>gi|26554250|ref|NP_758184.1| hypothetical protein MYPE7950 [Mycoplasma penetrans HF-2] >gi|26454259|dbj|BAC44588.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (259 aa)
Score = 997, Expect = 1.8e-106, Identities = 259/259 (100%), Positives = 259/259 (100%)
  Q:     1 MKKKLFSRLFKFGLPLVAVAVVPSVVSSCSSTVTTKTKVLNASNWNNGNVKYSELSSSNTSLESATFGSSFNSGNYIFIWGTLADSSFATFLYGSSGASATEEKSFENSTFLKSFFSSELSTSSVFGNVSLLLYIDTPPYNGDVTDNSAGETGYDSPTEQYTLDNVLKEANEGAAVGRYTAETLPLSYQLKVGNYMRGNKEAVTYREFVQYVKTVRPSVSGPENSGIIAFKKGKNPAAFSTSSTISDLTSYYTPSADDE 259
           MKKKLFSRLFKFGLPLVAVAVVPSVVSSCSSTVTTKTKVLNASNWNNGNVKYSELSSSNTSLESATFGSSFNSGNYIFIWGTLADSSFATFLYGSSGASATEEKSFENSTFLKSFFSSELSTSSVFGNVSLLLYIDTPPYNGDVTDNSAGETGYDSPTEQYTLDNVLKEANEGAAVGRYTAETLPLSYQLKVGNYMRGNKEAVTYREFVQYVKTVRPSVSGPENSGIIAFKKGKNPAAFSTSSTISDLTSYYTPSADDE
  S:     1 MKKKLFSRLFKFGLPLVAVAVVPSVVSSCSSTVTTKTKVLNASNWNNGNVKYSELSSSNTSLESATFGSSFNSGNYIFIWGTLADSSFATFLYGSSGASATEEKSFENSTFLKSFFSSELSTSSVFGNVSLLLYIDTPPYNGDVTDNSAGETGYDSPTEQYTLDNVLKEANEGAAVGRYTAETLPLSYQLKVGNYMRGNKEAVTYREFVQYVKTVRPSVSGPENSGIIAFKKGKNPAAFSTSSTISDLTSYYTPSADDE 259
>gi|126664069|ref|ZP_01735063.1| hypothetical protein FBBAL38_13040 [Flavobacteria bacterium BAL38] >gi|126624018|gb|EAZ94712.1| hypothetical protein FBBAL38_13040 [Flavobacteria bacterium BAL38] (550 aa)
Score = 88, Expect = 5.1e-01, Identities = 51/172 (29%), Positives = 80/172 (46%)
  Q:     1 MKKKLFSRLFKF-GLPLVAVAVVPSVVSSCSSTVTTKTKVLNASNWNNGNVKYSELSSSNTSLESA---TFGSSFNSGN---YIFIWGTLADSSFATFLYGSSGASATEEKSFENSTFLKSFFSSELSTS-SVFGNVSLLLYIDTPPYNGDVTDNSAGETGYDSPTEQYTLDNVLKEANE 172
           MKK  FS   +F   PL+ +  +  +V   +S  +T  K          N +Y+E S SN SLE A   TFG +  SG+    I     + D  F T +YG+S     ++ +   S  L   F S+L    + F N     Y++   YN ++ +       +DS      L++++KE NE
  S:     1 MKKIAFSNFRRFQDFPLLELGKISVIVGRNNSGKSTMVKAFLLFLDYLQNQQYNEFSFSNKSLEDANIVTFGRAIKSGSSKEQISFQMQIDDYLFTTSIYGNS-----DDTNANVSNLLIEDFKSKLKIEINYFEN-----YLNVVKYNSEIVEK------FDS------LNDLIKEMNE 158
>gi|12045207|ref|NP_073018.1| putative lipoprotein [Mycoplasma genitalium G37] >gi|1351553|sp|P47590|Y348_MYCGE Uncharacterized lipoprotein MG348 precursor >gi|3844931|gb|AAC71573.1| lipoprotein, putative [Mycoplasma genitalium G37] >gi|166078701|gb|ABY79319.1| lipoprotein, putative [synthetic Mycoplasma genitalium JCVI-1.0] (322 aa)
Score = 86, Expect = 7.8e-01, Identities = 30/94 (31%), Positives = 50/94 (53%)
  Q:     3 KKLFSRLFKFGLPLVAVAVVPSVVSSCSSTVTTKTKVLNASNWNNGNVKYSELSSSNTSLESATFGS-SFNSGNYIFIWGTLADSSFATFLYGSS 96
           K+LF  L      LV +     ++SSCS+   +  + L+  +    N  Y++L  ++T+  +  FG+ S+N GNY+ +  T  DSS   FL GS+
  S:     2 KRLFWNLKHKKAWLVLLLGTGMILSSCSNIDQSFFRELSVESVEK-NTAYNQLPVNSTTFRNLVFGTRSYNDGNYVVVIATETDSSQINFLNGST 95
>gi|13508262|ref|NP_110211.1| membrane component, STARP antigen [Mycoplasma pneumoniae M129] >gi|2496398|sp|P75255|Y523_MYCPN Uncharacterized lipoprotein MG348 homolog precursor >gi|1673992|gb|AAB95967.1| probably membrane component [Mycoplasma pneumoniae M129] (305 aa)
Score = 86, Expect = 8.2e-01, Identities = 31/101 (30%), Positives = 51/101 (50%)
  Q:     3 KKLFSRLFKFGLPLVAVAVVPS--VVSSCSSTVTTKTKVLNASNWNNGNVKYSELSSSNTSLESATFGSS-FNSGNYIFIWGTLADSSFATFLYGSSGASATEE 103
           KK FS + K  +    + ++ S  V+SSCS+          +       V YS+L   N ++ +  FG++ +N GNY+ +  T  DSS   FL GS+  + + E
  S:     2 KKWFSSISKKKVSFSTLLLLGSGIVLSSCSNIDKPNVFRTLSQQSVENKVDYSKLPKENKTVRNLVFGTAEYNDGNYVLVVTTETDSSQINFLNGSNNQAVSTE 105