAERVIVSQLVRSPGVYFHSETD---KNSRVT----YGTTVIPNRGA-WLEYETDAKDIAYVRI-----DRTRKIPLTELVRALGFGSDQDIINMFGDNDSLMLTL------EKDVHK-----------NTDDSR----TDEALKDIYERLRP------GEPKTADSSR-------------------------------------------SLLYARFFDPKRYDLASVGRYKVNKKLSLKTRLLNQVLAETLADPDTGEVIAQKGTKVDRQVMDKLAPYLDRDDFKTITYQPSDQGV--VTDPIELQSIKVYS-QVTPDKEINLIG-NGHIGKKVKHIVPADVLASMNYFLNLQEGLGSIDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQDTA--------------TVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLASYAVVNPYGFIETPYRRVSWDTHKVTDKIDYLTADEEDNYIVAQANSPLN-DDGSFVDETVLARHKDNNIEISPDKVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLVNPHAPLVGTGMEYKAAHDSGTAVLANNA--GTVEYVDAKQIRVRREDGALDAYNLMKFKRSNAGKNYNQRPIVTIGDHVDVDEIIADGPAMQNGELALGQNPIIAFMTWNMYNYEDAIVLSERLVKDDVYTSIHIEEYESEARDTKLGPEEVTREIPNVGEEALKDLDEFGVVRVGAEVRDGDILVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIIQDVKIFTREAGDELSPGVNMMVRVYITQKRKIQVGDKMAGRHGNKGTVSVVVPEEDMPYLPDGTPVDICLSPMGVPSRMNIGQVLELHLGMAARNLGIHVATPVF---DGANDKDLWATVKE 1003
Score = 540, Expect = 1.6e-52, Identities = 106/177 (59%), Positives = 130/177 (73%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++   L    ATPVF+G N  DL   + EAG+            GK  L DGRTGE F+  VSVGIMY +KL HMVDDKIH+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   974 GMAARNLGIHVATPVFDGANDKDLWATVKEAGM---------ASDGKSVLYDGRTGEPFENRVSVGIMYYMKLSHMVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQALGLDMKV 1141
>gi|19745277|ref|NP_606413.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS8232] >gi|94989594|ref|YP_597694.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS10270] >gi|41018073|sp|Q8P2Y3|RPOB_STRP8 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158564190|sp|Q1JJ23|RPOB_STRPD DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|19747374|gb|AAL96912.1| putative DNA-dependent RNA polymerase subunit beta [Streptococcus pyogenes MGAS8232] >gi|94543102|gb|ABF33150.1| DNA-directed RNA polymerase beta chain [Streptococcus pyogenes MGAS10270] (1188 aa)
Score = 2036, Expect = 0.0e+00, Identities = 448/1104 (40%), Positives = 671/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +S+I++  + PNL+ +Q ++F  F+D+ L+   + + PI +      LE++G + ++PK + +EAR    +Y  P++V   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF     ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  +++AE+L D   G+++++  T + +  +++I++         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D                 LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDEY +A +N  + E   F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + +G V + D   ++I+   GS + VY +TKF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:    10 KHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGLKEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIEKDIHK-----------------NPSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLIARFFDARRYDLAAVGRYKVNKKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPN---DYAVVTEPVVLQKFKVVSPIDP-DRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGLGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NDVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGTVTNEIVWLTADEEDEYTVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQHNGKVVFSDAEKVEIRRQDGSLD-VYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWDTVRE 1002
Score = 535, Expect = 6.8e-52, Identities = 109/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   973 GMAARNLGIHIATPVFDGASSEDLWDTVREAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1155
>gi|37521852|ref|NP_925229.1| DNA-directed RNA polymerase subunit beta [Gloeobacter violaceus PCC 7421] >gi|41017641|sp|Q7NIA0|RPOB_GLOVI DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|35212851|dbj|BAC90224.1| RNA polymerase beta subunit [Gloeobacter violaceus PCC 7421] (1112 aa)
Score = 2035, Expect = 0.0e+00, Identities = 415/858 (48%), Positives = 571/858 (66%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATP-VFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L+  DIL+   Y+INL++DIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ +++               ++LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SHYG+ICPIETPEG N GLI SLAT+A  +  GF+ TPY++VK+G ++ EI++LTA  EDE+ +A  ++ V E      + V  RYR  +      +VD++ +SP Q+VS+A S IPFLE+DDANRALMGANMQRQA PL+ P  P+VGTG E + A DSGM  V D   DG ++YV G  I+++    +E  Y L K+ +SNQ+TC +Q PIV+VG++V  G  +ADG A   GELALGQN+LVAF  W GYNYEDAI++S+RL  +D+FTSIH+ ++ ++  +TK G EEITR+IPNV E S + LD+ GI+ +GA ++ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VY+ QKRK+Q+GDK+AGRHGNKGIISKI+P EDMP+L DG  +DI+LNPLGVPSRMN+GQ+ E  LG A         L + +   P  +  +     +EASR L+   EK++  +++                                T  P V+    +   K       I   +G+ GE                FD  V+VG +YM+KL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEA+GAA+ L+ELLT+KSDD+ GRN   NAI+KGK IP  G+PESFK+L ++LQ LGL VS+ K
  S:   290 LTPQDILASIDYLINLEFDIGSPDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSEA--------------ETLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIGSLATHARVNSYGFIETPYKVVKDGRLSGEIKYLTADEEDEFRVAAGDVAVDEGGNILANPVTIRYRQEFGLASPAEVDYVAVSPIQIVSVATSLIPFLEHDDANRALMGANMQRQAVPLLRPERPLVGTGLEGQAARDSGMVIVSD--IDGAITYVSGEQIRVRGENGQEFAYPLQKYQRSNQDTCLSQRPIVNVGDQVRNGQILADGSATEGGELALGQNILVAFMPWEGYNYEDAILISERLVYDDVFTSIHVEKFEIEARQTKLGPEEITREIPNVGEDSLRNLDERGIVRIGAWMEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREQGDELPPGANMVVRVYLAQKRKVQVGDKVAGRHGNKGIISKILPKEDMPYLPDGRPVDIVLNPLGVPSRMNVGQVFETLLGWA------GACLNVRFKVTPFDEMYI-----KEASRYLVH--EKLMEAREV--------------------------------TGDPWVYSDTGKHIGK-------IQVYDGRTGEA---------------FDRPVTVGQIYMMKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAFGAAYTLQELLTVKSDDMTGRNEALNAIVKGKAIPRPGIPESFKVLVRELQSLGLDVSVHK 1067
Score = 257, Expect = 1.0e-19, Identities = 69/234 (29%), Positives = 124/234 (52%)
  Q:    26 NFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYI-GMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE-IYNEKDVF 259
           N+  P+L+ +Q+ +F  F++  L   + S  PI    G+  L ++   KL++PK S +EA+    TY   +YV   +V+ E+GE+K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   K ++  +N RK         ++P +G  +  F  +  D + V       + T  +     LKALGL+  EIL+ F + +  + +++ E  Y+E++  
  S:    23 NYLLPDLVEIQRESFRWFLEEGLIEELLSFSPITDYTGKMELHFLQDYKLKEPKYSVEEAKRRDSTYSVQMYVSTRLVNKETGEIKEQQ------------VFIGELPLMTDRGTFIINGAERVIVNQIVRSPGVYY--KQELD-TNGRKTFN----ASLIPNRGA-WLKFETDANDLVWVRI-----DKTRKLSAVVLLKALGLSDNEILDAFRHPEYFQKTIEKEGNYSEEEAL 233
>gi|34595749|gb|AAQ76597.1| RpoB [Mycobacterium senegalense] (1170 aa)
Score = 2035, Expect = 0.0e+00, Identities = 440/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G  E AS+     L + L    + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   280 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANSPIDTDGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVIV--SEKAGVVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKAGWNIDVAAGTPEWASK-----LPEQLYSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1162
Score = 253, Expect = 3.4e-19, Identities = 77/276 (27%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    30 RVSFAKLREPLEVPGLLDVQTDSFDWLVGSDEWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 294
>gi|34391549|gb|AAN65352.1| RpoB [Mycobacterium fortuitum] (1170 aa)
Score = 2035, Expect = 0.0e+00, Identities = 440/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G  E AS+     L + L    + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   280 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANSPIDPDGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVIV--SEKAGIVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKAGWNIDVAAGTPEWASK-----LPEQLYSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1162
Score = 251, Expect = 5.0e-19, Identities = 77/276 (27%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   +  +                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    30 RVSFAKLREPLEVPGLLDVQTDSFDWLVGADEWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 294
>gi|21909611|ref|NP_663879.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS315] >gi|28894988|ref|NP_801338.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes SSI-1] >gi|50913477|ref|YP_059449.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS10394] >gi|56808832|ref|ZP_00366545.1| COG0085: DNA-directed RNA polymerase, beta subunit/140 kD subunit [Streptococcus pyogenes M49 591] >gi|71902747|ref|YP_279550.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS6180] >gi|94991583|ref|YP_599682.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS2096] >gi|94993486|ref|YP_601584.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes MGAS10750] >gi|139472961|ref|YP_001127676.1| DNA-directed RNA polymerase subunit beta [Streptococcus pyogenes str. Manfredo] >gi|41018064|sp|Q8K8W3|RPOB_STRP3 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|73917874|sp|Q5XE97|RPOB_STRP6 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|88909643|sp|Q48VR1|RPOB_STRPM DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158512770|sp|A2RC51|RPOB_STRPG DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158564171|sp|Q1J8X1|RPOB_STRPF DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158564180|sp|Q1JE20|RPOB_STRPB DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|21903792|gb|AAM78682.1| putative DNA-dependent RNA polymerase subunit beta [Streptococcus pyogenes MGAS315] >gi|28810233|dbj|BAC63171.1| putative DNA-dependent RNA polymerase subunit beta [Streptococcus pyogenes SSI-1] >gi|50902551|gb|AAT86266.1| DNA-directed RNA polymerase beta chain [Streptococcus pyogenes MGAS10394] >gi|71801842|gb|AAX71195.1| DNA-directed RNA polymerase beta chain [Streptococcus pyogenes MGAS6180] >gi|94545091|gb|ABF35138.1| DNA-directed RNA polymerase beta chain [Streptococcus pyogenes MGAS2096] >gi|94546994|gb|ABF37040.1| DNA-directed RNA polymerase beta chain [Streptococcus pyogenes MGAS10750] >gi|134271207|emb|CAM29423.1| DNA-directed RNA polymerase beta chain [Streptococcus pyogenes str. Manfredo] (1188 aa)
Score = 2034, Expect = 0.0e+00, Identities = 448/1104 (40%), Positives = 671/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +S+I++  + PNL+ +Q ++F  F+D+ L+   + + PI +      LE++G + ++PK + +EAR    +Y  P++V   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF     ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  +++AE+L D   G+++++  T + +  +++I++         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D                 LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDEY +A +N  + E   F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + +G V + D   ++I+   GS + VY +TKF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:    10 KHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGLKEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIEKDIHK-----------------NPSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLIARFFDARRYDLAAVGRYKVNKKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPN---DYAVVTEPVVLQKFKVVSPIDP-DRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGLGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NDVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEYTVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQHNGKVVFSDAEKVEIRRQDGSLD-VYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWDTVRE 1002
Score = 535, Expect = 6.3e-52, Identities = 109/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   973 GMAARNLGIHIATPVFDGASSEDLWDTVREAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1155
>gi|118616532|ref|YP_904864.1| DNA-directed RNA polymerase subunit beta [Mycobacterium ulcerans Agy99] >gi|158512376|sp|A0PM24|RPOB_MYCUA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|118568642|gb|ABL03393.1| DNA-directed RNA polymerase, beta subunit, RpoB [Mycobacterium ulcerans Agy99] (1176 aa)
Score = 2034, Expect = 0.0e+00, Identities = 436/942 (46%), Positives = 596/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++DEI +LTA  ED +++A +N  ++ + +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V    I + +    +  Y + KF +SN  TC NQ PIV  GE+V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G+ E A +     L + L   Q  S+                              +TPVF+G    +L + +  A +   +G++     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   286 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTAMTAPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIHYLTADEEDRHVVAQANSPIDAQGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KAGVIEEVSADYITVMADDGTRHTYRMRKFARSNHGTCANQSPIVDAGERVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPAEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKSGWNIDVANGVPEWAGK-----LPENLLSAQPDSI-----------------------------VSTPVFDGAQEAEL-QGLLSATLPNRDGEVLVDGDGKAKLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1168
Score = 262, Expect = 3.2e-20, Identities = 81/276 (29%), Positives = 137/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I ++                 LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  KL +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG + E+I   F   + +  +L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    36 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSQRWRESAAQRGDATPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGGFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKLLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWSNEQIHERFGFSEIMMGTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 300
>gi|172038401|ref|YP_001804902.1| RNA polymerase beta subunit [Cyanothece sp. ATCC 51142] >gi|171699855|gb|ACB52836.1| RNA polymerase beta subunit [Cyanothece sp. ATCC 51142] (1104 aa)
Score = 2032, Expect = 0.0e+00, Identities = 424/871 (48%), Positives = 579/871 (66%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSE--EKV-----YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDI 1349
           L   DILS   Y+INL++D+G  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ +++                SLT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRRISA+GPGG++RE     +RD+H SH+G+ICP+ETPEG N GLI SLATYA  ++ GF+ TPY  V++G +  ++   +LTA  ED+  +A  +++  E+     + V  RYR  +       VD++ +SP Q++S+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V     +G V+Y D   I+++ +G E  EKV     Y L K+ +SNQ+TC NQ P+V VGE V  G  +ADG A   GELALGQN+LVA+  W GYNYEDAI++S+RL  +D++TSIH+ ++ ++  +TK G EEITR+IPNV E S + LD++GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG  IDI+LNPLGVPSRMN+GQ+ E  LG A + L +         +   + F   +G  EE+SR  +  L           L++A K+                R+  +Y T  P                               GK ++ DGRTGE FD  V+VG  YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLT+KSDD++GRN   NAI+KGKPIP  G PESFK+L ++LQ LGL +++ K +  A++   +D+
  S:   277 LRPEDILSAIDYLINLEFDVGTVDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSE--------------SDSLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIGSLATYARVNQYGFIETPYYRVQDGRVRRDLDPVYLTADEEDDLRVAPGDISTDEEGNILGNAVPTRYRQEFFITSPDQVDYVAVSPVQIISVATSMIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQAARDSGMVIV--SRTEGIVTYADANEIRVRVTGPEGHEKVGQEIQYILQKYQRSNQDTCLNQRPLVFVGEDVVPGQVLADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHVEKFEIEARQTKLGPEEITREIPNVGEDSLRNLDEQGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGRPIDIVLNPLGVPSRMNVGQVFECLLGWAGENLGV---------RFKITPFDEMYG--EESSRKTVHGL-----------LEKAAKK---------------PRKDWVYNTDHP-------------------------------GKIDVYDGRTGEKFDRAVTVGQAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAYGAAYTLQELLTVKSDDMQGRNEALNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIAVHK-VETADDGTSRDV 1073
Score = 254, Expect = 2.2e-19, Identities = 86/320 (26%), Positives = 151/320 (47%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGK-NAEKQKELN--EVINNIISEK--AAKDLVINLSISTKNIDSKFRLSNK 349
           P+L+ +Q ++F  F++  L   + S  PI    G+  L ++G   KL++PK    EA+    +Y   +YV   +++ E+GE+K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   ++     N R+     Y   ++P +G  +  F  +    + V       + T  +     LKA+GL+  EIL+   + +  + +LD     E +  E D L+ L + L   +     G    L   F  + S +  L   G+    K+  LN  + I  +  E   +A D +INL      +D    L N+
  S:    13 PDLIEIQHSSFRWFLEEGLIEELNSFSPITDYTGKLELHFLGENYKLKEPKYDVDEAKRRDASYSVQMYVPTRLMNKETGEIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYYKAETD---KNGRRT----YSASLIPNRGA-WLKFETDKNGLVWVRI-----DKTRKLSAQVLLKAIGLSDNEILDSLRHPEFYQRTLD----KEGNPSEEDALLELYRKLRPGEPPTVSGGQQLLESRF--FDSKRYDLGRVGRYKLNKKLRLNAPDTIRVLRPEDILSAIDYLINLEFDVGTVDDIDHLGNR 308
>gi|34391553|gb|AAN65354.1| RpoB [Mycobacterium septicum] (1185 aa)
Score = 2032, Expect = 0.0e+00, Identities = 441/942 (46%), Positives = 596/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++D+I +LTA  ED +++A +N  ++ +  F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP + DGT +DI+LN  GVP RMNIGQILE HLG   K      V E               G  E ASR     L   L+   + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   295 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDQIDYLTADEEDRHVVAQANSPIDADGSFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVIV--SEKAGVVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFMPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIDVAE---------------GTPEWASR-----LPDGLHSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1177
Score = 253, Expect = 2.8e-19, Identities = 77/276 (27%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   +  +                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    45 RVSFAKLREPLEVPGLLDVQTDSFDWLVGADGWRQKAVDRGETNPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDDSIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 309
>gi|194342080|gb|EDX23046.1| DNA-directed RNA polymerase subunit beta [Streptomyces sp. Mg1] (1160 aa)
Score = 2032, Expect = 0.0e+00, Identities = 437/917 (47%), Positives = 588/917 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYD------------IGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           T+E    ++ N+  + +   +A V +Y K+N              +G D  LD   L+  DI++   Y++ L               +   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR V +GV+TD++ +LTA  ED ++IA +N  + E  +F E++VL R R    ++    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANM RQA PLI   AP+VGTG EY+ A D+G +     EKDG V  V    + + +       Y + KF++SNQ T  NQ  IV+ G+++ +   +ADGPA   GE+ALG+N+LVAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GA+V  GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  E+  EL   V + ++VYV QKRKI  GDK+AGRHGNKG+ISKI+P+EDMP LEDGT +DI+LNPLGVPSRMN GQ+LE+HLG LA +   +S + E                                                   D +  L   G  R +     ATPVF+G  R D    + E  I   +G      SGK  L DGR+GE F   +S+G MY+LKL H+VDDK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G
  S:   275 TREAAQTLLENLYFNPKRYDLAKVGRY-KVN------------KKLGADEPLDAGVLTTDDIIATIKYLVRLHAGETETIGESGRSIVVETDDIDHFGNRRLRNVGELIQNQVRTGLARMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRVNAFGFVETPYRKVIDGVVTDDVDYLTADEEDRFVIAQANAGLSEDMRFTENRVLVRRRGGEIDYIAGDDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMMRQAVPLIKAEAPLVGTGMEYRCAVDAGDSI--RAEKDGVVQEVSADYVTVANDDGTYTTYRVAKFSRSNQGTSVNQKVIVNEGDRIVEAQVLADGPATEEGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVSEEVLADLDERGIIRIGADVVAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEIGKVIGVRVFDREEGDELPPGVNQLVRVYVAQKRKITDGDKLAGRHGNKGVISKILPIEDMPFLEDGTPVDIILNPLGVPSRMNPGQVLEIHLGWLASRGWDVSGLAE---------------------------------------------------DWAERLKVIGADRVEPGTNVATPVFDGA-REDELAGLFEHTIPNRDGDRLVLPSGKARLFDGRSGEPFPDPISIGYMYILKLHHLVDDKLHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVTGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDG 1126
Score = 266, Expect = 1.1e-20, Identities = 83/282 (29%), Positives = 138/282 (48%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFI---------------------DTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           LR  ++KI++    PNLL LQ  +F   +                      + LE   + I PI+   G  SL +   + E  K S  E +    TY  PL+V     +NE+GE+K  T            +F    P++T KGTF++NG E+ V+SQ+VRSPG Y    S I  ++ +    + +  +I+P++G  +     + +D + V       +S     +T  LKALG   E+IL  F  ++S++ +L+ +    +D    D L+++ + L   +        T L  L+   K+Y   K
  S:    20 LRISFAKIKEPLEVPNLLALQTESFDWLLGNAAWKSRVESALESGQDVPTKSGLEEIFEEISPIEDFSGSMSLTFRDHRFEPAKNSVDECKERDFTYAAPLFVTAEFTNNETGEIKSQT------------VFMGDFPLMTNKGTFVINGTERVVVSQLVRSPGVYF--DSSIDKTSDK----DIFSAKIIPSRGA-WLEMEIDKRDMVGVRIDRKRKQS-----VTVLLKALGWTTEQILEEFGEYESMRATLEKDHTQGQD----DALLDIYRKLRPGEPPTREAAQTLLENLYFNPKRYDLAK 297
>gi|183981015|ref|YP_001849306.1| DNA-directed RNA polymerase, beta subunit, RpoB [Mycobacterium marinum M] >gi|183174341|gb|ACC39451.1| DNA-directed RNA polymerase, beta subunit, RpoB [Mycobacterium marinum M] (1176 aa)
Score = 2032, Expect = 0.0e+00, Identities = 436/942 (46%), Positives = 596/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++DEI +LTA  ED +++A +N  ++ + +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V    I + +    +  Y + KF +SN  TC NQ PIV  GE+V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G+ E A +     L + L   Q  S+                              +TPVF+G    +L + +  A +   +G++     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   286 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTAMTAPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIHYLTADEEDRHVVAQANSPIDAQGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KAGVIEEVSADYITVMADDGTRHTYRMRKFARSNHGTCANQSPIVDAGERVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPAEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKSGWNIDVANGVPEWAGK-----LPENLLSAQPDSI-----------------------------VSTPVFDGAQEAEL-QGLLSATLPNRDGEVLVDGDGKAKLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1168
Score = 261, Expect = 3.6e-20, Identities = 81/276 (29%), Positives = 137/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I ++                 LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  KL +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG + E+I   F   + +  +L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    36 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSQRWRESAAQRGDATPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKLLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWSNEQIHERFGFSEIMMGTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 300
>gi|34595745|gb|AAQ76595.1| RpoB [Mycobacterium goodii] (1169 aa)
Score = 2031, Expect = 0.0e+00, Identities = 424/863 (49%), Positives = 568/863 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N   ++N +F E++V+ R +    EF     VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V    I + +     + Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE H               L +  K   +  +  G+ + AS+         L E                +L  A S S +         ATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   359 DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANSPTDENGRFTEERVMVRKKGGEVEFVSAGQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KTGVIEEVSADYITVMADDGTRQSYRLRKFARSNHGTCANQRPIVDAGQRVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETH---------------LGWVAKAGWNIDVAAGVPDWASK---------LPE----------------ELYTAPSDSIV---------ATPVFDGAQEGELA-GLLGSTLPNRDGEVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1161
Score = 264, Expect = 1.8e-20, Identities = 78/276 (28%), Positives = 135/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  +  + PI+   G  SL +   + ++ K S  E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +  +  D    + L+++ + L   +        T L  LF K
  S:    29 RVSFAKLREPLEVPGLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEVLAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDTTSGTD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 293
>gi|68536938|ref|YP_251643.1| DNA-directed RNA polymerase subunit beta [Corynebacterium jeikeium K411] >gi|88909131|sp|Q4JT32|RPOB_CORJK DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|68264537|emb|CAI38025.1| DNA-directed RNA polymerase, beta subunit [Corynebacterium jeikeium K411] (1164 aa)
Score = 2030, Expect = 0.0e+00, Identities = 422/874 (48%), Positives = 569/874 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEEMDI 1375
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QFLDQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V +G ITDE+ + TA  ED ++IA +N   ++N +F E+++  R R    E     +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V YV    I +      +  + L KF ++NQ TC NQ P+V  G++V  G  +ADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  ED+ TSIHI EY +D   TK G EEITRDIPNV E     LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT IDI+LN  GVP RMNIGQ+LE+HLG   K           +   P S         +   + +++ L + L E    SL                             TATPVF+G +  +L   +  + +   +G+      GK NLIDGR+GE F   V+VG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +    G     +  D +E  +      I    D++   +MD+
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFLDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYARVNPFGFIETPYRKVVDGQITDEVYYFTADEEDRHVIAQANTPFDENHRFTEERIEVRLRGGDVEVVPYTEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPFVGTGMELRAAYDAGDMII--APKAGVVEYVSADYITVMDDEGVRDTFMLRKFERTNQGTCYNQTPLVDEGDRVEAGQVLADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDVLTSIHIEEYEIDARDTKLGPEEITRDIPNVGEDVLADLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRVFSREDDDDLAAGVNEMVRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPIDIILNTHGVPRRMNIGQVLEVHLGWLAKA---------GWKVDPDS--------QDPKIQKMLETLPEELYEIPADSL-----------------------------TATPVFDGASNAEL-SGLLRSSLPNRDGERQVDDFGKSNLIDGRSGEPFPYPVAVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEVLAADGTPMELSSDDDDELENANAALGINLSRDERPDADMDV 1163
Score = 240, Expect = 1.1e-17, Identities = 71/241 (29%), Positives = 120/241 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R  ++KI+     P LL+LQ+ +F   + T                    LE  ++ + PI+      SL     + +  K +  EA+++   Y  PLYV     ++ SGE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y    + I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALGL  +EI + F   + + ++L+ +  +  D
  S:    19 RHSFAKIDAPIEVPGLLDLQRESFAWLVGTPEWRARAQAEAGEDVRIMSGLEEILEELSPIEDYSENMSLTLSEPRFDDVKSTIDEAKDKDINYAAPLYVTAEFTNSMSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DASIDASTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGLTTQEITDRFGFSELMMSTLEKDGVDNTD 254
>gi|34391565|gb|AAN65360.1| RpoB [Mycobacterium fortuitum] (1177 aa)
Score = 2030, Expect = 0.0e+00, Identities = 439/942 (46%), Positives = 598/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DD+DH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP RMNIGQILE HLG               +  K   +  +  G  E AS+     L + L    + S+                              +TPVF+G    +L   +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   287 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDMDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANSPIDPDGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVIV--SEKAGIVEEVSADYITVMADDGSRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG---------------WVAKAGWNIDVAAGTPEWASK-----LPEQLYSAPVDSI-----------------------------VSTPVFDGAREEELA-GLLGSTLPNRDGDVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1169
Score = 253, Expect = 3.6e-19, Identities = 77/276 (27%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    37 RVSFAKLREPLEVPGLLDVQTDSFDWLVGSDEWRQKAVDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMGTLEKDSTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 301
>gi|75910405|ref|YP_324701.1| DNA-directed RNA polymerase subunit beta [Anabaena variabilis ATCC 29413] >gi|115305557|sp|Q3M5D0|RPOB_ANAVT DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|75704130|gb|ABA23806.1| DNA-directed RNA polymerase, beta subunit [Anabaena variabilis ATCC 29413] (1117 aa)
Score = 2030, Expect = 0.0e+00, Identities = 419/868 (48%), Positives = 579/868 (66%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVI--TDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGS-------------------EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNF 1346
           L+  DIL+   Y+INL+YDIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ ++D               + LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SHYG+ICPIETPEG N GLI SLAT+A  ++ GFL TP+R V+NG +       ++TA  ED+  +A  ++ V++N      +V  RYR  +     + VD++ +SP Q+VS+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V     DG V YVD   I+++ SG                    +E  Y ++K+ +SNQ+TC NQ P+V +GE+V  G  +ADG +   GELALGQN++VA+  W GYNYEDAI++S+RL  +DI+TSIHI +Y ++  +TK G EEITR+IPNV E + + LD++GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG+ +DI+LNPLGVPSRMN+GQ+ E  LG A   L +         +   + F   +G  EE+SR       +I++ K  ++ D+  K++                   +Y    P                               GK  + DGRTGE FD  V++G+ YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEA+GAA+ L+ELLT+KSDD++GRN   NAI+KGK IP  G PESFK+L ++LQ LGL +++ K   +A+ ++ 
  S:   278 LTSGDILAAVDYLINLEYDIGSIDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSDA--------------EVLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIGSLATHARVNQYGFLETPFRPVENGRVRFDQPAVYMTADEEDDLRVAPGDIPVDENGHIIGPQVPVRYRQEFSTTTPEQVDYVAVSPVQIVSVATSMIPFLEHDDANRALMGSNMQRQAVPLLKPERPLVGTGLEAQGARDSGMVIV--SRTDGDVVYVDATEIRVRVSGQLPAASGKSTDNGQLTSQKGQEIRYTVSKYQRSNQDTCLNQKPLVRIGERVVAGQVLADGSSTEGGELALGQNIVVAYMPWEGYNYEDAILISERLVQDDIYTSIHIEKYEIEARQTKLGPEEITREIPNVGEDALRQLDEQGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRLFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGSPVDIVLNPLGVPSRMNVGQVFECLLGWAGHTLGV---------RFKITPFDEMYG--EESSR-------RIVHGKLQEARDETGKDW-------------------VYNPDDP-------------------------------GKIMVFDGRTGEPFDRPVTIGVAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAFGAAYTLQELLTVKSDDMQGRNEALNAIVKGKAIPRPGTPESFKVLMRELQSLGLDIAVHKVETQADGSSL 1084
Score = 269, Expect = 4.3e-21, Identities = 88/327 (26%), Positives = 157/327 (48%)
  Q:    23 IEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGK---NAEKQKELNEVINNIISEK--AAKDLVINLSISTKNIDSKFRLSNK 349
           IE  F  P+L+ +Q+++F  F++  L   + S  PI    G+  L ++G   KL++PK S +EA+    TY   +YV   +++ E+G++K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   KS+I  +  R      Y   ++P +G  +  F  +  D + V       + T  +     LKALGL+  EI +   + +  + +++     E    E + L+ L + L   +     G    L   F  +   +  L   G+   N + +  + + +  + S    AA D +INL     +ID    L N+
  S:     7 IEPAFLLPDLIEIQRSSFRWFLEEGLIEELNSFSPITDYTGKLELHFLGHNYKLKEPKYSVEEAKRRDSTYAVQMYVPTRLLNKETGDIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYY--KSEIDKNGRRT-----YSASLIPNRGA-WLKFETDRNDLVWVRI-----DKTRKLSAQVLLKALGLSDNEIFDALRHPEYFQKTIE----KEGQFSEEEALMELYRKLRPGEPPTVLGGQQLLDSRF--FDPKRYDLGRVGRYKLNKKLRLSVPDTVRVLTSGDILAAVDYLINLEYDIGSIDDIDHLGNR 309
>gi|17229086|ref|NP_485634.1| DNA-directed RNA polymerase subunit beta [Nostoc sp. PCC 7120] >gi|20141699|sp|P22703|RPOB_ANASP DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|17135414|dbj|BAB77960.1| RNA polymerase beta subunit [Nostoc sp. PCC 7120] (1131 aa)
Score = 2030, Expect = 0.0e+00, Identities = 419/868 (48%), Positives = 580/868 (66%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVI--TDEIRWLTALSEDEYIIACSNLNVEKNKFK-EDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGS-------------------EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNF 1346
           L+  DIL+   Y+INL+YDIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ ++D               + LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SHYG+ICPIETPEG N GLI SLAT+A  ++ GFL TP+R V+NG +       ++TA  ED+  +A  ++ V++N +    +V  RYR  +     + VD++ +SP Q+VS+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V     DG V YVD   I+++ SG                    +E  Y ++K+ +SNQ+TC NQ P+V +GE+V  G  +ADG +   GELALGQN++VA+  W GYNYEDAI++S+RL  +DI+TSIHI +Y ++  +TK G EEITR+IPNV E + + LD++GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG+ +DI+LNPLGVPSRMN+GQ+ E  LG A   L +         +   + F   +G  EE+SR       +I++ K  ++ D+  K++                   +Y    P                               GK  + DGRTGE FD  V++G+ YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEA+GAA+ L+ELLT+KSDD++GRN   NAI+KGK IP  G PESFK+L ++LQ LGL +++ K   +A+ ++ 
  S:   292 LTSGDILAAVDYLINLEYDIGSIDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSDA--------------EVLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIGSLATHARVNQYGFLETPFRPVENGRVRFDQPAAYMTADEEDDLRVAPGDIPVDENGYIIGPQVPVRYRQEFSTTTPEQVDYVAVSPVQIVSVATSMIPFLEHDDANRALMGSNMQRQAVPLLKPERPLVGTGLEAQGARDSGMVIV--SRTDGDVVYVDATEIRVRVSGQLPTASGKSTDNGQLTSQKGQEIRYTVSKYQRSNQDTCLNQKPLVRIGERVVAGQVLADGSSTEGGELALGQNIVVAYMPWEGYNYEDAILISERLVQDDIYTSIHIEKYEIEARQTKLGPEEITREIPNVGEDALRQLDEQGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRLFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGSPVDIVLNPLGVPSRMNVGQVFECLLGWAGHTLGV---------RFKITPFDEMYG--EESSR-------RIVHGKLQEARDETGKDW-------------------VYNPDDP-------------------------------GKIMVYDGRTGEAFDRPVTIGVAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAFGAAYTLQELLTVKSDDMQGRNEALNAIVKGKAIPRPGTPESFKVLMRELQSLGLDIAVHKVETQADGSSL 1098
Score = 282, Expect = 1.4e-22, Identities = 94/349 (26%), Positives = 168/349 (48%)
  Q:     1 MSKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGK---NAEKQKELNEVINNIISEK--AAKDLVINLSISTKNIDSKFRLSNK 349
           MS KKF   +  + ++  +Y  IE  F  P+L+ +Q+++F  F++  L   + S  PI    G+  L ++G   KL++PK S +EA+    TY   +YV   +++ E+G++K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   KS+I  +  R      Y   ++P +G  +  F  +  D + V       + T  +     LKALGL+  EI +   + +  + +++     E    E + L+ L + L   +     G    L   F  +   +  L   G+   N + +  + + +  + S    AA D +INL     +ID    L N+
  S:     1 MSSKKFNQVDKGRGMISENY--IEPAFLLPDLIEIQRSSFRWFLEEGLIEELNSFSPITDYTGKLELHFLGHNYKLKEPKYSVEEAKRRDSTYAVQMYVPTRLLNKETGDIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYY--KSEIDKNGRRT-----YSASLIPNRGA-WLKFETDRNDLVWVRI-----DKTRKLSAQVLLKALGLSDNEIFDALRHPEYFQKTIE----KEGQFSEEEALMELYRKLRPGEPPTVLGGQQLLDSRF--FDPKRYDLGRVGRYKLNKKLRLSVPDTVRVLTSGDILAAVDYLINLEYDIGSIDDIDHLGNR 323
>gi|46360920|gb|AAS89193.1| RpoB [Corynebacterium jeikeium] (1154 aa)
Score = 2029, Expect = 0.0e+00, Identities = 415/833 (49%), Positives = 555/833 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QFLDQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V +G ITDE+ + TA  ED ++IA +N   ++N +F E+++  R R    E     +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V YV    I +      +  + L KF ++NQ TC NQ P+V  G++V  G  +ADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI EY +D   TK G EEITRDIPNV E     LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT IDI+LN  GVP RMNIGQ+LE+HLG   K                 + + +     +   + +++ L + L E    SL                             TATPVF+G +  +L   +  + +   +G+      GK NLIDGR+GE F   V+VG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFLDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYARVNPFGFIETPYRKVVDGQITDEVYYFTADEEDRHVIAQANTPFDENHRFTEERIEVRLRGGDVEVVPYTEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPYVGTGMELRAAYDAGDMII--APKAGVVEYVSADYITVMDDEGVRDTFMLRKFERTNQGTCYNQKPLVDEGDRVEAGQVLADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDILTSIHIEEYEIDARDTKLGPEEITRDIPNVGEDVLADLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRVFSREDDDDLAAGVNEMVRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPIDIILNTHGVPRRMNIGQVLEVHLGWLAK-----------------AGWKVDTDSQDPKIQKMLETLPEELYEVPADSL-----------------------------TATPVFDGASNAEL-SGLLRSSLPNRDGERQVDDFGKSNLIDGRSGEPFPYPVAVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1122
Score = 240, Expect = 1.1e-17, Identities = 71/241 (29%), Positives = 120/241 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R  ++KI+     P LL+LQ+ +F   + T                    LE  ++ + PI+      SL     + +  K +  EA+++   Y  PLYV     ++ SGE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y    + I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALGL  +EI + F   + + ++L+ +  +  D
  S:    19 RHSFAKIDAPIEVPGLLDLQRESFAWLVGTPEWRARAQAEAGEGVRIMSGLEEILEELSPIEDYSENMSLTLSEPRFDDVKSTIDEAKDKDINYAAPLYVTAEFTNSMSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DASIDASTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGLTTQEITDRFGFSELMMSTLEKDGVDNTD 254
>gi|67922541|ref|ZP_00516049.1| DNA-directed RNA polymerase, beta subunit [Crocosphaera watsonii WH 8501] >gi|67855625|gb|EAM50876.1| DNA-directed RNA polymerase, beta subunit [Crocosphaera watsonii WH 8501] (1104 aa)
Score = 2027, Expect = 0.0e+00, Identities = 423/872 (48%), Positives = 577/872 (66%)
  Q:   478 TLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSE--EKV-----YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDI 1349
           TL   DILS   Y+I+L++DIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ +++                SLT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRRISA+GPGG++RE     +RD+H SH+G+ICP+ETPEG N GLI SLATYA  +  GF+ TPY  V+NG +  ++   +LTA  ED+  +A  +++  E+     + V  RYR  +       VD++ +SP Q++S+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V     +G V+Y D   I++K +G E  EKV     Y L K+ +SNQ+TC NQ P+V VGE V  G  +ADG A   GELALGQN+LVA+  W GYNYEDAI++S+RL  +D++TSIH+ ++ ++  +TK G EEITR+IPNV E S + LD++GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++ YV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG  +DI+LNPLGVPSRMN+GQ+ E  LG A + L +         +   + F   +G  EE+SR  +  L           L++A+ +                R+  +Y    P                               GK ++ DGRTGE FD  V+VG  YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLT+KSDD++GRN   NAI+KGKPIP  G PESFK+L ++LQ LGL +++ K +  A++   +D+
  S:   276 TLRSEDILSAIDYLISLEFDIGTVDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSE--------------SDSLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIGSLATYARVNNYGFIETPYYRVENGRVRRDLDPVYLTADEEDDLRVAPGDISTDEEGNILGNAVPTRYRQEFFITGPAQVDYVAVSPVQIISVATSMIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQAARDSGMVIV--SRTEGIVTYADANEIRVKVTGPEGHEKVGQEIQYILQKYQRSNQDTCLNQRPLVYVGEDVVPGQVLADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHVEKFEIEARQTKLGPEEITREIPNVGEDSLRNLDEQGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREQGDELPPGANMVVRAYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGRPMDIVLNPLGVPSRMNVGQVFECLLGWAGENLGV---------RFKITPFDEMYG--EESSRKTVHGL-----------LEKASNK---------------PRKDWVYNEEHP-------------------------------GKIDVYDGRTGEKFDRPVTVGEAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAYGAAYTLQELLTVKSDDMQGRNEALNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIAVHK-VETADDGTSRDV 1073
Score = 259, Expect = 6.6e-20, Identities = 86/320 (26%), Positives = 152/320 (47%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGK-NAEKQKELN--EVINNIISEK--AAKDLVINLSISTKNIDSKFRLSNK 349
           P+L+ +Q  +F  F++  L   + S  PI    G+  L ++G   KL++PK    EA+    +Y   +YV   +++ E+GE+K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   ++     N R+     Y   ++P +G  +  F  +    + V       + T  +     LKA+GL+  EIL+   + +  + +LD     E +  E D L+ L + L   +     G    L   F  + S +  L   G+    K+  LN  +V+  + SE   +A D +I+L      +D    L N+
  S:    13 PDLIEIQHASFRWFLEQGLIEELNSFSPISDYTGKLELHFLGENYKLKEPKYDVDEAKRRDASYSVQMYVPTRLINKETGEIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYYKAETD---KNGRRT----YSASLIPNRGA-WLKFETDKNGLVWVRI-----DKTRKLSAQVLLKAIGLSDNEILDSLRHPEFYQRTLD----KEGNPTEEDALLELYRKLRPGEPPTVSGGQQLLESRF--FDSKRYDLGRVGRYKLNKKLRLNAPDVMRTLRSEDILSAIDYLISLEFDIGTVDDIDHLGNR 308
>gi|46360936|gb|AAS89201.1| RpoB [Corynebacterium pseudotuberculosis] (1148 aa)
Score = 2026, Expect = 0.0e+00, Identities = 417/851 (49%), Positives = 569/851 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEY 1352
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V+NGV+TD+I +LTA  ED +++  +++ V+ + K   D V  R ++   +    + VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +   +K G V  V  D  T+    G+ E  Y L KF ++NQ TC NQ+P+V++G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  EDD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG LA     +                       + A+  L+K L + L +    SL                             TATPVF+G    ++   +T +  +  +G +    +GK  L DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +    G     +  D +E+
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNSFGFIETPYRKVENGVLTDQIDYLTADEEDRFVVGQAHVEVDAQGKITADSVTVRVKNGDIQVVAPESVDYLDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMERRAAYDAGDLII--NKKAGAVENVSADFITVMADDGTRE-TYMLRKFERTNQGTCYNQIPLVNLGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSIHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRRFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFMPDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAAAGWKIDP--------------------EDPANAELLKTLPEDLYDVPAGSL-----------------------------TATPVFDGATNEEVAGLLTNSRPNR-DGDVMVDANGKAQLFDGRSGEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEVLSADGTPMELSGSDDDEF 1135
Score = 238, Expect = 1.6e-17, Identities = 75/249 (30%), Positives = 122/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL++Q ++F   I T                    LE  ++ + PI+   G  SL     + E  K +  E +++   Y  PLYV    ++NE+ E+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    16 RFSFAKITEPIEVPGLLDIQLDSFAWLIGTPEWRARQQEELGESVRITSGLEEILEELSPIQDYSGNMSLSLSEPRFEDMKNTIDECKDKDINYSAPLYVTAEFINNETQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESD-----GVANTDEAL 254
>gi|196182224|gb|EDX77210.1| DNA-directed RNA polymerase, beta subunit [Microcoleus chthonoplastes PCC 7420] (1116 aa)
Score = 2023, Expect = 0.0e+00, Identities = 421/858 (49%), Positives = 573/858 (66%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNG-VITDEIR-WLTALSEDEYIIACSNLNVEKNKF-KEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSG----------------SEEKV--YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L+  DI+    Y+INL++DIG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ ++D                +LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRR+SA+GPGG++RE     +RD+H SHYG+ICPIETPEG N GLI SLAT+A  +  GF+ TP   V+NG VI D+   ++TA  ED+  +A  ++ +++N +   + V  RYR  +       VDF+ +SP Q++S+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V    K G V YVD   I++++                 SE ++  YE+ K+ +SNQ+TC NQ P+V  G+ V  G  +ADG A   GELALGQN+LVA+  W GYNYEDAI++S+RL ++D++TSIHI +Y ++  +TK G EEITR+IPNV E S + LD++GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DGT +DI+LNPLGVPSRMN+GQ+ E  LG A +       L+L +   P   F   +G  EEASR  +              L+QA +E               +++  ++    P                               GK  + DGRTGE FD  V++GI YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEA+GAA+ L+ELLT+KSDD++GRN   NAI+KGK IP  G PESFK+L ++LQ LGL +++ K
  S:   278 LTPQDIMGAIDYLINLEFDIGSTDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSD--------------SDTLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFAVRDIHPSHYGRICPIETPEGPNAGLIGSLATHARVNAYGFIETPSYPVENGRVIKDKAPLYMTADEEDDLRVAPGDIPMDENGYIMGESVPVRYRQEFTTTTPDQVDFVAVSPVQIISVATSLIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQAARDSGMVVV--ARKAGEVVYVDATKIRVQTAPSTPALPGDSTETAQTSEPEIIEYEIQKYQRSNQDTCLNQRPLVFYGDDVEAGQILADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVLDDVYTSIHIEKYEIEARQTKLGPEEITREIPNVGEDSLRQLDEQGIIRIGAWVEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRIFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPMEDMPYLPDGTPLDIILNPLGVPSRMNVGQVFECLLGWAGEN------LDLRFKMIP---FDEMYG--EEASRLTVHG-----------KLEQAREE---------------TQQDWVFDPENP-------------------------------GKIQVFDGRTGEAFDRPVTIGIAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAFGAAYTLQELLTVKSDDMQGRNEALNAIVKGKAIPRPGTPESFKVLMRELQSLGLDIAVHK 1072
Score = 265, Expect = 1.3e-20, Identities = 66/222 (29%), Positives = 114/222 (51%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           P+L+ +Q+ +F  F++  L   + S  PI    G+  L ++G   KL++PK    EA+    TY   +YV   +++ E+GE+K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   KS+I  +  R      Y   ++P +G  +  F  +  D + V       + T  +     LKALGL+  EI++   +    + +LD E
  S:    14 PDLVEIQRASFRWFLEAGLIEELDSFSPISDYTGKLELHFVGKDYKLKRPKYDVDEAKRRDSTYAVQMYVPTRLINKETGEIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGVYY--KSEIDKNGRRT-----YSASLIPNRGA-WLKFETDKNDLVWVRI-----DKTRKLSAQVLLKALGLSDNEIIDALRHPDYYQKTLDKE 212
>gi|195977259|ref|YP_002122503.1| DNA-directed RNA polymerase beta chain RpoB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195973964|gb|ACG61490.1| DNA-directed RNA polymerase beta chain RpoB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (1188 aa)
Score = 2020, Expect = 0.0e+00, Identities = 442/1109 (39%), Positives = 675/1109 (60%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKN--GVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           D +  K+  RR +S+I++  + PNL+ +Q ++F  F+D+ L+   + + PI +      LE++G + ++PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF + + ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  +++AE+L D   G+++++  T + +  +++I++         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D                 LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDE+ +A +N  +  +  F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + +G V + D   ++++   GS + VY +TKF +SN  T  NQ  +V +G+ V KG  IADGP+M  GE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR++PNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +  +    +D   + D  LW  + E
  S:     5 DVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGLKEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIIDIFGDSELVRNTIEKDIHK-----------------NQSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLTARFFDARRYDLAAVGRYKINKKLNIKTRLLNQIIAENLIDSETGEILVEAGTEMTRSVIESIEEQLDGDLNKFVYTPN---DYAVVTEPVILQKFKVVSPVDP-DRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGLGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NDVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRVIGRVTNEIVWLTADEEDEFTVAQANSKLNPDGTFAEEIVMGRHQGNNQEFPASQVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQHNGKVVFSDAERVEVRREDGSLD-VYHITKFRRSNSGTAYNQRTLVKIGDIVEKGDFIADGPSMEKGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREVPNVGEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGI-HIATPVFDGATSED--LWETVRE 1002
Score = 538, Expect = 3.0e-52, Identities = 110/194 (56%), Positives = 136/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G    DL E + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   973 GMAARNLGIHIATPVFDGATSEDLWETVREAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1155
>gi|117927508|ref|YP_872059.1| DNA-directed RNA polymerase subunit beta [Acidothermus cellulolyticus 11B] >gi|158512360|sp|A0LRL3|RPOB_ACIC1 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|117647971|gb|ABK52073.1| DNA-directed RNA polymerase, beta subunit [Acidothermus cellulolyticus 11B] (1169 aa)
Score = 2019, Expect = 0.0e+00, Identities = 429/884 (48%), Positives = 570/884 (64%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINLDYD-----------IGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI------TKELGKANNNNFKDINE 1351
           +G D    + TL+  DI++   Y++ L              I   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D                ++T +++IN +P   S KEFF + QL+QF+DQ NPLA LT+KRR++A+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI SLAT+   +  GF+ TPYR V NG +TD++ +LTA  ED ++IA +N  + E   F E++VL R R    ++     VD++D+SP+Q+VS+A + IPFLE+DDANRALMG+NMQRQA PL+   AP+VGTG E++ A D+G   +    K G V  V    I I +     + Y L KF +SNQ TC NQ PIV  G++V  G  IADGP    GELALG+N+LVAF +W G+NYEDAII+S+RL  EDI +SIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GA+V  GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  VK F   DD EL   V E ++VYV QKRKI  GDK+AGRHGNKG+I+KI+P EDMP LEDGT +DI+LNPLGVP RMN+GQ                 VLE +      S + +      E  R  + +         I +LD                             ATPVF+G    +++  + E  +   +G    G  GK  L DGRTGE +   +SVG +Y++KL H+VDDK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +      T E+ + ++  F+   E
  S:   316 LGLDLPYTQNTLTEEDIVATIDYLVRLHAGQTETTRNGRTVIIETDDIDHFGNRRLRTVGELIQNQIRLGLARMERVVRERMTTQDIV--------------AITPQTLINIRPVVASIKEFFGTSQLSQFMDQTNPLAGLTHKRRLNALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLATHGRVNAFGFVETPYRKVINGRVTDQVDYLTADEEDRHVIAQANAPLNEDGSFAEERVLVRRRGGEVDYVHPSTVDYMDVSPRQMVSVATALIPFLEHDDANRALMGSNMQRQAVPLLRAEAPLVGTGMEFRAAVDAGDVVI--ASKAGVVEEVSADAITIAADDGTRQTYRLAKFRRSNQGTCINQKPIVDEGQRVEAGQPIADGPCTQGGELALGRNLLVAFMSWEGHNYEDAIIISERLVKEDILSSIHIEEHEVDARDTKLGPEEITRDIPNVSEEILADLDERGIIRIGADVVPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIDVKVF-TRDDAELPPGVNELVRVYVAQKRKITDGDKLAGRHGNKGVIAKILPEEDMPFLEDGTPVDIILNPLGVPGRMNVGQ-----------------VLETHLGWAAKSGWKVELNGQPEGWRKRLAD---------IGALDAPPNTLV----------------------ATPVFDGAKEDEIR-GLLENALPNSDGLRMVGPDGKARLFDGRTGEPYPEPISVGYIYIMKLHHLVDDKLHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVLGRVKVYEAIVKGENIPEPGIPESFKVLVKEMQALCLNVEVLSSDGMTVEMRETDDEVFRAAEE 1153
Score = 286, Expect = 5.2e-23, Identities = 90/281 (32%), Positives = 140/281 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIG---ESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE--LINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  ++KI +  + PNLL LQ  +F   +  +                      LE   + I PI+ I G  SL +   + E PK +  E R    TY  PL+V    V+N +GE+K  T            +F    P++TEKGTFI+NG E+ V+SQ+VRSPG Y   ++  K S+     ++ Y C+I+P++G             +++  RD +G   +      +T  LKALG +   IL  F   ++I+ +L      EKD   T E  L+++ + L   +        T L  L+   K+Y   K
  S:    29 RVSFAKIHEPLDLPNLLALQIESFDWLVGNDAWKARVEAALAAGRTDVNTSSGLEEIFEEISPIEDISGTMSLSFRDHRFEPPKNTPDECRERDFTYSAPLFVTAEFVNNTTGEIKSQT------------VFMGDFPLMTEKGTFIINGTERVVVSQLVRSPGVY-FDRTVDKTSD-----RDIYGCKIIPSRGAWL---------ELEIDKRDNVGVRIDRKRKQSVTVLLKALGWDDARILERFGEFEAIRATL------EKDHVHTQEEALLDIYRKLRPGEPPTYEAAQTLLNNLYFNPKRYDLAK 306
>gi|50843338|ref|YP_056565.1| DNA-directed RNA polymerase subunit beta [Propionibacterium acnes KPA171202] >gi|81611188|sp|Q6A6K6|RPOB_PROAC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|50840940|gb|AAT83607.1| DNA-directed RNA polymerase beta chain [Propionibacterium acnes KPA171202] (1159 aa)
Score = 2019, Expect = 0.0e+00, Identities = 423/873 (48%), Positives = 568/873 (65%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYR-SSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGK 1340
           +G     D+  L++ DI++   +V  L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + D++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLAE+T+KRR+SA+GPGG+SR+   +++RDVH SHYG++CPIETPEG NIGLI SLA++A  +  GF+ TPYR V +G +TDE+ +LTA  ED ++IA +N  ++ +  F  D+VL R R    +     +VD++D+SP+Q+VS+A++ IPFLE+DDA+RALMGANMQRQA PL+   AP VGTG EY+ A D G   +   EK G+V  V    I I       + Y+L KF +SN  TC NQ P+V VG++V  GT +ADGP+  NGELALG+N+L AF  W G NYEDAIILS+R+  +D+ TSIHI E+ VD   TK G EEITRDIPNVSE     LD+ GI+ +GAEV  GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG EGTV  V+ F  E+  EL   V + ++VYV QKRKI IGDK+AGRHGNKG+ISKI+PVEDMP L DGT +DI+LNPLGVPSR                 + + +VLE++      S + +     + A R     L  I  E ++                                 ATPVF+G    ++   + + G    +G++     GK  L DGRTGE F  +V VG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA+EAYGAA  L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+++ L L V +    G+
  S:   308 LGLSLPFDQQVLTVDDIVAAIHFVCALHEGTAILPREGQDDIVVEPDDIDHFGNRRLRTVGELIQNQLRTGLSRMERVVRDRMTTQD--------------IEAITPQTLINIRPVTAAIKEFFGTSQLSQFMDQNNPLAEMTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASFARVNAFGFIETPYRKVVDGHVTDEVVYLTADEEDRHVIAQANAKLDDDGHFANDRVLVRQRHGEADEVPSSEVDYMDVSPRQMVSVASALIPFLEHDDASRALMGANMQRQAVPLVRTEAPFVGTGMEYRCAVDVGDVTL--AEKAGSVLSVSADLIDIACDDGTYQTYKLEKFRRSNAGTCINQRPLVKVGQRVEVGTPLADGPSTDNGELALGRNMLAAFMPWQGLNYEDAIILSQRIVSDDVLTSIHIEEHEVDARDTKLGAEEITRDIPNVSEDMLANLDENGIVRIGAEVGTGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEEGTVIGVRIFDTENGDELAPGVNQMVRVYVAQKRKISIGDKLAGRHGNKGVISKILPVEDMPFLPDGTPVDIILNPLGVPSR-----------------MNVGQVLEMHLGWIAHSGWDITQAEGDWAERLREVGLIDIPEESRL---------------------------------ATPVFDGATEQEIT-GLLQYGHPTRDGEMLVDTDGKATLFDGRTGEPFPSKVGVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMEAYGAAWALQELLTIKSDDVPGRVKVYEAIVKGENIPEPGIPESFKVLVKEMKSLCLNVEVLNSEGQ 1128
Score = 311, Expect = 6.1e-26, Identities = 106/385 (27%), Positives = 171/385 (44%)
  Q:    11 ISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAED 395
           IS    R  ++KI +    PNLL+LQ  +F+  +  E                      LE   + I PI+      SL +   + E PK S  E ++   TY  PL+V    ++NE+ E+K  T            +F    P++T KGTFI+NG E+ V+SQ+VRSPG Y   K+  K S+     ++ + C+++P++G  +  F  + +D + V       +      +T FLKALG   + IL  F  H+SI+ +L      EKD                      +GV+T+ + L   Y  L+   E   ++A +Q                                             ++ N++F+ K +DL+K GR+K+ +K+ LS    Q+VL  D
  S:    14 ISPQSGRISFAKIHEPLEVPNLLDLQVESFNWLVGNEIWQSRVDAALAEGRTDINTKSGLEEIFEEISPIEDYSQTMSLSFRDHRFEDPKHSVDECKDRDTTYAAPLFVTAEFMNNETEEIKSQT------------VFIGDFPLMTSKGTFIINGTERVVVSQLVRSPGVY-FEKTADKTSD-----KDIFTCKVIPSRGA-WLEFAIDKRDTVGVRL-----DRKRKQNVTVFLKALGWTADRILEEFGTHESIRQTL------EKD----------------------HGVETQDQALLDIYKKLRPG-EPPSRDAAQQ---------------------------------------------LLENYYFNPKRYDLAKVGRYKINKKLGLSLPFDQQVLTVD 322
>gi|158564250|sp|Q1JNX8|RPOB_STRPC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1197 aa)
Score = 2018, Expect = 0.0e+00, Identities = 448/1104 (40%), Positives = 671/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDK-PTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGN---------KGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR +S+I++  + PNL+ +Q ++F  F+D+ L+   + + PI +      LE++G + ++PK + +EAR    +Y  P++V   +V+ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EI++IF     ++N+++ +I+                  N SDS      D  L+E++++          E K A+  +                                           S++   FF  + +DL+  GR+K+ +K+ +  RL  +++AE+L D   G+++++  T + +  +++I++         V+  N     + +   V  +K  V    D  D  + I+G     DK   L+ +DIL+  SY +NL   +G  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D                 LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L+++   ++ GF+ TPYR V    G +T+EI WLTA  EDEY +A +N  + E   F E+ V+ R++ + + F    VDF+D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + +G V + D   ++I+   GS + VY +TKF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  ED++TS+H+ E+  +   TK G EEITR+IPNV E + K LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHGG+G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGN         KG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:    10 KHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGLKEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIEKDIHK-----------------NPSDSR----TDEALKEIYERLRP------GEPKTADSSR-------------------------------------------SLLIARFFDARRYDLAAVGRYKVNKKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPN---DYAVVTEPVVLQKFKVVSPIDP-DRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGLGKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQD--------------NDVLTPQQIINIRPVTAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEYTVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQHNGKVVFSDAEKVEIRRQDGSLD-VYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQNPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNVGEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWDTVRE 1011
Score = 536, Expect = 5.0e-52, Identities = 109/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   982 GMAARNLGIHIATPVFDGASSEDLWDTVREAGMD---------SDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1164
>gi|46360926|gb|AAS89196.1| RpoB [Corynebacterium auris] (1118 aa)
Score = 2016, Expect = 0.0e+00, Identities = 416/833 (49%), Positives = 552/833 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI +LA+YA  +  GF+ TPY+ V++G +TD+I +LTA  ED Y IA   + +N E+    E   +            + VD++DISP+Q+VS+A + IPFLE+DDANRALMGANMQ+QA PL+   AP V TG E + A+D+G   +    K G V+ V G  I I      +  Y L  F ++NQ TC NQVPIVS GE+V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TS+HI E+ +D   TK G EEITR+IPNVSE   K LD+ GII +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+RF  EDD +LN  V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP +EDGT +DI+LN  GVP RMNIGQ+LE+HLG LA    T++                      + A+  L++ L + L +   +SL                             TATPVF+G    ++   +     +  +G +     GK  L DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V +
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGALASYARVNAFGFIETPYQKVEDGRLTDQIDYLTADEEDRYAIAQAATPMNAERELIAERIEVRLKDGDIGVVGPQGVDYLDISPRQMVSVATAMIPFLEHDDANRALMGANMQKQAVPLLRSEAPYVATGMEQRAAYDAGDTVI--TRKSGAVTNVTGDFITIMDDEGIQDTYMLRTFERTNQGTCYNQVPIVSQGERVEAGQVIADGPGTKNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSVHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIIRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIAVRRFSREDDDDLNPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPQEDMPFMEDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAKAGWTVNP--------------------DDPANAELLETLPEHLYDVPAESL-----------------------------TATPVFDGATNEEIAGLLANTKPNR-DGDVMVNGDGKARLFDGRSGEPFKYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNVEV 1117
Score = 234, Expect = 4.8e-17, Identities = 72/249 (28%), Positives = 122/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL++Q+ +F   + T                    LE  ++ + PI+   G  SL     + E  K +  E +++   Y  PLYV    ++N++ E+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    16 RYSFAKISEPITVPGLLDVQRESFAWLVGTPEWREREQAARGEGVRVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEDVKYTIDECKDKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPLMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTAEQITERFGFSEIMMSTLESD-----GVANTDEAL 254
>gi|163840927|ref|YP_001625332.1| DNA-directed RNA polymerase subunit beta [Renibacterium salmoninarum ATCC 33209] >gi|189043864|sp|A9WSY0|RPOB_RENSM DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|162954403|gb|ABY23918.1| DNA-directed RNA polymerase beta chain [Renibacterium salmoninarum ATCC 33209] (1175 aa)
Score = 2015, Expect = 0.0e+00, Identities = 428/872 (49%), Positives = 574/872 (65%)
  Q:   468 IGTDTSLDKP---TLSISDILSITSYVINL--------------DYDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRSSWE---FFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGG-TIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           +G D SL  P    L I+DI++I  +++ L              D+++    DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SR+    ++RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR V  G ++DE+ +LTA  E  YIIA +N  ++ K+ F ED+VL R R            DV+++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E   A D+G   +   +K G V+ V     I +     E  Y + K+N+SNQ T  NQ  +VS G ++  G  IADGPA   GELALG+N+LVAF +W G+N+EDAIILS+RL  ED+ +SIHI E+ +D   TK G EEITRDIPNVSE     LD+ GII +GAEV  GD+LVGK++PKG+ ELT EE+LL+AIFGDKS   ++TSLKVPHG  GTV  V+ F  E+D +L   V + +++YV  KRKI  GDK+AGRHGNKG+ISKI+P+EDMP L DGT +DI+LNPLGVP RMN+GQ+LELHLG   K                        G   +   + +KNL  +  E                            R++++   ATPVF+G    ++   +    +   +G L   +SGK  L DGR+GE F   +SVG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD+ GR   Y AI+KG+ IPE G+PESFK+L K+++ L L V +    G
  S:   316 LGIDKSLASPDASVLDINDIVAIIKFLVTLHAGGKSLTAKRDGKDFELRVDVDDIDHFGNRRIRAVGELIENQVRTGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLAGLTHKRRLSALGPGGLSRDRAGYEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRINPLGFIETPYRKVSKGHVSDEVDYLTADDELNYIIAQANAPLDSKSSFVEDQVLVRQRGGGGEPVLVAADDVEYMDVSPRQMVSVATALIPFLEHDDANRALMGANMQRQAVPLVRSEAPVVGTGMERAAAVDAGDVVI--AKKAGVVTEVSADLVIMLNDDGTETNYRIAKYNRSNQGTAYNQRVLVSEGARLEVGGIIADGPATDQGELALGKNLLVAFMSWEGHNFEDAIILSQRLVSEDVLSSIHIEEHEIDARDTKLGAEEITRDIPNVSEEILAGLDERGIIHIGAEVDAGDILVGKVTPKGETELTPEERLLRAIFGDKSGEVRDTSLKVPHGESGTVIGVRFFDRENDDDLAPGVNQLVRIYVAAKRKITNGDKLAGRHGNKGVISKILPIEDMPFLADGTPVDIVLNPLGVPGRMNVGQVLELHLGWIAKT-----------------------GWKIDGEPDWVKNLPNLPRET--------------------------GRDQIL---ATPVFDGAREEEISGLLDSTNVTR-DGDLLINRSGKTRLFDGRSGEPFPDPISVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQELLTIKSDDIHGRVKVYEAIVKGENIPEPGIPESFKVLIKEMRSLCLNVEVLSTEG 1141
Score = 265, Expect = 1.2e-20, Identities = 83/281 (29%), Positives = 143/281 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAF-------------HKFID---------TELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIG---ESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  ++KI +  + PNLL LQ  +F              K +D         + L    + I PI+   G  SL +   +   PK +  E ++   T+  PLYV    ++N +GE+K+ T            +F    P++TEKGTF++NG E+ V+SQ+VRSPGAY   ++  K S+     ++ +  +I+P++G  F          +++  RD +G   +      +T  LKALG  + +IL  F    SI+ +L+ +  + ++    D L+++ + L   +        T L  L+   K+Y   K
  S:    29 RISFAKIHEPLDVPNLLALQTESFDWLVGNGRWQDRMQKAVDAGDESVATTSGLSDIFEEISPIEDFQGTMSLSFSEPEFADPKYTMAECKDRDATFSAPLYVKAEFMNNNTGEIKQQT------------VFMGDFPLMTEKGTFVINGTERVVVSQLVRSPGAY-FERTADKTSD-----KDIFTAKIIPSRGAWF---------ELEIDKRDQVGVRLDRKRKQSVTVLLKALGWTESQILEEFGEFDSIRATLEKDGTSTRE----DALLDIYRKLRPGEPPTVEAAQTLLDNLYFNPKRYDLAK 306
>gi|46360930|gb|AAS89198.1| RpoB [Corynebacterium bovis] (1149 aa)
Score = 2015, Expect = 0.0e+00, Identities = 422/857 (49%), Positives = 573/857 (66%)
  Q:   478 TLSISDILSITSYVINL-------------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKS-LDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           TL+  DIL+   Y++ L             +  IG  DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V+NG ITD + +LTA  ED +++A +N   +++K F ED++  R +    E   V  VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V +V    I +      +  Y L KF ++NQ TC NQ P+V  G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  ED+ TSIHI E+ +D   TK G EEITRDIPNV E     LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  E D +L   V E ++VYV QKRKIQ GDK+AGRHGNKG++ +I+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE+HLG   K                    + W             +++   ++ +IK+ L+Q  +E  D           +  + L   TATPVF+G +  +L   +  +  +    +L +   GK  LIDGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   311 TLTEEDILTTIEYLVRLHAGEKTMTSPEGVEIAIGV-DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYARVNPFGFIETPYRRVENGQITDVVDYLTADEEDRHVVAQANTPFDEDKRFTEDRIEVRLKGGDVEVVPVDQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPFVGTGMELRAAYDAGDVII--TPKAGVVEFVSADYITVMDDDGVRDTYMLRKFERTNQGTCYNQKPLVDEGDRVEAGQAIADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDVLTSIHIEEHEIDARDTKLGPEEITRDIPNVGEDVLADLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGESGKVIGVRVFSREYDDDLAPGVNEMVRVYVAQKRKIQDGDKLAGRHGNKGVVGRILPAEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLEIHLGWLAK--------------------AGW-------------SVDTNSDDPKIKAMLEQLPEELYD-----------VPADSL---TATPVFDGASNEELSGLLRSSRPNRDGIRLVD-DYGKAELIDGRSGEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1119
Score = 237, Expect = 2.2e-17, Identities = 76/249 (30%), Positives = 122/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDELI 265
           R  ++KI      P LL+LQ+ +F   + T                    LE  ++ + PI+      SL +   + ++ K +  E +++   Y  PLYV     ++ SGE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALGL  +EI   F   + + ++L      EKD V  TDE +
  S:    16 RYSFAKINAPIEVPGLLDLQRESFAWLVGTPEWRARRQAEVGDGVRVTSGLEDILEELSPIEDYSENMSLTFSEPRFDEVKNTIDECKDKDINYSAPLYVTAEFTNSMSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DESIDSSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGLTTQEITERFGFSEIMMSTL------EKDGVANTDEAL 254
>gi|46360966|gb|AAS89216.1| RpoB [Corynebacterium felinum] (1111 aa)
Score = 2012, Expect = 0.0e+00, Identities = 414/829 (49%), Positives = 556/829 (67%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+D  N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +GV+TD + +LTA  ED Y++A +N   ++N    ED+V  R +    +    KD+D++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +   +K G V  V    I I S       Y L KF ++NQ T  NQ P+V +GE+V +G  +ADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++RL  EDI TSIHI E+ +D   TK G EEITR+IPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  EDD +L+  V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE+HLG LA     +                       + A+  ++K L + L + +  SL                             TATPVF+G    +L   +  +  +  +G +   ++GK  L DGR+GE F   VSVG MY+LKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L
  S:   345 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDLNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNTFGFIETPYRKVVDGVVTDHVDYLTADEEDRYVVAQANTEYDENGVITEDRVTVRLKKGDIQVVSGKDIDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMELRAAYDAGDLII--NKKAGIVESVSADYITIMSDEGIRDTYMLRKFERTNQGTSYNQKPLVDLGERVEEGQVLADGPGTHNGEMALGRNLLVAFMPWEGHNYEDAIILNQRLVEEDILTSIHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRRFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAAAGWKIDT--------------------EDPANAEILKTLPEDLYDVEPGSL-----------------------------TATPVFDGATNDELAGLLRSSRPNR-DGDVMVDENGKAQLFDGRSGEPFPFPVSVGYMYILKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCL 1111
Score = 240, Expect = 9.9e-18, Identities = 75/249 (30%), Positives = 121/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R+ ++KI +    P LL++Q  +F   I +                    LE  +  + PI    G  SL     + E+ K S  E +++   Y  PLYV    ++ ++GE+K  T            +F    PM+TEKGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    14 RKSFAKITEPIEVPGLLDIQLESFAWLIGSPEWRARRQAELGEGVKVTSGLEDILAELSPIVDYSGNMSLSLSEPRFEEKKNSIDECKDKDINYSAPLYVTAEFINTDTGEIKSQT------------VFICDFPMMTEKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQIQERFGFSEIMMSTLESD-----GVANTDEAL 252
>gi|81429387|ref|YP_396388.1| DNA-directed RNA polymerase subunit beta [Lactobacillus sakei subsp. sakei 23K] >gi|88909140|sp|Q38UQ2|RPOB_LACSS DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|78611030|emb|CAI56083.1| DNA-directed RNA polymerase, beta subunit [Lactobacillus sakei subsp. sakei 23K] (1197 aa)
Score = 2011, Expect = 0.0e+00, Identities = 459/1104 (41%), Positives = 658/1104 (59%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSI--SDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGV--ITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR Y++I++    PNL+ +Q N++  F+D  L      I PI    G  SLE++  +L +PK + +EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y    S I   NSR      Y   ++P +G  +  F  + KD   V       + T  IP++  ++ALG                                                   YG D ++ ++     SL   LE         K++++  ++  +E+A KD+   L     K  DS           +S+++  FF  K +DL+  GR+K+ +K+ L  RL  + LAE L D + G+V+  K+T++ +  +D +           V     DE +  +   +  + I VY    + D+ I +IG +  +D     +  +DI++  +Y  NL   +G  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D +              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V      +TD+I +LTA  ED Y+IA +N  LN +   F ++ VL RY+       +  +D++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PL++P AP+VGTG EYK AHDSG+A +   +  GTV YVD   I+++   S    YEL KF +SN     NQ PIV+ G+ V     IADGPAM  GELALGQN L+AF TW+ YNYEDAI+LS+RL  ED++TSIHI EY  +   TK G EEITR+IPNV E S K LD+ GI+ VGAEVK+GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSLKVPHGG G +  VK F  E   EL+  V   ++VY+ QKRKIQ+GDKMAGRHGNKG +S +VP EDMP+  DGT +DI+L+P+GVPSRMNIGQ+LELHLG+A + L +     ++     A D  LW  + E
  S:    10 KHRTRRSYARIKEVLELPNLIEIQSNSYQWFLDEGLREMFDDIMPIDDFAGNLSLEFVDYQLLEPKYTVEEARQHDANYSAPLHVTLKLTNHETGEIK------------SQDVFFGDFPLMTDQGTFIINGAERVIVSQLVRSPGVYF--NSAID-KNSRTT----YGTTVIPNRGA-WLEFETDAKDIAYVRI-----DRTRKIPMSVLVRALG---------------------------------------------------YGSDQEIIDILGDNDSLMLTLE---------KDIHKNTDDSRTEEALKDVYERLRPGEPKTADSS----------RSLLFARFFDAKRYDLASVGRYKINKKLSLKTRLLGQTLAETLADPDTGEVIAAKDTVVDRQVMDALAPYLDCEDFKAVTYQPSDEGV--LPEPMTLQVIKVYSQK-TPDKEINLIG-NGHIDAKVKHVIPADIIASMNYFFNLQEGLGSTDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQDTS--------------TVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLASYAVVNRYGFIETPYRRVSWDTHDVTDKIDYLTADEEDNYVIAQANSPLN-DDGSFVDNTVLARYKDDNIETSIDKLDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLVNPHAPLVGTGMEYKAAHDSGIALL--AQHAGTVEYVDAKVIRVRREDSSLDTYELMKFRRSNAGKNYNQRPIVAKGDHVDVDEIIADGPAMEKGELALGQNPLIAFMTWNMYNYEDAIVLSERLVKEDLYTSIHIEEYESEARDTKLGPEEITREIPNVGEDSLKDLDEFGIVRVGAEVKDGDILVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLKVPHGGGGIIQDVKIFTREAGDELSPGVNMMVRVYITQKRKIQVGDKMAGRHGNKGTVSIVVPEEDMPYTPDGTPVDILLSPMGVPSRMNIGQVLELHLGMAARNLGIHVATPVF---DGAQDKDLWDAVRE 1003
Score = 529, Expect = 3.0e-51, Identities = 104/177 (58%), Positives = 130/177 (73%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G++   L    ATPVF+G    DL +A+ EA +            GK  L DGRTGE FD  VSVG+MY +KL HMVDDK+H+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR  TY AI+KG+PIP+ G+PESF++L K+LQ LGL + +
  S:   974 GMAARNLGIHVATPVFDGAQDKDLWDAVREANMP---------SDGKSILYDGRTGEPFDTRVSVGVMYYMKLAHMVDDKLHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKTYEAIVKGEPIPKPGVPESFRVLVKELQSLGLDMKV 1141
>gi|183602128|ref|ZP_02963496.1| DNA-directed RNA polymerase subunit beta [Bifidobacterium animalis subsp. lactis HN019] >gi|183218621|gb|EDT89264.1| DNA-directed RNA polymerase subunit beta [Bifidobacterium animalis subsp. lactis HN019] (1186 aa)
Score = 2010, Expect = 0.0e+00, Identities = 427/874 (48%), Positives = 573/874 (65%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINLDY-DIGF--------------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYE----LNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           +G +   +  +LS  DI++   Y++ L   D  F               DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NPLA +TNKRR+SA+GPGG+SR+  ++++RDVH SH+G++CPIE+PEG NIGLI SLAT+   +  GF+ TPYR V+NG +TDE+ ++TA  E E++IA +N  +++N  F E + L R  +   E   V+ VD++D+SP+Q+VS+ AS IPFLE+D+ +RALMG NMQRQA PLI    P+VGTG E++ A DSG   V   EK G V YV    I++         Y+L KF +SNQ TC NQVP++  GE+V KGT +ADGPA   GE+ALG+N+LVAF  W+GYNYEDA+I+S+RL  +D  +SIHI EY +D  +TK G EEITRD+PNV E +   LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  VK    ED  E    L   V + I+VY+ Q RKI  GDK++GRHGNKG+IS+I+P EDMP L DGT +DIMLNPLGVPSRMN+GQ+LE               L L +      D SL   +  E  + + K  EK                             G          ATPVF+GV +  LK  ++    D    KL  G +GK  L DGRTGE +   +SVG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L E++T KSDDV GR   Y AI+KG  +P +G+PESFK+L K++Q L L V +    G A
  S:   315 LGLEKDYNDRSLSREDIIATIKYLVTLHAGDATFPGKRDGEDVELRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQDA--------------EAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVENGHVTDEVVYMTADREVEHVIAQANQKLDENGNFVEKEALVRDAAGEAEDVPVEMVDYMDVSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIKSERPLVGTGAEWRAAVDSG--DVILAEKPGVVIYVSADIIRVMNDDGTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEKGTVLADGPATEKGEMALGKNLLVAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGETGTVIAVKEITREDAEEDGDELPNGVNQMIRVYIAQHRKITQGDKLSGRHGNKGVISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLGQVLE---------------LHLGWVAHAGWDISLDPDMEAEWKKMVPKGAEK--------------------------GEPGTP-------VATPVFDGVRQDVLKGLLSTTLTDRDGNKL-VGDNGKATLFDGRTGEPYPKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAIVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVA 1145
Score = 236, Expect = 3.3e-17, Identities = 70/269 (26%), Positives = 132/269 (49%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDS 276
           D ++ K   R ++  I++  + P LL +Q ++F   +  E                      L+     I PI++     SL +     E+P+ + +E + +  TY  PLYV+    + E+GE+K  T            +F    P+ T  GTFI+ G E+ ++SQ+VRSPG Y   +        R   +E +  +I+P++G  +  F  + +DF+ V       +S        FL A+G+ + EI + F ++  + ++L+ E  + +D      L++L + +  +D+
  S:    19 DIDLHKASDRVNFGSIKEPIDVPYLLGVQTDSFDWLVGNERWKKRVEEDEANGTNTVPHVSGLDEVFHEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGETGEIKSQT------------VFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVYFDRQP------DRTSDKEIFGAKIIPSRGA-WLEFEIDKRDFLGVRVDRKRKQSA-----IVFLMAIGMTRSEIRDAFKDYPLVLDALEKETIDSEDA----ALVDLYRKIRPADA 281
>gi|21223036|ref|NP_628815.1| DNA-directed RNA polymerase subunit beta [Streptomyces coelicolor A3(2)] >gi|41018149|sp|Q9L0L0|RPOB_STRCO DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|7248348|emb|CAB77428.1| DNA-directed RNA polymerase beta chain [Streptomyces coelicolor A3(2)] (1161 aa)
Score = 2009, Expect = 0.0e+00, Identities = 436/917 (47%), Positives = 588/917 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYD------------IGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           T+E    ++ N+  + +   +A V +Y K+N              +G D  LD   L+  D+++   Y++ L               +   DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S KEFF + QL+QF+DQ NPL+ LT+KRR++A+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR V  G +TD++ +LTA  ED ++IA +N  + +  +F E +VL R R    ++    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANM RQA PLI   +P+VGTG EY+ A D+G   V   EK G V  V    I   +     + Y L KF++SNQ T  NQ  IV+ G+++ +G  +ADGPA  NGE+ALG+N+LVAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV  GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  E+  EL   V + ++VYV QKRKI  GDK+AGRHGNKG+ISKI P+EDMP LEDGT +DI+LNPL VPSRMN GQ+LE+HLG LA +   +S                   G+ EE ++ L           Q+   D+                            ATPVF+G  R D    + +  I   +G+     SGK  L DGR+GE F   +SVG MY+LKL H+VDDK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G
  S:   276 TREAAQTLLENLYFNPKRYDLAKVGRY-KVN------------KKLGADEPLDAGVLTTDDVIATIKYLVKLHAGETETVGESGREIVVETDDIDHFGNRRIRNVGELIQNQVRTGLARMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQNNPLSGLTHKRRLNALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRINPFGFIETPYRKVVEGQVTDDVDYLTADEEDRFVIAQANAALGDDMRFAEARVLVRRRGGEVDYVPGDDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMMRQAVPLIKSESPLVGTGMEYRSAADAG--DVVKAEKAGVVQEVSADYITTTNDDGTYITYRLAKFSRSNQGTSVNQKVIVAEGDRIIEGQVLADGPATENGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVSEEVLADLDERGIIRIGAEVVAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEIGKVIGVRVFDREEGDELPPGVNQLVRVYVAQKRKITDGDKLAGRHGNKGVISKINPIEDMPFLEDGTPVDIILNPLAVPSRMNPGQVLEIHLGWLASRGWDVS-------------------GLAEEWAQRL-----------QVIGADKVEPG---------------------TNVATPVFDGA-REDELAGLLQHTIPNRDGERMVLPSGKARLFDGRSGEPFPEPISVGYMYILKLHHLVDDKLHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVTGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDG 1127
Score = 276, Expect = 7.5e-22, Identities = 84/282 (29%), Positives = 140/282 (49%)
  Q:    16 LRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE---------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           LR  ++KI++    PNLL LQ  +F   +  +                     LE   + I PI+   G  SL +   + E PK S  E ++   TY  PL+V     +NE+GE+K  T            +F    P++T KGTF++NG E+ V+SQ+VRSPG Y    S I  ++ +    + +  +I+P++G  +     + +D + V       +S     +T  LKALG   E+IL  F  ++S++ +L+ +    +D    D L+++ + L   +        T L  L+   K+Y   K
  S:    21 LRISFAKIKEPLEVPNLLALQTESFDWLLGNDAWKARVESALESGQDVPTKSGLEEIFEEISPIEDFSGSMSLTFRDHRFEPPKNSIDECKDRDFTYAAPLFVTAEFTNNETGEIKSQT------------VFMGDFPLMTNKGTFVINGTERVVVSQLVRSPGVYF--DSSIDKTSDK----DIFSAKIIPSRGA-WLEMEIDKRDMVGVRIDRKRKQS-----VTVLLKALGWTTEQILEEFGEYESMRATLEKDHTQGQD----DALLDIYRKLRPGEPPTREAAQTLLENLYFNPKRYDLAK 298
>gi|46361002|gb|AAS89234.1| RpoB [Corynebacterium variabile] (1114 aa)
Score = 2009, Expect = 0.0e+00, Identities = 422/863 (48%), Positives = 567/863 (65%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINL-------------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           +G D      TL+  DIL+   Y++ L             +  +G  DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI +LATYA  +  GF+ TPYR V NGVITD++ +LTA  ED +IIA +   V+ + +F ++++  R R+   E     +VD++D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PL+   AP VGTG E + A+D+G   V    K GTV YV    I I      +  Y L KF ++NQ TC NQ+P+V  G++V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  ED+ TSIHI E+ +D   TK G EEITRDIPNV E     LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L   V + ++VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP L DGT +D +LN  GVP RMNIGQ+LE HLG   K                   +      H E  +     ++ +LN                   +L      +  E L+   ATPVF+G    ++   +     +    KL + + GK  LIDGR+GE F   VSVG  YMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L
  S:   300 LGLDGDTGAMTLTEQDILTTIEYLVRLHAGERSMTSPDGTEIPLG-TDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHASHYGRMCPIETPEGPNIGLIGNLATYARVNPFGFIETPYRRVDNGVITDQVDYLTADEEDRHIIAQAKTPVDAEGRFVDEQIEVRLRAGDVEVVPATEVDYMDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLLRGEAPYVGTGMELRAAYDAGDVIV--TPKAGTVEYVSADYITIMDDDGVRDTYMLRKFERTNQGTCYNQIPLVDQGQRVEAGQAIADGPGTRNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDLLTSIHIEEHEIDARDTKLGPEEITRDIPNVGEDVLADLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRVFSREDDDDLAPGVNQMVRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPQEDMPFLPDGTPVDFILNTHGVPRRMNIGQVLETHLGWLAK-------------------YGWTVDTHSEDPK-----VQAMLN-------------------TLPEDLYEVPPESLV---ATPVFDGAENEEISGLLRSINPNADGMKLTD-EFGKAVLIDGRSGEPFPYPVSVGYKYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCL 1114
Score = 230, Expect = 1.7e-16, Identities = 75/249 (30%), Positives = 118/249 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDELI 265
           R  ++KI+     P LL++Q+ +F   + T                    LE  +  + P++      SL     + +  K +  E +++   Y  PLYV     +  SGE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALGL  EEI   F   + +  +L      EKD V  TDE +
  S:    16 RYSFAKIDAPIEVPGLLDVQRESFAWLVGTPEWRARRQAQAEEGTRVTSGLEDILDELSPVEDYSENMSLTLSEPRFDDVKNTIDECKDKDINYSAPLYVTAEFTNALSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DESIDASTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGLTTEEITERFGFSEIMMTTL------EKDGVANTDEAL 254
>gi|34391567|gb|AAN65361.1| RpoB [Mycobacterium mucogenicum] (1184 aa)
Score = 2005, Expect = 0.0e+00, Identities = 433/942 (45%), Positives = 600/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYE---KINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL-DYDIGF-----------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+   K+ ++  N +Q            +   TL+  DI++   Y++ L D D               DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +G++TD+I +LTA  ED +++A +N  ++ N  F E+K+L R +    EF    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V  D  T+    GS    Y + KFN+SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P+EDMP + DGT +DI+LN  GVP                 +++ + ++LE +             G   +A  N+    E   N                    L        R+ ++   ATPVF+G    +L + +  A +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    +++ +D+    +N+  N  +N+
  S:   295 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHDGNPAQ------------VTATTLTEEDIVATIEYLVRLHDGDTKMTAPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGIVTDQIDYLTADEEDRHVVAQANSPLDANGHFTEEKILVRRKGGEVEFVSANDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KSGVIEEVSADYVTVMADDGSRH-TYRMRKFNRSNHGTCANQRPIVDSGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPIEDMPFMPDGTPVDIILNTHGVP-----------------RRMNIGQILETH------------LGWVAKAGWNIEGEPEWAAN--------------------LPEGMRSAPRDSIV---ATPVFDGARENEL-QGLLGATLPNRDGDVMVDADGKSQLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDSDDEDLERTAANLGINLSRNE 1176
Score = 248, Expect = 1.1e-18, Identities = 77/276 (27%), Positives = 131/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL +Q ++F   I ++                 LE  +  + PI+   G  SL +   + ++ K    E + + +TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + K+  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    45 RVSFAKLREPLEVPGLLEVQTDSFEWLIGSDRWRSKAVDRGDINPVGGLEEVLAELSPIEDFAGTLSLSFSDPRFDEVKAPVDECKEKDQTYAAPLFVTAEFINNTTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKATEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIRERFGFSEIMMGTLEKDPTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 309
>gi|119960861|ref|YP_948666.1| DNA-directed RNA polymerase subunit beta [Arthrobacter aurescens TC1] >gi|158512968|sp|A1R8V4|RPOB_ARTAT DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|119947720|gb|ABM06631.1| DNA-directed RNA polymerase, beta subunit [Arthrobacter aurescens TC1] (1173 aa)
Score = 2005, Expect = 0.0e+00, Identities = 420/867 (48%), Positives = 567/867 (65%)
  Q:   468 IGTDTSL---DKPTLSISDILSITSYVINL--------------DYDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWE---FFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGG-TIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           +G D SL   +   L + DI+++  +++ L              D+++    DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SR+   +++RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR+V  GV++DE+++LTA  E E +IA +N  ++ +K F E+ VL R R            DV F+D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E   A D+G   +   +K G V+ V     + I     E  Y + KF +SNQ  C N   +V+ G+++  G  IADGPA   GELALG+N+LVAF +W G+N+EDAIILS+R+  ED+ +SIHI E+ +D   TK G EEITRDIPNVSE     LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSLKVPHG  GTV  V+ F  ++D EL   V + ++VYV  KRKI  GDK+AGRHGNKG+ISKI+P+EDMP L DGT +DI+LNPLGVP RMN+GQ+LE HLG   K                        G   E     +KNL                                + RE      ATPVF+G    ++   +    +     +L +  SGK  L DGR+GE F   +SVG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD+ GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +
  S:   315 LGIDRSLGDKEASVLHVEDIVAMIKFLVALHAGEKTLMGKRDGEDHELRVDVDDIDHFGNRRIRAVGELIENQVRTGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRINPFGFIETPYRLVSEGVVSDEVQYLTADDEAEVLIAQANAPLDADKKFSEETVLVRARGGGGEPVLVPAADVQFMDVSPRQMVSVATALIPFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMERAAAVDAGDVVI--AKKAGVVTEVSAELVVMINDDGTETNYRINKFARSNQGNCYNHRVLVNEGQRLEVGGIIADGPATDQGELALGKNLLVAFMSWEGHNFEDAIILSQRIVAEDVLSSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLAGLDERGIIHIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLKVPHGESGTVIGVRVFDRDNDDELPPGVNQLVRVYVAAKRKITDGDKLAGRHGNKGVISKILPIEDMPFLADGTPVDIVLNPLGVPGRMNVGQVLETHLGWVAKT-----------------------GWKIEGEPEWVKNL------------------------------PNLPRETGQTTVATPVFDGAREEEITGLLDSTNVTRDGDRLID-SSGKTRLFDGRSGEPFPDPISVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQELLTIKSDDIHGRVKVYEAIVKGENIPEPGVPESFKVLIKEMQSLCLNVEV 1134
Score = 280, Expect = 2.4e-22, Identities = 87/281 (30%), Positives = 143/281 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIG---ESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  ++KI +  + PNLL LQ ++F   +  E                      L    + I PI+   G  SL +   +   PK +  E ++   TY  PLYV    ++N +GE+K+ T            +F    P++TEKGTF+VNG E+ V+SQ+VRSPGAY   ++  K S+     ++ +  +I+P++G  F          +++  RD +G   +      +T  LKALG  + +IL  F  + S++ +L      EKD  ET  D L+++ + L   +        + L  L+   K+Y   K
  S:    28 RLSFAKIHEPLDVPNLLALQTDSFDWLVGNERWQARVAKAVEEGDLSVATTSGLADIFEEISPIEDFQGTMSLSFSEPEFADPKYTMAECKDRDATYSAPLYVKAEFMNNNTGEIKQQT------------VFMGDFPLMTEKGTFVVNGTERVVVSQLVRSPGAY-FERTADKTSD-----KDIFTAKIIPSRGAWF---------ELEIDKRDQVGVRLDRKRKQSVTVLLKALGWTEGQILEEFGQYDSMRATL------EKDATETREDALLDIYRKLRPGEPPTVEAAQSLLDNLYFNAKRYDLAK 305
>gi|184155999|ref|YP_001844339.1| DNA-directed RNA polymerase beta subunit [Lactobacillus fermentum IFO 3956] >gi|183227343|dbj|BAG27859.1| DNA-directed RNA polymerase beta subunit [Lactobacillus fermentum IFO 3956] (1193 aa)
Score = 2005, Expect = 0.0e+00, Identities = 445/1104 (40%), Positives = 668/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGL-NKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS-GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR YS+I++  + PNL+ +Q ++++ F+D  L      I PI    G+ SLE++  +L +PK +  EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y   ++        K  +  Y    +P +G  L +   A+   ++++       + T  +PIT  ++ALG  + +EI ++     S   SL+  I  EKD+ +  E           DS     V+  L++++++          E K A+  + L                     ++T+  D K                       +D++  GR+K  +K+++  RL    LAE L D   G+++ K   +I K  L  ++ + ++    ++     DE +  +   V+ +KI VY  ND + +   +     SLD   +  +DIL+  +Y +NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D                ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V   +  +TD I +LTA  ED +IIA +N  + E   F  D+++CR +  +     ++VD++D+SPKQVVS+A++ IPFLENDD+NRALMGANMQRQA PLI+P AP++GTG EYK AHDSG+A +   +  GTV YVD   ++++        Y+L KF +SN     NQ PIV VGE V     +ADGP+M  GELALGQN L+AF TW GYN+EDAI +++RL  +D++TSIHI  Y  +  +TK G EE+TR+IPNVSE ++K LD+ G+I VGAEV +GD+LVGK++PKG  EL++EE+LL AIFG+KS+  ++TSL+VPHGG G +  VK F  E+  EL   V + ++VY+ QKRKIQ+GDKM+GRHGNKG +S +VP EDMP++ DGT IDIML+P+GVPSRMNIGQ++ELHLG+A ++L +     ++     A+D  +W  + E
  S:    13 KHRTRRSYSRIKEVLDLPNLIEIQTDSYNWFMDKGLREMFDDIMPIDDFQGKLSLEFVDYQLLEPKYTVAEAREHDANYSAPLHVTLRLTNHETGEIK------------SQDVFFGDFPLMTDQGTFIINGAERVIVSQLVRSPGVYYNEEAD-------KNGRPSYGANFIPNRGAWLEYETDAKGISYVRI-------DRTRKLPITELVRALGFGSDDEIWDMLG---SESESLNATI--EKDLHKEPE-----------DSR----VEESLKDIYERLRP------GEPKTADSARSL---------------------LTTRFFDPK----------------------RYDMAPVGRYKTNKKLQMKYRLLGLTLAETLADPETGEIIAKDGDVITKEVLKELEPVLEQDDFKMITYTPSDEAV--VTAPVQLQKIMVYSKNDPERKVPVVSNGHISLDLKHIQPADILASINYFLNLQEGIGTTDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------INTVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLSSYARVNAYGFIETPYRRVSWADHKVTDRIDYLTADEEDNFIIAQANTPLNEDGSFVHDEIMCRDKEDYIETAPENVDYMDVSPKQVVSVASACIPFLENDDSNRALMGANMQRQAVPLINPHAPLIGTGIEYKAAHDSGVALI--AKNSGTVEYVDAREVRVRQEDGTLDTYKLMKFRRSNGGKNYNQRPIVKVGEWVDADDVLADGPSMEQGELALGQNPLIAFMTWQGYNFEDAIAINERLVKDDVYTSIHIESYESEARETKLGPEEMTREIPNVSEDARKDLDESGVIRVGAEVHDGDILVGKVTPKGVTELSAEERLLHAIFGEKSREVRDTSLRVPHGGGGIIQDVKVFTRENGDELAPGVNKMVRVYIAQKRKIQVGDKMSGRHGNKGTVSIVVPEEDMPYMPDGTPIDIMLSPMGVPSRMNIGQVIELHLGMAARELGIHIATPVF---DGANDQDVWDAVKE 1007
Score = 521, Expect = 2.9e-50, Identities = 108/208 (51%), Positives = 142/208 (68%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDE 1365
           G++  +L    ATPVF+G N  D+ +A+ EAG+            GK  L DGRTGE F+  V+VG+M+ LKL HMVDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDD  GR NTY AII G  IP+ G+PESF++L K+LQ LGL + +  +  K      K ++E ++++   A +  E
  S:   978 GMAARELGIHIATPVFDGANDQDVWDAVKEAGLP---------SDGKTILYDGRTGEPFEQRVAVGVMHYLKLAHMVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRVNTYQAIIDGDQIPKPGVPESFRVLVKELQSLGLDMKVLDD--KHEEIQLKSMDEDVADVRKLARRGHE 1174
>gi|54026619|ref|YP_120861.1| DNA-directed RNA polymerase subunit beta [Nocardia farcinica IFM 10152] >gi|81373434|sp|Q5YQP4|RPOB1_NOCFA DNA-directed RNA polymerase subunit beta 1 (RNAP subunit beta 1) (Transcriptase subunit beta 1) (RNA polymerase subunit beta 1) >gi|54018127|dbj|BAD59497.1| RNA polymerase beta subunit [Nocardia farcinica IFM 10152] (1162 aa)
Score = 2004, Expect = 0.0e+00, Identities = 417/833 (50%), Positives = 552/833 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRSSW-EFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLE--KILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGK--LGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S++N +P   + KEFF + QL+QF+DQ+NPLA LTNKRR+SA+GPGG+SRE   L++RDVHYSHYG++CPIETPEG NIGL+  L+ YA  +  GF+ TPYR V +G +TDE+ +LTA  ED +++A +N  ++ + +F   ++  R ++S  E  D   VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PLI   APIVGTG E + A D+G   V   EK G V  V    + + +     K Y + KFN+SNQ TC+NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD +L   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIGQILE HLG                          W G   +A   +  N E  K L E+  ++   +N     FD        G   E+L          G+  + L     E  +D  NGK  L +G+S          GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IPE G+PESFK+L K+LQ L L V +
  S:   355 DDIDHFGNRRVRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQSLMNIRPVVAAMKEFFGTSQLSQFMDQRNPLASLTNKRRLSALGPGGLSRERAGLEVRDVHYSHYGRMCPIETPEGPNIGLMGYLSVYARVNPFGFVETPYRRVVDGRVTDEVDYLTADEEDRHVVAQANEPLDAEGRFLAARIPVRRKNSEVELVDSAAVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLIRSEAPIVGTGMELRAAVDAGDVVV--NEKAGVVEEVSADYVTVMADDGTRKSYRMRKFNRSNQGTCSNQRPIVDEGQRVEAGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDDLPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVIGKILPTEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG--------------------------WIG---KAGWKVEGNPEWAKDLPEEMWEAPADSNIATPVFD--------GAREEELT---------GLLGSTLPNRDGERMVDD-NGKAVLFDGRS----------GEPFPYPVAVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPEPGVPESFKVLLKELQALCLNVEV 1121
Score = 224, Expect = 8.1e-16, Identities = 80/277 (28%), Positives = 123/277 (44%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFID------------TE----LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKY 293
           R  +++I +    P LL++Q  +F   I             TE    L   +  I PI+   G  SL     + E+ K S +E +++  TY  P +V    V+N +GE+K  T            +F    PM+T  GTF+VNG E+ V+SQ+VRSPG Y           S K +       ++P++G  +  F  + +D + V       +     P+T  LKALG + E I   F     I  SL  +     D    D L+ + + L   +          L  LF   K+Y
  S:    28 RLSFARIREPLAVPGLLDIQTESFGWLIGAPDWCARAAARGTEPVAGLAEVLAEISPIEDFAGTMSLTLSDPRFEEVKASVEECKDKDLTYAAPWFVTAEFVNNNTGEIKSQT------------VFMGDFPMMTAHGTFVVNGTERVVVSQLVRSPGVYF---DHAIDKGSEKDVHSA---RVIPSRGA-WLEFDVDKRDTLGVRI-----DRKRRQPVTVLLKALGWSAERIAERFGFAPLIMASLAKDNVAGTD----DALLEIHRKLRPGEPPTKESAQNLLANLFFTEKRY 295
Score = 96, Expect = 4.7e-01, Identities = 26/76 (34%), Positives = 40/76 (52%)
  Q:   320 IISEKAAKDLVINLSISTKNIDSKFRLSNKET--TYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAED 395
           +I    AKD V     +   I  K R     T  + Q+++ N FF+ K +DL++ GR+K+ +K+ L      RVL ED
  S:   246 LIMASLAKDNVAGTDDALLEIHRKLRPGEPPTKESAQNLLANLFFTEKRYDLARVGRYKIDKKLGLRAPGAPRVLTED 323
>gi|46361006|gb|AAS89236.1| RpoB [Corynebacterium kroppenstedtii] (1116 aa)
Score = 2003, Expect = 0.0e+00, Identities = 418/853 (49%), Positives = 563/853 (66%)
  Q:   478 TLSISDILSITSYVINLDYD------------IGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIK-IKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           TL+  DIL+   Y++ L               +   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   LD+RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V+NG  TD + +LTA  ED +I+A +N  ++ + +F ED V  R +  + E     +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + AHD+G   +    + G V  V    I  +    +   + L KF ++NQ TC NQ P+V  G+++ +G  +ADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  ED+ TSIHI E+ +D   TK G EEITRDIPN SE     LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L   V + ++VYV QKRKIQ GDK++GRHGNKG++ KI+P EDMP L DGT +D++LN  GVP RMNIGQ+LELHLG+  K                    S W  +  E+    IK + + L E                DL    + S         + ATPVF+G    +L   M  +  +  +G     + GK  LIDGRTGE F   +SVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L
  S:   312 TLTEEDILTTIEYLVRLHAGERTMESPDGTELMIATDDIDHFGNRRLRTVGELVQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGLDVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRVENGQATDVVDYLTADEEDRHIVAQANTKMDSEGRFVEDTVEVRMKGGNVEVVPASEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRNEAPFVGTGMELRAAHDAGDVVI--ARRSGVVETVCADFITTLGDDGQRDTFLLRKFERTNQGTCYNQKPLVEAGDRIEEGQALADGPGTENGEMALGRNLLVAFMPWEGHNYEDAIILNQRIVEEDVLTSIHIEEHEIDARDTKLGPEEITRDIPNASEDILADLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRVFSREDDDDLAPGVNQMVRVYVAQKRKIQDGDKLSGRHGNKGVVGKILPAEDMPFLPDGTPVDVILNTHGVPRRMNIGQVLELHLGMLAK--------------------SGW-KVDPESQDPAIKAMLETLPE----------------DLYDVPADS---------RVATPVFDGTTNEELSGLMRSSRPNR-DGDQMVNEFGKSTLIDGRTGEPFQQPISVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCL 1116
Score = 238, Expect = 1.7e-17, Identities = 73/249 (29%), Positives = 126/249 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFI-------------------DTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI++    P LL+LQ+++F   I                    + LE  ++ + PI+   G  SL     + +  K +  EA+++   Y  PLYV     +  SGE+K  T            +F    PM+T+KGTFI+NG E+ ++SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALGL+ ++I + F   + + ++L+++      V  TDE +
  S:    16 RYSFAKIKEPIEVPGLLDLQRDSFAWLIGAPEWRAKKQAESEEGARITSGLEDILEELSPIEDYSGNMSLTLSEPRFDDVKNTIDEAKDKDINYSAPLYVTAEFTNAMSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVIVSQLVRSPGVYF--DESIDKSTERPL----HSVKVIPSRGA-WLEFDIDKRDTVGVRI-----DRKRRQPVTVLLKALGLSTQDITDRFGFSELMMSTLEHD-----GVANTDEAL 254
>gi|46360934|gb|AAS89200.1| RpoB [Corynebacterium matruchotii] (1112 aa)
Score = 2002, Expect = 0.0e+00, Identities = 410/829 (49%), Positives = 556/829 (67%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF S QL+QF+D  N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +GV+TDE+ +LTA  ED Y++A +N   ++N    ED+V  R +    +  D KD++++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A+D+G   +   +K G V  V    I I      +  Y L KF ++NQ T  NQ P+V  G++V +G  +ADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++RL  EDI TSIHI ++ +D   TK G EEITR+IPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  ED+ +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +D++LN  GVP RMNIGQ+LE+HLG LA     +                     +++ A+  L++ L + L +    SL                             TATPVF+G    ++   +  + +   +G +     GK  L DGR+GE F   VSVG MY+LKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L
  S:   345 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGSSQLSQFMDLNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNSFGFIETPYRKVVDGVVTDEVDYLTADEEDRYVVAQANTKFDENGVITEDRVTVRLKKGDIQVVDGKDINYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAYDAGDLII--SKKAGVVETVCADYITIMGDDGVRDTYMLRKFERTNQGTSYNQKPLVDEGDRVEEGQVVADGPGTHNGEMALGRNLLVAFMPWEGHNYEDAIILNQRLVEEDILTSIHIEQHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRRFSREDEDDLGPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDVILNTHGVPRRMNIGQVLEVHLGWLAAAGWKVD--------------------VNDPANAKLLETLPEDLYDVPAGSL-----------------------------TATPVFDGATNDEIAGLLANS-LPNRDGDVMVNADGKAQLFDGRSGEPFPYPVSVGYMYILKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCL 1111
Score = 252, Expect = 4.0e-19, Identities = 72/235 (30%), Positives = 119/235 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           R+ ++KI+     P LL++Q  +F   I +                    LE  ++ + PI+   G  SL     + E+ K S  E +++   Y  PLYV    ++NE+ E+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + + ++L+N+
  S:    14 RKSFAKIQSPIEVPGLLDIQLESFAWLIGSPEWRARRQAELGEDVRVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEEMKNSIDECKDKDINYSAPLYVTAEFINNETQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQIVERFGFSEIMMSTLEND 243
>gi|148544705|ref|YP_001272075.1| DNA-directed RNA polymerase subunit beta [Lactobacillus reuteri F275] >gi|172048240|sp|A5VLL4|RPOB_LACRF DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|148531739|gb|ABQ83738.1| DNA-directed RNA polymerase, beta subunit [Lactobacillus reuteri F275] (1202 aa)
Score = 2001, Expect = 0.0e+00, Identities = 451/1104 (40%), Positives = 667/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGT-DTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS-GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR YS+I++    PNL+ +Q ++++ F++  L      I PI    G+ SLE++  +L +PK +  EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y   ++        K  +  Y    +P +G  L +   A+N  ++++       + T  +P+T  ++ALG   +                             DE+I++            +G D++   L     +L   +    KNAE  +           E+A KD+   L     K  DS           +S++   FF  K +D++  GR+K  +K+ L  RL  + LAE L D + G+V+ +K   + K  L+ ++          +     DE +  +   VK +KI VY  ND  D  +PIIG     L+   +  +DIL+  +Y  NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D                ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  K+  +TD+I +LTA  ED +IIA +N  + +   F +D+V+ R +  +    V+++D++D+SPKQVVS+A++ IPFLENDD+NRALMGANMQRQA PLI+P AP+V TG +YK AHDSG+A +   +K GTV YVD   ++++        Y+L KF +SN     NQ PIV VGE V     +ADGP+M  GELALGQN L+AF TW GYN+EDAI +++RL  +D++TSIHI  Y  +  +TK G EE+TR+IPNV + + K LD+ GI+ VGAEV +GD+LVGK++PKG  EL++EE+LL AIFG+KS+  ++TSL+VPHGG G +  VK F  E+  EL+  V   ++VY+ QKRKIQ+GDKM+GRHGNKG +S +VP EDMP++ DGT IDIML+P+GVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    10 KHRTRRSYSRIKEVLELPNLIEIQTDSYNWFMEKGLREMFDDIMPIDDFQGKLSLEFVDYQLLEPKYTVDEAREHDANYSAPLHVTLRLTNHETGEIK------------SQDVFFGDFPLMTDQGTFIINGAERVIVSQLVRSPGVYYSEEND-------KNGRPNYGATFIPNRGAWLEYETDAKNVSYVRI-------DRTRKLPMTELIRALGFGSD-----------------------------DEIIDM------------FGGDSETLSL-----TLDKDVH---KNAEDSR----------VEEALKDIYERLRPGEPKTADSA----------RSLLTARFFDPKRYDMAPVGRYKTNKKLMLKYRLLGQTLAETLADPDTGEVLAQKGDTVTKELLNKLEPYLDRDDFKTITYTPSDEAV--VTEPVKLQKILVYSKNDP-DRVVPIIGNGHIPLEYKHIEPADILASLNYFFNLQEGIGSTDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------PDTVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLSSYARVNKYGFIETPYRRVSWKDHKVTDKIDYLTADEEDNFIIAQANTPLNDDGSFVDDQVMARDKDDYIETSVENIDYMDVSPKQVVSVASACIPFLENDDSNRALMGANMQRQAVPLINPHAPLVSTGIDYKAAHDSGVAMI--AKKPGTVEYVDAREVRVREEDGTLDTYKLMKFRRSNGGKNYNQRPIVKVGEHVDADDVLADGPSMEQGELALGQNPLIAFMTWQGYNFEDAIAINERLVKDDVYTSIHIESYESEARETKLGPEEMTREIPNVGDDALKDLDENGIVRVGAEVHDGDILVGKVTPKGMTELSAEERLLHAIFGEKSREVRDTSLRVPHGGGGIIQDVKVFTRENGDELSPGVNTMVRVYIAQKRKIQVGDKMSGRHGNKGTVSIVVPEEDMPYMPDGTPIDIMLSPMGVPSRMNIGQLLELHLGMAARRLGIHMATPVF---DGASDKDVWDAVRE 1004
Score = 507, Expect = 1.2e-48, Identities = 104/201 (51%), Positives = 138/201 (68%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITN 1358
           G++  +L    ATPVF+G +  D+ +A+ E+G           + GK  L DGRTGE F+  ++VG M+ LKL HMVDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDD  GR  TY+AII G+PIP+ G+PESF++L K+LQ LGL + +    G       K+++E    + N
  S:   975 GMAARRLGIHMATPVFDGASDKDVWDAVRESGFP---------EDGKTILYDGRTGEPFENRIAVGSMHYLKLAHMVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRVRTYDAIINGQPIPKPGVPESFRVLVKELQALGLDMKVLD--GNNKEIQLKNMDEDDDEVVN 1164
>gi|154705562|gb|ABS84207.1| DNA-directed RNA polymerase beta subunit [Lactobacillus reuteri] (1202 aa)
Score = 2000, Expect = 0.0e+00, Identities = 450/1104 (40%), Positives = 666/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGT-DTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS-GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR YS+I++    PNL+ +Q ++++ F++  L      I PI    G+ SLE++  +L +PK +  EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y   ++        K  +  Y    +P +G  L +   A+N  ++++       + T  +P+T  ++ALG   +                             DE+I++            +G D++   L     +L   +    KNAE  +           E+A KD+   L     K  DS           +S++   FF  K +D++  GR+K  +K+ L  RL  + LAE L D + G+V+ +K   + K  L+ ++          +     DE +  +   VK +KI VY   D  D  +PIIG     L+   +  +DIL+  +Y  NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D                ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  K+  +TD+I +LTA  ED +IIA +N  + +   F +D+V+ R +  +    V+++D++D+SPKQVVS+A++ IPFLENDD+NRALMGANMQRQA PLI+P AP+V TG +YK AHDSG+A +   +K GTV YVD   ++++        Y+L KF +SN     NQ PIV VGE V     +ADGP+M  GELALGQN L+AF TW GYN+EDAI +++RL  +D++TSIHI  Y  +  +TK G EE+TR+IPNV + + K LD+ GI+ VGAEV +GD+LVGK++PKG  EL++EE+LL AIFG+KS+  ++TSL+VPHGG G +  VK F  E+  EL+  V   ++VY+ QKRKIQ+GDKM+GRHGNKG +S +VP EDMP++ DGT IDIML+P+GVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    10 KHRTRRSYSRIKEVLELPNLIEIQTDSYNWFMEKGLREMFDDIMPIDDFQGKLSLEFVDYQLLEPKYTVDEAREHDANYSAPLHVTLRLTNHETGEIK------------SQDVFFGDFPLMTDQGTFIINGAERVIVSQLVRSPGVYYSEEND-------KNGRPNYGATFIPNRGAWLEYETDAKNVSYVRI-------DRTRKLPMTELIRALGFGSD-----------------------------DEIIDM------------FGGDSETLSL-----TLDKDVH---KNAEDSR----------VEEALKDIYERLRPGEPKTADSA----------RSLLTARFFDPKRYDMAPVGRYKTNKKLMLKYRLLGQTLAETLADPDTGEVLAQKGDTVTKELLNKLEPYLHRDDFKTITPTPPDEAV--VTEPVKLQKILVYSKTDP-DRVVPIIGNGHIPLEYKHIEPADILASLNYFFNLQEGIGSTDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------PDTVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLSSYARVNKYGFIETPYRRVSWKDHKVTDKIDYLTADEEDNFIIAQANTPLNDDGSFVDDQVMARDKDDYIETSVENIDYMDVSPKQVVSVASACIPFLENDDSNRALMGANMQRQAVPLINPHAPLVSTGIDYKAAHDSGVAMI--AKKPGTVEYVDAREVRVREEDGTLDTYKLMKFRRSNGGKNYNQRPIVKVGEHVDADDVLADGPSMEQGELALGQNPLIAFMTWQGYNFEDAIAINERLVKDDVYTSIHIESYESEARETKLGPEEMTREIPNVGDDALKDLDENGIVRVGAEVHDGDILVGKVTPKGMTELSAEERLLHAIFGEKSREVRDTSLRVPHGGGGIIQDVKVFTRENGDELSPGVNTMVRVYIAQKRKIQVGDKMSGRHGNKGTVSIVVPEEDMPYMPDGTPIDIMLSPMGVPSRMNIGQLLELHLGMAARRLGIHMATPVF---DGASDKDVWDAVRE 1004
Score = 508, Expect = 8.7e-49, Identities = 104/201 (51%), Positives = 138/201 (68%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITN 1358
           G++  +L    ATPVF+G +  D+ +A+ E+G           + GK  L DGRTGE F+  ++VG M+ LKL HMVDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDD  GR  TY+AII G+PIP+ G+PESF++L K+LQ LGL + +    G       K+++E    + N
  S:   975 GMAARRLGIHMATPVFDGASDKDVWDAVRESGFP---------EDGKTILYDGRTGEPFENRIAVGSMHYLKLAHMVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRVRTYDAIINGQPIPKPGVPESFRVLVKELQALGLDMKVLD--GNNKEIQLKNMDEDDDEVVN 1164
>gi|184154057|ref|YP_001842398.1| DNA-directed RNA polymerase beta subunit [Lactobacillus reuteri F275] >gi|183225401|dbj|BAG25918.1| DNA-directed RNA polymerase beta subunit [Lactobacillus reuteri F275] (1205 aa)
Score = 1999, Expect = 0.0e+00, Identities = 451/1104 (40%), Positives = 667/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGT-DTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS-GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR YS+I++    PNL+ +Q ++++ F++  L      I PI    G+ SLE++  +L +PK +  EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y   ++        K  +  Y    +P +G  L +   A+N  ++++       + T  +P+T  ++ALG   +                             DE+I++            +G D++   L     +L   +    KNAE  +           E+A KD+   L     K  DS           +S++   FF  K +D++  GR+K  +K+ L  RL  + LAE L D + G+V+ +K   + K  L+ ++          +     DE +  +   VK +KI VY  ND  D  +PIIG     L+   +  +DIL+  +Y  NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D                ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  K+  +TD+I +LTA  ED +IIA +N  + +   F +D+V+ R +  +    V+++D++D+SPKQVVS+A++ IPFLENDD+NRALMGANMQRQA PLI+P AP+V TG +YK AHDSG+A +   +K GTV YVD   ++++        Y+L KF +SN     NQ PIV VGE V     +ADGP+M  GELALGQN L+AF TW GYN+EDAI +++RL  +D++TSIHI  Y  +  +TK G EE+TR+IPNV + + K LD+ GI+ VGAEV +GD+LVGK++PKG  EL++EE+LL AIFG+KS+  ++TSL+VPHGG G +  VK F  E+  EL+  V   ++VY+ QKRKIQ+GDKM+GRHGNKG +S +VP EDMP++ DGT IDIML+P+GVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    13 KHRTRRSYSRIKEVLELPNLIEIQTDSYNWFMEKGLREMFDDIMPIDDFQGKLSLEFVDYQLLEPKYTVDEAREHDANYSAPLHVTLRLTNHETGEIK------------SQDVFFGDFPLMTDQGTFIINGAERVIVSQLVRSPGVYYSEEND-------KNGRPNYGATFIPNRGAWLEYETDAKNVSYVRI-------DRTRKLPMTELIRALGFGSD-----------------------------DEIIDM------------FGGDSETLSL-----TLDKDVH---KNAEDSR----------VEEALKDIYERLRPGEPKTADSA----------RSLLTARFFDPKRYDMAPVGRYKTNKKLMLKYRLLGQTLAETLADPDTGEVLAQKGDTVTKELLNKLEPYLDRDDFKTITYTPSDEAV--VTEPVKLQKILVYSKNDP-DRVVPIIGNGHIPLEYKHIEPADILASLNYFFNLQEGIGSTDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------PDTVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLSSYARVNKYGFIETPYRRVSWKDHKVTDKIDYLTADEEDNFIIAQANTPLNDDGSFVDDQVMARDKDDYIETSVENIDYMDVSPKQVVSVASACIPFLENDDSNRALMGANMQRQAVPLINPHAPLVSTGIDYKAAHDSGVAMI--AKKPGTVEYVDAREVRVREEDGTLDTYKLMKFRRSNGGKNYNQRPIVKVGEHVDADDVLADGPSMEQGELALGQNPLIAFMTWQGYNFEDAIAINERLVKDDVYTSIHIESYESEARETKLGPEEMTREIPNVGDDALKDLDENGIVRVGAEVHDGDILVGKVTPKGMTELSAEERLLHAIFGEKSREVRDTSLRVPHGGGGIIQDVKVFTRENGDELSPGVNTMVRVYIAQKRKIQVGDKMSGRHGNKGTVSIVVPEEDMPYMPDGTPIDIMLSPMGVPSRMNIGQLLELHLGMAARRLGIHMATPVF---DGASDKDVWDAVRE 1007
Score = 506, Expect = 1.3e-48, Identities = 104/201 (51%), Positives = 138/201 (68%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITN 1358
           G++  +L    ATPVF+G +  D+ +A+ E+G           + GK  L DGRTGE F+  ++VG M+ LKL HMVDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDD  GR  TY+AII G+PIP+ G+PESF++L K+LQ LGL + +    G       K+++E    + N
  S:   978 GMAARRLGIHMATPVFDGASDKDVWDAVRESGFP---------EDGKTILYDGRTGEPFENRIAVGSMHYLKLAHMVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRVRTYDAIINGQPIPKPGVPESFRVLVKELQALGLDMKVLD--GNNKEIQLKNMDEDDDEVVN 1167
>gi|34391559|gb|AAN65357.1| RpoB [Mycobacterium mucogenicum] (1167 aa)
Score = 1999, Expect = 0.0e+00, Identities = 433/942 (45%), Positives = 599/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYE---KINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL-DYDIGF-----------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+   K+ ++  N +Q            +   TL+  DI++   Y++ L D D               DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +G++TD+I +LTA  ED +++A +N  ++ N  F E+K+L R +    EF    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V  D  T+    GS    Y + KFN+SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP + DGT +DI+LN  GVP                 +++ + ++LE +             G   +A  N+    E   N                    L        R+ ++   ATPVF+G    +L + +  A +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    +++ +D+    +N+  N  +N+
  S:   278 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHDGNPAQ------------VTATTLTEEDIVATIEYLVRLHDGDTKMTAPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGIVTDQIDYLTADEEDRHVVAQANSPLDANGHFTEEKILVRRKGGEVEFVSANDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KSGVIEEVSADYVTVMADDGSRH-TYRMRKFNRSNHGTCANQRPIVDSGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPQEDMPFMPDGTPVDIILNTHGVP-----------------RRMNIGQILETH------------LGWVAKAGWNIEGEPEWAAN--------------------LPEGMRSAPRDSIV---ATPVFDGARENEL-QGLLGATLPNRDGDVMVDADGKSQLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDSDDEDLERTAANLGINLSRNE 1159
Score = 250, Expect = 7.3e-19, Identities = 77/276 (27%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I ++                 LE  +  + PI+   G  SL +   + ++ K    E + + +TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + K+  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    28 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSDRWRSKAVDRGDINPVGGLEEVLAELSPIEDFAGTLSLSFSDPRFDEVKAPVDECKEKDQTYAAPLFVTAEFINNTTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKATEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIRERFGFSEIMMGTLEKDPTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 292
>gi|34391561|gb|AAN65358.1| RpoB [Mycobacterium mucogenicum] (1167 aa)
Score = 1998, Expect = 0.0e+00, Identities = 433/942 (45%), Positives = 600/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYE---KINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL-DYDIGF-----------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+   K+ ++  N +Q            +   TL+  DI++   Y++ L D D               DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +G++TD+I +LTA  ED +++A +N  ++ N  F E+K+L R +    EF    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V  D  T+    GS    Y + KFN+SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP + DGT +DI+LN  GVP                 +++ + ++LE +             G   +A  N+    E   N                    L        R+ ++   ATPVF+G    +L + +  A +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    +++ +D+    +N+  N  +N+
  S:   278 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHDGNPAQ------------VTATTLTEEDIVATIEYLVRLHDGDKTMTAPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGIVTDQIDYLTADEEDRHVVAQANSPLDANGHFTEEKILVRRKGGEVEFVSANDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KSGVIEEVSADYVTVMADDGSRH-TYRMRKFNRSNHGTCANQRPIVDSGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPQEDMPFMPDGTPVDIILNTHGVP-----------------RRMNIGQILETH------------LGWVAKAGWNIEGEPEWAAN--------------------LPEGMRSAPRDSIV---ATPVFDGARENEL-QGLLGATLPNRDGEVMVDADGKSQLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDSDDEDLERTAANLGINLSRNE 1159
Score = 250, Expect = 6.5e-19, Identities = 77/276 (27%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I ++                 LE  +  + PI+   G  SL +   + ++ K    E + + +TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + K+  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    28 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSDRWRSKAVDRGDINPVGGLEEVLAELSPIEDFAGTLSLSFSDPRFDEVKAPVDECKEKDQTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKATEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIRERFGFSEIMMGTLEKDPTAGPD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 292
>gi|149072056|ref|YP_001293553.1| RNA polymerase beta' chain [Rhodomonas salina] >gi|158513797|sp|A6MVX4|RPOB_RHDSA DNA-directed RNA polymerase subunit beta (PEP) (Plastid-encoded RNA polymerase subunit beta) (RNA polymerase subunit beta) >gi|134303007|gb|ABO70811.1| RNA polymerase beta' chain [Rhodomonas salina] (1097 aa)
Score = 1997, Expect = 0.0e+00, Identities = 420/858 (48%), Positives = 563/858 (65%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNG-VITD-EIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L+  D LS   Y+INL ++IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ I D               +SL   +++N KP   + +EFF S QL+QF+DQ NPLAELT+KRRISA+GPGG++R+     +RD+H SHYG+ICPIETPEG N GLI  LAT+A  +  GF+ TP+  V NG V++D    +LTA  ED + IA  ++ + E N    D V  RYR  +     + +D+I +SP QV+SIA S IPFLE+DDANRALMG+NMQRQA PL+ P +P++GTG E + A DSGM  V    +DG V+YV    I I     +E VY L K+ +SNQ+TC NQ P V +GEKV  G  IADG A   GELALGQN+L+A+  W GYNYEDA ++S+RL   D++TS+HI +Y ++  +TK G EEITR++PN+ E S + LDD GII++G+ V+ GD+LVGK++PKG+ +   E KLL+AIFG+K+++ ++TSL+VP+GG G V  V+ F  E   EL       I+VYV Q RKIQ+GDKMAGRHGNKGIIS+I+P +DMP+L DGT +D++LNPLGVPSRMN+GQI E  LGLA + L   +   + +D+   +          EASR L+       NEK +++     K++  FDL               +   T +F+G                                   RTGE FD  V+VGI YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q+GGQR GEMEVWALEA+GA++ L+ELLT+KSDD++GRN T NAI+KGKPIP  G PESFK+L ++LQ LGL +   K
  S:   276 LTPQDTLSAIDYLINLKFNIGETDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTICD--------------SESLAPNTLVNPKPIIAAIREFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLNRDRAGFAVRDIHPSHYGRICPIETPEGPNAGLIGVLATHARINSYGFIETPFYQVINGKVVSDGNPVYLTADQEDNFRIAPGDIAIDENNAINNDIVPVRYRQEFTITKPEQIDYIQVSPIQVISIATSLIPFLEHDDANRALMGSNMQRQAVPLLYPESPLIGTGIEAQAARDSGMVVV--SYQDGRVTYVSANKICITDDEGKEVVYYLQKYQRSNQDTCINQRPSVWLGEKVVAGQVIADGAATEGGELALGQNILIAYLPWEGYNYEDAFLISERLVYNDVYTSVHIEKYEIEARQTKLGSEEITRELPNIGEYSLRKLDDNGIIVIGSWVEVGDILVGKVTPKGESDQPPEGKLLRAIFGEKARDVRDTSLRVPNGGRGRVLDVRIFTREKGDELPTGANIVIRVYVAQTRKIQVGDKMAGRHGNKGIISRILPRQDMPYLPDGTPVDLVLNPLGVPSRMNVGQIFECLLGLAAENLD-KRFKIIPFDEMNGA----------EASRVLV-------NEKLMEARTLTEKDWI-FDLR--------------HPGKTQLFDG-----------------------------------RTGEAFDNPVTVGISYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQHGGQRLGEMEVWALEAFGASYTLQELLTVKSDDMQGRNETLNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIGAYK 1053
Score = 231, Expect = 1.0e-16, Identities = 65/222 (29%), Positives = 110/222 (49%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           P+L+ +Q+ +F  F++  L   IKS  PI    G   L + G   KL+ PK +  E++    TY   +YV   +++ ++G +K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   KS+      R      Y   ++  +G  +  F  +  D + V       + T  IP   FLKA+GL+  +I N   + + +K S   E
  S:    12 PDLVEIQRASFCWFLEEGLAEEIKSFSPITDYTGNLELHFFGDQFKLKCPKYNLLESKRRDATYSVQVYVPARLINRDTGIIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGIYY--KSETDRQGRRT-----YSGSLISNRGA-WVKFETDRNDLVWVRI-----DKTRKIPAHVFLKAMGLSDSDIYNGLRHPEYLKKSFRVE 210
>gi|46361028|gb|AAS89247.1| RpoB [Rhodococcus equi] (1118 aa)
Score = 1997, Expect = 0.0e+00, Identities = 435/912 (47%), Positives = 585/912 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSL--DKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFG-------IHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           TKE    ++ N+   ++   +A V +Y KIN              +G +T L  +  TL+  DI++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V+NG +TD++ +LTA  ED +++A +N  V+ N +F ED+VL R +    EF    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V  D  T+    GS    Y L KF +SNQ TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD +L   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP R                 + + +VLE +           W G       I  + SR    +    L E+ + +   +N                          ATPVF+G    +L   +  + +   +G+   G  GK  L DGR+GE F   VSVG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +
  S:   266 TKESAQTLLENLFFKDKRYDLARVGRY-KIN------------KKLGLNTGLPIEASTLTEDDIVTTIEYLVRLHAGDTMMTAPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGQLTDQVDYLTADEEDRHVVAQANSPVDANGRFTEDRVLVRRKGGEVEFVSSSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAVDAGDVIV--TEKTGVVEEVSSDYVTVMADDGSR-TTYRLRKFARSNQGTCANQRPIVDEGQRVEAGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDDLPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRR-----------------MNIGQVLETHLG---------WIGKTGWNVQIAGDGSR---PDWAATLPEEMLSAPADSN-------------------------IATPVFDGAKEDELT-GLLGSTLPNRDGERMVGPDGKATLFDGRSGEPFPYPVSVGYMYIIKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEV 1117
Score = 264, Expect = 1.8e-20, Identities = 80/276 (28%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++KI +    P LL+LQ ++F   + +                  LE  +  + PI+   G  SL +   + ++ K S  E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG+  EEI   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    16 RVSFAKIREPLEVPGLLDLQTDSFEWLVGSPSWRERAAARRDGAVTGGLEEILAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTTLLKALGMTDEEIRERFGFSEIMMATLEKDPAKNTD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 280
>gi|72163053|ref|YP_290710.1| DNA-directed RNA polymerase subunit beta [Thermobifida fusca YX] >gi|88909644|sp|Q47LI5|RPOB_THEFY DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|71916785|gb|AAZ56687.1| DNA-directed RNA polymerase, beta subunit [Thermobifida fusca YX] (1155 aa)
Score = 1995, Expect = 0.0e+00, Identities = 435/917 (47%), Positives = 580/917 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL------------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           TKE    ++ N+  + +   +A V +Y KIN              +G +  + + TL+  DI++   Y++ L             + I   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S +EFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI SLA YA  +  GF+ TPYR V +G ITDE+ +LTA  ED Y+IA +N  V  +  F E +VL R R   EF  V  ++V ++DISP+Q+VS+A + IPFLE+DDANRALMG+NMQRQA PL+   AP+VGTG EY+ A D+G   V   EK G V  V    I +       K Y + KF ++NQ TC NQ PIV  G++V +G  +ADGP+   GE+ALG+N+LVA+ +W G+NYEDAI+LS+RL  EDI +SIHI E+ VD  +TK G EEITR+IPNVSE     LD+ GII +GAEV +GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  E+  EL   V E ++VYV QKRKI  GDK+AGRHGNKG+I+KI+P EDMP LEDGT +DI+LNPLGVP R                 + + +++E++           W   H                            E  D +    L   G        K ATPVF+G  R D    +    +   +G +   K GK  L DGRTGE F   V+VG  Y LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD+ GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G
  S:   271 TKEAAQALLENLYFNPKRYDLAKVGRY-KIN------------KKLGLEIDITQGTLTEEDIVATVDYLVRLHAGEKELVRPHGTFPIEV-DDIDHFGNRRLRTVGELIQNQVRLGLARMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIREFFGTSQLSQFMDQTNPLAGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLAAYARVNSFGFIETPYRKVVDGRITDEVVYLTADEEDRYVIAQANTPVNPDGTFAESQVLAR-RKGGEFESVAAEEVHYMDISPRQMVSVATAMIPFLEHDDANRALMGSNMQRQAVPLLRAEAPLVGTGMEYRAATDAG--DVILAEKSGVVEDVTADYITVLADDGTRKTYRVHKFRRTNQGTCFNQRPIVEEGQRVEEGQVLADGPSTEAGEMALGKNLLVAYMSWEGHNYEDAIVLSQRLVEEDILSSIHIEEHEVDARETKLGPEEITREIPNVSEEVLADLDERGIIRIGAEVVDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREEGDELPPGVNELVRVYVAQKRKITDGDKLAGRHGNKGVIAKILPKEDMPFLEDGTPVDIVLNPLGVPGR-----------------MNIGQIMEMHLG---------WLAKH------------------------GWKVEGDDAEWKRRLRDIGAHEAPPNSKVATPVFDGA-REDEISGLLSCVLPDQDGDILVNKFGKAKLYDGRTGEPFKEPVAVGYAYFLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDINGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSRDG 1121
Score = 309, Expect = 1.0e-25, Identities = 87/281 (30%), Positives = 144/281 (51%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  +++I++    PNLL LQ  +F   +  E                      LE   + I PI+   G  SL +   + E PK SE+E +++  TY  P++V    ++N++GE+K  T            +F    P++T KGTFI+NG E+ V+SQ+VRSPG Y    SQ+  S+ +    E Y C+I+P++G  +  F  + +DF+ V       +      +T  LKALG   ++IL  F  ++SI+ +L+ +     D    D L+++ + L   +          L  L+   K+Y   K
  S:    16 RVSFARIKEPLEVPNLLALQTESFDWLLGNERWRARVEAARKAGRKDIPEQSGLEEIFEEISPIEDFSGTMSLSFRDHRFEPPKYSEEECKDKDMTYSAPMFVTAEFINNDTGEIKSQT------------VFMGDFPLMTAKGTFIINGTERVVVSQLVRSPGVYF--DSQMDKSSDK----ELYGCKIIPSRGA-WLEFEIDKRDFVGVRI-----DRKRKQAVTILLKALGWTTDQILERFGEYESIRATLEKDPTAGTD----DALLDIYRKLRPGEPPTKEAAQALLENLYFNPKRYDLAK 293
>gi|34595743|gb|AAQ76594.1| RpoB [Mycobacterium smegmatis] (1169 aa)
Score = 1995, Expect = 0.0e+00, Identities = 417/863 (48%), Positives = 563/863 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLE--LYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V+NGV+TD+I +LTA  ED +++A +N   ++N +F ED+V+ R +    EF     VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V    I + +     + Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP R                 + + ++LE  L +  K   +  +  G+ + AS             K  + L  A  + T                      ATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   359 DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRHVVAQANSPTDENGRFTEDRVMVRKKGGEVEFVSADQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KTGVIEEVSADYITVMADDGTRQSYRLRKFARSNHGTCANQRPIVDAGQRVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRR-----------------MNIGQILETHLGWVAKAGWNIDVAAGVPDWAS-------------KLPEELYSAPADST---------------------VATPVFDGAQEGELA-GLLGSTLPNRDGEVMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1161
Score = 264, Expect = 1.9e-20, Identities = 78/276 (28%), Positives = 135/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  +  + PI+   G  SL +   + ++ K S  E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +  +  D    + L+++ + L   +        T L  LF K
  S:    29 RVSFAKLREPLEVPGLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEVLAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDTTSGTD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 293
>gi|62720654|gb|AAX93863.1| RNA polymerase subunit B [Mycobacterium barrassiae] (1167 aa)
Score = 1995, Expect = 0.0e+00, Identities = 430/942 (45%), Positives = 594/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL---DYDIGF---------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L   D  +            DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR VK+GV+TD+I +LTA  ED +++A +N    EK +F E++VL R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP R                 + + ++LE +      + + +      + S +   NL + + E +  ++                              +TPVF+G    +L + +  A +   +G       GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   280 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHQGDQTMTAPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVKDGVVTDDIEYLTADEEDRHVVAQANSPTDEKGRFLEERVLVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KAGVIEEVSADYITVMADDGTRHTYRMRKFARSNHGTCANQRPIVDAGDRVEAGQVIADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRR-----------------MNIGQILETHLGWAAKAGWKI------DGSPDWAANLPEEMLEVEPNTI-----------------------------VSTPVFDGAREAEL-QGLLSATLPNRDGDTLVDGDGKAQLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1159
Score = 255, Expect = 2.1e-19, Identities = 80/276 (28%), Positives = 134/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   I ++                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    29 RISFAKLREPLEVPGLLDVQTESFEWLIGSDRWRENAKLRGDAIEPVGGLEEVLTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 294
>gi|194466962|ref|ZP_03072949.1| DNA-directed RNA polymerase, beta subunit [Lactobacillus reuteri 100-23] >gi|194453998|gb|EDX42895.1| DNA-directed RNA polymerase, beta subunit [Lactobacillus reuteri 100-23] (1202 aa)
Score = 1995, Expect = 0.0e+00, Identities = 450/1104 (40%), Positives = 666/1104 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSIST-KNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGT-DTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS-GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           K+  RR YS+I++    PNL+ +Q ++++ F++  L      I PI    G+ SLE++  +L +PK +  EAR     Y  PL+V L + ++E+GE+K            +  +FF   P++T++GTFI+NG E+ ++SQ+VRSPG Y   ++        K  +  Y    +P +G  L +   A+N  ++++       + T  +P+T  ++ALG   +                             DE+I++            +G D++   L     +L   +    KNAE  +           E+A KD+   L     K  DS           +S++   FF  K +D++  GR+K  +K+ L  RL  + LAE L D + G+V+ +K   + K  L+ ++          +     DE +  +   VK +KI VY   D  D  +PIIG     L+   +  +DIL+  +Y  NL   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D                ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SL++YA  ++ GF+ TPYR V  K+  +TD+I +LTA  ED +IIA +N  + +   F +D+V+ R +  +    V+++D++D+SPKQVVS+A++ IPFLENDD+NRALMGANMQRQA PLI+P AP+V TG +YK AHDSG+A +   +K GTV YVD   ++++        Y+L KF +SN     NQ PIV VGE V     +ADGP+M  GELALGQN L+AF TW GYN+EDAI +++RL  +D++TSIHI  Y  +  +TK G EE+TR+IPNV + + K LD+ GI+ VGAEV +GD+LVGK++PKG  EL++EE+LL AIFG+KS+  ++TSL+VPHGG G +  VK F  E+  EL+  V   ++VY+ QKRKIQ+GDKM+GRHGNKG +S +VP EDMP++ DGT IDIML+P+GVPSRMNIGQ+LELHLG+A ++L +     ++     ASD  +W  + E
  S:    10 KHRTRRSYSRIKEVLELPNLIEIQTDSYNWFMEKGLREMFDDIMPIDDFQGKLSLEFVDYQLLEPKYTVDEAREHDANYSAPLHVTLRLTNHETGEIK------------SQDVFFGDFPLMTDQGTFIINGAERVIVSQLVRSPGVYYSEEND-------KNGRPNYGATFIPNRGAWLEYETDAKNVSYVRI-------DRTRKLPMTELIRALGFGSD-----------------------------DEIIDM------------FGGDSETLSL-----TLDKDVH---KNAEDSR----------VEEALKDIYERLRPGEPKTADSA----------RSLLTARFFDPKRYDMAPVGRYKTNKKLMLKYRLLGQTLAETLADPDTGEVLAQKGDTVTKELLNKLEPYLDRDDFKTITYTPSDEAV--VTEPVKLQKILVYSKTDP-DRVVPIIGNGHIPLEYKHIEPADILASLNYFFNLQEGIGSTDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQD--------------PDTVTPQQLINIRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINSLSSYARVNKYGFIETPYRRVSWKDHKVTDKIDYLTADEEDNFIIAQANTPLNDDGSFVDDQVMARDKDDYIETSVENIDYMDVSPKQVVSVASACIPFLENDDSNRALMGANMQRQAVPLINPHAPLVSTGIDYKAAHDSGVAMI--AKKPGTVEYVDAREVRVREEDGTLDTYKLMKFRRSNGGKNYNQRPIVKVGEHVDADDVLADGPSMEQGELALGQNPLIAFMTWQGYNFEDAIAINERLVKDDVYTSIHIESYESEARETKLGPEEMTREIPNVGDDALKDLDENGIVRVGAEVHDGDILVGKVTPKGMTELSAEERLLHAIFGEKSREVRDTSLRVPHGGGGIIQDVKVFTRENGDELSPGVNTMVRVYIAQKRKIQVGDKMSGRHGNKGTVSIVVPEEDMPYMPDGTPIDIMLSPMGVPSRMNIGQLLELHLGMAARRLGIHMATPVF---DGASDKDVWDAVRE 1004
Score = 507, Expect = 1.2e-48, Identities = 104/201 (51%), Positives = 138/201 (68%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITN 1358
           G++  +L    ATPVF+G +  D+ +A+ E+G           + GK  L DGRTGE F+  ++VG M+ LKL HMVDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDD  GR  TY+AII G+PIP+ G+PESF++L K+LQ LGL + +    G       K+++E    + N
  S:   975 GMAARRLGIHMATPVFDGASDKDVWDAVRESGFP---------EDGKTILYDGRTGEPFENRIAVGSMHYLKLAHMVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRVRTYDAIINGQPIPKPGVPESFRVLVKELQALGLDMKVLD--GNNKEIQLKNMDEDDDEVVN 1164
>gi|41410228|ref|NP_963064.1| DNA-directed RNA polymerase subunit beta [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41399062|gb|AAS06680.1| RpoB [Mycobacterium avium subsp. paratuberculosis K-10] (1198 aa)
Score = 1994, Expect = 0.0e+00, Identities = 414/863 (47%), Positives = 559/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TDEI +LTA  ED +++A +N  ++ K +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIG                 ++LE +             G   ++  N+  N E  +N  +     Q N+                         +TPVF+G    +L   M    +   +G++     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   391 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDEIHYLTADEEDRHVVAQANSPIDDKGRFAEARVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKSGVIEEVSADYITVMADDGTRHTYRMRKFERSNHGTCANQSPIVDAGDRVEAGQVIADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIG-----------------QILETH------------LGWVAKSGWNIDGNPEWAVNLPEELRHAQPNQ-----------------------IVSTPVFDGAKEEELA-GMLSCTLPNRDGEVMVDGDGKAVLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1190
Score = 256, Expect = 1.6e-19, Identities = 81/276 (29%), Positives = 137/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFI-------------DTELEGTIKSIF----PIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I             D E +G ++ +     PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    61 RVSFAKLREPLEVPGLLDVQIDSFEWLIGAPRWREAAIARGDAEPKGGLEEVLDELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMSTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 325
>gi|118468129|ref|YP_885753.1| DNA-directed RNA polymerase subunit beta [Mycobacterium smegmatis str. MC2 155] >gi|41017600|sp|P60281|RPOB2_MYCS2 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|38174793|emb|CAE53837.1| RNA polymerase, beta subunit [Mycobacterium smegmatis] >gi|118169416|gb|ABK70312.1| DNA-directed RNA polymerase, beta subunit [Mycobacterium smegmatis str. MC2 155] (1169 aa)
Score = 1994, Expect = 0.0e+00, Identities = 417/863 (48%), Positives = 563/863 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLE--LYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V+NGV+TD+I +LTA  ED +++A +N   ++N +F ED+V+ R +    EF     VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V    I + +     + Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP R                 + + ++LE  L +  K   +  +  G+ + AS             K  + L  A  + T                      ATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   359 DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRHVVAQANSPTDENGRFTEDRVMVRKKGGEVEFVSADQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KTGVIEEVSADYITVMADDGTRQSYRLRKFARSNHGTCANQRPIVDAGQRVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRR-----------------MNIGQILETHLGWVAKAGWNIDVAAGVPDWAS-------------KLPEELYSAPADST---------------------VATPVFDGAQEGELA-GLLGSTLPNRDGEVMVDADGKSTLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1161
Score = 264, Expect = 1.9e-20, Identities = 78/276 (28%), Positives = 135/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  +  + PI+   G  SL +   + ++ K S  E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +  +  D    + L+++ + L   +        T L  LF K
  S:    29 RVSFAKLREPLEVPGLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEVLAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDTTSGTD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 293
>gi|177667708|ref|ZP_02943214.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 8801] >gi|196246167|ref|ZP_03144887.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 8802] >gi|172073531|gb|EDT58955.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 8801] >gi|196205806|gb|EDY00605.1| DNA-directed RNA polymerase, beta subunit [Cyanothece sp. PCC 8802] (1103 aa)
Score = 1994, Expect = 0.0e+00, Identities = 416/858 (48%), Positives = 564/858 (65%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK-SGSE-------EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L  +DI++   Y+INL++D+G  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ +++                 LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRRISA+GPGG++RE     +RD+H SH+G+ICP+ETPEG N GLI SLATYA  ++ GF+ TPY   +NG +  ++   +LTA  ED+  +   +   + E N   E  V  RYR  +     + VD++ +SP Q+VS+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V      G V+YVD   I+++ +G E       E  Y L K+ +SNQ+TC NQ P+V V E+V  G  +ADG A   GELALGQN+LVA+  W GYNYEDAI++S+RL  +D++TSIH+ +Y ++  +TK G EEITR+IPNV E S + LD++GII +GA  + GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       ++VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG  +DI+LNPLGVPSRMN+GQ+ E  LG A + L +         +   + F   +G  EE SR  +    +  + K+ KS                           IY+   P                       GK+         + DGRTGE FD  V+VG  YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLT+KSDD++GRN   NAI+KGKPIP+ G PESFK+L ++LQ LGL +++ K
  S:   276 LRPADIMAAIDYLINLEFDVGSTDDIDHLGNRRVRSVGELLQNQVRVGLNRLERIIRERMTVSE--------------SDGLTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIGSLATYARVNQYGFIETPYYKAENGRVRRDLDPVYLTADEEDDLRVCPGDAATDAEGNILGE-SVPIRYRQEFSTTSPEQVDYVAVSPVQIVSVATSMIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQAARDSGMVIV--SRTYGIVTYVDASEIRVQVTGPENHDKLGTEITYLLQKYQRSNQDTCLNQRPLVYVNEEVVPGQVLADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHVEKYEIEARQTKLGPEEITREIPNVGEDSLRNLDEQGIIRIGAWTEAGDILVGKVTPKGESDQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREQGDELPPGANMVVRVYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGRPVDIVLNPLGVPSRMNVGQVFECLLGWAGENLGV---------RFKVTPFDEMYG--EETSRKTVHGKLQEASHKRGKS--------------------------WIYQEENP-----------------------GKI--------QVFDGRTGEPFDRPVTVGQAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAYGAAYTLQELLTVKSDDMQGRNEALNAIVKGKPIPQPGTPESFKVLMRELQSLGLDIAVHK 1060
Score = 255, Expect = 1.7e-19, Identities = 65/222 (29%), Positives = 114/222 (51%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           P+L+ +Q+++F  F++  L   + S  PI    G+  L ++G   KL++PK    EA+    TY   +YV   +++ E+GE+K+              +F   +P++TE+GTFI+NG E+ +++QIVRSPG Y   K++I  +  R      Y   ++P +G  +  F  +    + V       + T  +     LKA+GL+  EIL+   +    + +LD E
  S:    12 PDLIEIQRSSFRWFLEEGLIEELDSFSPISDYTGKLELHFLGENYKLKQPKYDVDEAKRRDSTYSVQMYVPTRLINKETGEIKEQE------------VFIGDLPLMTERGTFIINGAERVIVNQIVRSPGVYY--KAEIDKNGRRT-----YSASLIPNRGA-WLKFETDKNGLVWVRI-----DKTRKLSAQVLLKAIGLSDAEILDGLRHPDFYQRTLDKE 210
>gi|54027073|ref|YP_121315.1| DNA-directed RNA polymerase subunit beta [Nocardia farcinica IFM 10152] >gi|81373140|sp|Q5YPE0|RPOB2_NOCFA DNA-directed RNA polymerase subunit beta 2 (RNAP subunit beta 2) (Transcriptase subunit beta 2) (RNA polymerase subunit beta 2) >gi|54018581|dbj|BAD59951.1| putative RNA polymerase beta subunit [Nocardia farcinica IFM 10152] (1163 aa)
Score = 1993, Expect = 0.0e+00, Identities = 428/863 (49%), Positives = 564/863 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRY-RSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLE--KILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGK--LGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +G +TDE+ +LTA  ED ++ A +N  V  + +F ED+VLCR      E+    +VDF+D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PLI   APIVGTG E + A D+G   V   EK G V  V    + + +     K Y + KFN+SNQ TC+NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD +L   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIGQILE HLG                          W G   +A   +  N E  K L E+  ++   +N     FD        G   E+L          G+  + L     E  +D  NGK  L +G+S          GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   355 DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGRVTDEVVYLTADEEDRHVRAQANSPVGPDGRFLEDRVLCRRGNEEMEYVAATEVDFMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLIRSEAPIVGTGMELRAAVDAGDVVV--NEKAGVVEEVSADYVTVMADDGTRKSYRMRKFNRSNQGTCSNQRPIVDEGQRVEAGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDDLPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVIGKILPTEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLG--------------------------WIG---KAGWKVEGNPEWAKDLPEEMWEAPADSNIATPVFD--------GAREEELT---------GLLGSTLPNRDGERMVDD-NGKAVLFDGRS----------GEPFPYPVAVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1154
Score = 258, Expect = 7.6e-20, Identities = 78/276 (28%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++KI +    P LL+LQ  +F   I +                  LE  ++ + PI+   G  SL +   + E+ K S  E + +  TY  PL+V    ++N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y         S  +   ++ +   ++P++G  +  F  + +D + V       +     P+T  LKALG   EEI   F   + + ++L+ +    +D    + L+++ + L   +        T L  LF K
  S:    25 RVSFAKIREPLEVPGLLDLQTESFAWLIGSPEWRERAAARGDVGLVGGLEEVLEELSPIEDFSGSMSLSFSDPRFEEVKASIDECKEKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDKGTFIINGTERVVVSQLVRSPGVY------FDHSIDKGTEKDLHSVRVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEEIAERFGFSEIMMSTLEKDNTAGQD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 289
>gi|118465939|ref|YP_883637.1| DNA-directed RNA polymerase subunit beta [Mycobacterium avium 104] >gi|118167226|gb|ABK68123.1| DNA-directed RNA polymerase, beta subunit [Mycobacterium avium 104] (1144 aa)
Score = 1993, Expect = 0.0e+00, Identities = 414/863 (47%), Positives = 559/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TDEI +LTA  ED +++A +N  ++ K +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIG                 ++LE +             G   ++  N+  N E  +N  +     Q N+                         +TPVF+G    +L   M    +   +G++     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   337 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDEIHYLTADEEDRHVVAQANSPIDDKGRFAEARVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKSGVIEEVSADYITVMADDGTRHTYRMRKFERSNHGTCANQSPIVDAGDRVEAGQVIADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIG-----------------QILETH------------LGWVAKSGWNIDGNPEWAVNLPEELRHAQPNQ-----------------------IVSTPVFDGAKEEELA-GMLSCTLPNRDGEVMVDGDGKAVLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1136
Score = 255, Expect = 1.8e-19, Identities = 81/276 (29%), Positives = 137/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFI-------------DTELEGTIKSIF----PIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I             D E +G ++ +     PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:     7 RVSFAKLREPLEVPGLLDVQIDSFEWLIGAPRWREAAIARGDAEPKGGLEEVLDELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMSTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 271
>gi|88909143|sp|Q73SE4|RPOB_MYCPA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158512716|sp|A0QL49|RPOB_MYCA1 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1175 aa)
Score = 1993, Expect = 0.0e+00, Identities = 414/863 (47%), Positives = 559/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TDEI +LTA  ED +++A +N  ++ K +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIG                 ++LE +             G   ++  N+  N E  +N  +     Q N+                         +TPVF+G    +L   M    +   +G++     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   368 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDEIHYLTADEEDRHVVAQANSPIDDKGRFAEARVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKSGVIEEVSADYITVMADDGTRHTYRMRKFERSNHGTCANQSPIVDAGDRVEAGQVIADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIG-----------------QILETH------------LGWVAKSGWNIDGNPEWAVNLPEELRHAQPNQ-----------------------IVSTPVFDGAKEEELA-GMLSCTLPNRDGEVMVDGDGKAVLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1167
Score = 255, Expect = 1.8e-19, Identities = 81/276 (29%), Positives = 137/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFI-------------DTELEGTIKSIF----PIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I             D E +G ++ +     PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    38 RVSFAKLREPLEVPGLLDVQIDSFEWLIGAPRWREAAIARGDAEPKGGLEEVLDELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMSTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 302
>gi|46191128|ref|ZP_00120579.2| COG0085: DNA-directed RNA polymerase, beta subunit/140 kD subunit [Bifidobacterium longum DJO10A] >gi|189439828|ref|YP_001954909.1| DNA-directed RNA polymerase beta subunit [Bifidobacterium longum DJO10A] >gi|189428263|gb|ACD98411.1| DNA-directed RNA polymerase beta subunit [Bifidobacterium longum DJO10A] (1187 aa)
Score = 1993, Expect = 0.0e+00, Identities = 412/836 (49%), Positives = 553/836 (66%)
  Q:   506 HLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDY----ELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           H GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NPL+ +TNKRR+SA+GPGG+SR+  ++++RDVH SH+G++CPIE+PEG NIGLI SLAT+   +  GF+ TPYR V NG +TDE+ ++TA  + +++IA +N  +++N  F +   L R     E  DV    VD++D+SP+Q+VS+ AS IPFLE+D+ +RALMG NMQRQA PLI    P+VGTG+E++ A+DSG   V   EKDG V+YV    I++         Y+L KF +SNQ TC NQ PIV  GE+V  G+ +ADGPA+ NG+LALG+N+L+AF  W+GYNYEDA+I+S+RL  +D  +SIHI EY +D  +TK G EEITRD+PNV E +   LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  VK    ED      EL   V + I+VY+ Q RKI +GDK++GRHGNKG IS+I+P EDMP L DGT +DIMLNPLGVPSRMN+GQ+LELHLG                          W   H     +L  NLE    +                     L  SG  + +     ATPVF+GV    LK  +    +   +G    G  GK  L DGRTGE +   +SVG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L E++T KSDDV GR   Y AI+KG  +P +G+PESFK+L K++Q L L V +    G A
  S:   369 HFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQDA--------------EAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLSGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRVNPFGFIETPYRKVVNGHVTDEVEYMTADRDLDHVIAQANQELDENGNFVQKSALARVGEE-EAVDVPVSSVDYMDVSPRQMVSLGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGSEWRAANDSG--DVIKSEKDGVVTYVSADLIRVMNDDGTTSSYKLAKFQRSNQTTCYNQRPIVHDGERVEAGSVMADGPAIQNGDLALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGETGTVIGVKEITREDAEEDGDELPNGVNQMIRVYIAQHRKITVGDKLSGRHGNKGCISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLGQVLELHLG--------------------------WIA-HSGWDISLDPNLEAEWKK---------------------LIPSGAEKAEPNTPVATPVFDGVKPEVLK-GLLSTTLPNRDGDRLVGPDGKATLFDGRTGEPYTKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAIVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVA 1146
Score = 236, Expect = 3.4e-17, Identities = 73/269 (27%), Positives = 133/269 (49%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDS 276
           D ++ K   R ++  I++  + P LL +Q ++F   I  E                      L+     I PI++     SL +     E+P+ + +E + +  TY  PLYV+    + ++GE+K  T            +F    P+ T  GTFI+ G E+ ++SQ+VRSPG Y   + Q + S+     +E +  +I+P++G  +  F  + KD  QV       +S        FL A+G+ K EI   F ++  + ++L+ E    +D    + L++L + +  +D+
  S:    20 DIDLHKASDRVNFGSIKEPIDVPYLLGVQTDSFDWLIGNERWKARVEEDEKNGTNTVAHTSGLDEVFNEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQT------------VFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVY-FDRQQDRTSD-----KEVFGAKIIPSRGA-WLEFEIDKKDQPQVRVDRKRKQSA-----IVFLMAIGMTKSEIAQAFKDYPLVLDALEKETLGTQD----EALVDLYRKIRPADT 282
>gi|34595755|gb|AAQ76600.1| RpoB [Mycobacterium abscessus] (1171 aa)
Score = 1993, Expect = 0.0e+00, Identities = 431/942 (45%), Positives = 605/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTS-LDKPTLSISDILSITSYVINLD---------------YDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + GT+ + +   TL+  D+++   Y++ L                 D+   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TDEI +LTA  ED +++A +N  V+ N +F E+K+L R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V  D  T+    G+ +  Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE +      + +++      E       NL                      DL+ A + +         +TATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +  + G A    + + +D+    +N+  N  +N+
  S:   282 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGTNPAQVTTTTLTEEDVVATIEYLVRLHEGQTTMTAPGGVEVPVDV---DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVSDGVVTDEIHYLTADEEDRHVVAQANSPVDANGRFTEEKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKAGVIEEVSADYVTVMADDGTRQS-YRLRKFARSNHGTCANQKPIVDEGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWIAKTGWNI------EGEPEWAANLPA--------------------DLTSAPADT---------RTATPVFDGAREEELT-GLLSSTLPNRDGEVMVDGDGKARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLERAAANLGINLSRNE 1163
Score = 233, Expect = 6.0e-17, Identities = 74/276 (26%), Positives = 129/276 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   + +                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+ GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    32 RLSFAKLREPLAVPGLLDVQTESFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDMGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 296
>gi|23465772|ref|NP_696375.1| DNA-directed RNA polymerase subunit beta [Bifidobacterium longum NCC2705] >gi|41017742|sp|Q8G514|RPOB_BIFLO DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|23326461|gb|AAN25011.1| RpoB [Bifidobacterium longum NCC2705] (1187 aa)
Score = 1992, Expect = 0.0e+00, Identities = 412/836 (49%), Positives = 553/836 (66%)
  Q:   506 HLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDY----ELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           H GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NPL+ +TNKRR+SA+GPGG+SR+  ++++RDVH SH+G++CPIE+PEG NIGLI SLAT+   +  GF+ TPYR V NG +TDE+ ++TA  + +++IA +N  +++N  F +   L R     E  DV    VD++D+SP+Q+VS+ AS IPFLE+D+ +RALMG NMQRQA PLI    P+VGTG+E++ A+DSG   V   EKDG V+YV    I++         Y+L KF +SNQ TC NQ PIV  GE+V  G+ +ADGPA+ NG+LALG+N+L+AF  W+GYNYEDA+I+S+RL  +D  +SIHI EY +D  +TK G EEITRD+PNV E +   LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  VK    ED      EL   V + I+VY+ Q RKI +GDK++GRHGNKG IS+I+P EDMP L DGT +DIMLNPLGVPSRMN+GQ+LELHLG                          W   H     +L  NLE    +                     L  SG  + +     ATPVF+GV    LK  +    +   +G    G  GK  L DGRTGE +   +SVG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L E++T KSDDV GR   Y AI+KG  +P +G+PESFK+L K++Q L L V +    G A
  S:   369 HFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQDA--------------EAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLSGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRVNPFGFIETPYRKVVNGHVTDEVEYMTADRDLDHVIAQANQELDENGNFVQKSALARVGEE-EAVDVPVSSVDYMDVSPRQMVSLGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGSEWRAANDSG--DVIKSEKDGVVTYVSADLIRVMNDDGTTSSYKLAKFQRSNQTTCYNQRPIVHDGERVEAGSVMADGPAIQNGDLALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGETGTVIGVKEITREDAEEDGDELPNGVNQMIRVYIAQHRKITVGDKLSGRHGNKGCISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLGQVLELHLG--------------------------WIA-HSGWDISLDPNLEAEWKK---------------------LIPSGAEKAEPNTPVATPVFDGVKPEVLK-GLLSTTLPNRDGDRLVGPDGKATLFDGRTGEPYTKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAIVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVA 1146
Score = 236, Expect = 3.4e-17, Identities = 73/269 (27%), Positives = 133/269 (49%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDS 276
           D ++ K   R ++  I++  + P LL +Q ++F   I  E                      L+     I PI++     SL +     E+P+ + +E + +  TY  PLYV+    + ++GE+K  T            +F    P+ T  GTFI+ G E+ ++SQ+VRSPG Y   + Q + S+     +E +  +I+P++G  +  F  + KD  QV       +S        FL A+G+ K EI   F ++  + ++L+ E    +D    + L++L + +  +D+
  S:    20 DIDLHKASDRVNFGSIKEPIDVPYLLGVQTDSFDWLIGNERWKARVEEDEKNGTNTVAHTSGLDEVFNEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQT------------VFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVY-FDRQQDRTSD-----KEVFGAKIIPSRGA-WLEFEIDKKDQPQVRVDRKRKQSA-----IVFLMAIGMTKSEIAQAFKDYPLVLDALEKETLETQD----EALVDLYRKIRPADT 282
>gi|38233060|ref|NP_938827.1| DNA-directed RNA polymerase subunit beta [Corynebacterium diphtheriae NCTC 13129] >gi|41017599|sp|P60280|RPOB_CORDI DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|38199319|emb|CAE48951.1| DNA-directed RNA polymerase beta chain [Corynebacterium diphtheriae] (1175 aa)
Score = 1992, Expect = 0.0e+00, Identities = 414/851 (48%), Positives = 567/851 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS--GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEY 1352
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V+NGV+TD+I +LTA  ED +++A +N+  + + K   D V  R ++   +    + VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E   A+D+G   +   +K G V  V    I + +  G+ E  Y L KF ++NQ TC NQ P+V++G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  +DD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG LA     +                       + A+  L+K L + L +    SL                             TATPVF+G    ++   +  +  +  +G +   ++GK  L DGR+GE F   VSVG MY+LKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +    G     +  D +E+
  S:   365 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVENGVLTDQIDYLTADEEDRFVVAQANVEHDADGKITADSVTVRVKNGDIQVVAPESVDYLDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMERAAAYDAGDLII--NKKGGVVENVSADIITVMADDGTRE-TYILRKFERTNQGTCYNQTPLVNIGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSIHIEEHEIDARDTKLGPEEITREIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRRFSRDDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFMPDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAAAGWKIDT--------------------EDPANAELLKTLPEDLYDVPAGSL-----------------------------TATPVFDGATNEEIAGLLGNSRPNR-DGDVMVDENGKATLFDGRSGEPFPYPVSVGYMYILKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEVLSADGTPMELSGSDDDEF 1153
Score = 249, Expect = 9.8e-19, Identities = 73/241 (30%), Positives = 120/241 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R+ ++KI +    P LL++Q N+F   I T                    LE  ++ + PI+   G  SL     + E  K +  E +++   Y  PLYV    ++NE+ E+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++  +  D
  S:    34 RKSFAKITEPIEVPGLLDIQLNSFAWLIGTPEWRARQQEELGDSVRVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEDMKNTIDECKDKDINYSAPLYVTAEFINNETQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESDGVSNTD 269
>gi|88854711|ref|ZP_01129377.1| DNA-directed RNA polymerase beta subunit [marine actinobacterium PHSC20C1] >gi|88815872|gb|EAR25728.1| DNA-directed RNA polymerase beta subunit [marine actinobacterium PHSC20C1] (1174 aa)
Score = 1992, Expect = 0.0e+00, Identities = 443/938 (47%), Positives = 598/938 (63%)
  Q:   406 KKNTLIQKHELDTI-------KQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLD---------YDIGF-----------------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK---SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANN 1343
           K N L ++  L  I       +Q+  E    ++ N   + +   +A V +Y KIN              +G DT + +  L++ DI++   Y+++L           D G                   DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA++A  +  GF+ TPYR + NG ++  I +LTA  ED+YI+A +N  + K+ KF E +VL R +    +   V+D+ ++D+SP+Q+VS+A S IPFLE+DDANRALMGANMQRQA PL+   +P+VGTG E   A DSG   V    K G VS V    + ++    G+++  Y L KFN+SNQ T  N   IVS GE+V  G  IADGPA  NGELALG+N+LVAF  W G+N+EDAIILS+ L  +D+ +SIHI EY VD   TK G EEITRD+PNVS      LD+ GII +GAEV+ GD+LVGK++PKG+ EL++EE+LL+AIF +KS+  ++TSLKVPHG +GT+  VK F  ++D EL + V +++ VY+ QKRKI  GDK+AGRHGNKG+ISKI+PVEDMP L DGT +DI+LNPLG+P RMN GQ+LE HLG   K+                       G   E +    KNL      +  K+          FD +     +G      +  + TP  +GV   D                     SGK  L DGR+GE F   VSVG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD+ GR   Y AI+KG+ I E G+PESFK+L K++Q L L V +    G   N
  S:   252 KDNILTKEEALKDIYRKLRPGEQVAAEAARALLDNFYFNSKRYDLAKVGRY-KINRK------------LGLDTDIKESVLTVEDIIATIKYMVSLHDNSAPSVSVSDSGVASVKGVRDGKKVNVRLDIDDIDHFGNRRIRAVGELIQNQVRTGLSRMERVVRERMTTQD--------------IEAITPQTLINVRPVVAAIKEFFGTSQLSQFMDQNNPLAGLTHKRRLSALGPGGLSRERAGVEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASFARINAFGFIETPYRRLINGTVSTTIDYLTASDEDDYIVAQANAPLTKDMKFAEPRVLARKKGGEVDLVPVEDIAYMDVSPRQMVSVATSIIPFLEHDDANRALMGANMQRQAVPLLRSESPLVGTGMEAFAAIDSG--DVVTALKAGVVSEVSADMVVVQLDEGGTQD--YFLRKFNRSNQGTSYNHRVIVSAGERVEVGQVIADGPATENGELALGKNLLVAFMPWEGHNFEDAIILSQNLVKDDVLSSIHIEEYEVDARDTKLGKEEITRDLPNVSPELLADLDERGIIRIGAEVRPGDILVGKVTPKGETELSAEERLLRAIFNEKSREVRDTSLKVPHGEQGTIIAVKEFSADNDDELGSGVNQRVVVYIAQKRKITEGDKLAGRHGNKGVISKILPVEDMPFLADGTPVDIILNPLGIPGRMNFGQVLETHLGWVAKQ-----------------------GWEVEGNPEWAKNLPA----EAYKAEPGTKVATPVFDGAYEEEIAG------LLDSTTPTRDGVRLID--------------------SSGKTPLFDGRSGEPFPAPVSVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDILGRVKVYEAIVKGENIQEPGIPESFKVLIKEMQSLCLNVEVLSADGSTVN 1143
Score = 280, Expect = 2.3e-22, Identities = 78/235 (33%), Positives = 126/235 (53%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           R  ++KI      P+LL LQ  +F   +  +                      L+   + I PI+ +G    L +   +LE+PK S  E +  GKT+  PLYV+   +++ +GE+K  T            +F    P++T +GTFI+NG E+ V+SQ+VRSPG Y   + + KLS+     ++ Y   I+P++G  +  F  + +D + V       +S     +T FLKALGL  EEIL+ F    SI+ +L+ +
  S:    21 RLSFAKITDTLTVPDLLALQTESFDWLVGNDIWKQRVTDGVAAGRTDLPTRSGLDEIFEEISPIEDLGETMQLSFTEPELEEPKYSIDECKERGKTFAAPLYVNAEFMNHLTGEIKTQT------------VFMGDFPLMTARGTFIINGTERVVVSQLVRSPGVYFDRQPE-KLSD-----KDIYSARIIPSRGA-WLEFEIDKRDHVGVRIDRKRKQS-----VTVFLKALGLTSEEILDEFKGFPSIEATLEKD 253
>gi|46360918|gb|AAS89192.1| RpoB [Corynebacterium diphtheriae] (1158 aa)
Score = 1992, Expect = 0.0e+00, Identities = 413/851 (48%), Positives = 567/851 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKS--GSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEY 1352
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V+NGV+TD+I +LTA  ED +++A +N+  + + K   D V  R ++   +    + VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E   A+D+G   +   +K G V  V    I + +  G+ E  Y L KF ++NQ TC NQ P+V++G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  +DD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG                          W      A+     + E   N + +K+L +   +F    L                 TATPVF+G    ++   +  +  +  +G +   ++GK  L DGR+GE F   VSVG MY+LKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +    G     +  D +E+
  S:   348 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVENGVLTDQIDYLTADEEDRFVVAQANVEHDADGKITADSVTVRVKNGDIQVVAPESVDYLDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMERAAAYDAGDLII--NKKGGVVENVSADIITVMADDGTRE-TYILRKFERTNQGTCYNQTPLVNIGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSIHIEEHEIDARDTKLGPEEITREIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRRFSRDDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFMPDGTPVDIILNTHGVPRRMNIGQVLEVHLG--------------------------WL-----AAAGWKIDTEDPANAELLKTLPEDLYDFPAGSL-----------------TATPVFDGATNEEIAGLLGNSRPNR-DGDVMVDENGKATLFDGRSGEPFPYPVSVGYMYILKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEVLSADGTPMELSGSDDDEF 1136
Score = 249, Expect = 1.1e-18, Identities = 73/241 (30%), Positives = 120/241 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R+ ++KI +    P LL++Q N+F   I T                    LE  ++ + PI+   G  SL     + E  K +  E +++   Y  PLYV    ++NE+ E+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++  +  D
  S:    17 RKSFAKITEPIEVPGLLDIQLNSFAWLIGTPEWRARQQEELGDSVRVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEDMKNTIDECKDKDINYSAPLYVTAEFINNETQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESDGVSNTD 252
>gi|46360960|gb|AAS89213.1| RpoB [Corynebacterium cystitidis] (1113 aa)
Score = 1991, Expect = 0.0e+00, Identities = 407/829 (49%), Positives = 555/829 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI +LA+YA  +  GF+ TPY+ V+NG +TD I +LTA  ED Y IA + + ++ +    E+++  R +       D + VD++DISP+Q+VS+A + IPFLE+DDANRALMGANMQ+QA PL+   AP V TG E + A+D+G   +   EK G V  V G  I I     ++  Y L  + ++NQ TC NQ+P+V++G++V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  +DI TS+HI E+ +D   TK G EEITR+IPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+RF  EDD +L+  V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG LA    T++                      + A+  L++ L + L++    SL                             TATPVF+G    ++   +     +  +G +     GK  L DGR+GE F   +SVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGALASYARVNAFGFIETPYQKVENGKLTDHIDYLTADEEDRYAIAQAAIEMDADGTIIEERIEVRIKDGDIAVTDAQGVDYLDISPRQMVSVATAMIPFLEHDDANRALMGANMQKQAVPLLRAEAPFVATGMEQRAAYDAGDMVI--SEKAGVVENVSGDIITIMDDEGQRDTYLLRTYERTNQGTCYNQLPLVNIGDRVEAGQVIADGPGTKNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEDDILTSVHIEEHEIDARDTKLGAEEITREIPNVSEEVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIAVRRFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPQEDMPFMADGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAKAGWTVNP--------------------DDPANAALLETLPEALHDVPADSL-----------------------------TATPVFDGATNEEIAGLLVNTKPNR-DGDVMVDGDGKTVLFDGRSGEPFKYPISVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCL 1113
Score = 222, Expect = 1.2e-15, Identities = 72/256 (28%), Positives = 123/256 (48%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           EI     R  ++KI +    P LL++Q  +F   + T                    LE  ++ + PI+   G  SL     + +  K +  E +++   Y  PLYV    ++N++ E+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG  + +I   F   + + ++L+++      V  TDE +
  S:     9 EIPGAPKRYSFAKISEPLAVPGLLDVQSESFSWLVGTPEWRERQQELRGPDARVTSGLEDILEELSPIQDYSGNMSLSLSEPRFDSVKYTVDECKDKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPLMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTEAQIKERFGFSEIMMSTLESD-----GVANTDEAL 254
>gi|46360940|gb|AAS89203.1| RpoB [Corynebacterium amycolatum] (1144 aa)
Score = 1990, Expect = 0.0e+00, Identities = 413/842 (49%), Positives = 550/842 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK------ELGKANN 1343
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+   ++IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V++GVITDE+ +LTA  ED Y++A +N  +++N  F ++ +  R +    E     +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   V      G V  V    I I     ++  Y L KF ++NQ TC NQ P+V  G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITRDIPN SE   K LD+ GI+ +GA+V++GD+LV K +PKG+ ELT EE+LL+AIFG+KS+  ++TS++VPHG  G V  V+ F  EDD +L   V E ++VYV QKRKIQ GDKMAGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE+HLG   K                        G   E   +  K L   L++    SL                              ATPVF+G    +L   +  +  +  +G++     GK  L DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V +        ELG +++
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--------------VESIQPTTLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSCYARVNPFGFIETPYRRVRDGVITDEVDYLTADEEDRYVVAQANTPIDENGHFVQETLSVRKKGGDVESVRADEVDYLDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPFVGTGMEQRAAYDAGDVIV--ASAAGVVETVSADFITIMDDEGQRHTYLLRKFERTNQGTCYNQKPLVDEGQRVEAGQVIADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDILTSIHIEEHEIDARDTKLGPEEITRDIPNASEEMLKDLDERGIVRIGADVRDGDILVAKTTPKGETELTPEERLLRAIFGEKSREVRDTSMRVPHGESGKVIGVRVFSREDDDDLAPGVNEMVRVYVAQKRKIQDGDKMAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAKA-----------------------GWSIEGDPDWAKRLPADLHDVPSDSL-----------------------------VATPVFDGAENEELAGLLASSRPNR-DGEVLVNADGKATLFDGRSGEKFPFPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNVEVLSADGVPVELGSSDD 1128
Score = 233, Expect = 6.8e-17, Identities = 78/249 (31%), Positives = 120/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDELI 265
           R  ++KI++    P LL+LQ+ +F   I T                    LE  ++ + PI+    + SL       +  K +  E++++   Y  PLYV     + E+GE+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +I+P++G  +  F  + +D + V       +     P+T  LKA G   EEI   F   + +  +L      EKD V  TDE +
  S:    16 RYSFAKIQEPIAVPGLLDLQRESFAWLIGTPEWRARRQEELGEDARVTSGLEDILEELSPIEDYSQKMSLTLSDPWFDSVKNTVDESKDKDINYSAPLYVTAEFTNRETGEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HSVKIIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKAFGWTTEEIKERFGFSEIMMATL------EKDGVANTDEAL 254
>gi|46360956|gb|AAS89211.1| RpoB [Corynebacterium argentoratense] (1116 aa)
Score = 1989, Expect = 0.0e+00, Identities = 409/829 (49%), Positives = 559/829 (67%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + Q++QF+DQ N L+ LTNKRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR + +G ITDE+ +LTA  ED Y++A +N   +K+ K  E++++ R +  + E    + ++++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A+D+G   +    K G V  V  D  T+    G+ +  Y L KF ++NQ TC NQ P+V +G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++RL  EDI TSIHI E+ +D   TK G EEITR+IPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  E+D +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ                 VLE++     A+ +++    +   ++ L++ L + L +    SL                             TATPVF+G +  +L   +  +  +  +G +     GK  LIDGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQMSQFMDQNNSLSGLTNKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSCYARVNSFGFIETPYRKIVDGHITDEVHYLTADEEDRYVVAQANTPHDKDGKITEERIVVRTKGGNIEVVGPEAIEYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAYDAGDMII--NAKGGVVENVCADYITVMADDGTRD-TYMLRKFQRTNQGTCYNQKPLVDMGQRVEAGQVIADGPGTDNGEMALGRNLLVAFMPWEGHNYEDAIILNQRLVEEDILTSIHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVISVRRFSREEDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPAEDMPFLPDGTPVDIILNTHGVPRRMNIGQ-----------------VLEVHLGWLAAAGWNI--DTNNPENKELMEILPEELYDVPAGSL-----------------------------TATPVFDGASNAELAGLLANSRPNR-DGDVMVDGDGKAQLIDGRSGEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCL 1116
Score = 249, Expect = 9.3e-19, Identities = 77/249 (30%), Positives = 122/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL+LQ ++F   + T                    LE  ++ + PI+   G  SL     + E+ K S  E +++   Y  PLYV    ++NE+ E+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+N+      V  TDE +
  S:    19 RYSFAKITEPIEVPGLLDLQLDSFAWLVGTPEWRERTQAEIGEGNRVTSGLEDILEELSPIQDYSGTMSLSLSEPRFEEVKNSIDECKDKDINYSAPLYVTAEFINNETQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DRTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMTTLEND-----GVANTDEAL 257
>gi|46360952|gb|AAS89209.1| RpoB [Corynebacterium capitovis] (1116 aa)
Score = 1989, Expect = 0.0e+00, Identities = 413/831 (49%), Positives = 553/831 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV-----KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQV 1332
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI +LA+YA  +  GF+ TPY+ V +G +TD+I +LTA  ED Y IA +   ++ +     D++  R +      D+       VD++DISP+Q+VS+A + IPFLE+DDANRALMGANMQ+QA PL+   AP V TG E + A+D+G   V    K G V+ V G  I I      +  Y L  F ++NQ TC NQ PIV+ G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  EDI TS+HI E+ +D   TK G EEITR+IPNVSE   K LD+ GII +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+RF  EDD +L+  V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG LA    T++                      + A+  L++ L + L +   +SL                             TATPVF+G    ++   +  +  +  +G +    +GK  L DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGALASYARVNAFGFIETPYQKVVDGKLTDQIDYLTADEEDRYAIAQAATPMDADGTLTADRIEVRLKDG----DIGVVGPHGVDYLDISPRQMVSVATAMIPFLEHDDANRALMGANMQKQAVPLLRAEAPYVATGMEQRAAYDAG--DVVTSAKAGAVTNVTGDFITIMDDEGIQDTYMLRTFERTNQGTCYNQSPIVAQGDRVEAGQVIADGPGTKNGEMALGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSVHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIIRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIAVRRFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPQEDMPFMADGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAKAGWTVNP--------------------DDPANAELLETLPEQLYDVPPESL-----------------------------TATPVFDGATNAEIAGLLANSKPNR-DGDVMVDANGKTMLFDGRSGEPFKYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNV 1115
Score = 228, Expect = 2.6e-16, Identities = 72/249 (28%), Positives = 120/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL++Q  +F   + T                    LE  ++ + PI+   G  SL     + E  K +  E +++   Y  PLYV    ++N++ E+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+++      V  TDE +
  S:    16 RYSFAKISEPITVPGLLDVQLESFAWLVGTPEWREREQAARGDDARVTSGLEDILEELSPIQDYSGSMSLSLSEPRFEDVKYTIDECKDKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPLMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITKRFGFSEIMMATLESD-----GVANTDEAL 254
>gi|62720648|gb|AAX93860.1| RNA polymerase subunit B [Mycobacterium phocaicum] (1167 aa)
Score = 1989, Expect = 0.0e+00, Identities = 430/942 (45%), Positives = 599/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSL-DKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + G + +L    TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +G++TD+I +LTA  ED +++A +N  ++ N  F E+K+L R +    EF    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V D  K G +  V  D  T+    GS    Y + KFN+SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+P+EDMP + DGT +DI+LN  GVP                 +++ + ++LE +             G   +A  N+    E   N                    L        R+ ++   ATPVF+G    +L + +  + +   +G +     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    +++ +D+    +N+  N  +N+
  S:   278 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGANPALVTATTLTEEDVVATIEYLVRLHEGQTTMTAPGGLEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGIVTDQIDYLTADEEDRHVVAQANSPLDANGHFTEEKILVRRKGGEVEFVSANDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAD--KSGVIEEVSADYVTVMADDGSRH-TYRMRKFNRSNHGTCANQRPIVDSGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSQRLVEQDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPIEDMPFMPDGTPVDIILNTHGVP-----------------RRMNIGQILETH------------LGWVAKAGWNIEGEPEWAAN--------------------LPEGMHSAPRDSIV---ATPVFDGARENEL-QGLLGSTLPNRDGDVMVDADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDSDDEDLERTAANLGINLSRNE 1159
Score = 242, Expect = 6.0e-18, Identities = 75/276 (27%), Positives = 131/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I ++                 LE  +  + PI+   G  SL +   + ++ K    E + + +TY  PL+V    ++N +GE+K  T            +F    PM+T+ GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    28 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSDRWRSKAVDRGDINPVGGLEEVLAELSPIEDFAGTLSLSFSDPRFDEVKAPVDECKEKDQTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDMGTFIINGTERVVVSQLVRSPGVYFDENIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 292
>gi|169630948|ref|YP_001704597.1| DNA-directed RNA polymerase beta chain [Mycobacterium abscessus] >gi|34391547|gb|AAN65351.1| RpoB [Mycobacterium abscessus] >gi|169242915|emb|CAM63943.1| DNA-directed RNA polymerase beta chain [Mycobacterium abscessus] (1171 aa)
Score = 1989, Expect = 0.0e+00, Identities = 430/942 (45%), Positives = 605/942 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTS-LDKPTLSISDILSITSYVINLD---------------YDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N         + + + GT+ + +   TL+  D+++   Y++ L                 D+   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG++R+   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  V+ N +F E+K+L R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  V  D  T+    G+ +  Y L KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE +      + +++      E       NL                      DL+ A + +         +TATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +  + G A    + + +D+    +N+  N  +N+
  S:   282 TKESAQALLENLFFKEKRYDLARVGRY-KVN---------KKLGLGGTNPAQVTTTTLTEEDVVATIEYLVRLHEGQTTMTAPGGVEVPVDV---DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVSDGVVTDDIHYLTADEEDRHVVAQANSPVDANGRFTEEKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEKAGVIEEVSADYVTVMADDGTRQS-YRLRKFARSNHGTCANQKPIVDEGQRVEAGQVIADGPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWIAKTGWNI------EGEPEWAANLPA--------------------DLTSAPADT---------RTATPVFDGAREEELT-GLLSSTLPNRDGEVMVDGDGKARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLERAAANLGINLSRNE 1163
Score = 233, Expect = 6.0e-17, Identities = 74/276 (26%), Positives = 129/276 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   + +                  LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+ GTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+ +     D    + L+++ + L   +          L  LF K
  S:    32 RLSFAKLREPLAVPGLLDVQTESFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDMGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTLEKDNIAGPD----EALLDIYRKLRPGEPPTKESAQALLENLFFK 296
>gi|188532108|gb|ACD63067.1| RNA polymerase beta-subunit [Actinosynnema pretiosum subsp. auranticum] (1160 aa)
Score = 1988, Expect = 0.0e+00, Identities = 433/919 (47%), Positives = 587/919 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL----------DYDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           TKE    ++  +   E+   +A V +Y K+N              +G DT +    L+  DI++   Y++ L          + ++    DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SL++Y   +  GF+ TPYR V +G +TD+I +LTA  ED Y+ A +N  ++ +  F E KVL R +    E  D +DVD++D+SP+Q+VS A + IPFLE+DDANRALMGANMQRQA PL+   +P+VGTG E + A D+G   V   +K G V  +  D  T+    GS +  Y + KF +SNQ TC NQ PIV+ G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVSE     LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+PVEDMP LEDGT +DI+LN  GVP RMN                 + +VLE +        +S+          +  KNL   L E +  +                             KTATPVF+G    ++   +  + +   +G+    ++GK  L DGR+GE +   VSVG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A
  S:   275 TKESAQALLETLFFKEKRYDLAKVGRY-KVN------------KKLGLDTPISTGVLTEDDIVTTIEYLVRLHAGETSMQPGETEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQTNPLAGLTHKRRLSALGPGGLSRERAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYGRVNPFGFIETPYRKVVDGRVTDQIDYLTADEEDRYVKAQANARIDGEGNFLEGKVLVRKKGGEVEMIDPRDVDYMDVSPRQMVSAATAMIPFLEHDDANRALMGANMQRQAVPLLRSESPLVGTGMELRAAVDAGDVVV--AKKTGVVEEISADYVTVMADDGSRQ-TYGMHKFRRSNQGTCINQKPIVNEGDRVQVGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVQDDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLADLDERGIIRIGAEVQPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEYGKVIGIRVFSREDDDELPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVIGKILPVEDMPFLEDGTPVDIVLNTHGVPRRMN-----------------IGQVLETHLGWIAKQGWSI------NGDPDWAKNLPADLYEVEPGT-----------------------------KTATPVFDGAREEEIT-GLLGSTVPNRDGERMVKENGKAQLFDGRSGEPYPFPVSVGYMYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVLGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAA 1125
Score = 265, Expect = 1.3e-20, Identities = 96/338 (28%), Positives = 162/338 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKN-----IDSKFRLSNKETTYQ 354
           R  ++KI +    PNLL+LQ  +F      E                 LE  +  I PI+   G  SL +   + ++ K S +E +++  TY  PL+V     ++ +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y  T      +  +   ++ +  +I+P++G  +  F  + +D + V       +     P+T  LKALG + E+I   F+  +++  +L      EKD    TDE L+++ + L   +          L  LF K               EK+ +L +V    +++K   D  I+  + T++     I+   RL   ET+ Q
  S:    25 RVSFAKIHEPLQTPNLLDLQIQSFEWLTGDEAWFQRRVDEGDEAPTGGLEEVLNEISPIEDFSGSMSLSFSDPRFDEVKASTEECKDKDMTYAAPLFVTAEFTNHTTGEIKSQT------------VFMGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYYDT------AIDKTTDKDVFSVKIIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWSTEQIRERFSFSETLLTTL------EKDHTAGTDEALLDIYRKLRPGEPPTKESAQALLETLFFK---------------EKRYDLAKVGRYKVNKKLGLDTPISTGVLTEDDIVTTIEYLVRLHAGETSMQ 341
>gi|46360932|gb|AAS89199.1| RpoB [Corynebacterium freneyi] (1114 aa)
Score = 1986, Expect = 0.0e+00, Identities = 411/833 (49%), Positives = 542/833 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+   ++IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +G +T ++ +LTA  ED Y++A +N  V+ + +F  D +  R R    E     +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +     DG V  V    I +     ++  + L KF ++NQ T  NQ P+V  G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNV E   K LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS++VPHG  G V  V+ F  EDD +L   V E I+VYV QKRKIQ GDKMAGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE+HLG   K                        G   E      K L K L +    SL                              ATPVF+G    +L   +  +  D  +G +     GK  LIDGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--------------VESIQPTTLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRRVVDGKLTTDVDYLTADEEDRYVVAQANTPVDADGQFVNDTLPVRKRGGDVEVVRATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRAEAPFVGTGMEQRAAYDAGDLII--APCDGVVETVSADFITVMDDEGQRHTFILRKFERTNQGTSYNQKPLVDEGDRVEAGQVIADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDILTSIHIEEHEIDARDTKLGPEEITREIPNVGEDMLKDLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMRVPHGESGKVIGVRVFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVIGKILPQEDMPFLPDGTPVDILLNTHGVPRRMNIGQVLEVHLGWLAKA-----------------------GWTIEGDPEWAKRLPKELYDVPADSL-----------------------------VATPVFDGAENEELAGLLASSRPDR-DGDVLVNADGKAQLIDGRSGEPFPFPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1113
Score = 227, Expect = 3.3e-16, Identities = 77/249 (30%), Positives = 118/249 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDELI 265
           R  ++KI +    P LL+LQ+ +F   I T                    LE  +  + PI+    + SL       +  K +  E +++   Y  PLYV     + E+GE+K  T            +F    PM+++KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +I+P++G  +  F  + +D + V       +     P+T  LKA G   EEI   F   + + ++L      EKD V  TDE +
  S:    16 RYSFAKISEPIPVPGLLDLQRESFAWLIGTPEWRARRQEELGEGAQVTSGLEDILDELSPIEDYSQKMSLTLSDPWFDSVKNTVDECKDKDINYSAPLYVTAEFTNRETGEIKSQT------------VFIGDFPMMSDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HSVKIIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKAFGWTTEEIKERFGFSEIMMSTL------EKDGVANTDEAL 254
>gi|125717055|ref|YP_001034188.1| DNA-directed RNA polymerase subunit beta [Streptococcus sanguinis SK36] >gi|125496972|gb|ABN43638.1| DNA-directed RNA polymerase I, beta chain (140 kDa subunit), putative [Streptococcus sanguinis SK36] (1127 aa)
Score = 1986, Expect = 0.0e+00, Identities = 438/1050 (41%), Positives = 642/1050 (61%)
  Q:    67 LEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLN-KEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTL-SISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIV--KNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           LE++G ++ +PK + +EAR    +Y  P++V   +++ E+GE+K            T  +FF   P++TE GTFI+NG E+ ++SQ+VRSPG Y   K         K  + GY   ++P +G  +     ++KD           + T  IP T  ++ALG +  +EIL+IF +   ++N+++ +I+                  N  DS      D  L+E++++          E K AE  + L E                                             FF    +DL+  GR+K+ +K+ +  RL  + +AE L D   G+++++  T++ +  +D+I +    G   I +  N D  +  +   V  +K  V    D  D  + IIG     DK  + + +DIL+  SY +NL   IG  DDIDHLGN+R++ + ELL  + + GL R+E+ + +++++ D               + LT + IIN +P   + KEFF S QL+QF+DQ NPL+EL++KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI +L++Y   ++ GF+ TPYR V  + GV+T+EI WLTA  EDE+I+A +N  + EK  F E  V+ R++ + + F    VD++D+SPKQVV++A + IPFLENDD+NRALMGANMQRQA PLI P AP VGTG EY+ AHDSG A +   + DG V+Y D   ++++   GS + VY++ KF +SN  T  NQ  +V VG+ V KG  IADGP+M NGE+ALGQN +VA+ TW GYN+EDA+I+S+RL  +D++TS+H+ EY  +   TK G EEITR+IPNV E + + LD+ GII +GAEVKEGD+LVGK++PKG+ +L++EE+LL AIFGDKS+  ++TSL+VPHG +G V  VK F   +  EL + V   ++VY+ QKRKI++GDKMAGRHGNKG++S+IVPVEDMP+L DGT +DIMLNPLGVPSRMNIGQ++ELHLG+A + L +     ++     AS   LW  + E
  S:     3 LEFVGYEIREPKYTLEEARIHDASYSAPIFVTFRLINKETGEIK------------TQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVD-------KNGKVGYGSTVIPNRGA-WLELETDSKDIAYTRI-----DRTRKIPFTTLVRALGFSGDDEILDIFGDSDLVRNTIEKDIHK-----------------NPMDSR----TDEALKEIYERLRP------GEPKTAESSRSLLEA-------------------------------------------RFFDPHRYDLAAVGRYKINKKLSVKTRLLNQTIAEPLVDAETGEILVEAGTVMTRSVIDSIAEQLDNGLNKITYIPN-DSAV--LTAPVDLQKFKVVAPTDP-DRVVTIIGNANPSDKVRIVTPADILAEMSYFLNLAEGIGRVDDIDHLGNRRIRAVGELLANQVRLGLSRMERNVRERMSVQD--------------NEVLTPQQIINIRPVTAAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKVDREAGVVTNEIVWLTADEEDEFIVAQANSKLNEKGGFAEPIVMGRHQGNNQEFPSDQVDYMDVSPKQVVAVATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVI--AQHDGKVTYADADKVEVRREDGSLD-VYQIQKFRRSNSGTAYNQRTLVKVGDVVEKGDFIADGPSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVGEDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVF---DGASSEDLWDTVRE 941
Score = 538, Expect = 2.7e-52, Identities = 109/194 (56%), Positives = 137/194 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           G++   L    ATPVF+G +  DL + + EAG+D            K  L DGRTGE FD  VSVG+MYM+KL HMVDDK+H+R+VGPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGA++ L+E+LT KSDDV GR   Y AI KGKPIP+ G+PESF++L K+LQ LGL + +  E    N    +D++E
  S:   912 GMAARNLGIHIATPVFDGASSEDLWDTVREAGMD---------SDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSVGPYSMVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVNGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDE--DDNEVELRDLDE 1094
>gi|116628956|ref|YP_814128.1| DNA-directed RNA polymerase subunit beta [Lactobacillus gasseri ATCC 33323] >gi|122274046|sp|Q046D2|RPOB_LACGA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|116094538|gb|ABJ59690.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Lactobacillus gasseri ATCC 33323] (1212 aa)
Score = 1984, Expect = 0.0e+00, Identities = 442/1100 (40%), Positives = 651/1100 (59%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETT--YQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           RR +S+I++    PNL ++Q  ++  F++  +      I PI    G+ SLE++  KL KPK + +EAR+    Y  PL+V L + ++E+GE+K            T  +FF   P++T+ GTF++NG E+ ++SQ+VRSPG Y         S+  K  ++ +   ++P +G  +  +  + KD   V       + T  +P+T  ++ALG                                                   +G D+++ ++F +  SL+  LE             ++  N    + A+ L        K+I  + R    +TT   +S++Y  FF  + +DL+  GR+K+ +K+ L  RL ++ LAE L D + G+++ KK  ++    LD +          +V      E +  + + V  ++I VY   D +     +     + D   L+ +D+L+  +Y  NL  +IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D +              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI SLATYA  ++ GF+ TPYR V      +TD+I +LTA  ED YIIA +N  + E   FK+  VL R++          +D++D+ PKQVVS+ ++ IPFLENDD+NRALMGAN QRQA PLI+P APIVGTG EY+ AHDSG A V   +  G V YVD   I+I+   +    Y L KF +SN     NQ P V  GE+V     IADGPAM NGELALGQN ++AF TW+ YNYEDA+++S+R+  +D++TSIHI +Y  +   TK G EEITR+IPNV E + K LD+EGI+ +GAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  V+ F  E   EL   V + ++VY+VQKRKIQ+GDKM+GRHGNKG I+ + P EDMP+L DG  +DI LNP+GVPSRMNIGQ+LELHLG+A K+L +     ++     AS+  +W  + E
  S:    17 RRSFSRIKEVLKLPNLTDVQTQSYKWFLNEGIREMFDDIMPISDFSGKLSLEFVDYKLLKPKYTLEEARDHDANYSAPLHVTLKLTNHETGEIK------------TQDVFFGEFPLMTDSGTFVINGAERIIVSQLVRSPGVYYH-------SDFDKNGRQIFGATVIPNRGA-WLEYETDAKDLAYVRI-----DRTRKLPLTVLIRALG---------------------------------------------------FGSDSEVADMFGESDSLRFTLE------------KDIHKNPADSRVAEAL--------KDIYERLRPGEPKTTDSSRSLLYARFFDPRRYDLAPVGRYKINKKLSLKNRLLRQTLAETLADPDTGEIIAKKGDVVTHEILDKLSPYLDRDDFKMVTYEPSKEGV--LPDPVTVQEIKVYSKVDPERVIKLMSNGHIADDVKHLTPADVLASINYFFNLQDNIGTTDDIDHLGNRRIRRVGELLQNQFRIGLARMERVVRERMSIQDIS--------------TVTPQQLINIRPVVASVKEFFGSSQLSQFMDQNNPLGELTHKRRMSALGPGGLSRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLINSLATYAIVNKYGFIETPYRRVSWDTHKVTDKIDYLTADVEDNYIIAGANAPLNEDGSFKDKIVLARHKEDNLEVTPDKIDYMDVIPKQVVSVTSACIPFLENDDSNRALMGANHQRQAVPLINPHAPIVGTGMEYRAAHDSGDALV--AKAPGVVEYVDANEIRIRRDDDTLDKYVLEKFRRSNATKNYNQTPAVKQGERVVADEVIADGPAMENGELALGQNPIIAFLTWNMYNYEDAVMISERMVKDDVYTSIHIEDYESEARDTKLGPEEITREIPNVGEDALKDLDEEGIVRIGAEVQDGDILVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVQNVQVFTREAGDELPPGVNKMVRVYIVQKRKIQVGDKMSGRHGNKGTIALVCPEEDMPYLPDGRPVDICLNPMGVPSRMNIGQVLELHLGIAAKQLGIHVATPVF---DGASEDDMWNMVRE 1006
Score = 537, Expect = 3.5e-52, Identities = 107/177 (60%), Positives = 131/177 (74%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           GI+ ++L    ATPVF+G +  D+   + EAGI         GK GK  L DGRTGE F   VSVGIMY LKL HMVDDKIH+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR   Y AI+KG+ IP+ G+PESF++L K+LQ LGL + +
  S:   977 GIAAKQLGIHVATPVFDGASEDDMWNMVREAGI---------GKDGKTVLYDGRTGEPFHNRVSVGIMYYLKLTHMVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKAYEAIVKGERIPKPGVPESFRVLVKELQSLGLDIKV 1144
>gi|46360938|gb|AAS89202.1| RpoB [Corynebacterium renale] (1146 aa)
Score = 1984, Expect = 0.0e+00, Identities = 409/833 (49%), Positives = 554/833 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SL+TYA  +  GF+ TPYR V NG +TD + +LTA  ED Y IA +   V  +    ++++  R +    +    + VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+ P +P VGTG E + A+D+G   +   +K G V  +    I I   + ++  Y L KF ++NQ TC NQ P+V+ G++V  G  +ADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNV +     LD+ GI+ +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+RF  +DD +L A V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP +EDGT +DI+LN  GVP RMNIGQ+LE HLG LA     L +                    ++E +  L+K L + L+     SL                             TATPVF+G    ++   +  +  +  +G +   + GK  L+DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V +
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSTYARVNSFGFIETPYRKVDNGHVTDIVEYLTADEEDRYAIAEATTEVNADGDIIQERIEVRVKDGDIQVTGPQGVDYLDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRPESPYVGTGMEQRAAYDAGDLVI--SKKAGVVEDMSADYITIMDDNGQRDTYLLRKFERTNQGTCYNQTPLVNTGDRVEAGQPLADGPGTHNGEMALGRNLLVAFMPWEGHNYEDAIILNQRIVEEDILTSIHIEEHEIDARDTKLGAEEITREIPNVGDEVLADLDERGIVRIGADVRAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIGVQRFSRDDDDDLPAGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPPEDMPFMEDGTPVDIILNTHGVPRRMNIGQVLETHLGWLASAGWQLDE--------------------NDERNAELLKTLPEELHSVPAGSL-----------------------------TATPVFDGATNEEIAGLLRSSRPNR-DGDVMVDEDGKAMLLDGRSGEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNVEV 1117
Score = 245, Expect = 2.8e-18, Identities = 72/242 (29%), Positives = 123/242 (50%)
  Q:    10 EISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFID-------------------TELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           EI     R  ++K ++    P LL++Q+++F   I                    + LE  ++ + PI+   G  SL     + E  K + +EA+ +   Y  PLYV    ++NE+ E+K  T            +F    PM+TEKGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   ++I++ F   + + ++L+++
  S:     9 EIPGAPKRYSFAKYQEPIEIPGLLDVQRDSFSWLIGAPEWRAEQQELRGEDARVVSGLEEILEELSPIEDYSGNMSLSLSEPRFEPVKNTIEEAKEKDINYSAPLYVTAEFINNETQEIKSQT------------VFIGDFPMMTEKGTFIVNGTERVVVSQLVRSPGVYF--DQSIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTQQIVDRFGFSEIMMSTLESD 245
>gi|158564067|sp|Q04C22|RPOB_LACDB DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1221 aa)
Score = 1983, Expect = 0.0e+00, Identities = 437/1074 (40%), Positives = 639/1074 (59%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETT--YQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGV--ITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           RR +S+I++    PNL ++Q  ++  F+D  ++     I PI    GR +LEY+  KL++PK +  E+R    TY  P++V L + ++E+GE+K            T  +FF  +P++T+ G+FIVNG E+ ++SQ+VRSPG Y   +         K  ++ +   ++P +G  L F   A+N  +++V       + T  +P++  ++ALG                                                   +G D++++E+F    +L   L+             +V  N    + A+ L        K+I  + R    +TT   +S++ + FF  + +DL+  GR+K+ +K+ L  RL    LAE L D + G+V+  K T++    +D +K          V     DE +  +   V  ++I V+       E   I     + D   ++ +DI++  +Y + L   +G  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D A              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI S+ATYA  ++ GFL TPYR V      +TD+I +LTA  ED YIIA +N  + E   F +D +LCR+R          +D+ID+ PKQVVS+ ++ IPFLENDD+NRALMGAN QRQA PLI+P  P+V TG EY+  HDSG A +   E DG V YVD   I+++   +    Y L K+ +SN     NQ P V  G+KV  G  IA+GP+M++GELALGQN ++AFTTW+ YN+EDAI+LS+RL  ED++TSIHI +Y  +   TK G EEITR+IPNV E + K LD+ GII +GAEV +GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  V+ F  E   EL   V   ++VY+VQKRKIQ+GDKM+GRHGNKG ++ I PVEDMP+L DGT +DI LNP+GVPSRMNIGQ+LE+HLG A + L
  S:    15 RRSFSRIKEILPLPNLTDVQTESYKWFLDEGVKEVFDDILPISDTSGRLTLEYVDYKLQEPKYTVDESRKHDATYSAPMHVTLKLTNHETGEIK------------TQDVFFGDLPLMTKSGSFIVNGAERVIVSQLVRSPGVYYSGEFD-------KNGRQIFGTTVIPNRGAWLEFETDAKNISYVRV-------DRTRKLPLSVLVRALG---------------------------------------------------FGSDSEIKEIFGDSDTLDLTLD------------KDVHKNPADSRVAEAL--------KDIYDRLRPGEPKTTDSSRSLLVSRFFDPRRYDLAAVGRYKVNKKLSLKNRLLGYTLAETLADPDTGEVLAAKGTVVNNEVMDVLKDYLDRDDFKTVTYTPSDEGV--IPEPVTVQEIKVFSREIPDREIKLISNGHIAEDVKCITPADIIASVNYFLELQEGVGNIDDIDHLGNRRIRRVGELLQNQMRIGLARMERVVRERMSIQDAA--------------TVTPQQLINIRPIVGSIKEFFGSSQLSQFMDQNNPLGELTHKRRMSALGPGGLSRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLINSMATYAIINKYGFLETPYRRVSWATHKVTDKIDYLTADEEDNYIIAGANTPLNEDGSFVDDVILCRHREDNVEVSPDRIDYIDVIPKQVVSVTSACIPFLENDDSNRALMGANHQRQAVPLINPHGPLVATGMEYRAGHDSGDALL--AEADGEVEYVDANEIRVRREDQTLDTYTLEKYRRSNATKNYNQTPNVKRGDKVVDGQVIANGPSMADGELALGQNPVIAFTTWNMYNFEDAIMLSERLVKEDVYTSIHIEDYDSEARDTKLGPEEITREIPNVGEDALKDLDENGIIRIGAEVHDGDILVGKVTPKGITELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGVVQDVQVFTREAGDELAPGVNTLVRVYIVQKRKIQVGDKMSGRHGNKGTVALIAPVEDMPYLPDGTPVDICLNPMGVPSRMNIGQLLEIHLGRAARAL 981
Score = 510, Expect = 4.7e-49, Identities = 103/183 (56%), Positives = 130/183 (71%)
  Q:  1169 ATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           ATPVF+G +  D+ + + EAG+D           GK  L DGRTGE F   VSVG+MY LKL HMVDDKIH+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR   Y AI+KG+ I + G+PESF++L K+LQ LGL + +       N    +D++E
  S:   986 ATPVFDGASEDDVWDFVREAGVD---------SDGKTVLYDGRTGEPFHNRVSVGVMYYLKLTHMVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKAYEAIVKGERITKPGVPESFRVLVKELQSLGLDLRVLDS--DENEVELRDMDE 1157
>gi|46360928|gb|AAS89197.1| RpoB [Corynebacterium minutissimum] (1118 aa)
Score = 1982, Expect = 0.0e+00, Identities = 411/831 (49%), Positives = 551/831 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN---KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQV 1332
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +G +TD++ +LTA  ED Y IA     VEK+       D++  R +       D   VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V  V    I I     ++  Y L KF ++NQNT  NQ P+VS+G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNVS+   + LD+ GI+ +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  EDD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP +EDGT +DI+LN  GVP RMNIGQ+LE+HLG LA     +                       + A+ +L+K L + L +   +SL                             TATPVF+G    ++   +  +  +  +G +   + GK  L DGR+GE +   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVVDGKVTDQVEYLTADEEDRYAIA--QAEVEKDADGTLTADRIEVRLKDGDIGVTDASGVDYVDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPYVGTGMEQRAAYDAGDLII--TPKAGVVENVTADLITIMDDEGQRDTYMLRKFERTNQNTNYNQTPLVSLGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRIVEEDILTSIHIEEHEIDARDTKLGPEEITREIPNVSDDVLRDLDERGIVRIGADVRAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVSRFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPPEDMPFMEDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAHAGWKIDT--------------------EDPANADLLKKLPEELYDVPPESL-----------------------------TATPVFDGATNEEISRLLASSKPNR-DGDVMVDEHGKARLFDGRSGEPYMYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNV 1115
Score = 232, Expect = 8.0e-17, Identities = 73/249 (29%), Positives = 122/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL+LQ +++   I T                    LE  ++ + PI+   G  SL     + E  K +  E + +   Y  PLYV    ++N++ E+K  T            +F    PM+T+KGTFIVNG E+ ++SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG  +E+I   F   + + ++L+++      V  TDE +
  S:    16 RYSFAKISEPIAVPGLLDLQLDSYAWLIGTPEWREREQAERGDDARVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEPVKNTVDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVIVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTEEQIKERFGFSELMMSTLESD-----GVANTDEAL 254
>gi|46360964|gb|AAS89215.1| RpoB [Corynebacterium falsenii] (1109 aa)
Score = 1982, Expect = 0.0e+00, Identities = 418/847 (49%), Positives = 559/847 (65%)
  Q:   478 TLSISDILSITSYVINL-------------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQ 1324
           TL+  DIL+   Y++ L             +  I   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QFLDQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V +G ITDE+ + TA  ED ++IA +N   ++N +F ED++  R R    E      VDF+D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V YV    I +      +  + L KF ++NQ T  NQ P+V  GE+V  G  +ADGP    GE+ALG+N+LVAF  W G+NYEDAIIL++R+  ED+ TSIHI EY +D   TK G EEITRDIPNV +     LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT IDI+LN  GVP RMNIGQ+LE+HLG                          W     +A   +  N E    +K +++L +        DL    + S          TATPVF+G + ++L   +  +  +    +L +   GK  L+DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G PESFK+L K+
  S:   311 TLTEEDILTTIEYLVRLHAGERTMTSPAGVEIPIA-TDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFLDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYARVNPFGFIETPYRRVVDGQITDEVHYFTADEEDRHVIAQANTPFDENHRFTEDRIEVRLRGGDVEVVPFDQVDFMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPFVGTGMELRAAYDAGDMII--APKAGVVEYVSADYITVMDDDGVRDTFMLRKFERTNQGTSYNQKPLVDEGERVEAGQVLADGPGTDQGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDVLTSIHIEEYEIDARDTKLGPEEITRDIPNVGDDVLADLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRVFSREDDDDLAAGVNEMVRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPIDIILNTHGVPRRMNIGQVLEVHLG--------------------------WLA---KAGWKVDTNSEDPKIQKMLETLPE--------DLYDVPADS---------LTATPVFDGASNSELSGLLRSSRPNRDGIRLVD-DFGKAQLMDGRSGEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGXPESFKVLLKE 1109
Score = 233, Expect = 7.5e-17, Identities = 75/249 (30%), Positives = 123/249 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDELI 265
           R  ++KI+     P LL+LQ+ +F   + +                    LE  ++ + PI+      SL     + ++ K +  EA+++   Y  PLYV     +  SGE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      +  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALGL  +EI + F   + + ++L      EKD V  TDE +
  S:    16 RYSFAKIDSPIEVPGLLDLQRESFAWLVGSADWRARAQAEAGEGVRVTSGLEDILEELSPIEDYSENMSLTLSEPRFDEVKSTIDEAKDKDINYAAPLYVTAEFTNAMSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DESMDASTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGLTTQEITDRFGFSEIMMSTL------EKDGVANTDEAL 254
>gi|104773535|ref|YP_618515.1| DNA-directed RNA polymerase subunit beta [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|122397386|sp|Q1GBM5|RPOB_LACDA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|103422616|emb|CAI97221.1| DNA-directed RNA polymerase beta chain [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (1221 aa)
Score = 1982, Expect = 0.0e+00, Identities = 437/1074 (40%), Positives = 638/1074 (59%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETT--YQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDI-NGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGV--ITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           RR +S+I++    PNL ++Q  ++  F+D  ++     I PI    GR +LEY+  KL++PK +  E+R    TY  P++V L + ++E+GE+K            T  +FF  +P++T+ G+FIVNG E+ ++SQ+VRSPG Y   +         K  ++ +   ++P +G  L F   A+N  +++V       + T  +P++  ++ALG                                                   +G D++++E+F    +L   L+             +V  N    + A+ L        K+I  + R    +TT   +S++ + FF  + +DL+  GR+K+ +K+ L  RL    LAE L D   G+V+  K T++    +D +K          V     DE +  +   V  ++I V+       E   I     + D   ++ +DI++  +Y + L   +G  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D A              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI S+ATYA  ++ GFL TPYR V      +TD+I +LTA  ED YIIA +N  + E   F +D +LCR+R          +D+ID+ PKQVVS+ ++ IPFLENDD+NRALMGAN QRQA PLI+P  P+V TG EY+  HDSG A +   E DG V YVD   I+++   +    Y L K+ +SN     NQ P V  G+KV  G  IA+GP+M++GELALGQN ++AFTTW+ YN+EDAI+LS+RL  ED++TSIHI +Y  +   TK G EEITR+IPNV E + K LD+ GII +GAEV +GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  V+ F  E   EL   V   ++VY+VQKRKIQ+GDKM+GRHGNKG ++ I PVEDMP+L DGT +DI LNP+GVPSRMNIGQ+LE+HLG A + L
  S:    15 RRSFSRIKEILPLPNLTDVQTESYKWFLDEGVKEVFDDILPISDTSGRLTLEYVDYKLQEPKYTVDESRKHDATYSAPMHVTLKLTNHETGEIK------------TQDVFFGDLPLMTKSGSFIVNGAERVIVSQLVRSPGVYYSGEFD-------KNGRQIFGTTVIPNRGAWLEFETDAKNISYVRV-------DRTRKLPLSVLVRALG---------------------------------------------------FGSDSEIKEIFGDSDTLDLTLD------------KDVHKNPADSRVAEAL--------KDIYDRLRPGEPKTTDSSRSLLVSRFFDPRRYDLAAVGRYKVNKKLSLKNRLLGYTLAETLADPGTGEVLAAKGTVVNNEVMDVLKDYLDRDDFKTVTYTPSDEGV--IPEPVTVQEIKVFSREIPDREIKLISNGHIAEDVKCITPADIIASVNYFLELQEGVGNIDDIDHLGNRRIRRVGELLQNQMRIGLARMERVVRERMSIQDAA--------------TVTPQQLINIRPIVGSIKEFFGSSQLSQFMDQNNPLGELTHKRRMSALGPGGLSRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLINSMATYAIINKYGFLETPYRRVSWATHKVTDKIDYLTADEEDNYIIAGANTPLNEDGSFVDDVILCRHREDNVEVSPDRIDYIDVIPKQVVSVTSACIPFLENDDSNRALMGANHQRQAVPLINPHGPLVATGMEYRAGHDSGDALL--AEADGEVEYVDANEIRVRREDQTLDTYTLEKYRRSNATKNYNQTPNVKRGDKVVDGQVIANGPSMADGELALGQNPVIAFTTWNMYNFEDAIMLSERLVKEDVYTSIHIEDYDSEARDTKLGPEEITREIPNVGEDALKDLDENGIIRIGAEVHDGDILVGKVTPKGITELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGVVQDVQVFTREAGDELAPGVNTLVRVYIVQKRKIQVGDKMSGRHGNKGTVALIAPVEDMPYLPDGTPVDICLNPMGVPSRMNIGQLLEIHLGRAARAL 981
Score = 510, Expect = 4.5e-49, Identities = 103/183 (56%), Positives = 130/183 (71%)
  Q:  1169 ATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINE 1351
           ATPVF+G +  D+ + + EAG+D           GK  L DGRTGE F   VSVG+MY LKL HMVDDKIH+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR   Y AI+KG+ I + G+PESF++L K+LQ LGL + +       N    +D++E
  S:   986 ATPVFDGASEDDVWDFVREAGVD---------SDGKTVLYDGRTGEPFHNRVSVGVMYYLKLTHMVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKAYEAIVKGERITKPGVPESFRVLVKELQSLGLDLRVLDS--DENEVELRDMDE 1157
>gi|46360944|gb|AAS89205.1| RpoB [Corynebacterium ammoniagenes] (1116 aa)
Score = 1982, Expect = 0.0e+00, Identities = 406/833 (48%), Positives = 551/833 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V+NG +TDE+R+LTA  ED Y IA + +  + +     D++  R +       D   VD++D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PL+   AP VGTG E + A+D+G   +    K G V  V+   I I      +  Y L KF ++NQ T  NQ P+V++G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIILS+R+  ED+ TSIHI E+ +D   TK G EEITR+IPNVSE   + LDD GII +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  EDD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ K++P EDMP + DGT +D++LN  GVP RMNIGQ+LELHLG                          W      A      + E   NE+ +K+L +   E  D           +  + L   TATPVF+G    ++   +  +  +  +G +   + GK  L DGR+GE +   +SVG MY+LKL H++D+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V +
  S:   346 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVENGRVTDEVRYLTADEEDRYSIAQAEVEQDADGNIVGDRIEVRLKDGDIGVTDANGVDYVDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLVRGEAPYVGTGMELRAAYDAGDMVI--SPKAGVVENVNADLITIMDDEGVRDTYMLRKFERTNQGTNYNQTPLVNMGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILSQRIVEEDVLTSIHIEEHEIDARDTKLGAEEITREIPNVSEDVLRDLDDRGIIRIGADVRAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVARFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKVLPPEDMPFMADGTPVDVILNTHGVPRRMNIGQVLELHLG--------------------------WL-----AHTGWTVDTEDPKNEELLKTLPE---ELYD-----------VPADSL---TATPVFDGATNEEISRLLASSKPNR-DGDVMVDEDGKTVLFDGRSGEPYQYPISVGFMYILKLHHLIDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNVEV 1116
Score = 231, Expect = 1.2e-16, Identities = 69/235 (29%), Positives = 116/235 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           R  ++KI +    P LL+LQ  +F   I T                   LE  +  + PI+   G  SL     + E  K +  E + +   Y  PLYV    ++N++ E+K  T            +F    PM+T++GTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG  +++I + F   + + ++L+++
  S:    16 RYSFAKISEPIAVPGLLDLQLESFAWLIGTSEWRERQQEERGEEHVSSGLEDILAELSPIQDYSGNMSLSLSEPRFEPVKNTVDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPMMTDEGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTEQQIRDRFGFSELMMSTLESD 244
>gi|55981782|ref|YP_145079.1| DNA-directed RNA polymerase subunit beta [Thermus thermophilus HB8] >gi|41018085|sp|Q8RQE9|RPOB_THET8 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|21730339|pdb|1IW7|C Chain C, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution >gi|21730345|pdb|1IW7|M Chain M, Crystal Structure Of The Rna Polymerase Holoenzyme From Thermus Thermophilus At 2.6a Resolution >gi|49259057|pdb|1SMY|C Chain C, Structural Basis For Transcription Regulation By Alarmone Ppgpp >gi|49259063|pdb|1SMY|M Chain M, Structural Basis For Transcription Regulation By Alarmone Ppgpp >gi|78101159|pdb|1ZYR|C Chain C, Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme In Complex With The Antibiotic Streptolydigin >gi|78101165|pdb|1ZYR|M Chain M, Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme In Complex With The Antibiotic Streptolydigin >gi|78101221|pdb|2A68|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Antibiotic Rifabutin >gi|78101227|pdb|2A68|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Antibiotic Rifabutin >gi|78101233|pdb|2A69|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Antibiotic Rifapentin >gi|78101239|pdb|2A69|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Antibiotic Rifapentin >gi|78101245|pdb|2A6E|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme >gi|78101251|pdb|2A6E|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme >gi|78101257|pdb|2A6H|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Antibiotic Sterptolydigin >gi|78101263|pdb|2A6H|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Antibiotic Sterptolydigin >gi|78101759|pdb|2CW0|C Chain C, Crystal Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme At 3.3 Angstroms Resolution >gi|78101765|pdb|2CW0|M Chain M, Crystal Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme At 3.3 Angstroms Resolution >gi|83754374|pdb|2BE5|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Inhibitor Tagetitoxin >gi|83754380|pdb|2BE5|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase Holoenzyme In Complex With Inhibitor Tagetitoxin >gi|151567771|pdb|2O5I|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase Elongation Complex >gi|151567776|pdb|2O5I|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase Elongation Complex >gi|151567787|pdb|2O5J|C Chain C, Crystal Structure Of The T. Thermophilus Rnap Polymerase Elongation Complex With The Ntp Substrate Analog >gi|151567792|pdb|2O5J|M Chain M, Crystal Structure Of The T. Thermophilus Rnap Polymerase Elongation Complex With The Ntp Substrate Analog >gi|152149353|pdb|2PPB|C Chain C, Crystal Structure Of The T. Thermophilus Rnap Polymerase Elongation Complex With The Ntp Substrate Analog And Antibiotic Streptolydigin >gi|152149358|pdb|2PPB|M Chain M, Crystal Structure Of The T. Thermophilus Rnap Polymerase Elongation Complex With The Ntp Substrate Analog And Antibiotic Streptolydigin >gi|20160390|dbj|BAB89400.1| DNA-directed RNA polymerase beta chain [Thermus thermophilus] >gi|55773195|dbj|BAD71636.1| DNA-directed RNA polymerase beta chain (RpoB) [Thermus thermophilus HB8] (1119 aa)
Score = 1981, Expect = 0.0e+00, Identities = 407/836 (48%), Positives = 559/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA--------------------MKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +          SE+     SLT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  DE GF+ TPYR V  GV+TDE+ ++TA  ED Y IA +N  +E N+   ++V+ R +        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V+ VDG  I ++      V Y L +F +SNQ T  +Q P V VG++V KG  +ADGPA  NG LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EG++ +GAEVK GD+LVG+ S KG+ E T EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++VYV QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA                    +K+L L++  E+Y+ K+    F                     +++++++ L +A K        L L   G + E+                 LKE   +               GK  L DGRTGE  +G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LT+KSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMG---------SED-----SLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKEL-LAQAFEVYFGKRKGEGFG--------------------VDKREVEVLRRAEK--------LGLVTPGKTPEE----------------QLKELFLQ---------------GKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1104
Score = 174, Expect = 4.4e-10, Identities = 42/143 (29%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ + +  +          ++   +  FPI    K  GG   L+++  +L +P   + E R +  TY  PLY  L ++  ++G +K+            D +F   IP++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGG-LVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|111018959|ref|YP_701931.1| DNA-directed RNA polymerase subunit beta [Rhodococcus sp. RHA1] >gi|123340762|sp|Q0SFB3|RPOB_RHOSR DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|110818489|gb|ABG93773.1| DNA-directed RNA polymerase beta subunit [Rhodococcus sp. RHA1] (1168 aa)
Score = 1980, Expect = 0.0e+00, Identities = 433/942 (45%), Positives = 602/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL---DYDIGF---------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFG-------IHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   ++   +A V +Y+       N  Q    PI+ +       TL+  DI++   Y++ L   D ++            DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V+NG +TD++ +LTA  ED +++A +N  ++ N  F +D++L R +    EF    ++D++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V  D  T+    GS  K Y + KF +SNQ TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GII +GAEV++GDVLVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  +DD +L   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP                 +++ + ++LE +           W G       I  + SR    +  + L E+ + +   +N                          ATPVF+G    +L   +  + +   +G++     GK  L DGR+GE F   VSVG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   275 TKESAQTLLENLFFKDKRYDLARVGRYKINKKLGLNLGQ----PIVAS-------TLTEEDIVATIEYLVRLHAGDTEMTAPGGSAVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGQVTDQVDYLTADEEDRHVVAQANSALDANGHFTDDRILVRRKGGEVEFVSSAEIDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAVDAGDVIV--TEKTGVVEEVSADYVTVMADDGSR-KTYRMRKFARSNQGTCANQRPIVDEGQRVEFGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIIRIGAEVRDGDVLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIGIRVFSRDDDDDLPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVP-----------------RRMNIGQILETHLG---------WIGKTGWNVQIAGDGSR---PDWAEQLPEEMLSAPADSN-------------------------IATPVFDGAKEDELT-GLLGSTLPNRDGEVMVASDGKATLFDGRSGEPFPYPVSVGYMYIIKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIAMADGDDEDLERAAANLGINLSRNE 1159
Score = 256, Expect = 1.6e-19, Identities = 78/276 (28%), Positives = 135/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFI-------------DTELEGTIKSIF----PIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++KI +    P LL++Q ++F   I             D+ + G ++ I     PI+   G  SL +   + ++ K S  E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y         S  +   ++ +  +++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + +  +L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    25 RVSFAKIREPLEVPGLLDVQTDSFEWLIGAQSWRERAAARGDSAISGGLEDILAELSPIEDFSGSMSLSFSDPRFDEVKASTDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDKGTFIINGTERVVVSQLVRSPGVY------FDHSVDKGTEKDLHSVKVIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEILMATLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 289
>gi|158513166|sp|A1T4J2|RPOB_MYCVP DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1167 aa)
Score = 1980, Expect = 0.0e+00, Identities = 430/942 (45%), Positives = 597/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL---DYDIGF---------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLE--LYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L   D  +            DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ +  F+E++VL R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GII +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE  L +  K   +  +  G  E A++         L E+ + +   +                           ATPVF+G    +L + +  + +   +G+      GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   277 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNVGQ----PITSS-------TLTEEDVVATIEYLVRLHQGDQTMTAPGGSEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVTDGVVTDQIDYLTADEEDRHVVAQANSPLDGDGHFEEERVLVRRKGGEVEFVSAAEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--TEKAGVVEEVSADYITVMADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVESGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIIRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWVAKAGWNIDVAAGTPEWAAK---------LPEQMLSAPADS-------------------------IVATPVFDGAQEGEL-QGLLGSTLPNRDGETMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1159
Score = 257, Expect = 9.7e-20, Identities = 80/276 (28%), Positives = 135/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   I  E                 L+  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + + ++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    27 RISFAKLREPLEVPGLLDVQTESFEWLIGAEDWFQRAADRGDVDPKGGLQEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMSTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 291
>gi|86739286|ref|YP_479686.1| DNA-directed RNA polymerase subunit beta [Frankia sp. CcI3] >gi|108884786|sp|Q2JFI5|RPOB_FRASC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|86566148|gb|ABD09957.1| DNA-directed RNA polymerase, beta subunit [Frankia sp. CcI3] (1141 aa)
Score = 1980, Expect = 0.0e+00, Identities = 413/865 (47%), Positives = 558/865 (64%)
  Q:   475 DKPTLSISDILSITSYVINL-------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           D   L+ +DI+    YV+ L       +Y++   DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S KEFF + QL+QF+DQ NPLA LT+KRR++A+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI SL+T+A  +  GF+ TPYR V+NG +T +I WLTA  ED ++ A +N  +  +  F ED+VL R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMG+NMQRQ+ PL+   AP+VGTG E + A D+G   V    + G V  +    I +       + Y L KF +SNQ TC NQ PIV+ G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNV+E     LD+ GII +GAEV  GDVLVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  ED  EL   V E ++VYV QKRKI  GDK+AGRHGNKG+I+KI+P EDMP LEDGT +D++LNP GVP                 +++ + ++LE +      + + +  G  +   R                                 L   G          ATPVF+G    ++   + ++ +   +G    G SGK  L DGRTGE +   V+VG +Y+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G
  S:   303 DVGVLTENDIVRTIEYVVKLHAGADPAEYEV---DDIDHFGNRRIRTVGELIQNQVRLGLARMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQTNPLAGLTHKRRLNALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSTFARVNPFGFIETPYRKVENGRVTGQIDWLTADEEDRHVKAQANTPLRPDGSFAEDRVLVRRKGGEVEFIPPDEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGSNMQRQSVPLLRSEAPLVGTGMEARAAKDAGDVVVC--AQAGVVEDLSADYITVMHDDGTRRTYRLAKFRRSNQGTCINQKPIVNEGDRVGAGQVIADGPCTDNGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVAEEVLADLDERGIIRIGAEVSPGDVLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDGDELPPGVNELVRVYVAQKRKITDGDKLAGRHGNKGVIAKILPAEDMPFLEDGTPVDVVLNPHGVP-----------------RRMNIGQILETHLGWVAKTGWQVDSGTEDWKER---------------------------------LRGIGADAASAGTNVATPVFDGAREEEIT-GLLDSTLPNRDGIQLIGSSGKAKLFDGRTGEPYPYPVAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDG 1107
Score = 278, Expect = 3.7e-22, Identities = 84/278 (30%), Positives = 141/278 (50%)
  Q:    20 YSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           ++KI +    P+LL LQ  +F   I ++                      LE   K I PI+   G  SL +   + E PK S +E +++  T+  PL+V     +N +GE+K  T            +F    P++T KGTF++NG E+ V+SQ+VRSPG Y   +S  K S+     ++ Y C+++P++G  +  F  + +D + V       +S     +T  LKALG ++  IL  F +  S++ +L+ +    +D    D L+++ + L   +        T L  LF   K+Y   K
  S:    12 FAKIIEPLEVPDLLALQTQSFDWLIGSDAWAERVQEAIDSGRDDVPITSGLEEVFKEISPIEDFSGSMSLSFRDHRFEPPKYSVEECKDKDMTFSAPLFVTAEFTNNNTGEIKSQT------------VFMGDFPLMTPKGTFVINGTERVVVSQLVRSPGVY-FERSLDKASD-----KDLYSCKVIPSRGA-WLEFEIDKRDTVGVRIDRKRRQS-----VTVLLKALGWDEARILERFGDFPSMRITLEKDHTAGQD----DALLDIYRKLRPGEPPTRESAQTLLENLFFNPKRYDLAK 286
>gi|120402269|ref|YP_952098.1| DNA-directed RNA polymerase subunit beta [Mycobacterium vanbaalenii PYR-1] >gi|119955087|gb|ABM12092.1| DNA-directed RNA polymerase, beta subunit [Mycobacterium vanbaalenii PYR-1] (1161 aa)
Score = 1979, Expect = 0.0e+00, Identities = 430/942 (45%), Positives = 597/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL---DYDIGF---------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLE--LYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L   D  +            DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ +  F+E++VL R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GII +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE  L +  K   +  +  G  E A++         L E+ + +   +                           ATPVF+G    +L + +  + +   +G+      GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   271 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNVGQ----PITSS-------TLTEEDVVATIEYLVRLHQGDQTMTAPGGSEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVTDGVVTDQIDYLTADEEDRHVVAQANSPLDGDGHFEEERVLVRRKGGEVEFVSAAEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--TEKAGVVEEVSADYITVMADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVESGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIIRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWVAKAGWNIDVAAGTPEWAAK---------LPEQMLSAPADS-------------------------IVATPVFDGAQEGEL-QGLLGSTLPNRDGETMVNADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1153
Score = 257, Expect = 1.0e-19, Identities = 80/276 (28%), Positives = 135/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   I  E                 L+  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + + ++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    21 RISFAKLREPLEVPGLLDVQTESFEWLIGAEDWFQRAADRGDVDPKGGLQEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMSTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 285
>gi|42561522|ref|NP_975973.1| DNA-directed RNA polymerase subunit beta [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81400331|sp|Q6MRX6|RPOB_MYCMS DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|42493021|emb|CAE77615.1| DNA-directed RNA polymerase beta chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1291 aa)
Score = 1979, Expect = 0.0e+00, Identities = 476/1082 (43%), Positives = 678/1082 (62%)
  Q:     9 KEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLE---------------------------YIGMKLEKPKRSEKEARNEGKTYDRPL--------------------------YVDLAIVDNESGEV--------KKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIG------ESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVI-TDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVE-----DDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           ++I++ V RRDY+K+  N + PNL+ +Q   F  F    ++  +   FPI S  G   L                            Y  +KL   K  E +   +G   D  L                          + +L I  +E  ++        KKT+         +  +F    P++TE GTFI+NG +K ++SQ+VRSPGAY   +       +RK  +  Y  +I+P++GT       E +   + +  DAI       + +     T+ L A G++K++ILNI                     F+ DE++      +S   +       +++E++KK +        +G+ A              SE A+K                             I +  F  + +DL+KAGRFK+ +K+ +  R+  RV+AED+ D N  V+I K+T + KH +  I ++  +  + I  N      +S +    K +KI VY+D++ + +   +IG  +S ++  ++++DILS  SY++NL Y+IG  DDID+LGN+R++ + ELL+ + + GL RI+K + +KLA +D                 +   +IIN KP      EFFN  QL+QF+DQ NPL+ELTNKRR++A+G GG+SR+   L++RDVH SHYG+ICPIETPEG NIGLI +L+TYA  +E GF+ TPYR V NG+I  D++ +LTA  E  +IIA SN+N ++N K  ++ ++ R+        V+++D+ID+SPKQ+VS+A S IPFLENDDANRALMGANMQRQA PLI P +PIV TG E++ A DSG A V   ++D  V YVD  TI     S  + Y L+ + +SN  T   Q PIV VG+ V KG  IADGP+M  GELA+GQNV+VAF+T++GYN+EDAI++S+R+ ++D FTS HI EY+++   TK G EE+ R+IPN+SE +K++LD EGI+ +G EVK GDVLVGK++PKGQV+L+ E+KLL AIFG+KS+N K+ SL+VP+GGEG V  +KRFK +     D  EL AD+IE IKVYVVQKRKIQ GDKM+GRHGNKGIIS+I+PVEDMPHLEDGT +DI+LNP GVPSRMNIGQILE+HLG+A KKL
  S:     6 RKINRNVERRDYTKVSMNLSLPNLIGIQTETFEWFKTKGIQEVLDEFFPILSFDGSSVLTLENWGFKEPRLSVRQAKEESKIYDAPIYANLKLSVNKTEEIQKEFDGVVLDDALQILSKWLEEKTVSKNITFKQQSQNSYFFELTIKKSEKPDLIQIDIIEDKKTSLICNVSIYKSGEVFLGDFPLMTEAGTFIINGSQKVIVSQLVRSPGAYFNKEL------NRKTGEMIYFADIIPSRGTWL-----EYETDSKKIGNDAINPLYVKIDKSRKTTATSLLLAFGISKDDILNI---------------------FDNDEVLVETLQQDSIIGDFKIDWSNQVQEIYKKIT--------QGETA-------------TSEGASK----------------------------FINSILFDKRKYDLTKAGRFKLKQKLSIKNRILNRVIAEDIVDANNNVLIAKDTEVNKHNIKQISEILDQDVMSIDLNY-----LSDIPGTRKVQKIKVYKDSELKTDTTCLIGLTSSSNEEFITVADILSTVSYLLNLKYNIGEIDDIDNLGNRRVRTVGELLQNQFRMGLNRIDKNVKEKLATSD--------------LYKVKTSTIINAKPLTAIIGEFFNLSQLSQFMDQINPLSELTNKRRLTALGSGGLSRDRAGLEVRDVHPSHYGRICPIETPEGPNIGLINNLSTYARVNEYGFITTPYRKVINGIIQNDQVEYLTADQEKNFIIAQSNVNQDENGKILDEIIVSRFNGDDYMAKVEEIDYIDVSPKQIVSVATSGIPFLENDDANRALMGANMQRQAVPLIKPESPIVATGIEFEAARDSGEAIV--AKEDAIVKYVDSKTIITDGESGIRTYILSDYERSNNGTSLTQSPIVKVGDVVKKGEIIADGPSMDQGELAIGQNVVVAFSTYNGYNFEDAIVMSERIVIDDRFTSTHIDEYTLEVRNTKQGQEEVIREIPNMSEQAKRHLDAEGIVAIGTEVKVGDVLVGKVTPKGQVQLSPEDKLLHAIFGEKSRNVKDNSLRVPNGGEGIVQSIKRFKAKSALNPDGIELPADIIEVIKVYVVQKRKIQEGDKMSGRHGNKGIISRILPVEDMPHLEDGTPVDIILNPQGVPSRMNIGQILEIHLGMAAKKL 1059
Score = 572, Expect = 3.2e-56, Identities = 120/217 (55%), Positives = 153/217 (70%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEEMD 1374
           G++ +KL  K  TP FEG+N  +L+E M EAG+            GK  LIDG+TGE FD  ++VG+MYMLKL HMVDDKIH+R VGPYS ITQQPLGGK+QNGGQRFGEMEVWALEAYGAAH LRE+LTIKSDD+KGR+ TY AI++ K IPE G+PESF +L+K++ GLG  + +  E G+ +  N  D   + ++       N ED +I+ + D
  S:  1053 GMAAKKLNQKVITPAFEGLNEKELEEIMAEAGMT---------NYGKVTLIDGQTGEPFDKPIAVGVMYMLKLSHMVDDKIHARNVGPYSLITQQPLGGKAQNGGQRFGEMEVWALEAYGAAHTLREILTIKSDDIKGRSKTYEAIVRSKKIPEPGIPESFNVLSKEIMGLGFNMYMIDETGEKSVINAYDKKNFDAD-------NYEDDEILVKTD 1253
>gi|42518422|ref|NP_964352.1| DNA-directed RNA polymerase subunit beta [Lactobacillus johnsonii NCC 533] >gi|81668275|sp|Q74L95|RPOB_LACJO DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|41582707|gb|AAS08318.1| DNA-directed RNA polymerase beta chain [Lactobacillus johnsonii NCC 533] (1209 aa)
Score = 1979, Expect = 0.0e+00, Identities = 440/1100 (40%), Positives = 651/1100 (59%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETT--YQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE 1116
           RR +S+I++    PNL ++Q  ++  F++  +      I PI    G+ SLE++  KL KPK + +EAR+    Y  PL+V L + ++E+GE+K            T  +FF   P++T+ GTF++NG E+ ++SQ+VRSPG Y         S+  K  ++ +   ++P +G  +  +  + KD   V       + T  +P+T  ++ALG                                                   +G D+++ ++F +  S++  LE             ++  N    + A+ L        K+I  + R    +TT   +S++Y  FF  + +DL+  GR+K+ +K+ L  RL ++ LAE L D + G+++ KK  ++    LD +          +V      E +  + + V  ++I VY   D +     +     + D   L+ +D+L+  +Y  +L  +IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D +              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG+SR+    ++RDVHY+HYG++CPIETPEG NIGLI SLATYA  ++ GF+ TPYR V      +TD+I +LTA  ED YIIA +N  + E   FK+  VL R++          +D++D+ PKQVVS+ ++ IPFLENDD+NRALMGAN QRQA PLI+P APIVGTG EY+ AHDSG A V   +  G V YVD   I+I+   +    Y L KF +SN     NQ P V  GE+V     IADGPAM NGELALGQN ++AF TW+ YNYEDA+++S+R+  +D++TSIHI +Y  +   TK G EEITR+IPNV E + K LD+EGI+ +GAEV++GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  V+ F  E   EL   V + ++VY+VQKRKIQ+GDKM+GRHGNKG I+ + P EDMP+L DG  +DI LNP+GVPSRMNIGQ+LELHLG+A K+L +     ++     AS+  +W  + E
  S:    14 RRSFSRIKEVLKLPNLTDVQTQSYKWFLNEGIREMFDDIMPISDFSGKLSLEFVDYKLLKPKYTLEEARDHDANYSAPLHVTLKLTNHETGEIK------------TQDVFFGEFPLMTDSGTFVINGAERVIVSQLVRSPGVYYH-------SDFDKNGRQIFGATVIPNRGA-WLEYETDAKDLAYVRI-----DRTRKLPLTVLIRALG---------------------------------------------------FGSDSEIADMFGESDSIRFTLE------------KDIHKNPADSRVAEAL--------KDIYERLRPGEPKTTDSSRSLLYARFFDPRRYDLAPVGRYKINKKLSLKNRLLRQTLAETLADPDTGEIIAKKGDVVTHELLDKLSPYLDRDDFKMVTYEPSKEGV--LPDPVTVQEIKVYSKVDPERVVKLMSNGHIADDVKHLTPADVLASINYFFDLQDNIGTTDDIDHLGNRRIRRVGELLQNQFRIGLARMERVVRERMSIQDIS--------------TVTPQQLINIRPVVASVKEFFGSSQLSQFMDQNNPLGELTHKRRMSALGPGGLSRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLINSLATYAIVNKYGFIETPYRRVSWDTHKVTDKIDYLTADVEDNYIIAGANARLNEDGSFKDKIVLARHKEDNLEVTPDKIDYMDVIPKQVVSVTSACIPFLENDDSNRALMGANHQRQAVPLINPHAPIVGTGMEYRAAHDSGDALV--AKAPGVVEYVDANEIRIRRDDDTLDKYVLEKFRRSNATKNYNQTPAVKQGERVVADEVIADGPAMENGELALGQNPIIAFLTWNMYNYEDAVMISERMVKDDVYTSIHIEDYESEARDTKLGPEEITREIPNVGEDALKDLDEEGIVRIGAEVQDGDILVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVQNVQVFTREAGDELPPGVNKMVRVYIVQKRKIQVGDKMSGRHGNKGTIALVCPEEDMPYLPDGRPVDICLNPMGVPSRMNIGQVLELHLGIAAKQLGIHVATPVF---DGASEDDMWNMVRE 1003
Score = 537, Expect = 3.5e-52, Identities = 107/177 (60%), Positives = 131/177 (74%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           GI+ ++L    ATPVF+G +  D+   + EAGI         GK GK  L DGRTGE F   VSVGIMY LKL HMVDDKIH+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR   Y AI+KG+ IP+ G+PESF++L K+LQ LGL + +
  S:   974 GIAAKQLGIHVATPVFDGASEDDMWNMVREAGI---------GKDGKTVLYDGRTGEPFHNRVSVGIMYYLKLTHMVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKAYEAIVKGERIPKPGVPESFRVLVKELQSLGLDIKV 1141
>gi|46199763|ref|YP_005430.1| DNA-directed RNA polymerase subunit beta [Thermus thermophilus HB27] >gi|81405493|sp|Q72HM5|RPOB_THET2 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|46197390|gb|AAS81803.1| DNA-directed RNA polymerase beta chain [Thermus thermophilus HB27] (1119 aa)
Score = 1978, Expect = 0.0e+00, Identities = 407/836 (48%), Positives = 558/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA--------------------MKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +          SE+     SLT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  DE GF+ TPYR V  GV+TDE+ ++TA  ED Y IA +N  +E N+   ++V+ R +        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V+ VDG  I ++      V Y L +F +SNQ T  +Q P V VG++V KG  +ADGPA  NG LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EG++ +GAEVK GD+LVG+ S KG+ E T EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++VYV QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA                    +K+L L++  E+Y+ K+    F                     +++++++ L +A K        L L   G   E+                 LKE   +               GK  L DGRTGE  +G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LT+KSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMG---------SED-----SLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKEL-LAQAFEVYFGKRKGEGFG--------------------VDKREVEVLRRAEK--------LGLVTPGKPPEE----------------QLKELFLQ---------------GKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1104
Score = 174, Expect = 4.4e-10, Identities = 42/143 (29%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ + +  +          ++   +  FPI    K  GG   L+++  +L +P   + E R +  TY  PLY  L ++  ++G +K+            D +F   IP++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGG-LVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|46360962|gb|AAS89214.1| RpoB [Corynebacterium durum] (1113 aa)
Score = 1978, Expect = 0.0e+00, Identities = 410/829 (49%), Positives = 557/829 (67%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V +G +TD+I +LTA  ED +++A +N   +K+    E++V+ R +    E  +  D+D++DISP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +   +K G V  +    I +         Y L KF ++NQ TC NQ P+V +G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++RL  EDI TSIHI E+ +D   TK G EEITR+IPNVSE   K LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  +DD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ                 VLE++     A+ +S+    +   +++L++ L + L +    SL                             TATPVF+G +  +L   +  +  +     L +G +GK  LIDGR+GE F   VSVG MY+LKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYAQVNPFGFIETPYRKVVDGKLTDQIDYLTADEEDRHVVAQANTPFDKDGNITEERVVVRMKGGDIEVVNATDIDYMDISPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPYVGTGMELRAAYDAGDLVI--SKKSGVVENLSADFITVMGDDGIRDTYILRKFQRTNQGTCYNQKPLVDIGDRVEAGQVIADGPGTDNGEMALGRNLLVAFMPWEGHNYEDAIILNQRLVEEDILTSIHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRRFSRDDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQ-----------------VLEVHLGWLAAAGWSI--DTNNPDNKDLMEMLPEELYDVPAGSL-----------------------------TATPVFDGASNEELAGLLANSRPNRDGDILVDG-NGKAQLIDGRSGEPFPYPVSVGYMYILKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCL 1113
Score = 250, Expect = 6.5e-19, Identities = 75/241 (31%), Positives = 119/241 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R  ++KI +    P LL+LQ  +F   I T                    LE  ++ + PI+   G  SL     + E+ K S  E + +   Y  PLYV    V+N++GE+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L+++  +  D
  S:    16 RYSFAKITEPIEVPGLLDLQLESFAWLIGTPEWRARMQEKVSEGTRVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEEVKYSIDECKEKDINYSAPLYVTAEFVNNDTGEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERAL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTHEQIVERFGFSEIMMTTLESDGVSNTD 251
>gi|116488418|gb|AAQ76602.2| RpoB [Mycobacterium wolinskyi] (1169 aa)
Score = 1977, Expect = 0.0e+00, Identities = 430/942 (45%), Positives = 595/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLE--LYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y+       N  Q    PI  +       TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV+TD+I +LTA  ED +++A +N  ++ + +F ED+V+ R R   E  +V   DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    + + +    +  Y + KF +SN  TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE  L +  K   +  +  G  + AS+     L + L      S+                              +TPVF+G    +L + +  + +   +G++     GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + +  D+    +N+  N  +N+
  S:   279 TKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGQ----PITSS-------TLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDQIDYLTADEEDRHVVAQANSPIDADGRFTEDRVMVR-RKGGEVENVAPSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--SEKTGVVEEVSADYVTVMADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVESGQVIADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWVAKAGWNIDVAAGTPDWASK-----LPEQLYSAPADSI-----------------------------VSTPVFDGAQEGEL-QGLLGSTLPNRDGEVMVDADGKATLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDADLERAAANLGINLSRNE 1161
Score = 256, Expect = 1.5e-19, Identities = 82/276 (29%), Positives = 136/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   + ++                 LE  ++ + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + +  +L      EKD    TDE L+++ + L   +        T L  LF K
  S:    29 RVSFAKLREPLEVPGLLDVQTDSFDWLVGSDEWRQKAIDRGETDPKGGLEEVLEELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMGTL------EKDSTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 293
>gi|58336623|ref|YP_193208.1| DNA-directed RNA polymerase subunit beta [Lactobacillus acidophilus NCFM] >gi|75358070|sp|Q5FM97|RPOB_LACAC DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|58253940|gb|AAV42177.1| RNA-polymerase DNA-directed beta subunit [Lactobacillus acidophilus NCFM] (1213 aa)
Score = 1976, Expect = 0.0e+00, Identities = 435/1078 (40%), Positives = 651/1078 (60%)
  Q:    13 KYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETT--YQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVK--NGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIK--SGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           K+  RR +S+I++    PNL ++Q  ++  F+D  ++     I PI    G+ SLEY+G KL+KPK +  EAR+   TY  P++V L + + E+GE+K            T  +FF  +P++TE G+FIVNG E+ ++SQ+VRSPG Y          +  K  ++ +   ++P +G  L +   A+N  +++V       + T  +P+T  ++A+G+                                                   G D+++ E+F +  +L+  L+             +V  N    + A+ L        K+I  + R    +TT   +S++Y  FF  + +DL+  GR+K+ +K+ L  RLY + LAE L D + G++++KK+T++    +D +          +V      E +  + + +  ++I VY   D + E   +       D   L+ +D+L+  +Y   L   IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ + ++++I D +              ++T + +IN +P   S KEFF S QL+QF+DQ NPL ELT+KRR+SA+GPGG++R+    ++RDVHY+HYG++CPIETPEG NIGLI SLA+YA  ++ GF+ TPYR V      +TD+I +LTA  ED YIIA +N  + +   FKED +L R +          +D++D+ PKQVVS+A++ IPFLENDD+NRALMGAN QRQA PLI+P + +VGTG EY+ AHDSG A +   +  GTV YVD   I+I+   G+ +K Y L K+ +SN +   NQ P V +G+ V +   IA+GP M +GELALGQN L+AF TW+ YNYEDAI+LS+RL  +D++TSI I +Y  +   TK G EEITR++PN+ E + K LD +GI+ VGAEV +GD+LVGK++PKG  EL++EE+LL AIFG+K++  ++TSL+VPHGG G V  VK +  E   EL+  V   ++VY+ QKRKIQ+GDKM+GRHGNKG ++ ++P EDMP+L DGT +DI LNP+GVPSRMNIGQ+LELHLG A ++L
  S:    11 KHRTRRSFSRIKEVLKLPNLTDVQTESYKWFLDKGIKEVFDDIMPISDFSGKLSLEYVGYKLQKPKYTVDEARDHDATYAAPMHVTLKLTNQETGEIK------------TQDVFFGDLPLMTESGSFIVNGAERVIVSQLVRSPGVYYT-------GDYDKNGRQIFGTTVIPNRGAWLEYETDAKNVSYVRV-------DRTRKLPLTVLIRAMGI---------------------------------------------------GSDSEIIEMFGQSDTLQFTLD------------KDVHKNPADSRVAEAL--------KDIYERLRPGEPKTTDSSRSLLYARFFDPRRYDLAPVGRYKINKKLSLKNRLYGQTLAETLADPDTGEIIVKKDTVVTHEIMDKLAPYLDRDDFKMVTYQPSKEGV--LPDPITVQEIKVYSKVDPEREVKLMSNGHIDADVKHLTPADVLASINYFFALQDKIGTTDDIDHLGNRRIRRVGELLQNQFRIGLARMERVVRERMSIQDPS--------------TVTPQQLINIRPIVASIKEFFGSSQLSQFMDQHNPLGELTHKRRMSALGPGGLTRDRAGYEVRDVHYTHYGRLCPIETPEGPNIGLINSLASYAIINKYGFIETPYRRVSWDTHKVTDKIDYLTADEEDNYIIAGANTPLNDDGSFKEDIILARQKEDNVEVTPDKIDYMDVIPKQVVSVASACIPFLENDDSNRALMGANQQRQAAPLINPHSSLVGTGMEYRAAHDSGAALI--AKAAGTVEYVDADEIRIRREDGTLDK-YTLEKYRRSNNSKSYNQTPNVKLGDHVDESDVIANGPTMDHGELALGQNPLIAFMTWNMYNYEDAIMLSERLVKDDVYTSISIEDYESEARDTKLGPEEITRELPNIGEDALKDLDADGIVRVGAEVHDGDILVGKVTPKGVTELSAEERLLHAIFGEKAREVRDTSLRVPHGGGGIVQDVKVYTREAGDELSPGVNTMVRVYIAQKRKIQVGDKMSGRHGNKGTVAAVMPEEDMPYLPDGTPVDICLNPMGVPSRMNIGQLLELHLGAAARQL 981
Score = 521, Expect = 2.8e-50, Identities = 102/177 (57%), Positives = 130/177 (73%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           G +  +L    ATPVF+G N  D+ + + +AG+D         K GK  + DGRTGE F   VSVG+M+ LKL HMVDDKIH+R++GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+E+LT KSDDV GR   Y AI+KG+ IP+ G+PESF++L K+LQ LGL + +
  S:   975 GAAARQLGIHVATPVFDGANENDVWDTVRQAGMD---------KDGKTVIYDGRTGEPFHNRVSVGVMHYLKLTHMVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKAYEAIVKGERIPKPGVPESFRVLVKELQSLGLDIRV 1142
>gi|154507874|ref|ZP_02043516.1| hypothetical protein ACTODO_00356 [Actinomyces odontolyticus ATCC 17982] >gi|153797508|gb|EDN79928.1| hypothetical protein ACTODO_00356 [Actinomyces odontolyticus ATCC 17982] (1158 aa)
Score = 1975, Expect = 0.0e+00, Identities = 434/903 (48%), Positives = 589/903 (65%)
  Q:   430 IVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDY-DIGF--------------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKD-VDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHE--EASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDP-INGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQV 1332
           +++N   D R   +A V +Y KIN              +  +      TLS+ DI++   Y++ L   D  F               DDID+  N+R++ + EL++ + + GL R+E+ + +++        +QE         S+T +++IN +P   + KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SR+   +++RDVH SHYG++CPIE+PEG NIGLI SLAT+A  +  GF+ TPYR+VK+G +TDEIR+LTA  E  + IA ++  +E +  F E  VLCR          +D VD++D+S +Q+VS+AA+ IPFLE+DDANRALMGANMQRQA PL++  AP+VGTG E + AHDSG   +      G VS V    I + +    +  Y L KF +SN   C NQ  IV  G++V  G  +ADGPA SNGE+ALG+N+LVA+ +W G NYEDAIILS+R+  EDI TSIHI EY VD  +TK G+EEITRDIPNVSE S   LD+ GII +GAEV  GD+LVGK++PKG+ ELTSEE+LL+AIFG+K++  ++TSL+VPHG EG V  V+ F  +D+ +LN  V + ++VYV Q+RKI IGDKMAGRHGNKG++SKI+PVEDMP L DGT +DI+LNPLGVP                  ++ + +VLE          + L +  H+  +AS  +                 +A +E+     +  L   GI  E      ATPVF+G+   +L   +    ++P  +G +     GK  L DGR+GE F   +SVG  YMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESF++L ++++ L L V
  S:   275 LLNNFYFDSRRYDLAKVGRY-KIN------------KKLAIEADPKASTLSLEDIVATVKYLLALHQGDKTFAGTRNGEPVEVRVEVDDIDNFANRRIRAVGELIQGQVRTGLARMERTVRERMT-------TQETD-------SITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLAGLTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIESPEGPNIGLIGSLATFARINPFGFIETPYRVVKDGKVTDEIRYLTADDEKGHYIAQASSPLEADGSFAEHDVLCRVAGDDPTLIARDRVDYMDVSARQMVSVAAAFIPFLEHDDANRALMGANMQRQAVPLLTTEAPLVGTGMEMRAAHDSGEMIL--AAHSGVVSEVSADLIVVSTDEGGRDSYRLEKFERSNPGNCTNQRVIVDEGDRVEAGDVLADGPATSNGEVALGKNLLVAYMSWEGLNYEDAIILSRRVVEEDILTSIHIEEYEVDARETKLGEEEITRDIPNVSEESLADLDERGIIRIGAEVTAGDILVGKVTPKGETELTSEERLLRAIFGEKAREVRDTSLRVPHGEEGIVIGVREFN-DDEDDLNPGVRQTVRVYVAQRRKITIGDKMAGRHGNKGVVSKILPVEDMPFLADGTPVDIILNPLGVPG-----------------RMNVGQVLE----------YHLGWLAHQGWDASAAV-----------------EAGEEW-----AAHLPADGIKTEPGT-PVATPVFDGLEADELAGLLRN--VNPNRDGDVLTNYEGKARLFDGRSGEPFPYPISVGYTYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDTTGRVKVYEAIVKGEDIPEPGIPESFRVLIQEMRSLCLNV 1116
Score = 279, Expect = 2.8e-22, Identities = 84/274 (30%), Positives = 137/274 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE--LINLRKNLNSSDSNRSYGVDTKLRELF 290
           R  ++K+ +    PNLL LQ  +F   +  +                      LE     I PI+ + G  SL +   +LE PK S +EA+ +  TY  P+YV    ++ E+GE+K  T            +F    P++T +GTFI+NG E+ V+SQ+VRSPG Y       KLS+ R   +E +  +++P++G  +  F  + +D + V       +S     +T FLKA+G+ + EI   FA +  +  +L      EKD   T E  L+++ + L   +        T L   +
  S:    13 RISFAKLREPLQAPNLLGLQVESFDWLLGNDAWKARVEAAQASGHGDVPDVSGLEEIFHEISPIEDVAGTMSLSFHDHRLESPKYSMEEAKAKDYTYSAPMYVTAEFMNYETGEIKSQT------------VFMGDFPLMTPRGTFIINGTERVVVSQLVRSPGVYFE-----KLSD-RSSDKETFGAKVIPSRGA-WLEFEIDKRDAVGVRIDRKRKQS-----VTHFLKAVGMTESEIRETFAAYPVLLETL------EKDTVATQEEALLDIYRKLRPGEPANVDAAQTLLNNFY 280
>gi|14278483|pdb|1I6V|C Chain C, Thermus Aquaticus Core Rna Polymerase-Rifampicin Complex (1118 aa)
Score = 1975, Expect = 0.0e+00, Identities = 408/836 (48%), Positives = 555/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA---MKKLTLSKVL----ELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +                  +LT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  D  GF+ TPYR VKNGV+T+E+ ++TA  ED Y IA +N  +E ++   D+V+ R R        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V  VDG  I ++      V+ L ++ +SNQ T  +Q P V VG++V KG  +ADGPA   G LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EGI+ +GAEVK GD+LVG+ S KG+ E + EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++V+V QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA   + +  +S V     E    +  A  F+L+FG  +     + K       EK++  L +A K        L L   G S E+                 LKE                   GK  L DGRTGE F+G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LTIKSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMADQFRVGLARLARGVRERMVMGS--------------PDTLTPAKLVNSRPLEAALREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDALGFIRTPYRRVKNGVVTEEVVYMTASEEDRYTIAQANTPLEGDRIATDRVVARRRGEPVIVAPEEVEFMDVSPKQVFSLNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVVKVDGTRIAVRYEDGRLVHPLRRYARSNQGTAFDQRPRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGIVRIGAEVKPGDILVGRTSFKGEQEPSPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPVFDGATEPEIKELLAEAFNLYFGKRQGEGFGVDK------REKEV--LARAEK--------LGLVSPGKSPEE----------------QLKELF---------------DLGKVVLYDGRTGEPFEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTIKSDDIEGRNAAYQAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1103
Score = 177, Expect = 2.0e-10, Identities = 43/143 (30%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ K +  +          ++   K  FPI    K  GG   L+++  ++  P  S+ E R +  TY  PLY  L ++  ++G +K+            D +F   +P++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGG-LVLDFLEYRIGDPPFSQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHLPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|21466005|pdb|1L9U|C Chain C, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution >gi|21466011|pdb|1L9U|L Chain L, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A Resolution >gi|21466018|pdb|1L9Z|C Chain C, Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Junction Promoter Dna Complex At 6.5 A Resolution (1118 aa)
Score = 1974, Expect = 0.0e+00, Identities = 408/836 (48%), Positives = 555/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA---MKKLTLSKVL----ELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +                  +LT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  D  GF+ TPYR VKNGV+T+E+ ++TA  ED Y IA +N  +E ++   D+V+ R R        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V  VDG  I ++      V+ L ++ +SNQ T  +Q P V VG++V KG  +ADGPA   G LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EGI+ +GAEVK GD+LVG+ S KG+ E + EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++V+V QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA   + +  +S V     E    +  A  F+L+FG  +     + K       EK++  L +A K        L L   G S E+                 LKE                   GK  L DGRTGE F+G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LTIKSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMADQFRVGLARLARGVRERMVMGS--------------PDTLTPAKLVNSRPLEAALREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDALGFIRTPYRRVKNGVVTEEVVYMTASEEDRYTIAQANTPLEGDRIATDRVVARRRGEPVIVAPEEVEFMDVSPKQVFSLNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVVKVDGTRIAVRYEDGRLVHPLRRYARSNQGTAFDQRPRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGIVRIGAEVKPGDILVGRTSFKGEQEPSPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPVFDGATEPEIKELLAEAFNLYFGKRQGEGFGVDK------REKEV--LARAEK--------LGLVSPGKSPEE----------------QLKELF---------------DLGKVVLYDGRTGEPFEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTIKSDDIEGRNAAYQAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1103
Score = 177, Expect = 2.0e-10, Identities = 43/143 (30%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ K +  +          ++   K  FPI    K  GG   L+++  ++  P  S+ E R +  TY  PLY  L ++  ++G +K+            D +F   +P++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGG-LVLDFLEYRIGDPPFSQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHLPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|55139438|gb|AAV41383.1| RpoB [Corynebacterium aurimucosum] (1113 aa)
Score = 1974, Expect = 0.0e+00, Identities = 409/827 (49%), Positives = 548/827 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN---KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGL 1328
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +G +TD++ +LTA  ED + IA     VEK+       D++  R +       D   VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V  V    I I     ++  Y L KF ++NQNT  NQ P+VS+GE+V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNVS+   + LD+ GI+ +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  EDD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP +EDGT +DI+LN  GVP RMNIGQ+LE+HLG LA     +                       + A+  L+K L + L +   +SL                             TATPVF+G    ++   +  +  +  +G +   + GK  L DGR+GE +   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L
  S:   348 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVVDGKVTDQVEYLTADEEDRFAIA--QAEVEKDADGTLTGDRIEVRLKDGDIGVTDASGVDYVDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPYVGTGMEQRAAYDAGDLII--TPKAGVVENVTADLITIMDDEGQRDTYMLRKFERTNQNTNYNQTPLVSLGERVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRIVEEDILTSIHIEEHEIDARDTKLGPEEITREIPNVSDDVLRDLDERGIVRIGADVRAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVSRFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPPEDMPFMEDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAHAGWKIDT--------------------EDPANAELLKTLPEELYDVPPESL-----------------------------TATPVFDGATNEEISRLLASSKPNR-DGDVMVDEHGKARLFDGRSGEPYMYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSL 1112
Score = 236, Expect = 3.1e-17, Identities = 74/249 (29%), Positives = 122/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL+LQ +++   I T                    LE  ++ + PI+   G  SL     + E  K +  E + +   Y  PLYV    ++N++ E+K  T            +F    PM+TEKGTFIVNG E+ ++SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG  +E+I   F   + + ++L+++      V  TDE +
  S:    17 RYSFAKISEPIAVPGLLDLQLDSYAWLIGTPEWREREQAERGEDARVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEPVKNTVDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPMMTEKGTFIVNGTERVIVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTEEQIKERFGFSELMMSTLESD-----GVANTDEAL 255
>gi|46360924|gb|AAS89195.1| RpoB [Corynebacterium xerosis] (1149 aa)
Score = 1973, Expect = 0.0e+00, Identities = 408/833 (48%), Positives = 542/833 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+   ++IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +G +T E+ +LTA  ED +++A +N  V++N +F  + +  R +    E     +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +      G V  V    I I     ++  + L KF ++NQ T  NQ P+V  G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  +DI TSIHI E+ +D   TK G EEITR+IPNV E   K LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS++VPHG  G V  V+ F  EDD +L   V E I+VYV QKRKIQ GDKMAGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE+HLG   K                        G   E   +  K L   L++    SL                              ATPVF+G    +L   +  +  D  +G +     GK  LIDGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V +
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--------------VESIQPTTLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRRVVDGKLTTEVDYLTADEEDRFVVAQANTPVDENGQFVNETLPVRKKGGDVEVVRATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRAEAPFVGTGMEQRAAYDAGDLVI--APCAGVVETVSADFITIMDDEGQRHTFILRKFERTNQGTSYNQKPLVDEGDRVEAGQVIADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEDDILTSIHIEEHEIDARDTKLGPEEITREIPNVGEDMLKDLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMRVPHGESGKVIGVRVFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVIGKILPQEDMPFLPDGTPVDILLNTHGVPRRMNIGQVLEVHLGWLAKA-----------------------GWTIEGDPDWAKRLPAELHDVPADSL-----------------------------VATPVFDGAENEELAGLLASSRPDR-DGDVLVNADGKAQLIDGRSGEPFPFPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNVEV 1116
Score = 225, Expect = 5.8e-16, Identities = 77/249 (30%), Positives = 117/249 (46%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDELI 265
           R  ++KI +    P LL+LQ+ +F   I T                    LE  +  + PI+    + SL       +  K +  E +++   Y  PLYV     + E+GE+K  T            +F    PM+++KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +I+P++G  +  F  + +D + V       +     P+T  LKA G   EEI   F   + +  +L      EKD V  TDE +
  S:    19 RYSFAKISEPIPVPGLLDLQRESFAWLIGTPEWRARRQEELGDGAQVTSGLEDILDELSPIEDYSQKMSLTLSDPWFDSVKNTVDECKDKDINYSAPLYVTAEFTNRETGEIKSQT------------VFIGDFPMMSDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HSVKIIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKAFGWTTEEIKERFGFSEIMMATL------EKDGVANTDEAL 257
>gi|25027053|ref|NP_737107.1| DNA-directed RNA polymerase subunit beta [Corynebacterium efficiens YS-314] >gi|41017740|sp|Q8FS97|RPOB_COREF DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|23492333|dbj|BAC17307.1| putative DNA-directed RNA polymerase beta chain [Corynebacterium efficiens YS-314] (1171 aa)
Score = 1973, Expect = 0.0e+00, Identities = 410/833 (49%), Positives = 553/833 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDK-VLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRN--LIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +G +TD+I +LTA  ED +++A +N + +++    D+ V  R +          DVD++D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PL+   AP VGTG E + A+D+G   +    K G V  V    + I     ++  Y L KF ++NQ T  NQ P+V+ G++V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++ +  +DI TSIHI E+ +D   TK G EEITRDIPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+RF  EDD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE HLG                    A+ +S    +  E  +N  LIK L K L +    SL                             TATPVF+G +  +L   +  +  +  +G +     GK  LIDGR+GE +   VS+G MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   362 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRVIDGKLTDQIDYLTADEEDRFVVAQANTHYDEDGVITDESVTVRLKDGDIAMVSRTDVDYMDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLVRAEAPFVGTGMELRAAYDAGDLVI--TPKAGVVENVTADIVTIMDDEGKRDTYVLRKFQRTNQGTSYNQKPLVNQGDRVEAGQVIADGPGTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRRFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLETHLGWL-----------------AAAGWS----VDPEDPKNAELIKTLPKELYDVPAGSL-----------------------------TATPVFDGASNEELAGLLANSRPNR-DGDVMVNADGKATLIDGRSGEPYPYPVSIGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1132
Score = 244, Expect = 3.3e-18, Identities = 76/249 (30%), Positives = 121/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++K+      P LL+LQ ++F   I T                    LE  ++ + PI+   G  SL     + E  K +  EA+ +   Y  PLYV    V+N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    31 RYSFAKVSAPIEVPGLLDLQLDSFAWLIGTPEWRARQQEEFGEGARITSGLENILEELSPIQDYSGNMSLSLSEPRFEPVKNTIDEAKEKDINYAAPLYVTAEFVNNTTGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDSVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESD-----GVANTDEAL 269
>gi|46360954|gb|AAS89210.1| RpoB [Corynebacterium confusum] (1118 aa)
Score = 1972, Expect = 0.0e+00, Identities = 405/833 (48%), Positives = 549/833 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+D  N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CP+ETPEG NIGLI SLA+YA  +  GF+ TPYR V +G +TD++ +LTA  ED + IA + +  + +     D++  R R       D   VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V  V    I I     ++  Y L KF ++NQ T  NQ P+VS+G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TS+HI E+ +D   TK G EEITR+IPNV+E     LD+ GII +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  EDD +L   V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP +EDGT +DI+LN  GVP RMNIGQ+LE+HLG LA     +                     + + A+  L++ L + L +    SL                             TATPVF+G    ++   +  +  +     L +G+ GK  L DGR+GE +   +SVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDHNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPVETPEGPNIGLIGSLASYARVNSFGFIETPYRKVVDGKVTDQVEYLTADEEDRFSIAQAEVEQDAEGNIVGDRIEVRQRDGDIAVTDASGVDYVDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPYVGTGMEQRAAYDAGDLVI--TPKAGVVEDVTADLITIMDDEGQRDTYMLRKFERTNQGTNYNQTPLVSMGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRIVEEDILTSVHIEEHEIDARDTKLGAEEITREIPNVAEDVLSDLDERGIIRIGADVRPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGEVGKVIGVARFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPPEDMPFMEDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAHAGWKVD--------------------VDDPANAELLQTLPEELYDVPADSL-----------------------------TATPVFDGATNEEISRLLASSRPNRDGDVLVDGE-GKATLFDGRSGEPYKYPISVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1117
Score = 238, Expect = 1.6e-17, Identities = 75/249 (30%), Positives = 123/249 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL+LQ ++F   I T                    LE  ++ + PI+   G  SL     + E  K +  E + +   Y  PLYV    ++N++ E+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG ++E+I   F   + + ++L+++      V  TDE +
  S:    16 RYSFAKISEPIAVPGLLDLQLDSFAWLIGTPEWRERQQAERGDGARVTSGLEDILEELSPIEDYSGNMSLSLSEPRFEPVKNTVDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWSEEQIRERFGFSELMMSTLESD-----GVASTDEAL 254
>gi|46360948|gb|AAS89207.1| RpoB [Corynebacterium callunae] (1113 aa)
Score = 1971, Expect = 0.0e+00, Identities = 406/829 (48%), Positives = 549/829 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRN--LIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR +  G +TD+I +LTA  ED Y++A +N N  E     ++ V  R +       + ++VD++D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PL+   AP VGTG E + A+D+G   +      G V  V    I I +   + + Y L KF ++NQ T  NQ P+V++G++V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++ +  +DI TS+HI E+ +D   TK G EEITRDIPNVSE   K LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L   V E I++YV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE HLG                        S  + +  E  +N  LIK L K L E    SL                             TATPVF+G +  +L   +  +  +  +G +   K GK  L+DGR+GE +   VS+G MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRIVEGKLTDQIDYLTADEEDRYVVAQANTNYDEDGNITDETVTVRLKDGDIAMVNREEVDYMDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLVRAEAPFVGTGMEQRAAYDAGDLVI--TPVAGVVENVSADIITIMADDGKRETYMLRKFQRTNQGTSYNQKPLVNLGDRVEAGQVIADGPGTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSVHIEEHEIDARDTKLGAEEITRDIPNVSEEVLKDLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRHFSREDDDDLAPGVNEMIRIYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLETHLGWLA---------------------SAGWSVDPEDPKNAELIKTLPKELYEVPAGSL-----------------------------TATPVFDGASNEELVGLLANSRPNR-DGDVMVNKDGKATLMDGRSGEPYPYPVSIGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCL 1113
Score = 242, Expect = 6.2e-18, Identities = 75/249 (30%), Positives = 121/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++K+      P LL+LQ +++   I T                    LE  ++ + PI+   G  SL     + E  K +  EA+ +   Y  PLYV    V+N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    16 RYSFAKVSAPIEVPGLLDLQLDSYSWLIGTPEWRARQKEEFGEGARVTSGLENILEELSPIQDYSGNMSLSLSEPRFEDVKNTIDEAKEKDINYAAPLYVTAEFVNNTTGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDSVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESD-----GVANTDEAL 254
>gi|46361030|gb|AAS89248.1| RpoB [Rhodococcus equi] (1107 aa)
Score = 1970, Expect = 0.0e+00, Identities = 429/899 (47%), Positives = 577/899 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSL--DKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFG-------IHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLL 1321
           TKE    ++ N+   ++   +A V +Y KIN              +G +T L  +  TL+  DI++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V+NG +TD++ +LTA  ED +++A +N  V+ N +F ED+VL R +    EF    DVD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V  D  T+    GS    Y L KF +SNQ TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS+RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD +L   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+P EDMP L DGT +DI+LN  GVP R                 + + +VLE +           W G       I  + SR    +    L E+ + +   +N                          ATPVF+G    +L   +  + +   +G+   G  GK  L DGR+GE F   VSVG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L
  S:   269 TKESAQTLLENLFFKDKRYDLARVGRY-KIN------------KKLGLNTGLPIEASTLTEDDIVTTIEYLVRLHAGDTMMTAPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGQLTDQVDYLTADEEDRHVVAQANSPVDANGRFTEDRVLVRRKGGEVEFVSSSDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAVDAGDVIV--TEKTGVVEEVSSDYVTVMADDGSR-TTYRLRKFARSNQGTCANQRPIVDEGQRVEAGQVLADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSQRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDDLPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRR-----------------MNIGQVLETHLG---------WIGKTGWNVQIAGDGSR---PDWAATLPEEMLSAPADSN-------------------------IATPVFDGAKEDELT-GLLGSTLPNRDGERMVGPDGKATLFDGRSGEPFPYPVSVGYMYIIKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVL 1107
Score = 264, Expect = 1.7e-20, Identities = 80/276 (28%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++KI +    P LL+LQ ++F   + +                  LE  +  + PI+   G  SL +   + ++ K S  E +++  TY  PL+V    ++N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG+  EEI   F   + +  +L+ +     D    + L+++ + L   +        T L  LF K
  S:    19 RVSFAKIREPLEVPGLLDLQTDSFEWLVGSPSWRERAAARRDGAVTGGLEEILAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTTLLKALGMTDEEIRERFGFSEIMMATLEKDPAKNTD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 283
>gi|1350848|sp|P47767|RPOB_SPICI DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|886053|gb|AAC44217.1| DNA-dependent RNA polymerase beta subunit [Spiroplasma citri] (1302 aa)
Score = 1969, Expect = 0.0e+00, Identities = 480/1083 (44%), Positives = 679/1083 (62%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDL-------------AIVDNESGEVK---------------KTTKSSKNKASNTDGI---------------------------FFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFF------IFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDING-KVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           +KE   Y  R DY+K+  N + PNL+ +Q   +  F  T +    + +FPI    G   LE +  +  +P+R+  +A++E K ++ P+Y +L             AIV  E   +K               KTT        + D I                           FF   P++T KGTFIVNG EK V+SQ+VRSPGAY       K+  +RK  +  Y  +++P++GT L F      I + + + F  V +     + +  + +  FL ALG+ KE+ L+IF ++K +K++       E D +  D L               Y     ++E++KK   ++S   A    A K       +  ++ +K   DL       TK    +F+L  K  + ++ IYN   +    D++    F     M             D + IN  K ++K    +Q  E+    ++    K+  +     +E  S++AN++         D ++ DE++              ++ D+L+  SY++NL   IG  DDIDHLGN+R++ I ELL+ + + GL+RIEK + +K++ ++                 +   +IIN KP      EFFN  QL+QF+DQ NPLAELTNKRR++A+GPGG+SRE   L++RDVHYSHYG+ICPIETPEG NIGLI +LATYA  +  GF+ TPYR V    +T E  +LTA  E  Y++A +N+ + +K +  +++V+ R++         DVD++D+SPKQ+VSIA S IPFLENDDANRALMGANMQRQA PLI+P +P VGTG EY  A DSG+A V   + DG V +VD   I +K+    K Y L  F +SNQ T    VP+V  G+KV KG  +ADGP++  GELALGQNV+VAFTTW+GYNYEDAII+S+RL  ED+FTSIHI EY+++  +TK G EEITR+IPN+SE+++K+LDD+G++++G EVK GD+LVGK++PKGQ +L+ E+KLLQAIFG+KSKN K+ SL+VP+GGEG +  +KRF  E  YE++ADV+E IK+Y+VQKRKIQ GDKMAGRHGNKG+ISKI+P+EDMPH+EDGT +DIMLNPLGVPSRMNIGQ+LE+HLG+A KKL
  S:     5 EKEFGHYAKRIDYTKVSGNLDLPNLIEIQTETYDWFKKTGISEVFREVFPIVGHEGNIVLEMLDWEFREPRRTISQAKDESKIFEAPIYSNLKLTINSKDVEVEKAIVKGEPELIKAWIEERVGHMITILKKTTDVIYYDIHSGDEIATCTVTIKERLDDKLIVDITIEKEGEVFFGDFPLMTGKGTFIVNGSEKVVVSQLVRSPGAY------YKIDLNRKNGENVYYVDLIPSRGTWLEFESDHKKIKVGKEEKFENVFYVKI--DKSRKVSVANFLTALGIIKEDALDIFGDNKLVKSTY------ELDPYTGDIL---------------YDQSIAVQEIYKK---IRSGETATPDGATK------YLYGLLFDKRKYDL-------TKA--GRFKLIQK-LSVENRIYNKILAEDIKDVNGKVVFTEGTLM-------------DKEAINKLKGILKAGACLQ--EVKFSDEIICSNKIQKIKVYVDNEVRSRVANIIGI-------DPNATDEYV--------------TVPDVLATFSYLLNLTDGIGEVDDIDHLGNRRVRTIGELLQNQFRIGLLRIEKNVKEKMSTSN--------------LFKMKPSNIINNKPLSAIIGEFFNLSQLSQFMDQTNPLAELTNKRRLTALGPGGLSRERAGLEVRDVHYSHYGRICPIETPEGPNIGLINNLATYAKINSYGFIETPYRRVIGCKVTMENDYLTADEEKNYVVAQANIRLSDKGEILDEQVVARFQGENIIAGRNDVDYVDVSPKQIVSIATSCIPFLENDDANRALMGANMQRQAIPLIAPNSPYVGTGVEYAAARDSGLAIV--SQYDGIVDFVDATRIVLKTKEGLKNYNLDTFVRSNQGTSLTHVPLVRQGQKVEKGQVLADGPSIDKGELALGQNVVVAFTTWNGYNYEDAIIVSERLVSEDVFTSIHIEEYTIERRQTKQGPEEITREIPNISENARKFLDDDGLVIIGTEVKPGDILVGKVTPKGQTQLSPEDKLLQAIFGEKSKNVKDNSLRVPNGGEGIIQAIKRFPRE-KYEVSADVLEVIKIYIVQKRKIQEGDKMAGRHGNKGVISKILPLEDMPHMEDGTPVDIMLNPLGVPSRMNIGQVLEIHLGMAAKKL 1050
Score = 570, Expect = 6.4e-56, Identities = 116/196 (59%), Positives = 142/196 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYI 1353
           G++ +KL  K +TPVF+G+   +L E M +AG+            GK  LIDGRTGE FD  VSVG+MYMLKL HMVDDK+H+R VGPYS ITQQPLGGK+QNGGQRFGEMEVWALEAYGAAH LRE+LTIKSDD+KGR   Y +I+K K IPE G+PESF +LT+++QGLG  + +  E G   N    D  +Y+
  S:  1044 GMAAKKLGQKISTPVFDGMINEELIEIMDKAGMKNF---------GKEVLIDGRTGEKFDNPVSVGVMYMLKLSHMVDDKLHARNVGPYSLITQQPLGGKAQNGGQRFGEMEVWALEAYGAAHTLREILTIKSDDIKGRTRAYESIVKDKKIPEPGIPESFNVLTREIQGLGFNIHMIDEKGNIKNIKSYDEADYV 1230
>gi|110003980|emb|CAK98320.1| dna-directed rna polymerase beta chain protein [Spiroplasma citri] (1301 aa)
Score = 1969, Expect = 0.0e+00, Identities = 480/1083 (44%), Positives = 679/1083 (62%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDL-------------AIVDNESGEVK---------------KTTKSSKNKASNTDGI---------------------------FFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFF------IFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDING-KVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           +KE   Y  R DY+K+  N + PNL+ +Q   +  F  T +    + +FPI    G   LE +  +  +P+R+  +A++E K ++ P+Y +L             AIV  E   +K               KTT        + D I                           FF   P++T KGTFIVNG EK V+SQ+VRSPGAY       K+  +RK  +  Y  +++P++GT L F      I + + + F  V +     + +  + +  FL ALG+ KE+ L+IF ++K +K++       E D +  D L               Y     ++E++KK   ++S   A    A K       +  ++ +K   DL       TK    +F+L  K  + ++ IYN   +    D++    F     M             D + IN  K ++K    +Q  E+    ++    K+  +     +E  S++AN++         D ++ DE++              ++ D+L+  SY++NL   IG  DDIDHLGN+R++ I ELL+ + + GL+RIEK + +K++ ++                 +   +IIN KP      EFFN  QL+QF+DQ NPLAELTNKRR++A+GPGG+SRE   L++RDVHYSHYG+ICPIETPEG NIGLI +LATYA  +  GF+ TPYR V    +T E  +LTA  E  Y++A +N+ + +K +  +++V+ R++         DVD++D+SPKQ+VSIA S IPFLENDDANRALMGANMQRQA PLI+P +P VGTG EY  A DSG+A V   + DG V +VD   I +K+    K Y L  F +SNQ T    VP+V  G+KV KG  +ADGP++  GELALGQNV+VAFTTW+GYNYEDAII+S+RL  ED+FTSIHI EY+++  +TK G EEITR+IPN+SE+++K+LDD+G++++G EVK GD+LVGK++PKGQ +L+ E+KLLQAIFG+KSKN K+ SL+VP+GGEG +  +KRF  E  YE++ADV+E IK+Y+VQKRKIQ GDKMAGRHGNKG+ISKI+P+EDMPH+EDGT +DIMLNPLGVPSRMNIGQ+LE+HLG+A KKL
  S:     5 EKEFGHYAKRIDYTKVSGNLDLPNLIEIQTETYDWFKKTGISEVFREVFPIVGHEGNIVLEMLDWEFREPRRTISQAKDESKIFEAPIYSNLKLTINSKDVEVEKAIVKGEPELIKAWIEERVGHMITILKKTTDVIYYDIHSGDEIATCTVTIKERLDDKLIVDITIEKEGEVFFGDFPLMTGKGTFIVNGSEKVVVSQLVRSPGAY------YKIDLNRKNGENVYYVDLIPSRGTWLEFESDHKKIKVGKEEKFENVFYVKI--DKSRKVSVANFLTALGIIKEDALDIFGDNKLVKSTY------ELDPYTGDIL---------------YDQSIAVQEIYKK---IRSGETATPDGATK------YLYGLLFDKRKYDL-------TKA--GRFKLIQK-LSVENRIYNKILAEDIKDVNGKVVFTEGTLM-------------DKEAINKLKGILKAGACLQ--EVKFSDEIICSNKIQKIKVYVDNEVRSRVANIIGI-------DPNATDEYV--------------TVPDVLATFSYLLNLTDGIGEVDDIDHLGNRRVRTIGELLQNQFRIGLLRIEKNVKEKMSTSN--------------LFKMKPSNIINNKPLSAIIGEFFNLSQLSQFMDQTNPLAELTNKRRLTALGPGGLSRERAGLEVRDVHYSHYGRICPIETPEGPNIGLINNLATYAKINSYGFIETPYRRVIGCKVTMENDYLTADEEKNYVVAQANIRLSDKGEILDEQVVARFQGENIIAGRNDVDYVDVSPKQIVSIATSCIPFLENDDANRALMGANMQRQAIPLIAPNSPYVGTGVEYAAARDSGLAIV--SQYDGIVDFVDATRIVLKTKEGLKNYNLDTFVRSNQGTSLTHVPLVRQGQKVEKGQVLADGPSIDKGELALGQNVVVAFTTWNGYNYEDAIIVSERLVSEDVFTSIHIEEYTIERRQTKQGPEEITREIPNISENARKFLDDDGLVIIGTEVKPGDILVGKVTPKGQTQLSPEDKLLQAIFGEKSKNVKDNSLRVPNGGEGIIQAIKRFPRE-KYEVSADVLEVIKIYIVQKRKIQEGDKMAGRHGNKGVISKILPLEDMPHMEDGTPVDIMLNPLGVPSRMNIGQVLEIHLGMAAKKL 1050
Score = 570, Expect = 6.3e-56, Identities = 116/196 (59%), Positives = 142/196 (72%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYI 1353
           G++ +KL  K +TPVF+G+   +L E M +AG+            GK  LIDGRTGE FD  VSVG+MYMLKL HMVDDK+H+R VGPYS ITQQPLGGK+QNGGQRFGEMEVWALEAYGAAH LRE+LTIKSDD+KGR   Y +I+K K IPE G+PESF +LT+++QGLG  + +  E G   N    D  +Y+
  S:  1044 GMAAKKLGQKISTPVFDGMINEELIEIMDKAGMKNF---------GKEVLIDGRTGEKFDNPVSVGVMYMLKLSHMVDDKLHARNVGPYSLITQQPLGGKAQNGGQRFGEMEVWALEAYGAAHTLREILTIKSDDIKGRTRAYESIVKDKKIPEPGIPESFNVLTREIQGLGFNIHMIDEKGNIKNIKSYDEADYV 1230
>gi|54303713|gb|AAV33243.1| rifampicin-resistant RNA polymerase beta chain [Nonomuraea sp. ATCC 39727] (1149 aa)
Score = 1969, Expect = 0.0e+00, Identities = 422/917 (46%), Positives = 582/917 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL---DYDIGF---YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           TKE    ++ N+  + +   +A V +Y K+N              +G D  +D   L+  DI++   Y++ L   +   G     DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   S +EF+ + QL+QF+DQ NPLA LTNKRR++A+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI  LA +   +  GF+ TPYR V +G +TD+I +LTA  ED+++IA +N  +  +  F + +VL R +   +E+    +VD++D+SP+Q+VS+A + IPFLE+DDANR   GANMQRQ+ PL+   AP+VGTG EY+ A D+G   V   EK G V  V    + + +    +  Y + KF +SNQ T  NQ PIV+ G++V     IADGP    GE+ALG+N+LVAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV  GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V   + F  ++  EL   V   ++V V QKRKI  GDK+AGRHGNKG+ISKI+PVEDMP LEDGT +DI+LNPLGVP RMN+GQ+LE HLG +A +   +S + E +                  A R   K  E++     +                                 ATPVF+G +  ++   +    +   +G      SGK  L DGR+GE F   ++VG +Y+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA+EAYGAA+ L+ELLTIKSDDV+GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G
  S:   271 TKESAQTLLENLYFNPKRYDLAKVGRY-KVN------------KKLGLDLDIDVTVLTEDDIVATIEYLVRLHAGEESTGLPLEVDDIDHFGNRRVRSVGELIQNQVRLGLSRMERVVRERMTTQD--------------VEAITPQSLINIRPVVASIREFYGTSQLSQFMDQTNPLAGLTNKRRLNALGPGGLSRERAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGYLACFGRLNAFGFIETPYRKVVDGRVTDQIDYLTADEEDQFVIAQANSPLTADGAFADHRVLVRTKGGEFEYVRSGEVDYMDVSPRQMVSVATAMIPFLEHDDANRP-DGANMQRQSVPLLKSEAPLVGTGMEYRAATDTG--DVISAEKAGVVEEVSADYVTVMNDDGTRTTYRVAKFKRSNQGTSFNQKPIVAEGDRVEVNQVIADGPCTDQGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVSEEVLADLDERGIIRIGAEVVPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGRVIHTQVFSRDEGDELPPGVNVLVRVLVAQKRKITDGDKLAGRHGNKGVISKILPVEDMPFLEDGTPVDIILNPLGVPGRMNVGQVLETHLGWIAARGWDISGIQEAW------------------AERLRDKGFEQVAPRTNM---------------------------------ATPVFDGAHEEEIIGLLGNT-VPTRDGDRLVQSSGKARLFDGRSGEPFPYPIAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMEAYGAAYALQELLTIKSDDVQGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDG 1115
Score = 270, Expect = 3.5e-21, Identities = 79/281 (28%), Positives = 140/281 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  +++I++    P+LL LQ  +F   +  +                      L+   + I PI+   G  SL +   + E PK S +E + +  T+  P++V    ++N +GE+K  T            +F    P++T KG+FIVNG E+ V SQ++RSPG Y   ++  K S+     ++ Y C+++P++G  +  F  + +D + V       +     P+T  LKALG   E IL  F   +S++ +L+ +    +D    D L+++ + L   +        T L  L+   K+Y   K
  S:    16 RVSFARIQEPLEVPDLLALQTESFDWLLGNDRWKARVEAARQAGRRNVPSQSGLQEIFEEISPIEDFSGSMSLSFRDHRFEPPKYSVEECKEKDMTFSAPMFVTAEFINNTTGEIKSQT------------VFMGDFPLMTPKGSFIVNGTERVVTSQLIRSPGVY-FERTVDKTSD-----KDLYGCKVIPSRGA-WLEFEIDKRDSVGVRI-----DRKRKQPVTVLLKALGWTSERILERFGRFESMRATLEKDHTAGQD----DALLDIYRKLRPGEPPTKESAQTLLENLYFNPKRYDLAK 293
>gi|152964649|ref|YP_001360433.1| DNA-directed RNA polymerase subunit beta [Kineococcus radiotolerans SRS30216] >gi|182676583|sp|A6W5T0|RPOB_KINRD DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|151359166|gb|ABS02169.1| DNA-directed RNA polymerase, beta subunit [Kineococcus radiotolerans SRS30216] (1171 aa)
Score = 1967, Expect = 0.0e+00, Identities = 420/919 (45%), Positives = 586/919 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLD--------------YDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           T+E    ++ N+  + +   +A V +Y K+N              +GT+  L    LS+ DI+    Y++ L                D+    DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SL++Y   +  GF+ TPYR + +GV++DE+ +LTA  ED ++IA +N  ++ + +F E +VL R +    EF    +VD++D++ +Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP++GTG E++ A D+G   V    K G  + V    I   +       Y++ KF +SN  T  NQ  +++ G++V  GT +ADGP+   GE+ALG+N++VAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNV+E     LD+ GII +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  GTV  VK F  ++  EL   V + ++VYV  KRKI  GDK+AGRHGNKG+ISKI+PVEDMP LEDGT +D++LNPLGVPSR                 + + +VLEL+     +  + +      E   +  K + + + E    S                             + ATPVF+G    ++   +  + I   +G    G  GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G A
  S:   285 TQEAARNLLDNLYFNPKRYDLAKVGRY-KVN------------KKLGTEEPLSDSVLSVDDIVRTIKYLVKLHAGEVTMPGVKNGQPVDVRVEVDDIDHFGNRRLRSVGELIQNQVRTGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQTNPLAGLTHKRRLSALGPGGLSRERAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYGRINPFGFIETPYRKIVDGVVSDEVEYLTADEEDAFVIAQANAPLDADSRFAEARVLVRAKGGETEFVPRDEVDYMDVAARQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVKSEAPLIGTGMEFRAAVDAGDVVV--ATKAGVATDVSADMITTSNDDGTSTTYKVAKFRRSNHGTAYNQQVVINEGDRVEVGTVLADGPSTDGGEMALGRNLMVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVAEEVLADLDERGIIRIGAEVRDGDLLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGTVIGVKVFDRDEGDELPPGVNQLVRVYVANKRKITDGDKLAGRHGNKGVISKILPVEDMPFLEDGTPVDVILNPLGVPSR-----------------MNVGQVLELHLGWIASRGWKI------EGQPDWAKLIPEEIREAPAGS-----------------------------RIATPVFDGAREEEIT-GLLSSTIPTRDGDRLVGGDGKARLFDGRSGEPFPDPVAVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVLGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDGMA 1139
Score = 251, Expect = 5.2e-19, Identities = 93/379 (24%), Positives = 168/379 (44%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE---------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAED 395
           R  + KI +    P+LL LQ ++F   +  +                     LE   + I PI+   G  SL +   + E PK S  + +    TY  PL+V    ++  +GE+K  T            +F    P++T++GTF++NG E+ V+SQ+VRSPG Y   +   K S+     ++ +  +I+P++G  +  F  + +D + V       +S     +T  +KALG ++ +I   FA+++S+ ++L      EKD                     + GV+  L ++++K    +                        +++AA++L+ NL                           +F+ K +DL+K GR+K+ +K+   E L   VL+ D
  S:    31 RYSFGKIHEPLEVPDLLALQTDSFDWLLGNKRWQDRVEASTNGGLAVPTTSGLEEIFEEISPIEDFSGSMSLSFRDHRFEPPKYSLDDCKERDLTYSAPLFVTAEFINGNTGEIKSQT------------VFMGDFPLMTDRGTFVINGTERVVVSQLVRSPGIY-FERVPDKTSD-----RDTWTAKIIPSRGA-WLEFEIDKRDTVGVRVDRKRKQS-----VTVLMKALGWSESQIREEFADYESMISTL------EKD--------------------HTSGVEDALLDIYRKLRPGEPP----------------------TQEAARNLLDNL---------------------------YFNPKRYDLAKVGRYKVNKKLGTEEPLSDSVLSVD 331
>gi|196236839|ref|ZP_03135632.1| DNA-directed RNA polymerase, beta subunit [Thermus aquaticus Y51MC23] >gi|196219085|gb|EDY13711.1| DNA-directed RNA polymerase, beta subunit [Thermus aquaticus Y51MC23] (1119 aa)
Score = 1967, Expect = 0.0e+00, Identities = 404/836 (48%), Positives = 553/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA---MKKLTLSKVL----ELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +                  +LT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  D  GF+ TPYR VKNGV+T+E+ ++TA  ED Y IA +N  +E ++   D+V+ R R        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V  VDG  I ++      V + L ++ +SNQ T  +Q P V VG++V KG  +ADGPA   G LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EGI+ +GAEVK GD+LVG+ S KG+ E + EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++V+V QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA   + +  +S V     E    +  A  F+L+FG  +     + K  +++L   +                 L L   G S E+                 LKE   +               GK  L DGRTGE F+G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LTIKSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMADQFRVGLARLARGVRERMVMGS--------------PDTLTPAKLVNSRPLEAALREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDALGFIRTPYRRVKNGVVTEEVVYMTASEEDRYTIAQANTPLEGDRIATDRVVARRRGEPVIVAPEEVEFMDVSPKQVFSLNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVVKVDGTRIAVRYEDGRLVEHPLRRYARSNQGTAFDQRPRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGIVRIGAEVKPGDILVGRTSFKGEQEPSPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLSQRYISPVFDGATEPEIKELLAEAFNLYFGKRQGEGFGVDKREKEVLARAE----------------KLGLVSPGKSPEE----------------QLKELFVQ---------------GKVVLYDGRTGEPFEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTIKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1104
Score = 177, Expect = 2.1e-10, Identities = 43/143 (30%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ K +  +          ++   K  FPI    K  GG   L+++  ++  P  S+ E R +  TY  PLY  L ++  ++G +K+            D +F   +P++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGG-LVLDFLEYRIGDPPFSQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHLPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|151337018|gb|ABS00954.1| RNA polymerase beta subunit [Thermus aquaticus] (1119 aa)
Score = 1967, Expect = 0.0e+00, Identities = 408/836 (48%), Positives = 556/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA---MKKLTLSKVL----ELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +                  +LT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  D  GF+ TPYR VKNGV+T+E+ ++TA  ED Y IA +N  +E ++   D+V+ R R        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V  VDG  I ++      V + L ++ +SNQ T  +Q P V VG++V KG  +ADGPA   G LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EGI+ +GAEVK GD+LVG+ S KG+ E + EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++V+V QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA   + +  +S V     E    +  A  F+L+FG  +     + K       EK++  L +A K        L L   G S E+                 LKE   +               GK  L DGRTGE F+G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LTIKSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMADQFRVGLARLARGVRERMVMGS--------------PDTLTPAKLVNSRPLEAALREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDALGFIRTPYRRVKNGVVTEEVVYMTASEEDRYTIAQANTPLEGDRIATDRVVARRRGEPVIVAPEEVEFMDVSPKQVFSLNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVVKVDGTRIAVRYEDGRLVEHPLRRYARSNQGTAFDQRPRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGIVRIGAEVKPGDILVGRTSFKGEQEPSPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPVFDGATEPEIKELLAEAFNLYFGKRQGEGFGVDK------REKEV--LARAEK--------LGLVSPGKSPEE----------------QLKELFVQ---------------GKVVLYDGRTGEPFEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTIKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1104
Score = 177, Expect = 2.0e-10, Identities = 43/143 (30%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ K +  +          ++   K  FPI    K  GG   L+++  ++  P  S+ E R +  TY  PLY  L ++  ++G +K+            D +F   +P++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGG-LVLDFLEYRIGDPPFSQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHLPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|54303711|gb|AAV33242.1| rifampicin-sensitive RNA polymerase beta chain [Nonomuraea sp. ATCC 39727] (1155 aa)
Score = 1967, Expect = 0.0e+00, Identities = 431/917 (47%), Positives = 580/917 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYD------------IGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSN--LNVEKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           TKE    ++ N+  + +   +A V +Y KIN              +G D+ + + TL+  DI++   Y++ L               I   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR V +G +TD+I +LTA  ED Y+ A +N  LN +   F E +VL R +    E     +VD+ID+SP+Q+VS+A + IP LE+DDANR  MG+NMQRQ+ PL+   AP+VGTG +Y+ A D+G   V   EK G V  V    + +       + Y + KF +SNQ T  NQ PIV+  ++V     IADGP    GE+ALG+N+LVAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV  GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG +G V  V+    E+  EL   V E ++VYV QKRKI  GDK+AGRHGNKG+ISKI+PVEDMP  EDGT +DI+LNPLGVP RMN+GQ+LE HLG +A +   +S + E +                  A R   K  E++     +                                 ATPVF+G +  ++   +    I   +G      +GK  L DGR+GE F   ++VG +Y+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G
  S:   271 TKESAQTLLENLYFNPKRYDLAKVGRY-KIN------------KKLGVDSEITQGTLTEEDIVATIEYIVRLHAGEESMPGANDREVIVEVDDIDHFGNRRLRSVGELIQNQVRLGLARMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQTNPLAGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRINAFGFVETPYRKVVDGKVTDQIDYLTADEEDRYVKAQANTVLNAD-GSFAEARVLVRTKGGETELMRADEVDYIDVSPRQMVSVATAMIPSLEHDDANRP-MGSNMQRQSAPLLKSEAPLVGTGMDYRAATDAG--DVISAEKAGVVEEVSADYVTVMNDDGTRRRYRVAKFKRSNQGTSFNQKPIVADPDRVEVNQVIADGPCTDQGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVSEEVLADLDERGIIRIGAEVVPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEQGKVIAVRVNSREEGDELPPGVNELVRVYVAQKRKITDGDKLAGRHGNKGVISKILPVEDMPFPEDGTPVDIILNPLGVPGRMNVGQVLETHLGWIAARGWDISGIQEAW------------------AERLRDKGFEQVAPRTNM---------------------------------ATPVFDGAHEEEIVGLLGNT-IANRDGDRMVQPTGKARLFDGRSGEPFPYPIAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVLGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDG 1121
Score = 272, Expect = 1.9e-21, Identities = 80/281 (28%), Positives = 141/281 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           R  +++I++    P+LL LQ  +F   +  E                      LE   + I PI+   G  SL +   + E PK S  E + +  T+  P++V    ++N +GE+K  T            +F    P++T KGTFI+NG E+ V+SQ+VRSPG Y   ++  K S+     ++ Y C+++P++G  +  F  + +D + V       +      +T  LKALG   ++IL  F  ++S++ +L+ +    +D    D L+++ + L   +        T L  L+   K+Y   K
  S:    16 RVSFARIQEPLEVPDLLALQTESFDWLLGNEKWKARVEAARQAGRRDVPTQSGLEEIFEEISPIEDFSGTMSLSFRDHRFEPPKYSVDECKEKDMTFSAPMFVTAEFINNTTGEIKSQT------------VFMGDFPLMTPKGTFIINGTERVVVSQLVRSPGVY-FERNVDKTSD-----KDLYGCKVIPSRGA-WLEFEIDKRDSVGVRI-----DRKRKQAVTVLLKALGWTSDQILERFGQYESMRATLEKDHTAGQD----DALLDIYRKLRPGEPPTKESAQTLLENLYFNPKRYDLAK 293
>gi|171742261|ref|ZP_02918068.1| hypothetical protein BIFDEN_01367 [Bifidobacterium dentium ATCC 27678] >gi|171277875|gb|EDT45536.1| hypothetical protein BIFDEN_01367 [Bifidobacterium dentium ATCC 27678] (1186 aa)
Score = 1967, Expect = 0.0e+00, Identities = 418/874 (47%), Positives = 567/874 (64%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINLDY-DIGFYDDID--------------HLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIK-IKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYE----LNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           +G +  ++  +LS  DI++   Y++ L   +  F    D              H GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NPLA +TNKRR+SA+GPGG+SR+  ++++RDVH SH+G++CPIE+PEG NIGLI SLAT+   +  GF+ TPYR V NG +TDE+ ++TA  + E++IA +N  +++N  F + + L R     E  DV    VD++D+SP+Q+VS+ AS IPFLE+D+ +RALMG NMQRQA PLI    P+VGTG E++ A DSG   V   EK G V+YV    I+ +        Y+L KF +SNQ TC NQVP++  GE+V  GT +ADGPA   GE+ALG+N+L+AF  W+GYNYEDA+I+S+RL  +D  +SIHI EY +D  +TK G EEITRD+PNV E +   LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  VK    ED  E    L   V + I+VY+ Q RKI  GDK++GRHGNKG+IS+I+P EDMP L DGT +DIMLNPLGVPSRMN+G                 +VLEL+      + + +      EA                      A K+F            G  +       ATPVF+GV +  LK  ++    D    KL  G  GK  L DGRTGE F   +SVG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L E++T KSDDV GR   Y AI+KG  +P +G+PESFK+L K++Q L L V +    G A
  S:   315 LGLEKDVNDRSLSREDIIATIKYLVTLHAGEAKFPGKRDGQDVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQD--------------PEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVVNGHVTDEVEYMTADRDAEHVIAQANQELDENGNFVKSQALARVGEE-EAVDVPVSSVDYMDVSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIQSERPLVGTGAEWRAAVDSG--DVILAEKPGVVTYVSADIIRTMNDDGTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEAGTVLADGPATQKGEMALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGETGTVIAVKEITREDAEEDGDELPNGVNQMIRVYIAQHRKITQGDKLSGRHGNKGVISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLG-----------------QVLELHLGWIAHAGWDISLDPDAEA----------------------AWKKFVP---------QGAEKGAPGTPVATPVFDGVRQDTLKGLLSCTLPDRDGNKL-VGPDGKATLFDGRTGEPFPKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAIVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVA 1145
Score = 237, Expect = 2.2e-17, Identities = 70/255 (27%), Positives = 129/255 (50%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETD 262
           D ++ K   R ++  I +  + P LL +Q ++F   I +E                      L+   + I PI++     SL +     E+P+ + +E + +  TY  PLYV+    + ++GE+K  T            +F    P+ T  GTFI+ G E+ ++SQ+VRSPG Y   +SQ + S+     +E +  +I+P++G  +  F  + +D + V       +S        FL A+G+ K+EI + F ++  + ++L  E  + ++   TD
  S:    19 DIDLHKASDRVNFGSIREPIDVPYLLGVQTDSFDWLIGSERWKQRVEEDLENGTNTVPHTSGLDEVFQEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQT------------VFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVY-FDRSQDRTSD-----KEIFGAKIIPSRGA-WLEFEIDKRDVLGVRVDRKRKQSA-----IVFLMAIGMTKQEIADAFKDYPLVMDALAKETVDTQEAALTD 271
>gi|73913595|gb|AAZ91715.1| DNA-directed RNA polymerase beta chain [Corynebacterium ammoniagenes] (1164 aa)
Score = 1967, Expect = 0.0e+00, Identities = 406/833 (48%), Positives = 548/833 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V+NG +TDE+ +LTA  ED Y I  + +  + +    +D++  R +       D   VDF+D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PL+   AP VGTG E + A+D+G   +    K G V  V+   I I         Y L KF ++NQ T  NQ P+V++G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIILS+R+  EDI TSIHI E+ +D   TK G EEITR+IPNVSE   + LDD GII VGA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  ++D +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ K++P EDMP + DGT +D++LN  GVP RMNIGQ+LELHLG                          W      A      + E   N + +K+L Q   E  D           +  + L   TATPVF+G    ++   +  +  +  +G +   + GK  L DGR+GE +   +SVG MYMLKL H++D+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V +
  S:   355 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVENGRVTDEVYYLTADEEDRYAIGQAEVEQDADGNIIDDRIEVRLKDGDIGVTDANGVDFVDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLVRAEAPYVGTGMELRAAYDAGDMVI--TPKAGVVENVNADLITIMDDEGIRDTYMLRKFERTNQGTNYNQTPLVNMGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILSQRIVEEDILTSIHIEEHEIDARDTKLGAEEITREIPNVSEDVLRDLDDRGIIRVGADVRPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVARFSRDEDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKVLPPEDMPFMADGTPVDVLLNTHGVPRRMNIGQVLELHLG--------------------------WL-----AHTGWKVDTEDPKNAELLKTLPQ---ELYD-----------VPADSL---TATPVFDGATNEEISRLLASSKPNR-DGDVMIDEDGKTVLFDGRSGEPYQYPISVGYMYMLKLHHLIDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNVEV 1125
Score = 232, Expect = 9.5e-17, Identities = 70/235 (29%), Positives = 115/235 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           R  ++KI +    P LL+LQ  +F   I T                   LE  +  + PI+   G  SL     + E  K +  E + +   Y  PLYV    ++N++ E+K  T            +F    PM+T++GTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG  +E+I   F   + + ++L+++
  S:    25 RYSFAKISEPIAVPGLLDLQLESFAWLIGTPEWRERQQEERGQDHVSSGLEDILAELSPIQDYSGNMSLSLSEPRFEPVKNTVDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPMMTDEGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTEEQIRERFGFSELMMSTLESD 253
>gi|46360978|gb|AAS89222.1| RpoB [Corynebacterium lipophiloflavum] (1113 aa)
Score = 1965, Expect = 0.0e+00, Identities = 407/829 (49%), Positives = 549/829 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI +LA+YA  +  GF+ TPY+ V++G +TD+I +LTA  ED Y IA +   ++K      +++  R +           VD++DISP+Q+VS+A + IPFLE+DDANRALMGANMQ+QA PL+   A  V TG E + A+D+G   +    K G +  V G  I +         Y L  F ++NQ TC NQ PIVS G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  +DI TS+HI E+ +D   TK G EEITR+IPNVSE   K LD+ GII +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+RF  EDD +L+  V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG LA    T++                      + A+  L++ L + L +   +SL                             TATPVF+G +  ++   +  +  +  +G +    +GK  L DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGALASYARVNAFGFIETPYQKVEDGKLTDQIDYLTADEEDRYAIAQAATPMDKEGNLTGERIEVRLKDGDIGVVGASGVDYLDISPRQMVSVATAMIPFLEHDDANRALMGANMQKQAVPLLRSEAAYVATGMEQRAAYDAGDTVI--SRKAGVIEDVTGDFITVMDDEGIRDTYLLRTFERTNQGTCYNQTPIVSAGQRVEAGQVIADGPGTKNGEMALGRNLLVAFMPWEGHNYEDAIILNQRVVEDDILTSVHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIIRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIAVRRFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPQEDMPFMADGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAHAGWTVNP--------------------DDPANAKLLETLPEHLYDVPPESL-----------------------------TATPVFDGASNEEITGLLANSKPNR-DGDVMVDGNGKTVLFDGRSGEPFKYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCL 1113
Score = 236, Expect = 2.7e-17, Identities = 73/249 (29%), Positives = 122/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +  + P LL++Q  +F   + T+                   LE  ++ I PI+   G  SL     + E+ K S  E + +   Y  PLYV    ++N++ E+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   ++I   F   + +  +L+++      V  TDE +
  S:    16 RYSFAKISEPVSVPGLLDVQSESFAWLVGTQEWRERQRAERGDDAHIKSGLEDILEEISPIQDYSGNMSLSLSEPRFEEIKYSIDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPLMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTQQITERFGFSEIMMTTLESD-----GVANTDEAL 254
>gi|188159048|ref|ZP_02998489.1| DNA-directed RNA polymerase subunit beta [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1291 aa)
Score = 1964, Expect = 0.0e+00, Identities = 450/1002 (44%), Positives = 639/1002 (63%)
  Q:    89 KTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENK---DFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDINGKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVI-TDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVE-----DDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           K  D+P  + + I+++     KKT+         +  +F    P++TE GTFI+NG +K ++SQ+VRSPGAY   +       +RK  +  Y  +I+P++GT         K   D I  ++   I +S  T   T+ L A G++K++IL                     D+F+ DE++      +S   +       +++E++KK          +G+ A              SE A+K                             I +  F  + +DL+KAGRFK+ +K+ +  R+  RV+AED+ D N  V++ K+T + KH +  I ++  +  + +  N      +S +    K +KI VY+D++ + +   +IG  +S ++  ++++DILS  SY++NL Y+IG  DDID+LGN+R++ + ELL+ + + GL RI+K + +KLA +D                 +   +IIN KP      EFFN  QL+QF+DQ NPL+ELTNKRR++A+GPGG+SR+   L++RDVH SHYG+ICPIETPEG NIGLI +L+TYA  +E GF+ TPYR V NG+I  D++ +LTA  E  +IIA SN+N ++N K  ++ ++ R+        V+++D+ID+SPKQ+VS+A S IPFLENDDANRALMGANMQRQA PLI P +PIV TG E++ A DSG A V   ++D  V YVD  TI     S  + Y L+ + +SN  T   Q PIV VG+ V KG  IADGP+M  GELA+GQNV+VAF+T++GYN+EDAI++S+R+ ++D FTSIHI EY+++   TK G EE+TR+IPN+SE +K++LD EGI+ +G EVK GDVLVGK++PKGQV+L+ E+KLL AIFG+KS+N K+ SL+VP+GGEG V  +KRFK +     D  EL AD+IE IKVYVVQKRKIQ GDKM+GRHGNKGIIS+I+P+EDMPHLEDGT +DI+LNP GVPSRMNIGQILE+HLG+A KKL
  S:   152 KKSDKPDLIQIDIIED-----KKTSLICNVSIYKSGEVFLGDFPLMTEAGTFIINGSQKVIVSQLVRSPGAYFNKEL------NRKTGEMIYFADIIPSRGTWLEYETDSKKTGADAINPLYVK-IDKSRKTTA-TSLLLAFGISKDDIL---------------------DIFDNDEVLVETLQQDSIVGDFKIDWSNQVQEIYKKIR--------QGETA-------------TSEGASK----------------------------FINSILFDKRKYDLTKAGRFKLKQKLSIKNRILNRVIAEDIVDANNNVLVAKDTEVNKHNIKQISEILDQDVMSVDLNY-----LSDILGTRKVQKIKVYKDSELKTDTTCLIGLTSSSNEEFITVADILSTVSYLLNLKYNIGEIDDIDNLGNRRVRTVGELLQNQFRMGLNRIDKNVKEKLATSD--------------LYKVKTSTIINAKPLTAIIGEFFNLSQLSQFMDQINPLSELTNKRRLTALGPGGLSRDRAGLEVRDVHPSHYGRICPIETPEGPNIGLINNLSTYARVNEYGFITTPYRKVINGIIQNDQVEYLTADQEKNFIIAQSNVNQDENGKILDEIIVSRFNGDDYMAKVEEIDYIDVSPKQIVSVATSGIPFLENDDANRALMGANMQRQAVPLIKPESPIVATGIEFEAARDSGEAIV--AKEDAIVKYVDSKTIITDGESGIRTYILSDYERSNNGTSLTQSPIVKVGDVVKKGEIIADGPSMDQGELAIGQNVVVAFSTYNGYNFEDAIVMSERIVIDDRFTSIHIDEYTLEVRNTKQGQEEVTREIPNMSEQAKRHLDAEGIVAIGTEVKVGDVLVGKVTPKGQVQLSPEDKLLHAIFGEKSRNVKDNSLRVPNGGEGIVQSIKRFKAKSALNPDGIELPADIIEVIKVYVVQKRKIQEGDKMSGRHGNKGIISRILPIEDMPHLEDGTPVDIILNPQGVPSRMNIGQILEIHLGMAAKKL 1059
Score = 578, Expect = 5.8e-57, Identities = 121/217 (55%), Positives = 155/217 (71%)
  Q:  1158 GISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEEMD 1374
           G++ +KL  K  TPVFEG+N  +L+E M EAG+            GK  LIDG+TGE FD  ++VG+MYMLKL HMVDDKIH+R VGPYS ITQQPLGGK+QNGGQRFGEMEVWALEAYGAAH LRE+LTIKSDD+KGR+ TY AI++ K IPE G+PESF +L+K++ GLG  + +  E G+ +  N  D  ++ ++       N ED +I+ + D
  S:  1053 GMAAKKLNQKVITPVFEGLNEKELEEIMAEAGMT---------NYGKVTLIDGQTGEPFDKPIAVGVMYMLKLSHMVDDKIHARNVGPYSLITQQPLGGKAQNGGQRFGEMEVWALEAYGAAHTLREILTIKSDDIKGRSKTYEAIVRSKRIPEPGIPESFNVLSKEIMGLGFNMYMIDETGEKSVINAYDKKDFDAD-------NYEDDEILVKTD 1253
Score = 231, Expect = 1.3e-16, Identities = 94/315 (29%), Positives = 167/315 (53%)
  Q:     9 KEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKK----------------------TTKSSKNKASNTDGIFFA------------SIPMITEKGT---------------------------FIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENK---DFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE-IYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKEL--NEVINNIISE 323
           ++I++ V RRDY+K+  N + PNL+ +Q   F  F    ++  +   FPI S  G   L       ++P+ S ++AR E K YD P+Y +L +  N++ E++K                       +K+   K  + +  FF              I +I +K T                           FI+NG +K ++SQ+VRSPGAY   +       +RK  +  Y  +I+P++GT         K   D I  ++   I +S  T   T+ L A G++K++IL+IF N + +  +L  + I  +  +  ++++  + K +   ++  S G    +  +   +   K  L   G+   KQK    N ++N +I+E
  S:     6 RKINRNVERRDYTKVSMNLSLPNLIGIQTETFEWFKTKGIQEVLDEFFPILSFDGSSVLTLENWGFKEPRLSVRQAREESKIYDAPIYANLKLSVNKTEEIQKEFDGVALDDTLKILTNWLEEKTVSKNITFKQQSQNSYFFELTIKKSDKPDLIQIDIIEDKKTSLICNVSIYKSGEVFLGDFPLMTEAGTFIINGSQKVIVSQLVRSPGAYFNKEL------NRKTGEMIYFADIIPSRGTWLEYETDSKKTGADAINPLYVK-IDKSRKTTA-TSLLLAFGISKDDILDIFDNDEVLVETLQQDSIVGDFKIDWSNQVQEIYKKIRQGETATSEGASKFINSIL--FDKRKYDLTKAGRFKLKQKLSIKNRILNRVIAE 377
>gi|62389386|ref|YP_224788.1| DNA-directed RNA polymerase subunit beta [Corynebacterium glutamicum ATCC 13032] >gi|41017761|sp|Q8NT26|RPOB_CORGL DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|21323253|dbj|BAB97881.1| DNA-directed RNA polymerase beta subunit/140 kD subunit (split gene in Mjan, Mthe, Aful) [Corynebacterium glutamicum ATCC 13032] >gi|41324720|emb|CAF19202.1| DNA-DIRECTED RNA POLYMERASE BETA CHAIN [Corynebacterium glutamicum ATCC 13032] (1165 aa)
Score = 1964, Expect = 0.0e+00, Identities = 407/833 (48%), Positives = 547/833 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRN--LIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR + +G +TD+I +LTA  ED +++A +N +  E+    ++ V  R +           VD++D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PLI   AP VGTG E + A+D+G   +      G V  V    I I +   + + Y L KF ++NQ T  NQ P+V++GE+V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++ +  +DI TSIHI E+ +D   TK G EEITRDIPNVSE   K LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L   V E I++YV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE HLG                        S  + +  E   N  L+K L   L E    SL                             TATPVF+G +  +L   +  +  +  +G +     GK  LIDGR+GE +   VS+G MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   356 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRIIDGKLTDQIDYLTADEEDRFVVAQANTHYDEEGNITDETVTVRLKDGDIAMVGRNAVDYMDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLIRAEAPFVGTGMEQRAAYDAGDLVI--TPVAGVVENVSADFITIMADDGKRETYLLRKFQRTNQGTSYNQKPLVNLGERVEAGQVIADGPGTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLKDLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRHFSREDDDDLAPGVNEMIRIYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLETHLGWLA---------------------SAGWSVDPEDPENAELVKTLPADLLEVPAGSL-----------------------------TATPVFDGASNEELAGLLANSRPNR-DGDVMVNADGKATLIDGRSGEPYPYPVSIGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1126
Score = 242, Expect = 5.3e-18, Identities = 75/249 (30%), Positives = 121/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++K+      P LL+LQ +++   I T                    LE  ++ + PI+   G  SL     + E  K +  EA+ +   Y  PLYV    V+N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    25 RYSFAKVSAPIEVPGLLDLQLDSYSWLIGTPEWRARQKEEFGEGARVTSGLENILEELSPIQDYSGNMSLSLSEPRFEDVKNTIDEAKEKDINYAAPLYVTAEFVNNTTGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDSVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESD-----GVANTDEAL 263
>gi|111220537|ref|YP_711331.1| DNA-directed RNA polymerase subunit beta [Frankia alni ACN14a] >gi|122954583|sp|Q0RRT0|RPOB_FRAAA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|111148069|emb|CAJ59737.1| DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) [Frankia alni ACN14a] (1141 aa)
Score = 1964, Expect = 0.0e+00, Identities = 416/865 (48%), Positives = 559/865 (64%)
  Q:   475 DKPTLSISDILSITSYVINL-------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSG---MAAVYDGEKDGTVSYVDGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           D   L+  DI+    YV+ L       +Y++   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SRE    ++RDVH SHYG++CPIETPEG NIGLI SL+T+A  +  GF+ TPYR V NG +TD+I +LTA  ED ++ A +N  +  +  F ED+VL R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMG+NMQRQ+ PL+   AP+VGTG E + A D+G   +       +D +  Y+   T+    G+  + Y L KF +SNQ TC NQ PIV  G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNV+E     LD+ GII +GAEV  GDVLVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  ED  EL   V E ++VYV QKRKI  GDK+AGRHGNKG+I+KI+P EDMP LEDGT +DI+LNP GVP                 +++ + ++LE +      + + +  G  +   R                                 L   G          ATPVF+G    ++   + ++ +   +G    G SGK  L DGRTGE +   V+VG +Y+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +    G
  S:   303 DVGVLTEDDIVRTIEYVVKLHAGADPAEYEV---DDIDHFGNRRLRTVGELIQNQVRLGLARMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQTNPLAGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSTFARVNPFGFVETPYRKVVNGRVTDQIDYLTADEEDRHVKAQANTPLSPDGTFAEDRVLVRRKGGEVEFIPPDEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGSNMQRQSVPLLRSEAPLVGTGMEARAAKDAGDVVVCVQAGVVEDLSADYI---TVMHDDGTR-RTYRLAKFRRSNQGTCINQKPIVFEGDRVEAGQVIADGPCTDNGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVAEEVLADLDERGIIRIGAEVSPGDVLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGVRVFSREDGDELPPGVNELVRVYVAQKRKITDGDKLAGRHGNKGVIAKILPQEDMPFLEDGTPVDIVLNPHGVP-----------------RRMNIGQILETHLGWVAKTGWQVDAGTEDWKER---------------------------------LRGIGADSSTPGTNVATPVFDGAREEEIT-GLLDSTLPNRDGVQLIGSSGKATLFDGRTGEPYPYPVAVGYIYILKLLHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDG 1107
Score = 274, Expect = 1.3e-21, Identities = 83/278 (29%), Positives = 141/278 (50%)
  Q:    20 YSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLK 297
           ++KI +    P+LL LQ  +F   I ++                      LE   + I PI+   G  SL +   + E PK S +E +++  T+  PL+V     +N +GE+K  T            +F    P++T KGTF++NG E+ V+SQ+VRSPG Y   +S  K S+     ++ Y C+++P++G  +  F  + +D + V       +S     +T  LKALG ++  IL  F +  S++ +L+ +    +D    D L+++ + L   +        T L  LF   K+Y   K
  S:    12 FAKIIEPLEVPDLLALQTQSFDWLIGSDAWAERVQEAIDSGRDDVPITSGLEEVFEEISPIEDFSGSMSLSFRDHRFEPPKYSVEECKDKDMTFSAPLFVTAEFTNNTTGEIKSQT------------VFMGDFPLMTPKGTFVINGTERVVVSQLVRSPGVY-FERSLDKASD-----KDLYSCKVIPSRGA-WLEFEIDKRDTVGVRIDRKRRQS-----VTVLLKALGWDEARILERFGDFPSMRITLEKDHTASQD----DALLDIYRKLRPGEPPTRESAQTLLENLFFNPKRYDLAK 286
>gi|145294640|ref|YP_001137461.1| DNA-directed RNA polymerase subunit beta [Corynebacterium glutamicum R] >gi|158513582|sp|A4QBG2|RPOB_CORGB DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|140844560|dbj|BAF53559.1| hypothetical protein [Corynebacterium glutamicum R] (1165 aa)
Score = 1964, Expect = 0.0e+00, Identities = 407/833 (48%), Positives = 547/833 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRN--LIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR + +G +TD+I +LTA  ED +++A +N +  E+    ++ V  R +           VD++D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PLI   AP VGTG E + A+D+G   +      G V  V    I I +   + + Y L KF ++NQ T  NQ P+V++GE+V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++ +  +DI TSIHI E+ +D   TK G EEITRDIPNVSE   K LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L   V E I++YV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE HLG                        S  + +  E   N  L+K L   L E    SL                             TATPVF+G +  +L   +  +  +  +G +     GK  LIDGR+GE +   VS+G MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   356 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRIIDGKLTDQIDYLTADEEDRFVVAQANTHYDEEGNITDETVTVRLKDGDIAMVGRNAVDYMDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLIRAEAPFVGTGMEQRAAYDAGDLVI--TPVAGVVENVSADFITIMADDGKRETYLLRKFQRTNQGTSYNQKPLVNLGERVEAGQVIADGPGTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLKDLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRHFSREDDDDLAPGVNEMIRIYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLETHLGWLA---------------------SAGWSVDPEDPENAELVKTLPADLLEVPAGSL-----------------------------TATPVFDGASNEELSGLLANSRPNR-DGDVMVNADGKATLIDGRSGEPYPYPVSIGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1126
Score = 242, Expect = 5.6e-18, Identities = 75/249 (30%), Positives = 121/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++K+      P LL+LQ +++   I T                    LE  ++ + PI+   G  SL     + E  K +  EA+ +   Y  PLYV    V+N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    25 RYSFAKVSAPIEVPGLLDLQLDSYSWLIGTPEWRARQKEEFGEGARVTSGLENILEELSPIQDYSGNMSLSLSEPRFEDVKNTIDEAKEKDINYAAPLYVTAEFVNNTTGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDSVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESD-----GVANTDEAL 263
>gi|19551731|ref|NP_599733.1| DNA-directed RNA polymerase subunit beta [Corynebacterium glutamicum ATCC 13032] (1159 aa)
Score = 1963, Expect = 0.0e+00, Identities = 407/833 (48%), Positives = 547/833 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRN--LIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR + +G +TD+I +LTA  ED +++A +N +  E+    ++ V  R +           VD++D+SP+Q+VS+  + IPFLE+DDANRALMGANMQ+QA PLI   AP VGTG E + A+D+G   +      G V  V    I I +   + + Y L KF ++NQ T  NQ P+V++GE+V  G  IADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++ +  +DI TSIHI E+ +D   TK G EEITRDIPNVSE   K LDD GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L   V E I++YV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE HLG                        S  + +  E   N  L+K L   L E    SL                             TATPVF+G +  +L   +  +  +  +G +     GK  LIDGR+GE +   VS+G MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRIIDGKLTDQIDYLTADEEDRFVVAQANTHYDEEGNITDETVTVRLKDGDIAMVGRNAVDYMDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLIRAEAPFVGTGMEQRAAYDAGDLVI--TPVAGVVENVSADFITIMADDGKRETYLLRKFQRTNQGTSYNQKPLVNLGERVEAGQVIADGPGTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLKDLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRHFSREDDDDLAPGVNEMIRIYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLETHLGWLA---------------------SAGWSVDPEDPENAELVKTLPADLLEVPAGSL-----------------------------TATPVFDGASNEELAGLLANSRPNR-DGDVMVNADGKATLIDGRSGEPYPYPVSIGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEV 1120
Score = 242, Expect = 5.6e-18, Identities = 75/249 (30%), Positives = 121/249 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++K+      P LL+LQ +++   I T                    LE  ++ + PI+   G  SL     + E  K +  EA+ +   Y  PLYV    V+N +GE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++      V  TDE +
  S:    19 RYSFAKVSAPIEVPGLLDLQLDSYSWLIGTPEWRARQKEEFGEGARVTSGLENILEELSPIQDYSGNMSLSLSEPRFEDVKNTIDEAKEKDINYAAPLYVTAEFVNNTTGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDSVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESD-----GVANTDEAL 257
>gi|11465718|ref|NP_053862.1| RNA polymerase beta subunit [Porphyra purpurea] >gi|1710671|sp|P51252|RPOB_PORPU DNA-directed RNA polymerase subunit beta (PEP) (Plastid-encoded RNA polymerase subunit beta) (RNA polymerase subunit beta) >gi|1276718|gb|AAC08138.1| DNA-directed RNA polymerase beta chain [Porphyra purpurea] (1143 aa)
Score = 1963, Expect = 0.0e+00, Identities = 420/858 (48%), Positives = 561/858 (65%)
  Q:   479 LSISDILSITSYVINL-DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVI--TDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKK-PASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           LS  DILS   Y+IN+ D + G  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ I D                SL++ ++IN KP   S +EFF S QL+QF+DQ NP+AELT+KRRISA+GPGG +++     +RD+H SHYG+ICPIETPEG N GLI SLAT A  +  GF+ TP+  V NG +  ++   +LTA  ED++ +A  ++ V  +N  + D +  RYR  +       VD+I ISP QV+S A S IPFLE+DDANRALMG+NMQRQA PL+ P  PI+GTG E KIA DSGM  +      G V+YV    I I+  +   V Y L K+ +SNQ+TC NQ PIV VGEK+  G T+ADG +   GE+ALG+N+LVA+  W GYNYEDA ++S+RL  ED++TSIHI +Y V+C +TK G EEITR+IPNVS+ S K LD  GI++ G+ V+ GD+LVGKI+PKG+ +   E KLL+AIFG+K+++ ++TSL++P+  +G V  V+ F  +   EL       I+VYV QKRKIQ+GDKMAGRHGNKGIIS+I+P +DMP+L DGT +DI+LNPLGVPSRMN+GQ+ E  LGLA            Y DK+     F   +G   EASR L+            + L +A               S +++ K I+    P                               GK  + DGRTGE FD  V++G  YMLKL H+VDDKIH+R+ GPYS +TQQPLGG++Q+GGQR GEMEVWALEA+GAA+ L+ELLT+KSDD++ RN   NAI+KGKPIP+ G PESFK+L ++LQ LGL +++ K
  S:   322 LSPQDILSSIDYLINIKDKNSGNLDDIDHLGNRRVRSVGELLQNQFRVGLNRLERIIRERMMICD--------------IDSLSLSNLINPKPLIASVREFFGSSQLSQFMDQTNPVAELTHKRRISALGPGGFNKDRAGFAVRDLHPSHYGRICPIETPEGPNAGLIGSLATCARVNIFGFIETPFYPVHNGQVDYSNNPIYLTADEEDDFRVAPGDVKVNVQNYIEGDIIPVRYRQEFVTTIPNQVDYIAISPIQVISAATSLIPFLEHDDANRALMGSNMQRQAVPLLYPEKPIIGTGLETKIARDSGMVVI--SRTSGCVNYVSANKIGIQDNNGRTVLYRLKKYYRSNQDTCINQRPIVWVGEKIVVGQTLADGASTDCGEIALGRNILVAYMPWEGYNYEDAFLISERLVYEDVYTSIHIEKYEVECRQTKLGPEEITREIPNVSDHSLKDLDRNGIVVCGSWVEAGDILVGKITPKGEADQLPEGKLLRAIFGEKARDVRDTSLRLPNAAKGRVVNVRVFTRQKGDELPPGTNAMIRVYVAQKRKIQVGDKMAGRHGNKGIISRILPKQDMPYLCDGTPVDIVLNPLGVPSRMNVGQVFECLLGLAGG----------YLDKRFKIIPFDEMYG--AEASRALVN-----------RKLQEA---------------SILTKNKWIFNDQHP-------------------------------GKMQVFDGRTGEPFDNPVTIGRAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGRAQHGGQRLGEMEVWALEAFGAAYTLQELLTVKSDDMQARNEALNAIVKGKPIPKPGTPESFKVLMRELQSLGLDIAVHK 1100
Score = 189, Expect = 9.3e-12, Identities = 102/369 (27%), Positives = 175/369 (47%)
  Q:    25 KNFNEPNLLNLQKNAFHKFIDTELEG--TIKSIFP-IKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAI----VDNESGEVKKTTKS---SKNKASNTDG------------IFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKET--TYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLA 393
           KN   P+L+ +Q+++F  F+   LEG   +   FP I     R  L+  G   K++ P+ S ++A++  +TY   +YV   +    +D  S +  KT KS   S N    +              +F   +P++T +GTFIV+G E+ +I+QI+RSPG Y   K  I      K  ++ Y   ++  +G+ L F    + + +I++       + TH +    FL+A+GLNK EI                    +K + +   LI+         +++SY V    +E+              GKN          I  +  E+A   L+I        + SK R +   T    + ++Y+ FF  K +DL + GR+K+ +K+ L+     RVL+
  S:     8 KNKLLPDLVEIQRDSFKWFL---LEGLTEVLEFFPNISDPTSRLELQLFGKEYKIKFPRYSVRQAKSRDRTYSAQIYVPAKLTRKDIDLPSKDQNKTIKSLDLSSNHLQFSAEKQIKNKKYKKRLVFIGDLPIMTNRGTFIVSGTERVIINQIIRSPGIYY--KQDID-----KNGKQIYSASLISNRGSWLKFEIDPKGEIWIRI-------DKTHKVNAYIFLRAIGLNKNEI--------------------QKGLSKYAFLIS---------ASQSYSVKELAKEI--------------GKND---------IEEVTDEEA---LLI--------VYSKLRPNEPATVPVAKQMLYSRFFDPKRYDLGEVGRYKINKKLGLNIPKTFRVLS 323
>gi|134103282|ref|YP_001108943.1| DNA-directed RNA polymerase subunit beta [Saccharopolyspora erythraea NRRL 2338] >gi|158513556|sp|A4FPP3|RPOB_SACEN DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|133915905|emb|CAM06018.1| DNA-directed RNA polymerase, beta subunit [Saccharopolyspora erythraea NRRL 2338] (1164 aa)
Score = 1962, Expect = 0.0e+00, Identities = 441/942 (46%), Positives = 597/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL--------------DYDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTL-------SKVLELYYDKKPASDFS--LWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGK--LGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N              +G D   +   L+  DI++   Y++ L              D  I    DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NP+A LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLAT+A  +  GF+ TPYR V +G +TD+I +LTA  ED ++ A +N  ++ +  F  D+VL R +    E     ++D++D+SP+Q+VS A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G +  +  D  T+    G+  + Y L KF++SN  TC NQ PIV+ G++V  G  IADGP   NGE+ALG+N+ VA   W G+NYEDAIILS+RL  +D+ TSIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+ F  EDD EL   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+P EDMP  EDGT +DI+LN  GVP RMNIGQILE HLG +A +  ++        ++ E  YD  P ++ +  ++ G  EE                          E T    S   +R G                        E M +A     NGK  L +G+SG          E +   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   275 TKESAQTLLENLFFKEKRYDLARVGRY-KVN------------KKLGLDLPFESGVLTEEDIVTTIEYLVRLHAGEAEMPDRGQGGDATIPVEVDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQTNPIAGLTHKRRLSALGPGGLSRERAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLATFARVNPFGFIETPYRKVVDGRVTDQIDYLTADEEDRFVKAQANTPIDDEGNFLADRVLGRRKGGEVELLAPTEIDYMDVSPRQMVSAATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPLVGTGMELRAAVDAG--DVVTAEKAGVIEELCADYITVMADDGTR-RTYRLQKFSRSNHGTCTNQKPIVNEGDRVEAGQVIADGPCTQNGEMALGKNLRVAIMPWEGHNYEDAIILSQRLVQDDVLTSIHIEEHEVDARDTKLGAEEITRDIPNVSEDVLADLDERGIIRIGAEVQGGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIGVRVFNREDDDELPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVIGKILPAEDMPFTEDGTPVDIILNTHGVPRRMNIGQILETHLGWIASQGWSIDGDPEWAKRLPEELYDVDPGTNTASPVFDGAREE--------------------------EITGLLASTKPNRDG------------------------ERMVKA-----NGKAQLFDGRSG----------EPYPYPVAVGYMYILKLSHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1155
Score = 251, Expect = 5.2e-19, Identities = 76/276 (27%), Positives = 132/276 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++ I +    P+LL+LQ  +F   +  E                 LE  +  I PI+   G  SL +   + ++ K S +E +++  TY  PL+V     ++ +GE+K  T            +F    P++T+KGTFI+NG E+ V+SQ+VRSPG Y         S  +   ++ Y  +I+P++G  +  F  + +D + V       +     P+T  LKALG   E I   F   +++  +L+ +    +D    + L+++ + L   +        T L  LF K
  S:    25 RVSFANIREPLEVPDLLDLQVQSFEWLVGDETWFQRRVDAGDENPVGGLEEVLSEISPIEDFSGSMSLSFSDPRFDEVKASVEECKDKDMTYAAPLFVTAEFTNHTTGEIKSQT------------VFMGDFPVMTDKGTFIINGTERVVVSQLVRSPGVY------FDQSVDKTTDKDVYSVKIIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTAEAIRERFGFSETLMATLEKDHTAGQD----EALLDIYRKLRPGEPPTKESAQTLLENLFFK 289
>gi|13096178|pdb|1HQM|C Chain C, Crystal Structure Of Thermus Aquaticus Core Rna Polymerase- Includes Complete Structure With Side-Chains (Except For Disordered Regions)-Further Refined From Original Deposition-Contains Additional Sequence Information (1119 aa)
Score = 1962, Expect = 0.0e+00, Identities = 408/836 (48%), Positives = 555/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA---MKKLTLSKVL----ELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +                  +LT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  D  GF+ TPYR VKNGV+T+E+ ++TA  ED Y IA +N  +E ++   D+V+ R R        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V  VDG  I ++      V + L ++ +SNQ T  +Q P V VG++V KG  +ADGPA   G LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EGI+ +GAEVK GD+LVG+ S KG+ E + EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++V+V QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA   + +  +S V     E    +  A  F+L+FG  +     + K       EK++  L +A K        L L   G S E+                 LKE                   GK  L DGRTGE F+G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LTIKSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMADQFRVGLARLARGVRERMVMGS--------------PDTLTPAKLVNSRPLEAALREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDALGFIRTPYRRVKNGVVTEEVVYMTASEEDRYTIAQANTPLEGDRIATDRVVARRRGEPVIVAPEEVEFMDVSPKQVFSLNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVVKVDGTRIAVRYEDGRLVEHPLRRYARSNQGTAFDQRPRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGIVRIGAEVKPGDILVGRTSFKGEQEPSPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPVFDGATEPEIKELLAEAFNLYFGKRQGEGFGVDK------REKEV--LARAEK--------LGLVSPGKSPEE----------------QLKELF---------------DLGKVVLYDGRTGEPFEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTIKSDDIEGRNAAYQAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1104
Score = 177, Expect = 2.0e-10, Identities = 43/143 (30%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ K +  +          ++   K  FPI    K  GG   L+++  ++  P  S+ E R +  TY  PLY  L ++  ++G +K+            D +F   +P++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGG-LVLDFLEYRIGDPPFSQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHLPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|20139789|sp|Q9KWU7|RPOB_THEAQ DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|62738682|pdb|1YNJ|C Chain C, Taq Rna Polymerase-Sorangicin Complex >gi|62738688|pdb|1YNN|C Chain C, Taq Rna Polymerase-Rifampicin Complex >gi|109157856|pdb|2GHO|C Chain C, Recombinant Thermus Aquaticus Rna Polymerase For Structural Studies >gi|7573273|emb|CAB65465.2| RNA polymerase, beta subunit [Thermus aquaticus] (1119 aa)
Score = 1962, Expect = 0.0e+00, Identities = 408/836 (48%), Positives = 555/836 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEKV-YELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLA---MKKLTLSKVL----ELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKE 1337
           DDIDHLGN+R++ + EL+  + + GL R+ + + +++ +                  +LT   ++N++P + + +EFF+  QL+QF D+ NPL+ L +KRRISA+GPGG++RE    D+RDVH +HYG+ICP+ETPEG NIGLI SLA YA  D  GF+ TPYR VKNGV+T+E+ ++TA  ED Y IA +N  +E ++   D+V+ R R        ++V+F+D+SPKQV S+  + IPFLE+DDANRALMG+NMQ QA PLI   AP+V TG E ++  DS +AA+Y  E+DG V  VDG  I ++      V + L ++ +SNQ T  +Q P V VG++V KG  +ADGPA   G LALGQNVLVA   + GYN+EDAI++S+ L   D +TSIHI  Y ++   TK G E ITRDIP++SE++ + LD+EGI+ +GAEVK GD+LVG+ S KG+ E + EE+LL++IFG+K+++ K+TSL+VP G  G V    R +  D   EL   V E ++V+V QKRK+Q+GDK+A RHGNKG+++KI+PVEDMPHL DGT +D++LNPLGVPSRMN+GQILE HLGLA   + +  +S V     E    +  A  F+L+FG  +     + K       EK++  L +A K        L L   G S E+                 LKE                   GK  L DGRTGE F+G + VG M+++KL HMV+DK+H+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAAH L+E+LTIKSDD++GRN  Y AIIKG+ +PE  +PESF++L K+LQ L L V    E
  S:   323 DDIDHLGNRRIRTVGELMADQFRVGLARLARGVRERMVMGS--------------PDTLTPAKLVNSRPLEAALREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDALGFIRTPYRRVKNGVVTEEVVYMTASEEDRYTIAQANTPLEGDRIATDRVVARRRGEPVIVAPEEVEFMDVSPKQVFSLNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDS-LAALY-AEEDGEVVKVDGTRIAVRYEDGRLVEHPLRRYARSNQGTAFDQRPRVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGIVRIGAEVKPGDILVGRTSFKGEQEPSPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPVFDGATEPEIKELLAEAFNLYFGKRQGEGFGVDK------REKEV--LARAEK--------LGLVSPGKSPEE----------------QLKELF---------------DLGKVVLYDGRTGEPFEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTIKSDDIEGRNAAYQAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDE 1104
Score = 177, Expect = 2.0e-10, Identities = 43/143 (30%), Positives = 77/143 (53%)
  Q:    18 RDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------LEGTIKSIFPI----KSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAY 160
           + + +I +    P L  +Q  ++ K +  +          ++   K  FPI    K  GG   L+++  ++  P  S+ E R +  TY  PLY  L ++  ++G +K+            D +F   +P++TE G+FI+NG ++ ++SQI RSPG Y
  S:     4 KRFGRIREVIPLPPLTEIQVESYKKALQADVPPEKRENVGIQAAFKETFPIEEGDKGKGG-LVLDFLEYRIGDPPFSQDECREKDLTYQAPLYARLQLIHKDTGLIKE------------DEVFLGHLPLMTEDGSFIINGADRVIVSQIHRSPGVY 147
>gi|46360922|gb|AAS89194.1| RpoB [Corynebacterium pseudodiphtheriticum] (1158 aa)
Score = 1960, Expect = 0.0e+00, Identities = 404/838 (48%), Positives = 548/838 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNL-NVEKNKFKEDKVLCRYRSSWEFFDVKD-VDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   S +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +G +TDE+ +L A +ED Y IA + +   E      D++  R +         D VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V  V    I I         Y L KF ++NQ T  NQ P+V++G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++ +  +D  TS+HI E+ +D   TK G EEITR+IPNVSE   + LD+ GII +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  EDD +L+  V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP +EDGT +D++LN  GVP RMNIGQ+LE+HLG LA     +                      ++  +  LIK L K L +    SL                             TATPVF+G +  ++   +  +  +  +G +   + GK  L DGR+GE F+  +SVG MY+LKL H++D+KIH+R+ GPYS ITQQPLGGK+Q GG+RFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V +    G
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSASIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNSFGFIETPYRKVVDGRVTDEVEYLAADAEDRYSIAQAEVPTAEDGTITSDRIEVRQKDGDIAVTTADGVDYVDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPYVGTGMELRAAYDAGDVVI--TPKAGVVENVSADLITIMDDDGIRDTYMLRKFERTNQGTNYNQTPLVNIGDRVEAGQVLADGPGTHNGEMSLGRNMLVAFMPWEGHNYEDAIILNQSIVEDDSLTSVHIEEHEIDARDTKLGAEEITREIPNVSEDVLRDLDERGIIRIGADVRPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVARFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPPEDMPFMEDGTPVDVILNTHGVPRRMNIGQVLEIHLGWLAHAGWKVDP--------------------NDPQNEELIKTLPKELYDVPAHSL-----------------------------TATPVFDGASNEEVSGLLANSRPNR-DGNVMVDRHGKARLFDGRSGEPFEHPISVGYMYILKLHHLIDEKIHARSTGPYSMITQQPLGGKAQFGGERFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNVEVLSSDG 1125
Score = 238, Expect = 1.8e-17, Identities = 74/249 (29%), Positives = 123/249 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL+LQ++++   I T                    LE  +  + PI+   G  SL     + E  K +  EA+ +   Y  PLYV    +++++ E+K  T            +F    PM+TEKGTFIVNG E+ ++SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG  +E+I + F   + + ++L+ +      V  TDE +
  S:    19 RYSFAKINEPIAVPGLLDLQRDSYDWLIGTPEWREREQERRGADAQITSGLEDILNELSPIEDYSGNMSLSLSEPRFEPVKNTVDEAKEKDINYSAPLYVTAEFINSDTQEIKSQT------------VFIGDFPMMTEKGTFIVNGTERVIVSQLVRSPGVYF--DRSIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTEEKIRDRFGFSELMMSTLEAD-----GVANTDEAL 257
>gi|46360976|gb|AAS89221.1| RpoB [Corynebacterium imitans] (1110 aa)
Score = 1960, Expect = 0.0e+00, Identities = 405/825 (49%), Positives = 553/825 (67%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV-----KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI--KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQ 1326
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI +L++YA  +  GF+ TPYR V NG +TD+I +LTA  ED Y IA +   + K+ +   +++  R +      D+     + VD++DISP+Q+VS+A + IPFLE+DDANRALMGANM +QA PL+   AP V TG E + A+D+G   +      G V  V G  I +    G+ +   +L  F+++NQ TC NQ PIVS G++V  G  IADGP   +GE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TS+HI E+ +D   TK G EEITR+IPNVSE   K LD+ GII +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+RF  EDD +L+  V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP +EDGT +DI+LN  GVP RMNIGQ+LE+HLG LA    T++                      + A+  L++ L + L +   +SL                             TATPVF+G +  ++   +  +  +  +G +     GK  L DGR+GE +   +SVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGALSSYARVNPFGFIETPYRKVDNGQLTDQIDYLTADEEDRYAIAQAATPMTKDGELTGERIEVRLKDG----DIGVVGPQGVDYLDISPRQMVSVATAMIPFLEHDDANRALMGANMHKQAVPLLRAEAPYVATGMEQRAAYDAGDTVI--SPLSGVVETVTGDYITVLGDDGTRD-TQQLRTFHRTNQGTCYNQTPIVSAGQRVEAGQVIADGPGTKDGEMSLGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSVHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIIRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIAVRRFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPTEDMPFMEDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAKAGWTVNP--------------------DDPANAALLETLPEKLYDVPPESL-----------------------------TATPVFDGASNDEIAGLLANSKPNR-DGDVMVDAQGKTTLYDGRSGEPYKYPISVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQ 1109
Score = 249, Expect = 8.7e-19, Identities = 79/264 (29%), Positives = 128/264 (48%)
  Q:     2 SKKKFIDKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           S++     EI     R  ++KIE+    P LL++Q  +F   + T                    LE  +  I PI+   G  SL     + E  K + +EA+++   Y  PLYV    ++N++ E+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+N+      V  TDE +
  S:     1 SRQTMSMAEIPGAPERYSFAKIEEPITVPGLLDVQLESFAWLVGTSEWREREQELRGDEARVKSGLEDILDEISPIQDYSGNMSLTLSEPRFEDAKYTIEEAKDKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPLMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSELMMSTLEND-----GVANTDEAL 254
>gi|46360982|gb|AAS89224.1| RpoB [Corynebacterium mycetoides] (1110 aa)
Score = 1960, Expect = 0.0e+00, Identities = 407/825 (49%), Positives = 545/825 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIA--CSNLNVEKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQ 1326
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI +LA+YA  +  GF+ TPY+ V +G +TD+I +LTA  ED Y IA   + L+ E+N   E   +              VD++DISP+Q+VS+A + IPFLE+DDANRALMGANMQ+QA PL+   A  V TG E + A+D+G   +    K G +  V G  I +         Y L  F ++NQ TC NQ PIV+ G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIIL++R+  EDI TS+HI E+ +D   TK G EEITR+IPNVSE   K LD+ GII +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  V+RF  EDD +L+  V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG LA    T++                      + A+  L++ L + L +   +SL                             TATPVF+G +  ++   +  +  +  +G +    +GK  L DGR+GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ
  S:   347 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGALASYARVNAFGFIETPYQKVVDGKLTDQIDYLTADEEDRYAIAQAATPLDGERNLVGERIEVRLKDGDIGVVGAHGVDYLDISPRQMVSVATAMIPFLEHDDANRALMGANMQKQAVPLLRSEAAYVATGMEQRAAYDAGDTVI--SRKAGVIEDVTGDYITVMDDDGIRDTYMLRTFERTNQGTCYNQTPIVNAGDRVEAGQVIADGPGTKNGEMALGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSVHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIIRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIAVRRFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPQEDMPFMADGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAHAGWTVNP--------------------DDPANAELLQTLPEHLYDVPPESL-----------------------------TATPVFDGASNEEIAGLLANSKPNR-DGDVMVDGNGKTMLFDGRSGEPFKYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQ 1109
Score = 241, Expect = 6.9e-18, Identities = 72/241 (29%), Positives = 118/241 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R  ++KI +    P LL++Q  +F   + TE                   LE  +  I PI+   G  SL     + E+ K S  E + +   Y  PLYV    ++N++ E+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+++  +  D
  S:    16 RYSFAKISEPVTVPGLLDVQSESFAWLVGTEEWRERQRAERGDDARITSGLEDILDEISPIQDYSGNMSLSLSEPRFEEIKYSIDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPLMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HAVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESDGVSNTD 251
>gi|15607807|ref|NP_215181.1| DNA-directed RNA polymerase subunit beta [Mycobacterium tuberculosis H37Rv] >gi|31791851|ref|NP_854344.1| DNA-directed RNA polymerase subunit beta [Mycobacterium bovis AF2122/97] >gi|121636588|ref|YP_976811.1| DNA-directed RNA polymerase subunit beta [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148660441|ref|YP_001281964.1| DNA-directed RNA polymerase subunit beta [Mycobacterium tuberculosis H37Ra] >gi|2143293|emb|CAB09390.1| DNA-DIRECTED RNA POLYMERASE (BETA CHAIN) RPOB (TRANSCRIPTASE BETA CHAIN) (RNA POLYMERASE BETA SUBUNIT) [Mycobacterium tuberculosis H37Rv] >gi|31617438|emb|CAD93548.1| DNA-DIRECTED RNA POLYMERASE (BETA CHAIN) RPOB (TRANSCRIPTASE BETA CHAIN) (RNA POLYMERASE BETA SUBUNIT) [Mycobacterium bovis AF2122/97] >gi|121492235|emb|CAL70702.1| DNA-directed RNA polymerase (beta chain) rpoB [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148504593|gb|ABQ72402.1| DNA-directed RNA polymerase subunit beta [Mycobacterium tuberculosis H37Ra] (1172 aa)
Score = 1960, Expect = 0.0e+00, Identities = 404/863 (46%), Positives = 560/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSL--WFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++DEI +LTA  ED +++A +N  ++ + +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   E+ G +  V    I +       + Y + KF +SN  TC NQ PIV  G++V  G  IADGP   +GE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPN+S+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  ED+ EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE +      S + +    G+ + A+R     L   L E Q  ++                              +TPVF+G    +L + +    +   +G +     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   362 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAAR-----LPDELLEAQPNAI-----------------------------VSTPVFDGAQEAEL-QGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1164
Score = 262, Expect = 3.0e-20, Identities = 80/276 (28%), Positives = 136/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I +                  LE  +  + PI+   G  SL +   + +  K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + ++++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    32 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKD-----NTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 296
>gi|158513701|sp|A5U052|RPOB_MYCTA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1177 aa)
Score = 1960, Expect = 0.0e+00, Identities = 404/863 (46%), Positives = 560/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSL--WFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++DEI +LTA  ED +++A +N  ++ + +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   E+ G +  V    I +       + Y + KF +SN  TC NQ PIV  G++V  G  IADGP   +GE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPN+S+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  ED+ EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE +      S + +    G+ + A+R     L   L E Q  ++                              +TPVF+G    +L + +    +   +G +     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   367 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAAR-----LPDELLEAQPNAI-----------------------------VSTPVFDGAQEAEL-QGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1169
Score = 262, Expect = 3.0e-20, Identities = 80/276 (28%), Positives = 136/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I +                  LE  +  + PI+   G  SL +   + +  K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + ++++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    37 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKD-----NTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 301
>gi|15840070|ref|NP_335107.1| DNA-directed RNA polymerase subunit beta [Mycobacterium tuberculosis CDC1551] >gi|61234284|sp|P0A680|RPOB_MYCTU DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|61234288|sp|P0A681|RPOB_MYCBO DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158513177|sp|A1KGE7|RPOB_MYCBP DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|13880218|gb|AAK44921.1| DNA-directed RNA polymerase, beta subunit [Mycobacterium tuberculosis CDC1551] >gi|134149131|gb|EBA41176.1| DNA-directed RNA polymerase (beta chain) rpoB [Mycobacterium tuberculosis str. Haarlem] (1178 aa)
Score = 1960, Expect = 0.0e+00, Identities = 404/863 (46%), Positives = 560/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSL--WFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++DEI +LTA  ED +++A +N  ++ + +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   E+ G +  V    I +       + Y + KF +SN  TC NQ PIV  G++V  G  IADGP   +GE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPN+S+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  ED+ EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE +      S + +    G+ + A+R     L   L E Q  ++                              +TPVF+G    +L + +    +   +G +     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   368 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAAR-----LPDELLEAQPNAI-----------------------------VSTPVFDGAQEAEL-QGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1170
Score = 262, Expect = 3.0e-20, Identities = 80/276 (28%), Positives = 136/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I +                  LE  +  + PI+   G  SL +   + +  K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + ++++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    38 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKD-----NTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 302
>gi|167967486|ref|ZP_02549763.1| DNA-directed RNA polymerase subunit beta [Mycobacterium tuberculosis H37Ra] (1096 aa)
Score = 1957, Expect = 0.0e+00, Identities = 404/863 (46%), Positives = 560/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSL--WFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++DEI +LTA  ED +++A +N  ++ + +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   E+ G +  V    I +       + Y + KF +SN  TC NQ PIV  G++V  G  IADGP   +GE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPN+S+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  ED+ EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE +      S + +    G+ + A+R     L   L E Q  ++                              +TPVF+G    +L + +    +   +G +     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   286 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAAR-----LPDELLEAQPNAI-----------------------------VSTPVFDGAQEAEL-QGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1088
Score = 248, Expect = 1.3e-18, Identities = 72/245 (29%), Positives = 119/245 (48%)
  Q:    48 LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           LE  +  + PI+   G  SL +   + +  K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + ++++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:     4 LEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKD-----NTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 220
>gi|46360992|gb|AAS89229.1| RpoB [Corynebacterium striatum] (1115 aa)
Score = 1957, Expect = 0.0e+00, Identities = 402/831 (48%), Positives = 548/831 (65%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQV 1332
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+D  N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +G +TD++ +LTA  ED++ IA + L  + +     +++  R +       D   VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V  V    I I     ++  Y L KF ++NQ T  NQ P+V +G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNVS+   + LD+ GI+ +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  EDD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP + DGT +D++LN  GVP RMNIGQ+LE+HLG LA     +                     + + A+  L+K L + L +    SL                             TATPVF+G +  ++   +  +  +  +G +   + GK  L DGR+GE +   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L V
  S:   347 DDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDHNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVVDGKVTDQVEYLTADEEDKFAIAQAELEKDADGTIIGERIEVRLKDGDIGVTDASGVDYVDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMEQRAAYDAGDLII--TPKAGVVENVTADLITIMDDEGQRDTYMLRKFERTNQGTNYNQTPLVELGQRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRIVEEDILTSIHIEEHEIDARDTKLGPEEITREIPNVSDDVLRDLDERGIVRIGADVRAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGENGKVIGVARFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPPEDMPFMADGTPVDVILNTHGVPRRMNIGQVLEVHLGWLAHAGWKVD--------------------VDDPANAELLKTLPEELYDVPAGSL-----------------------------TATPVFDGASNEEIGRLLASSRPNR-DGDVMVDEHGKAQLFDGRSGEPYKYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCLNV 1115
Score = 237, Expect = 2.3e-17, Identities = 74/249 (29%), Positives = 124/249 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL+LQ ++F   I T                    LE  ++ + PI+   G  SL     + E  K +  E + +   Y  PLYV    ++N++ E+K  T            +F    PM+T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG ++++I + F   + + ++L+++      V  TDE +
  S:    16 RYSFAKISEPIAVPGLLDLQLDSFAWLIGTPEWREREQAERGPEARVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEPVKNTVDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVVVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWSEQQIKDRFGFSELMMSTLESD-----GVANTDEAL 254
>gi|11467690|ref|NP_050742.1| RNA polymerase beta subunit [Guillardia theta] >gi|6094123|sp|O78485|RPOB_GUITH DNA-directed RNA polymerase subunit beta (PEP) (Plastid-encoded RNA polymerase subunit beta) (RNA polymerase subunit beta) >gi|3603015|gb|AAC35676.1| RNA polymerase b-chain [Guillardia theta] (1096 aa)
Score = 1956, Expect = 0.0e+00, Identities = 412/858 (48%), Positives = 561/858 (65%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L+  D L+   Y+INL ++IG  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ I D                SLT  +++N KP   S +EFF S QL+QF+DQ NPLAELT+KRRISA+GPGG++R+     +RD+H SHYG+ICPIETPEG N GLI  LAT+A  +  GF+  P+  V++G + +  +  +LTA  ED+Y IA  ++ + E N+     V  +YR  +       VDFI +SP QV+SIA S IPFLE+DDANRALMG+NMQRQA PL+ P +P+VGTG E + A DSGM  V    +DG V++V G  I + +   +E  Y L K+ +SNQ+TC NQ P V +GE V +G  IADG A   GELALGQN+LVA+  W GYNYEDA ++++RL   D++TS+HI +Y ++  +TK G EEITR++PNV E++ + LD+ GII++G+ V+ GD+L+GK++PKG+ +   E KLL+AIFG+K+++ ++TSL+VP+GG G +  V+ F  E   EL       I+VY+ Q RKIQ+GDKMAGRHGNKGIIS+I+P +DMP+L DGT +D++LNPLGVPSRMN+GQI E  LGLA + L           +   + F    G   EASR L+   EK LNE +IK+      E   FDL                                         P    L +G++G          E FD  V++G+ YMLKL H+VDDKIH+R+ GPYS +TQQPLGG++Q+GGQR GEMEVWALEA+GA++ L+ELLT+KSDD++GRN T NAI+KGKPIP  G PESFK+L ++LQ LGL +   K
  S:   276 LTPQDTLAAIDYLINLKFEIGETDDIDHLGNRRVRSVGELLQNQVRIGLNRLERIIRERMTICD--------------ITSLTPNTLVNPKPIIASIREFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLNRDRAGFGVRDIHPSHYGRICPIETPEGPNAGLIGVLATHARINTYGFIEAPFFKVQDGQVYNHSQPIYLTADQEDKYRIAPGDITLDETNRIATKIVPIKYRQEFTTTKPNQVDFIAVSPIQVISIATSLIPFLEHDDANRALMGSNMQRQAVPLLYPESPLVGTGLEAQAARDSGMVVV--SIEDGQVTFVSGDKICVTNKKGDEIAYYLQKYQRSNQDTCINQRPTVWLGEDVIEGQVIADGAATEGGELALGQNILVAYLPWEGYNYEDAFLINERLVYNDVYTSVHIEKYEIEARQTKLGSEEITRELPNVGEAALRKLDENGIIVIGSWVEAGDILIGKVTPKGESDQPPEGKLLRAIFGEKARDVRDTSLRVPNGGRGRILDVRIFTREKGDELPTGANIVIRVYIAQSRKIQVGDKMAGRHGNKGIISRILPRQDMPYLPDGTPVDLVLNPLGVPSRMNVGQIFECLLGLAAENLN---------KRFKITPFDEMHG--AEASRVLVN--EK-LNEAKIKT-----GENWLFDLR---------------------------------------HPGKITLYDGRTG----------EAFDNPVTIGVSYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGRAQHGGQRLGEMEVWALEAFGASYTLQELLTVKSDDMQGRNETLNAIVKGKPIPRPGTPESFKVLMRELQSLGLDIGAYK 1053
Score = 225, Expect = 5.3e-16, Identities = 63/222 (28%), Positives = 108/222 (48%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNE 251
           P+L+ +Q+ +F  F++  L   I+S  PI +  G   L   G    L  PK +  E +    TY   +YV   +++ E+G +K+              +F   +P++T++GTFI+NG E+ +++QIVRSPG Y   KS++     R      Y   ++  +G  +  F  +  D + V       + T  IP   FLKA+GL+  +I N   + + +K +   E
  S:    12 PDLVEIQRASFCWFLNEGLAEEIQSFSPIVNYTGNLELHLFGDQYTLRYPKHNINECKRRDTTYSVQIYVPAQLINRETGVIKEQE------------VFIGDLPLMTDRGTFIINGAERVIVNQIVRSPGIYY--KSELDKQGRRT-----YSSSLISNRGA-WVKFETDRNDLVWVRI-----DKTRKIPAHVFLKAMGLSDTDIYNGLRHPEYLKKTFRFE 210
>gi|46361022|gb|AAS89244.1| RpoB [Corynebacterium aurimucosum] (1110 aa)
Score = 1956, Expect = 0.0e+00, Identities = 405/823 (49%), Positives = 545/823 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN---KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQ 1324
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +G +TD++ +LTA  ED + IA     VEK+       D++  R +       D   VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V  V    I I     ++  Y L KF ++NQNT  NQ P+VS+G++V  G  +ADGP   NGE++LG+N+LVAF  W G+NYEDAIIL++R+  EDI TSIHI E+ +D   TK G EEITR+IPNVS+   + LD+ GI+ +GA+V+ GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V RF  EDD +L   V E I+VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP +EDGT +DI+LN  GVP RMNIGQ+LE+HLG LA     +                       + A+  L+K L + L +   +SL                             TATPVF+G    ++   +  +  +  +G +   + GK  L DGR+GE +   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHASHYGRMCPIETPEGPNIGLIGSLASYARVNAFGFIETPYRKVVDGKVTDQVEYLTADEEDRFAIA--QAEVEKDADGTLTGDRIEVRLKDGDIGVTDASGVDYVDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPYVGTGMEQRAAYDAGDLII--TPKAGVVENVTADLITIMDDEGQRDTYMLRKFERTNQNTNYNQTPLVSLGDRVEAGQVLADGPGTHNGEMSLGRNLLVAFMPWEGHNYEDAIILNQRIVEEDILTSIHIEEHEIDARDTKLGPEEITREIPNVSDDVLRDLDERGIVRIGADVRAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVSRFSREDDDDLAPGVNEMIRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPPEDMPFMEDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAHAGWKIDT--------------------EDPANAELLKTLPEELYDVPPESL-----------------------------TATPVFDGATNEEISRLLASSKPNR-DGDVMVDEHGKARLFDGRSGEPYLYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKE 1110
Score = 233, Expect = 6.8e-17, Identities = 73/249 (29%), Positives = 123/249 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELI 265
           R  ++KI +    P LL+LQ +++   I T                    LE  ++ + PI+   G  SL     + E  K +  E + +   Y  PLYV    ++N++ E+K  T            +F    PM+T+KGTFIVNG E+ ++SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG ++E+I   F   + + ++L+++      V  TDE +
  S:    19 RYSFAKISEPIAVPGLLDLQLDSYAWLIGTPEWREREQAERGEDARVTSGLEDILEELSPIQDYSGNMSLSLSEPRFEPVKNTVDECKEKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPMMTDKGTFIVNGTERVIVSQLVRSPGVYF--DQTIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWSEEQIKERFGFSELMMSTLESD-----GVANTDEAL 257
>gi|16329957|ref|NP_440685.1| DNA-directed RNA polymerase subunit beta [Synechocystis sp. PCC 6803] >gi|2500610|sp|P77965|RPOB_SYNY3 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|1652443|dbj|BAA17365.1| RNA polymerase beta subunit [Synechocystis sp. PCC 6803] (1102 aa)
Score = 1954, Expect = 0.0e+00, Identities = 407/858 (47%), Positives = 561/858 (65%)
  Q:   479 LSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIR--WLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS--------EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITK 1336
           L+  DIL+  +Y+INL++D+G  DDIDHLGN+R++ + ELL+ + + GL R+E+ I +++ +++                +LT  S++N KP   + KEFF S QL+QF+DQ NPLAELT+KRRISA+GPGG++RE     +RD+H SH+G+ICP+ETPEG N GLI SLAT A  ++ GF+ TPY  V++G +  ++   +LTA  ED+  +A  ++   E+     + V  RYR  +     + VD++ +SP Q++S+A S IPFLE+DDANRALMG+NMQRQA PL+ P  P+VGTG E + A DSGM  V      G V+YVD   I+++  S        EE VY + K+ +SNQ+TC NQ P+V  GE V  G  +ADG A   GELALGQN+LVA+  W GYNYEDAI++S+RL  +D++TSIHI ++ ++  +TK G EEITR+IPNV E + + LD+ GII +GA V+ GD+LVGK++PKG+ +   EEKLL+AIFG+K+++ ++ SL+VP+G +G V  V+ F  E   EL       +++YV QKRKIQ+GDKMAGRHGNKGIIS+I+P+EDMP+L DG  IDI LNPLGVPSRMN+GQ+ E  LG A + L +         +   + F   +G  EEASR+ +  L           L++A++                  +  ++    P                  I   +G+ GE                FD  ++VG  YMLKL H+VDDKIH+R+ GPYS +TQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLT+KSDD++GRN   NAI+KGK IP  G PESFK+L ++LQ LGL ++  K
  S:   274 LTPQDILAAINYLINLEFDVGTTDDIDHLGNRRVRSVGELLQNQIRVGLNRLERIIRERMTVSE--------------SDALTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIGSLATCARVNDYGFIETPYFRVESGRVRKDLDPVYLTADEEDDMRVAPGDIPTDEEGNIIGESVPIRYRQEFSTTSPEQVDYVAVSPVQIISVATSMIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQAARDSGMVIV--SRTHGIVTYVDATEIRVQPHSPDNPAEKGEEIVYPIQKYQRSNQDTCLNQRPLVYAGEDVVPGQVLADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHIEKFEIEARQTKLGPEEITREIPNVGEDALRNLDEHGIIRIGAWVESGDILVGKVTPKGEADQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREKGDELPPGANMVVRIYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGRPIDIALNPLGVPSRMNVGQVFECLLGWAGENLGV---------RFKITPFDEMYG--EEASRDTVHGL-----------LEEASQR---------------PNKDWVFNENHP----------------GKIQVFDGRTGEP---------------FDRPITVGQAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAYGAAYILQELLTVKSDDMQGRNEALNAIVKGKSIPRPGTPESFKVLMRELQSLGLDIAAHK 1058
Score = 261, Expect = 4.1e-20, Identities = 85/320 (26%), Positives = 151/320 (47%)
  Q:    30 PNLLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIG--MKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGK-NAEKQKELNEV-INNIISEK---AAKDLVINLSISTKNIDSKFRLSNK 349
           P+L+ +Q  +FH F++  L   + S  PI    G+  L ++G   KL++PK    E++    +Y   +YV   +++ E+GE+K+              +F   +P++TE+GTFI+NG E+ +++QIVRSPG Y   K ++  +  R      Y   ++P +G  +  F  +    + V       + T  +     LKA+GL+  EIL+  ++ +  + +LD     E +  E + L+ L K L   +     G    L   F  +   +  L   G+    K+  LNE     +++ +   AA + +INL       D    L N+
  S:    10 PDLIEIQHASFHWFLEEGLIEELNSFSPISDYTGKLELHFLGKDYKLKQPKYDVDESKRRDASYSVQMYVPTRLINKETGEIKEQE------------VFIGDLPLMTERGTFIINGAERVIVNQIVRSPGVYY--KKELDKNGRRT-----YSASLIPNRGA-WLKFETDKNGLVYVRI-----DKTRKLSAQVLLKAIGLSDNEILDSLSHPEFYQKTLD----KEGNPTEEEALVELYKKLRPGEPPTVSGGQQLLESRF--FDPKRYDLGRVGRYKLNKKLRLNEADTTRVLTPQDILAAINYLINLEFDVGTTDDIDHLGNR 305
>gi|41017808|sp|Q9L637|RPOB_AMYMD DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|7331268|gb|AAF60349.1|AF242549_1 DNA-dependent RNA polymerase beta subunit [Amycolatopsis mediterranei] >gi|41581816|gb|AAS07760.1| RpoB [Amycolatopsis mediterranei] (1167 aa)
Score = 1954, Expect = 0.0e+00, Identities = 438/942 (46%), Positives = 593/942 (62%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL-----------DYDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGK--LGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+    +   +A V +Y K+N              +G  T ++  TL+  DI++I  Y++ L           + +I    DDIDH GN+R++ + EL++ + + GL R E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+ Q NP+  LT+KRR++A+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SL +YA  +  GF+ TPYR V  G +TD+I +LTA  ED ++ A +N  +  +  F ED+V+ R +    E  D  D+D++D+SP+Q+VSIA + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A DSG   V   E+ G V  +    I +       K Y L KF +SN  TC N  PIV+ G+++  G  IADGP+  NGE+ALG+N+LVA   W G+NYEDAIILS+RL  +D+ TSIHI E+ +D   TK G EEITRDIPNVSE     LD+ GII +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL   V E ++VYV QKRKIQ GDK+AGRHGNKG+I KI+PVEDMP +EDGT +DI+LN  GVP RMNIGQILELHLG LA +  T+                        E   +  KNL   L +    +    N     FD        G   E+L     T +          E M +      NGK  L +G+SG          E +   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G +    ++  +D+    +N+  N  +N+
  S:   281 TKESAQTLLENLFFKAKRYDLAKVGRY-KVN------------KKLGLSTPIENGTLTEEDIVTIIEYLVRLHAGEDKMTAANNTEIPVETDDIDHFGNRRIRTVGELIQNQIRVGLSRTERVVRERMTTQD--------------VEAITPQTLINIRPIGAAIKEFFGTSQLSQFMQQTNPIDGLTHKRRLNALGPGGLSRERAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLCSYARVNPFGFIETPYRKVVEGRVTDQIDYLTADEEDRFVKAQANAPISDDGTFIEDRVMARRKGGEVELIDPLDIDYMDVSPRQMVSIATAMIPFLEHDDANRALMGANMQRQAVPLLRSQAPYVGTGVELRAAIDSGDMLV--AEQSGVVEELSADLITVMHDDGTRKSYSLYKFRRSNHGTCFNHRPIVNEGDRIEAGQVIADGPSTENGEVALGKNLLVAVMPWEGHNYEDAIILSERLVQDDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLADLDERGIIRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGKVIGIRVFSREDDDELPPGVNELVRVYVAQKRKIQPGDKLAGRHGNKGVIGKILPVEDMPFMEDGTPVDIILNTHGVPRRMNIGQILELHLGWLASQGWTI------------------------EGDPDWAKNLSAELRDVAPGT----NTATPVFD--------GAKEEEL-----TGLLSATKPNRDGERMVKE-----NGKANLFDGRSG----------EPYPYPVAVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGSSIEMRDSGDEDLERAAANLGINLSRNE 1158
Score = 270, Expect = 3.2e-21, Identities = 85/276 (30%), Positives = 139/276 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD-VFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++KI +  N PNLL++Q  +F  F   E                 LE  +  I PI+   G  SL +   + ++ K S +E +++  TY  PL+V    V+N +GE+K  T            +F    P++T+KGTF++NG E+ V+SQ+VRSPG Y  +K   K S+     ++ +   ++P++G  +  F  + +D + V       +     P+T  LKALG   E I   F+  +++  +L      EKD    TDE L+++ + L   +        T L  LF K
  S:    31 RVSFAKIREPLNTPNLLDVQIQSFQWFTGDEAWFQRRVEEGEENPVGGLEEVLNEISPIEDFSGSMSLSFSAPRFDEVKASIEECKDKDMTYAAPLFVTAEFVNNNTGEIKSQT------------VFLGDFPVMTDKGTFVINGTERVVVSQLVRSPGVY-YSKDIDKTSD-----KDVFSVRVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEAIRERFSFSETLLATL------EKDHTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 295
>gi|46360988|gb|AAS89227.1| RpoB [Corynebacterium afermentans subsp. afermentans] (1116 aa)
Score = 1953, Expect = 0.0e+00, Identities = 404/829 (48%), Positives = 551/829 (66%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEK-NKFKEDKVLCRYRSSWEFFDV-----KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLG-LAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CP+ETPEG NIGLI +L+TYA  +  GF+ TPY+ V +G +T +I +LTA  ED Y IA +   ++K N    +++  R +      D+     + VD++DISP+Q+VS+A + IPFLE+DDANRALMGANMQ+QA PL+   +  V TG E + A+D+G   +   +K G +  V G  I +      +  Y L  F ++NQ TC NQ PIVS G++V  G  IADGP   +GE+ALG+N+LVAF  W G+NYEDAIIL++R+  EDI TS+HI E+ +D   TK G EEITR+IPNVSE   K LD+ GII +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG +G V  V+RF  EDD +L+  V E I+VYV QKRKIQ GDKMAGRHGNKG++ KI+P EDMP + DGT +DI+LN  GVP RMNIGQ+LE+HLG LA    T++                      + A+  L++ L + L +    SL                             TATPVF+G    ++   +     +     + +G+ GK  L DGR+GE +   +SVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L
  S:   350 DDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGIEVRDVHPSHYGRMCPVETPEGPNIGLIGALSTYARVNAFGFIETPYQKVNDGKLTGQIDYLTADEEDRYAIAEAATPMDKDNNLTGERIEVRLKDG----DIGVVGPQGVDYLDISPRQMVSVATAMIPFLEHDDANRALMGANMQKQAVPLLRAESAYVATGMEQRAAYDAGDTVI--SKKAGVIENVTGDFITVMDDEGGRDTYMLRTFERTNQGTCYNQTPIVSAGDRVEAGQVIADGPGTKDGEMALGRNLLVAFMPWEGHNYEDAIILNQRVVEEDILTSVHIEEHEIDARDTKLGAEEITREIPNVSEDVLKDLDERGIIRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEQGKVIAVRRFSREDDDDLSPGVNEMIRVYVAQKRKIQDGDKMAGRHGNKGVVGKILPQEDMPFMADGTQVDIILNTHGVPRRMNIGQVLEIHLGWLAKAGWTVNP--------------------DDPANAKLLETLPEHLYDVPADSL-----------------------------TATPVFDGATNEEIAGLLANTKPNRDGDVMVDGE-GKTTLFDGRSGEPYKYPISVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCL 1116
Score = 235, Expect = 4.1e-17, Identities = 70/241 (29%), Positives = 119/241 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R  ++KI +    P LL++Q  +F   + T+                   LE  ++ + PI+   G  SL     + E  K +  E +++   Y  PLYV    ++N++ E+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPG Y      I  S  R      +  +++P++G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+N+  +  D
  S:    19 RYSFAKINEPITVPGLLDVQLESFAWLVGTQEWREREQANRGDDTRITSGLEDILEELSPIEDYSGNMSLTLSEPRFEDVKYTIDECKDKDINYSAPLYVTAEFINNDTQEIKSQT------------VFIGDFPLMTDKGTFIVNGTERVVVSQLVRSPGVYF--DETIDKSTERPL----HSVKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTTEQITERFGFSEIMMSTLENDGVSNTD 254
>gi|154488235|ref|ZP_02029352.1| hypothetical protein BIFADO_01809 [Bifidobacterium adolescentis L2-32] >gi|154083386|gb|EDN82431.1| hypothetical protein BIFADO_01809 [Bifidobacterium adolescentis L2-32] (1186 aa)
Score = 1953, Expect = 0.0e+00, Identities = 416/874 (47%), Positives = 566/874 (64%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINLDY-DIGFYDDID--------------HLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIK-IKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYE----LNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           +G +  ++  +LS  DI++   Y++ L   +  F    D              H GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NPLA +TNKRR+SA+GPGG+SR+  ++++RDVH SH+G++CPIE+PEG NIGLI SLAT+   +  GF+ TPYR V NG +TDE+ ++TA  + E++IA +N  +++N  F + + L R     E  DV    VD++D+SP+Q+VS+ AS IPFLE+D+ +RALMG NMQRQA PLI    P+VGTG E++ A DSG   V   EK G V+YV    I+ +        Y+L KF +SNQ TC NQVP++  GE+V  GT +ADGPA   GE+ALG+N+L+AF  W+GYNYEDA+I+S+RL  +D  +SIHI EY +D  +TK G EEITRD+PNV E +   LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  VK    ED  E    L   V + I+VY+ Q RKI  GDK++GRHGNKG+IS+I+P EDMP L DGT +DIMLNPLGVPSRMN                 L +VLEL+      + + +      EA                      A K++            G  +       ATPVF+GV    +K  ++    D    KL  G  GK  L DGRTGE F   +SVG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L E++T KSDDV GR   Y AI+KG+ +P +G+PESFK+L K++Q L L V +    G A
  S:   315 LGLEKDVNDRSLSREDIIATIKYLVTLHAGETKFPGKRDGQDVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQD--------------PEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVVNGHVTDEVEYMTADRDAEHVIAQANQELDENGNFVKKQALARVGEE-EAVDVPVSSVDYMDVSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGAEWRAAVDSG--DVILAEKPGVVTYVSADIIRTMNDDGTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEAGTVLADGPATQKGEMALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGETGTVIAVKEITREDAEEDGDELPNGVNQMIRVYIAQHRKITQGDKLSGRHGNKGVISRILPEEDMPFLADGTPVDIMLNPLGVPSRMN-----------------LGQVLELHLGWIAHAGWDISLDPDAEA----------------------AWKKYVP---------QGAEKGAPGTPVATPVFDGVRPETIKGLLSCTLPDRDGNKL-VGPDGKATLFDGRTGEPFPKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAIVKGENLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVA 1145
Score = 237, Expect = 2.4e-17, Identities = 72/269 (26%), Positives = 134/269 (49%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDS 276
           D ++ K   R ++  I +  + P LL +Q ++F   I  E                      L+   + I PI++     SL +     E+P+ + +E + +  TY  PLYV+    + ++GE+K  T            +F    P+ T  GTFI+ G E+ ++SQ+VRSPG Y   +SQ + S+     +E +  +I+P++G  +  F  + +D + V       +S        FL A+G+ K+EI + F ++  + ++L  E    +D    + L +L + +  +D+
  S:    19 DIDLHKASDRVNFGSIREPIDVPYLLGVQTDSFDWLIGNERWQKRVQEDLENGTNTVPHTSGLDEVFQEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQT------------VFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVY-FDRSQDRTSD-----KEVFGAKIIPSRGA-WLEFEIDKRDVLGVRVDRKRKQSA-----IVFLMAIGMTKDEIADAFKDYPLVMDALAKETVQTQD----EALTDLYRKIRPADT 281
>gi|148821872|ref|YP_001286626.1| DNA-directed RNA polymerase subunit beta [Mycobacterium tuberculosis F11] >gi|148720399|gb|ABR05024.1| DNA-directed RNA polymerase beta subunit rpoB [Mycobacterium tuberculosis F11] (1178 aa)
Score = 1953, Expect = 0.0e+00, Identities = 403/863 (46%), Positives = 559/863 (64%)
  Q:   502 DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSL--WFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           DDIDH GN+RL+ + EL++ + + G+ R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+ A+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V +GV++DEI +LTA  ED +++A +N  ++ + +F E +VL R ++   E+    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   E+ G +  V    I +       + Y + KF +SN  TC NQ PIV  G++V  G  IADGP   +GE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPN+S+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  ED+ EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L DGT +DI+LN  GVP                 +++ + ++LE +      S + +    G+ + A+R     L   L E Q  ++                              +TPVF+G    +L + +    +   +G +     GK  L DGR+GE F   V+VG MY++KL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A        +D+    +N+  N  +N+
  S:   368 DDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLLALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--AEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVP-----------------RRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAAR-----LPDELLEAQPNAI-----------------------------VSTPVFDGAQEAEL-QGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNE 1170
Score = 262, Expect = 3.1e-20, Identities = 80/276 (28%), Positives = 136/276 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q ++F   I +                  LE  +  + PI+   G  SL +   + +  K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P++G  +  F  + +D + V       +     P+T  LKALG   E+I+  F   + ++++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    38 RVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVK---------VIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKD-----NTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 302
>gi|119026337|ref|YP_910182.1| DNA-directed RNA polymerase subunit beta [Bifidobacterium adolescentis ATCC 15703] >gi|118765921|dbj|BAF40100.1| DNA-directed RNA polymerase beta chain [Bifidobacterium adolescentis ATCC 15703] (1165 aa)
Score = 1951, Expect = 0.0e+00, Identities = 416/874 (47%), Positives = 566/874 (64%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINLDY-DIGFYDDID--------------HLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIK-IKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYE----LNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           +G +  ++  +LS  DI++   Y++ L   +  F    D              H GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NPLA +TNKRR+SA+GPGG+SR+  ++++RDVH SH+G++CPIE+PEG NIGLI SLAT+   +  GF+ TPYR V NG +TDE+ ++TA  + E++IA +N  +++N  F + + L R     E  DV    VD++D+SP+Q+VS+ AS IPFLE+D+ +RALMG NMQRQA PLI    P+VGTG E++ A DSG   V   EK G V+YV    I+ +        Y+L KF +SNQ TC NQVP++  GE+V  GT +ADGPA   GE+ALG+N+L+AF  W+GYNYEDA+I+S+RL  +D  +SIHI EY +D  +TK G EEITRD+PNV E +   LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  VK    ED  E    L   V + I+VY+ Q RKI  GDK++GRHGNKG+IS+I+P EDMP L DGT +DIMLNPLGVPSRMN                 L +VLEL+      + + +      EA                      A K++            G  +       ATPVF+GV    +K  ++    D    KL  G  GK  L DGRTGE F   +SVG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L E++T KSDDV GR   Y AI+KG+ +P +G+PESFK+L K++Q L L V +    G A
  S:   294 LGLEKDVNDRSLSREDIIATIKYLVTLHAGETKFPGKRDGQDVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQD--------------PEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVVNGHVTDEVEYMTADRDAEHVIAQANQELDENGNFVKKQALARVGEE-EAVDVPVSSVDYMDVSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGAEWRAAVDSG--DVILAEKPGVVTYVSADIIRTMNDDGTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEAGTVLADGPATQKGEMALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGETGTVIAVKEITREDAEEDGDELPNGVNQMIRVYIAQHRKITQGDKLSGRHGNKGVISRILPEEDMPFLADGTPVDIMLNPLGVPSRMN-----------------LGQVLELHLGWIAHAGWDISLDPDAEA----------------------AWKKYVP---------QGAEKGAPGTPVATPVFDGVRPETIKGLLSCTLPDRDGNKL-VGPDGKATLFDGRTGEPFPKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAIVKGENLPPAGIPESFKVLLKEMQSLSLNVEVLNADGVA 1124
Score = 234, Expect = 5.1e-17, Identities = 70/260 (26%), Positives = 130/260 (50%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDS 276
           R ++  I +  + P LL +Q ++F   I  E                      L+   + I PI++     SL +     E+P+ + +E + +  TY  PLYV+    + ++GE+K  T            +F    P+ T  GTFI+ G E+ ++SQ+VRSPG Y   +SQ + S+     +E +  +I+P++G  +  F  + +D + V       +S        FL A+G+ K+EI + F ++  + ++L  E    +D    + L +L + +  +D+
  S:     7 RVNFGSIREPIDVPYLLGVQTDSFDWLIGNERWQKRVQEDLENGTNTVPHTSGLDEVFQEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQT------------VFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVY-FDRSQDRTSD-----KEVFGAKIIPSRGA-WLEFEIDKRDVLGVRVDRKRKQSA-----IVFLMAIGMTKDEIADAFKDYPLVMDALAKETVQTQD----EALTDLYRKIRPADT 260
>gi|84494796|ref|ZP_00993915.1| DNA-directed RNA polymerase beta subunit [Janibacter sp. HTCC2649] >gi|84384289|gb|EAQ00169.1| DNA-directed RNA polymerase beta subunit [Janibacter sp. HTCC2649] (1162 aa)
Score = 1951, Expect = 0.0e+00, Identities = 435/919 (47%), Positives = 594/919 (64%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLD------------YDIGF---YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEK--NKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGS-EEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAM-----TEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           T+E    ++ N+  + +   +A V +Y KIN              +G ++ L   TL+++DI++   Y++ L              D+      DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   S KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SR+   +D+RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR V  G +TDEI +L+A  EDE++IA +N  ++    +F  ++VL R +    E+    DVD+ID+S +Q+VS A + IPFLE+DDANRALMG+NMQRQA PL+   AP+VGTG E + A DSG   +   EK G V+ V    + + +     + Y + KF +SNQ    NQ  IVS G++V KG  IADGPA   GE+ALG+N+LVAF  W G+NYEDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPNVSE     LD+ GII +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  GTV  VK F  ++  EL   V + ++V+V  KRKI  GDK+AGRHGNKG+ISKI+PVEDMP LEDGT +D++LNPLGVP                  ++ + ++LEL+           W      ASR            + + + D AN    D       +RS     ++    A+PVF+GV   ++   +     T  G+  I+G      SGK  L DGR+GE +   VSVG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IPE G+PESFK+L K++Q L L V +    G+A
  S:   275 TREAAQNLLDNLYFNGKRYDLAKVGRY-KIN------------KKLGIESELTDSTLNVNDIVATIKYIVALHNGDETLPGRRKGEDVAIRVETDDIDHFGNRRLRNVGELIQNQVRTGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRDRAGMDVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRINAFGFIETPYRKVTKGRVTDEIHYLSADEEDEHVIAQANAALDAAGERFTSERVLVRVKGGEVEYIPADDVDYIDVSARQMVSAATALIPFLEHDDANRALMGSNMQRQAVPLVKAEAPLVGTGMELRAAVDSGDVVI--AEKAGVVTEVSADLVTVAADDGTSRTYRIDKFTRSNQGNSYNQRVIVSEGDRVEKGGLIADGPATDGGEMALGRNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVSEEVLADLDERGIIRIGAEVRDGDLLVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGETGTVIGVKVFDKDEGDELPPGVNQLVRVHVANKRKITDGDKLAGRHGNKGVISKILPVEDMPFLEDGTPVDVVLNPLGVPG-----------------RMNIGQILELHLG---------W-----AASRGW----------EIVGNPDWANLIPDD-------ARSAEPGTRV----ASPVFDGVREDEIVGLLDSTRETRDGVRLIDG------SGKTPLFDGRSGEPYPEPVSVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVNGRVKVYEAIVKGDNIPEPGIPESFKVLIKEMQSLCLNVEVLSSDGQA 1130
Score = 270, Expect = 3.2e-21, Identities = 98/389 (25%), Positives = 185/389 (47%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELF---KKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETTYQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLY-QRVLAEDLKDINGKVVI 405
           R  + KI +    P+LL LQ  +F   +  E                      LE   + I PI+   G  SL +   + E+ K S ++ +   +TY  PL+V    ++N +GE+K  T            +F    P++TE+GTFI+NG E+ V+SQ+VRSPG Y   ++  K S+     ++ Y  +I+P++G  +  F  + +D + V       +S     +T  LKALGL + +I   FA ++SI+ +LD +    +D    D L+++ + L   +          L  L+   K+Y   K       K    + EL +   N+    A    ++ L    + +  + +  +     ++   +HF + +  ++ +  + ++   +   ER+  +R+  +D++ I  + +I
  S:    20 RLSFGKIREPMEVPDLLALQTESFDWLLGNERWQERVAQARAAGRDDVPERSGLEDIFEEISPIEDFSGSMSLSFRDHRFEEVKYSIEDCKERDQTYSAPLFVTAEFMNNTTGEIKSQT------------VFMGDFPLMTERGTFIINGTERVVVSQLVRSPGVY-FERTPDKTSD-----KDIYTAKIIPSRGA-WIEFEIDKRDMVGVRVDRKRKQS-----VTVLLKALGLTEAQIREEFAGYESIELTLDKDNTEGQD----DALLDIYRKLRPGEPPTREAAQNLLDNLYFNGKRYDLAKVGRYKINKKLGIESELTDSTLNVNDIVATIKYIVALHNGDETLPGRRKGEDVAIRVETDDIDHFGNRRLRNVGELIQNQVRTGLSRMERVVRERMTTQDVEAITPQTLI 406
>gi|50955586|ref|YP_062874.1| DNA-directed RNA polymerase subunit beta [Leifsonia xyli subsp. xyli str. CTCB07] >gi|81390570|sp|Q6ACX5|RPOB_LEIXX DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|50952068|gb|AAT89769.1| DNA-directed RNA polymerase, beta subunit [Leifsonia xyli subsp. xyli str. CTCB07] (1165 aa)
Score = 1950, Expect = 0.0e+00, Identities = 435/953 (45%), Positives = 609/953 (63%)
  Q:   389 QRVLAEDLKDINGKVVIKKNTLIQKHE--------LDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINL-DYDIGF--------------YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYV--DGGTIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVED-DYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           + +LAE     + ++ ++K+ ++ K E        L   +Q+  E    ++ N   + +   +A V +Y KIN              +G +  L    L++ DI++   Y+++L D    F               DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SRE   +++RDVH SHYG++CPIETPEG NIGLI SLA++A  +  GF+ TPYR V +G++TD+I +LTA  ED++++A +N  ++ +  F E++VL R +    +    +++ ++D+SP+Q+VS+  S IPFLE+DDANRALMGANMQRQA PL+   +P+VGTG E   A D+G   +   EK G VS V  D  T++   G+  K Y L KF++SNQ T  N   +V  G+++  G  +ADGPA  NGELALG+N+LVAF  W G+N+EDAIILS+ L  +D  +SIHI EY VD   TK G EEITRD+PNVS      LD+ GII +GAEV+ GD+LVGK++PKG+ EL++EE+LL+AIF +KS+  ++TSLKVPHG EGT+  VK F  +D D EL + V +++ VY+ QKRKI  GDK+AGRHGNKG+ISKI+PVEDMP L DGT +D++LNPLGVP RMN GQ                 VLE++           W                   N  +IK   +   E  +   S A +           K ATPVF+G    ++   + +  +   +G    G SGK  L DGR+GE +   VSVG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD+ GR   Y AI+KG+ I E G+PESFK+L K++Q L L V +    G+A
  S:   235 EEILAEFAGFQSIELTLEKDAILTKEEALKDIYRKLRPGEQVAAEAARALLDNFYFNPKRYDLAKVGRY-KINRK------------LGLEAPLTDSVLTVQDIIATIKYLVSLHDGQTSFTGLRSGVETDIRLDIDDIDHFGNRRIRAVGELIQNQVRTGLSRMERVVRERMTTQD--------------IEAITPQTLINVRPVVAAIKEFFGTSQLSQFMDQNNPLAGLTHKRRLSALGPGGLSRERAGVEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASFARINSFGFIETPYRKVVDGLVTDQIDYLTASEEDDFVVAQANAPLDARGHFVEERVLARQKGGEVDLVPAEEIGYMDVSPRQMVSVGTSLIPFLEHDDANRALMGANMQRQAVPLLRSESPVVGTGMEGYAAIDAGDVVI--AEKSGIVSEVSADAVTVQADDGTV-KTYYLRKFDRSNQGTSYNHRVVVDEGDRIEAGEVVADGPATENGELALGKNLLVAFMPWEGHNFEDAIILSQNLVKDDTLSSIHIEEYEVDARDTKLGKEEITRDLPNVSPDLLADLDERGIIRIGAEVRPGDILVGKVTPKGETELSAEERLLRAIFNEKSREVRDTSLKVPHGEEGTIIGVKVFDAQDGDDELGSGVNQRVVVYIAQKRKITAGDKLAGRHGNKGVISKILPVEDMPFLADGTPVDVILNPLGVPGRMNFGQ-----------------VLEIHLG---------WIA----------------KNGWEIKGKPKWAAELPETAFSAAPNT----------KVATPVFDGAKEEEIA-GLLDVTLPTRDGDRLIGSSGKTQLFDGRSGEPYPDPVSVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDILGRVKVYEAIVKGENIQEPGIPESFKVLIKEMQSLCLNVEVLSADGQA 1132
Score = 283, Expect = 1.1e-22, Identities = 86/249 (34%), Positives = 128/249 (51%)
  Q:    15 VLRRDYSKIEKNFNEPNLLNLQKNAFHKFID----------------------TELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE 263
           V R  ++KI      P+LL LQ  +F   +                       T LE   + I PI+ +G    L +    LE+ K S  E + +G+TY  PLYV+   +++ +GE+K  T            +F    P++TE+GTFI+NG E+ V+SQ+VRSPG Y    +      S K I   Y   ++P++G+ +  F  + +D + V       +S     +T FLKALGL  EEIL  FA  +SI+ +L      EKD   T E
  S:    20 VSRLSFAKITDTLTVPDLLALQTESFDWLVGNDAWQARVAAAEAQGRQDLPAATGLEEIFEEISPIEDLGETMQLSFTNPFLEEKKYSIDECKEKGRTYAAPLYVEAEFMNHLTGEIKTQT------------VFMGDFPLMTERGTFIINGTERVVVSQLVRSPGVYFEAAAD---KTSDKDI---YSARVIPSRGS-WLEFEIDKRDQVGVRIDRKRKQS-----VTVFLKALGLTSEEILAEFAGFQSIELTL------EKDAILTKE 260
>gi|158512701|sp|A1A317|RPOB_BIFAA DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) (1186 aa)
Score = 1950, Expect = 0.0e+00, Identities = 416/874 (47%), Positives = 566/874 (64%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINLDY-DIGFYDDID--------------HLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRSSWEFFDV--KDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIK-IKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYE----LNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA 1341
           +G +  ++  +LS  DI++   Y++ L   +  F    D              H GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +S+IN +P   + KEFF + QL+QF+DQ NPLA +TNKRR+SA+GPGG+SR+  ++++RDVH SH+G++CPIE+PEG NIGLI SLAT+   +  GF+ TPYR V NG +TDE+ ++TA  + E++IA +N  +++N  F + + L R     E  DV    VD++D+SP+Q+VS+ AS IPFLE+D+ +RALMG NMQRQA PLI    P+VGTG E++ A DSG   V   EK G V+YV    I+ +        Y+L KF +SNQ TC NQVP++  GE+V  GT +ADGPA   GE+ALG+N+L+AF  W+GYNYEDA+I+S+RL  +D  +SIHI EY +D  +TK G EEITRD+PNV E +   LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  VK    ED  E    L   V + I+VY+ Q RKI  GDK++GRHGNKG+IS+I+P EDMP L DGT +DIMLNPLGVPSRMN                 L +VLEL+      + + +      EA                      A K++            G  +       ATPVF+GV    +K  ++    D    KL  G  GK  L DGRTGE F   +SVG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L E++T KSDDV GR   Y AI+KG+ +P +G+PESFK+L K++Q L L V +    G A
  S:   315 LGLEKDVNDRSLSREDIIATIKYLVTLHAGETKFPGKRDGQDVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQD--------------PEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVVNGHVTDEVEYMTADRDAEHVIAQANQELDENGNFVKKQALARVGEE-EAVDVPVSSVDYMDVSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGAEWRAAVDSG--DVILAEKPGVVTYVSADIIRTMNDDGTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEAGTVLADGPATQKGEMALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGETGTVIAVKEITREDAEEDGDELPNGVNQMIRVYIAQHRKITQGDKLSGRHGNKGVISRILPEEDMPFLADGTPVDIMLNPLGVPSRMN-----------------LGQVLELHLGWIAHAGWDISLDPDAEA----------------------AWKKYVP---------QGAEKGAPGTPVATPVFDGVRPETIKGLLSCTLPDRDGNKL-VGPDGKATLFDGRTGEPFPKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAIVKGENLPPAGIPESFKVLLKEMQSLSLNVEVLNADGVA 1145
Score = 237, Expect = 2.5e-17, Identities = 72/269 (26%), Positives = 134/269 (49%)
  Q:     8 DKEISKYVLRRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDS 276
           D ++ K   R ++  I +  + P LL +Q ++F   I  E                      L+   + I PI++     SL +     E+P+ + +E + +  TY  PLYV+    + ++GE+K  T            +F    P+ T  GTFI+ G E+ ++SQ+VRSPG Y   +SQ + S+     +E +  +I+P++G  +  F  + +D + V       +S        FL A+G+ K+EI + F ++  + ++L  E    +D    + L +L + +  +D+
  S:    19 DIDLHKASDRVNFGSIREPIDVPYLLGVQTDSFDWLIGNERWQKRVQEDLENGTNTVPHTSGLDEVFQEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQT------------VFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGVY-FDRSQDRTSD-----KEVFGAKIIPSRGA-WLEFEIDKRDVLGVRVDRKRKQSA-----IVFLMAIGMTKDEIADAFKDYPLVMDALAKETVQTQD----EALTDLYRKIRPADT 281
>gi|172039980|ref|YP_001799694.1| DNA-directed RNA polymerase, beta subunit [Corynebacterium urealyticum DSM 7109] >gi|171851284|emb|CAQ04260.1| DNA-directed RNA polymerase, beta subunit [Corynebacterium urealyticum DSM 7109] (1170 aa)
Score = 1950, Expect = 0.0e+00, Identities = 422/898 (46%), Positives = 575/898 (64%)
  Q:   478 TLSISDILSITSYVINLD-----------YDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKANNNNFKDINEYISNITNNAIKNDEDQQIIEEMDI 1375
           TL+  DIL+   Y++ L             +I    DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QF+DQ N L+ LT+KRR++A+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V +G ITDE+ + TA  ED ++IA +N   + + KF ED++  R R    E      VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V YV    I I         + L KF ++NQ T  NQ P+V+ G++V  G  IADGP   NGE+ALG+N+LVAF  W G+NYEDAIILS+R+  ED+ TSIHI EY +D   TK G EEITRDIPNV E     LD+ GI+ +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L A V E ++VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT +DI+LN  GVP RMNIGQ+LE+HLG   K           +     SD        +   + +++ L + L +    SL         FD +     SG+ R      ++ P  +G+   D          D    +L +G++          GE ++  +SVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG+ IP+ G+PESFK+L K+LQ L L V +    G     +  D +E  S      I    D++   ++D+
  S:   320 TLTEEDILTTIEYLVRLHAGERTMTSPEGVEIPIEVDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLNALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYARVNPFGFIETPYRRVVDGQITDEVEYFTADEEDRHVIAQANTPFDADMKFTEDQIEVRLRGGDVEVVPASQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRAEAPYVGTGIEQRAAYDAGDLII--APKAGVVEYVSADYITIMDDEGIRDTFMLRKFERTNQGTSYNQKPLVNQGDRVEAGQVIADGPGTDNGEMALGKNLLVAFMPWEGHNYEDAIILSQRMVEEDVLTSIHIEEYEIDARDTKLGPEEITRDIPNVGEDVLADLDERGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRVFSREDDDDLAAGVNEMVRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLEVHLGWLAKA---------GWQVDTNSD--------DPKIKAMLETLPEDLYDVPADSLTST----PVFDGASNAELSGLLR------SSRPDRDGIRLVD----------DFGKAQLIDGRT----------GEPYEHPISVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEVLAADGTPMELSSDDDDELESANAALGINLQRDERPDADIDV 1169
Score = 237, Expect = 2.6e-17, Identities = 77/249 (30%), Positives = 123/249 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFI-------------------DTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFE-TDELI 265
           R  ++KI+     P LL+LQ+ +F   +                    + LE  ++ + PI+      SL     + +  K S  EA+ +   Y  PLYV     + +SGE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y        +  S +R   G   +++P++G  +  F  + +D + V       +     P+T  LKALGL  +EI + F   + + ++L      EKD  E TDE +
  S:    25 RYSFAKIDAPIEVPGLLDLQRESFAWLVGAPEWRARMQAEAGEGVRVTSGLEDILEELSPIEDYSENMSLTLSEPRFDDMKTSIDEAKEKDINYAAPLYVTAEFTNAQSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF----DESIDTSTERPLHG--VKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGLTTQEITDRFGFSEIMMSTL------EKDGVENTDEAL 263
>gi|116671530|ref|YP_832463.1| DNA-directed RNA polymerase subunit beta [Arthrobacter sp. FB24] >gi|158512272|sp|A0JZ93|RPOB_ARTS2 DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|116611639|gb|ABK04363.1| DNA-directed RNA polymerase, beta subunit [Arthrobacter sp. FB24] (1171 aa)
Score = 1949, Expect = 0.0e+00, Identities = 420/867 (48%), Positives = 568/867 (65%)
  Q:   468 IGTDTSL---DKPTLSISDILSITSYVINL--------------DYDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKNK-FKEDKVLCRYRSSWE---FFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGG-TIKIKSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRT-DLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSI 1334
           +G D SL   +   L + DI+++  +++ L              D+++    DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SR+   +++RDVH SHYG++CPIETPEG NIGLI SLA+Y   +  GF+ TPYR+V  GV++DE+++LTA  E E +IA +N  +++NK F E+ VL R R            DV+F+D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E   A D+G   +   +K G V+ V     I +     E  Y + KF +SNQ  C N   +VS G+++  G  IADGPA   GELALG+N+LVAF +W G+N+EDAIILS+R+  ED+ +SIHI E+ +D   TK G EEITRDIPNVSE     LD+ GII +GAEV+ GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSLKVPHG  GTV  V+ F  ++D EL   V + ++VYV  KRKI  GDK+AGRHGNKG+ISKI+P+EDMP L DGT +DI+LNPLGVP RMN+GQ+LE HLG   K                        G   E     +K L  +  E    S   A   F              +RE+ I    T + +  N T D    +  +G      +L +G+SG          E F   +SVG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD+ GR   Y AI+KG+ IPE G+PESFK+L K++Q L L V +
  S:   313 LGIDRSLGDKEASVLHVEDIVAMIKFLVALHAGEKTLTGKRDGQDHELRVEIDDIDHFGNRRIRAVGELIENQVRTGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRINPFGFIETPYRLVSEGVVSDEVQYLTADDEAEVLIAQANAPLDENKKFAEETVLVRARGGGGEPVLVPAADVEFMDVSPRQMVSVATALIPFLEHDDANRALMGANMQRQAVPLVRSEAPFVGTGMERAAAVDAGDVVI--AKKAGVVTEVSAELVIMLNDDGTETNYRINKFARSNQGNCYNHRVLVSEGQRLEVGGIIADGPATDQGELALGKNLLVAFMSWEGHNFEDAIILSQRIVAEDVLSSIHIEEHEIDARDTKLGAEEITRDIPNVSEEVLAGLDERGIIHIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLKVPHGESGTVIGVRVFDRDNDDELPPGVNQLVRVYVAAKRKITDGDKLAGRHGNKGVISKILPIEDMPFLADGTPVDIVLNPLGVPGRMNVGQVLETHLGWVAKT-----------------------GWKIEGEPEWVKQLPNLPRES--GSTTVATPVFDG------------AREEEI----TGLLDSTNVTRDGDRLINSSG----KTRLFDGRSG----------EPFPDPISVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQELLTIKSDDIHGRVKVYEAIVKGENIPEPGVPESFKVLIKEMQSLCLNVEV 1132
Score = 281, Expect = 1.9e-22, Identities = 82/255 (32%), Positives = 134/255 (52%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIG---ESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFET--DELINLRKNL 271
           R  ++KI +  + PNLL LQ ++F   +  E                      L    + I PI+   G  SL +   +   PK +  E ++   TY  PLYV    ++N +GE+K+ T            +F    P++TEKGTF+VNG E+ V+SQ+VRSPGAY   ++  K S+     ++ +  +I+P++G  F          +++  RD +G   +      +T  LKALG  + +IL  F  + S++ +L      EKD  ET  D L+++ + L
  S:    26 RLSFAKIHEPLDVPNLLALQTDSFDWLVGNERWQARVAKAVEEGDLSVATSSGLSDIFEEISPIEDFQGTMSLSFSDPEFADPKYTMAECKDRDATYSAPLYVKAEFMNNNTGEIKQQT------------VFMGDFPLMTEKGTFVVNGTERVVVSQLVRSPGAY-FERTADKTSD-----KDIFTAKIIPSRGAWF---------ELEIDKRDQVGVRLDRKRKQSVTVLLKALGWTEGQILEEFGQYDSMRATL------EKDATETREDALLDIYRKL 274
>gi|46360946|gb|AAS89206.1| RpoB [Corynebacterium auriscanis] (1115 aa)
Score = 1948, Expect = 0.0e+00, Identities = 416/853 (48%), Positives = 556/853 (65%)
  Q:   478 TLSISDILSITSYVINL-------------DYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVEKN-KFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSE-EKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGL 1330
           TL+  DIL+   Y++ L             +  IG  DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +S+T  S+IN +P   + +EFF + QL+QFLDQ N L+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL++YA  +  GF+ TPYR V +G ITDE+ + TA  ED ++IA +N   ++N +F E+ +  R R    E   V +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP VGTG E + A+D+G   +    K G V YV    I +         + L KF ++NQ T  NQ P+V+ G++V  G  +ADGP  + GE+ALG+N+LVAF  W G+NYEDAIIL++R+  ED+ TSIHI E+ +D   TK G EEITRDIPNV E     LD+ GII +GA+V++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TS+KVPHG  G V  V+ F  EDD +L   V E ++VYV QKRKIQ GDK+AGRHGNKG++ KI+P EDMP L DGT IDI+LN  GVP RMNIGQ+LE+HLG   K                    + W    +     + K LE + +E      D        FD +     SG+ R      ++ P  +G+   D          D    +L +G+S          GE F   VSVG MYMLKL H+VD+KIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWA++AYGAA+ L+ELLTIKSDDV GR   Y AI+KG  IP+ G+PESFK+L K+LQ L L
  S:   311 TLTEEDILTTIEYLVRLHAGEKTMTSPEGVEIPIG-TDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDA--------------ESITPTSLINVRPVSAAIREFFGTSQLSQFLDQNNSLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSSYARVNPFGFIETPYRRVIDGQITDEVHYFTADEEDRHVIAQANTPFDENHRFTEETIEVRLRGGDVEVVPVAEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLLRSEAPFVGTGMELRAAYDAGDMII--APKAGVVEYVSADYITVMDDEGIRDTFMLRKFERTNQGTSYNQKPLVNEGDRVEAGQVLADGPGTAEGEMALGKNLLVAFMPWEGHNYEDAIILNQRMVEEDVLTSIHIEEHEIDARDTKLGPEEITRDIPNVGEDVLADLDERGIIRIGADVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRVFSREDDDDLAPGVNEMVRVYVAQKRKIQDGDKLAGRHGNKGVVGKILPAEDMPFLPDGTPIDIILNTHGVPRRMNIGQVLEVHLGWLAK--------------------AGWKVDTDSQDPKIQKMLETLPSELYDVPSDSLTATPV-FDGASNAELSGLLR------SSRPNRDGIRLVD----------DFGKAQLMDGRS----------GEPFPYPVSVGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGDNIPDPGIPESFKVLLKELQSLCL 1115
Score = 240, Expect = 1.1e-17, Identities = 72/241 (29%), Positives = 119/241 (49%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKD 257
           R  ++KI+     P LL+LQ+ +F   I +                    LE  ++ + PI+      SL     + E  K +  EA+++   Y  PLYV     +  SGE+K  T            +F    PM+T+KGTFI+NG E+ V+SQ+VRSPG Y        +  S +R   G   +++P++G  +  F  + +D + V       +     P+T  LKALGL  +EI + F   + + ++L+ +  +  D
  S:    16 RYSFAKIDSPIEVPGLLDLQRESFAWLIGSPEWRARAQAEAGEDVRITSGLEDILEELSPIEDYSENMSLTLSEPRFEDVKSTIDEAKDKDINYAAPLYVTAEFTNAMSGEIKSQT------------VFIGDFPMMTDKGTFIINGTERVVVSQLVRSPGVYF----DASIDASTERPLHG--VKVIPSRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGLTTQEITDRFGFSEIMMSTLEKDGVDNTD 251
>gi|126433605|ref|YP_001069296.1| DNA-directed RNA polymerase subunit beta [Mycobacterium sp. JLS] >gi|158513447|sp|A3PV78|RPOB_MYCSJ DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|126233405|gb|ABN96805.1| DNA-directed RNA polymerase, beta subunit [Mycobacterium sp. JLS] (1172 aa)
Score = 1948, Expect = 0.0e+00, Identities = 428/942 (45%), Positives = 594/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N              + TD  +   TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V+NGV+TD+I +LTA  ED +++A +N  ++ +  F ED+VL R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L           P G P    +  IL  H G+  +++ + ++LE +      + ++    I+   +  +    EK+  E                 L  A S S +         ATPVF+G    +L   +  + +   +G +   + GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   280 TKESAQTLLENLFFKEKRYDLARVGRY-KVNKKLG----------LNTDKPITSSTLTEEDVVATIEYLVRLHEGQATMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRHVVAQANSPLDDEGHFTEDRVLVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--SEKAGVVEEVSADYITVMADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFL-----------PDGTP----VDIILNTH-GVP-RRMNIGQILETHLGWVAKAGWN----INVAGADGVPDWAEKLPEE-----------------LYSAPSDSIV---------ATPVFDGARENEL-SGLLASTLPNRDGDVMVNEDGKAELFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1164
Score = 252, Expect = 4.3e-19, Identities = 80/276 (28%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   I  +                 LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    30 RISFAKLREPLEVPGLLDVQTESFDWLIGADSWRQRATARGDVNPTGGLEEVLTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMSTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 294
>gi|62424433|ref|ZP_00379579.1| COG0085: DNA-directed RNA polymerase, beta subunit/140 kD subunit [Brevibacterium linens BL2] (1159 aa)
Score = 1948, Expect = 0.0e+00, Identities = 413/872 (47%), Positives = 573/872 (65%)
  Q:   468 IGTDTSLDKPTLSISDILSITSYVINL--------------DYDIGF-YDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRS---SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKI-KSGSEEKVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKIL-NEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELG 1339
           +G D  L    LS  D+++   Y+++L              D ++    DDIDH GN+R++ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPLA LT+KRR+SA+GPGG+SR+   +++RDVH SHYG++CPIETPEG NIGLI SLA+YA  +  GF+ TPYR V +GV+TD+  +LTA  E E+ IA +N  + E+ +F E +VL R +      E      +DF+D+S +Q+VS+A++ IPFLE+DDANRALMGANMQRQA PL+   +P+VGTG EY+ A D+G   V   ++ G ++ V    + +       + Y   KF +SN  T  NQ  IV  G++V  GT +ADGP+  NGE+ALG+N+LVAF +W GYN+EDAIILS+RL  +D+ +SIHI E+ VD   TK G EEITRDIPN+S  +   LDD GII +GAEV +GD+LVGK++PKG+ ELT EE+LL+AIFG+KS+  ++TSL+VPHG  GTV  V+ F  E+D EL+  V + ++VYV Q+RKI IGDKMAGRHGNKG+IS I+PVEDMP L DGT +DI+LNP GVP                 +++ + +V E++           W            K   KI  N +    L +A +E          + +G +        ATPVF+G +  +L+  +     +    +L +  SGK  L DGR+GE F   ++VG MYMLKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEMEVWALEAYGAA+ L+ELLTIKSDD+ GR   Y AI+KG+ +P+ G+PESFK+L K++Q L L V +    G
  S:   303 LGVDAPLSDSVLSTDDVVATIRYLVSLHAGVDTSKGVRDGEDIELSVKLDDIDHFGNRRIRAVGELIENQVRTGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLAGLTHKRRLSALGPGGLSRDRAAMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARINPFGFIETPYRKVVDGVVTDDTEYLTADDELEFNIAQANAPLTEEQRFAEVEVLARPKGGGGEAELVQYDTIDFMDVSARQMVSVASALIPFLEHDDANRALMGANMQRQAVPLVMSESPVVGTGMEYRAAVDAG--DVITADRPGVITEVSADFVTVLADDGTMQTYRAAKFKRSNHGTSYNQRIIVDEGDRVEAGTVLADGPSTQNGEMALGKNLLVAFMSWEGYNFEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGAEEITRDIPNISPDALADLDDRGIIRIGAEVTDGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGEIGTVIGVRVFDREEDDELSPGVNQMVRVYVAQRRKITIGDKMAGRHGNKGVISTILPVEDMPFLADGTPVDIILNPHGVP-----------------RRMNIGQVFEVHLG---------WIS----------KQGWKIEGNPEWAAELPEAARE----------AEAGTN-------LATPVFDGAHEQELRGLLDSTTPNRDGDRLID-SSGKAQLFDGRSGEPFPYPIAVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQELLTIKSDDIPGRVKVYEAIVKGENLPDPGIPESFKVLIKEMQSLCLNVEVLSSDG 1125
Score = 284, Expect = 7.5e-23, Identities = 81/255 (31%), Positives = 132/255 (51%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE----------------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNL 271
           R  ++KI +    P+LL LQ ++F   I +E                      LE   + I PI+  GG  SL +   + E  K S  E +    TY  PLYV    ++N +GE+K  T            +F    P++T+KGTFIVNG E+ V+SQ+VRSPGAY  +      S  +   ++ +  +I+P++G  +  F  + +D + V       +S     +T  LKALG ++ +IL  F   +SI+ ++  +  N +D    + L+++ K L
  S:    16 RISFAKIREPLEVPDLLGLQTDSFDWLIGSEAWQDRVAEAIEIGDDSVATTSGLEDIFEEISPIEDFGGSMSLSFREHRFEAAKYSIDECKERDMTYSAPLYVTAEFMNNNTGEIKSQT------------VFMGDFPLMTDKGTFIVNGTERVVVSQLVRSPGAYFES------SVDKTTDKDIFTAKIIPSRGA-WLEFEVDKRDQVGVRLDRKRKQS-----VTVLLKALGWSEAKILEEFGEFESIRETMAKDTVNTQD----EALLDIYKKL 264
>gi|119867039|ref|YP_936991.1| DNA-directed RNA polymerase subunit beta [Mycobacterium sp. KMS] >gi|158513056|sp|A1UBJ3|RPOB_MYCSK DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|158564121|sp|Q1BDF0|RPOB_MYCSS DNA-directed RNA polymerase subunit beta (RNAP subunit beta) (Transcriptase subunit beta) (RNA polymerase subunit beta) >gi|119693128|gb|ABL90201.1| DNA-directed RNA polymerase, beta subunit [Mycobacterium sp. KMS] (1172 aa)
Score = 1948, Expect = 0.0e+00, Identities = 428/942 (45%), Positives = 594/942 (63%)
  Q:   423 TKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFY------------DDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGVITDEIRWLTALSEDEYIIACSNLNVE-KNKFKEDKVLCRYRS-SWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEEK-VYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKLTLSKVLELYYDKKPASDFSLWFGIHEEASRNLIKNLEKILNEKQIKSLDQANKEFTDFDLSLALSRSGISREKLIYKTATPVFEGVNRTDLKEAMTEAGIDPINGKLGEGKSGKFNLIDGRTGEYFDGEVSVGIMYMLKLDHMVDDKIHSRAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAHNLRELLTIKSDDVKGRNNTYNAIIKGKPIPESGLPESFKLLTKQLQGLGLQVSITKELGKA---NNNNFKDINEYISNITNNAIKND 1364
           TKE    ++ N+   E+   +A V +Y K+N              + TD  +   TL+  D+++   Y++ L                   DDIDH GN+RL+ + EL++ + + GL R+E+ + +++   D               +++T +++IN +P   + KEFF + QL+QF+DQ NPL+ LT+KRR+SA+GPGG+SRE   L++RDVH SHYG++CPIETPEG NIGLI SL+ YA  +  GF+ TPYR V+NGV+TD+I +LTA  ED +++A +N  ++ +  F ED+VL R +    EF    +VD++D+SP+Q+VS+A + IPFLE+DDANRALMGANMQRQA PL+   AP+VGTG E + A D+G   V   EK G V  V    I + +    +  Y + KF +SN  TC NQ PIV  G++V  G  +ADGP   NGE+ALG+N+LVA   W G+NYEDAIILS RL  ED+ TSIHI E+ +D   TK G EEITRDIPNVS+     LD+ GI+ +GAEV++GD+LVGK++PKG+ ELT EE+LL+AIFG+K++  ++TSLKVPHG  G V  ++ F  EDD EL A V E ++VYV QKRKI  GDK+AGRHGNKG+I KI+PVEDMP L           P G P    +  IL  H G+  +++ + ++LE +      + ++    I+   +  +    EK+  E                 L  A S S +         ATPVF+G    +L   +  + +   +G +   + GK  L DGR+GE F   V+VG MY+LKL H+VDDKIH+R+ GPYS ITQQPLGGK+Q GGQRFGEME WA++AYGAA+ L+ELLTIKSDD  GR   Y AI+KG+ IPE G+PESFK+L K+LQ L L V +    G A    + + +D+    +N+  N  +N+
  S:   280 TKESAQTLLENLFFKEKRYDLARVGRY-KVNKKLG----------LNTDKPITSSTLTEEDVVATIEYLVRLHQGDTVMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQD--------------VEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRHVVAQANSPLDDEGHFTEDRVLVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVV--SEKAGVVEEVSADYITVMADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVEAGQVVADGPCTQNGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFL-----------PDGTP----VDIILNTH-GVP-RRMNIGQILETHLGWVAKAGWN----INVAGADGVPDWAEKLPEE-----------------LYSAPSDSIV---------ATPVFDGARENEL-SGLLASTLPNRDGDVMVNEDGKAELFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNE 1164
Score = 252, Expect = 4.3e-19, Identities = 80/276 (28%), Positives = 133/276 (48%)
  Q:    17 RRDYSKIEKNFNEPNLLNLQKNAFHKFIDTE-----------------LEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYI---LTKSQIKLSNSRKRIQEGYICEILPAKGTLFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDE-LINLRKNLNSSDSNRSYGVDTKLRELFKK 292
           R  ++K+ +    P LL++Q  +F   I  +                 LE  +  + PI+   G  SL +   + ++ K    E +++  TY  PL+V    ++N +GE+K  T            +F    PM+TEKGTFI+NG E+ V+SQ+VRSPG Y    + KS  K  +S K         ++P +G  +  F  + +D + V       +     P+T  LKALG   E+I   F   + + ++L+ +     +   TDE L+++ + L   +        T L  LF K
  S:    30 RISFAKLREPLEVPGLLDVQTESFDWLIGADSWRQRATARGDVNPTGGLEEVLTELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT------------VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVK---------VIPGRGA-WLEFDVDKRDTVGVRI-----DRKRRQPVTVLLKALGWTNEQITERFGFSEIMMSTLEKD-----NTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFK 294
>gi|116513532|ref|YP_812438.1| DNA-directed RNA polymerase subunit beta [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092847|gb|ABJ58000.1| DNA-directed RNA polymerase, beta subunit/140 kD subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (1192 aa)
Score = 1946, Expect = 0.0e+00, Identities = 430/1059 (40%), Positives = 629/1059 (59%)
  Q:    32 LLNLQKNAFHKFIDTELEGTIKSIFPIKSIGGRYSLEYIGMKLEKPKRSEKEARNEGKTYDRPLYVDLAIVDNESGEVKKTTKSSKNKASNTDGIFFASIPMITEKGTFIVNGIEKFVISQIVRSPGAYILTKSQIKLSNSRKRIQEGYICEILPAKGT-LFFIFMAENKDFIQVMFRDAIGESTHTIPITAFLKALGLNKEEILNIFANHKSIKNSLDNEIYNEKDVFETDELINLRKNLNSSDSNRSYGVDTKLRELFKKYSSLKSQLEAEGKNAEKQKELNEVINNIISEKAAKDLVINLSISTKNIDSKFRLSNKETT--YQSIIYNHFFSNKSFDLSKAGRFKMARKMRLSERLYQRVLAEDLKDIN-GKVVIKKNTLIQKHELDTIKQLTKEGKLGIVHNVNLDERISKMANVVKYEKINVYQDNDSQDEFIPIIGTDTSLDKPTLSISDILSITSYVINLDYDIGFYDDIDHLGNKRLKLIDELLKTRAQAGLVRIEKFINDKLAIADGANKSQEQSEEQEPKKSLTVKSIINTKPFQISFKEFFNSHQLTQFLDQQNPLAELTNKRRISAMGPGGISREDPNLDIRDVHYSHYGKICPIETPEGMNIGLIMSLATYASTDENGFLITPYRIVKNGV--ITDEIRWLTALSEDEYIIACSNLNV-EKNKFKEDKVLCRYRSSWEFFDVKDVDFIDISPKQVVSIAASSIPFLENDDANRALMGANMQRQATPLISPIAPIVGTGNEYKIAHDSGMAAVYDGEKDGTVSYVDGGTIKIKSGSEE-KVYELTKFNKSNQNTCNNQVPIVSVGEKVTKGTTIADGPAMSNGELALGQNVLVAFTTWSGYNYEDAIILSKRLFMEDIFTSIHIVEYSVDCLKTKNGDEEITRDIPNVSESSKKYLDDEGIIMVGAEVKEGDVLVGKISPKGQVELTSEEKLLQAIFGDKSKNHKETSLKVPHGGEGTVAMVKRFKVEDDYELNADVIEQIKVYVVQKRKIQIGDKMAGRHGNKGIISKIVPVEDMPHLEDGTTIDIMLNPLGVPSRMNIGQILELHLGLAMKKL 1090
           + ++Q  ++  F+D  ++     I PI    GR +LEY+  KL++PK +  E+R    TY  P++V L + ++E+GE+K            T  +FF  +P++T+ G+FIVNG E+ ++SQ+VRSPG Y   +