>gi|26553460|ref|NP_757394.1| Soj protein [Mycoplasma penetrans HF-2] >gi|26453466|dbj|BAC43798.1| Soj protein [Mycoplasma penetrans HF-2] (275 aa)
Score = 1321, Expect = 6.1e-144, Identities = 275/275 (100%), Positives = 275/275 (100%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRETSVNNGNQENSFGENF 275
           MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRETSVNNGNQENSFGENF
  S:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRETSVNNGNQENSFGENF 275
>gi|31544205|ref|NP_852783.1| ParA/Soj [Mycoplasma gallisepticum R] >gi|31541049|gb|AAP56351.1| ParA/Soj [Mycoplasma gallisepticum R] (263 aa)
Score = 549, Expect = 1.8e-54, Identities = 115/252 (45%), Positives = 178/252 (70%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLS--LDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           M I  +NNKGGVLKTTL+TN+    S      + +IVDLDGQGNV ATFG+ P+ L+  ++D  +G+   +D ++    ++ ILP N EL++ D  + +K+   S +K LI KL+E+YD+V +DTPPAMS +V+ ++ I D+ ++PFEPDQY+ LGL R+I+  + F+E+ N ++K++ +PTKVN R  +HND++   +K KL  + + ++ N +S TTKS+A+VGYE++PIV+   +SKYQ+EY  + KEI+N
  S:     2 MIISFINNKGGVLKTTLATNICGVFSKFFPKSRSVIVDLDGQGNVSATFGQHPERLKNTLIDIFRGEKDIDDCVLNVFPSIDILPSNHELSFVDMDVARKEYKLSVIKNLIEKLEEMYDFVFLDTPPAMSTIVSVSMHISDMIVIPFEPDQYSILGLLRVIDTIETFRER-NEDLKVLVVPTKVNARTRLHNDVL-NIVKTKLSKKNIPLSKNIVSFTTKSSASVGYEKLPIVLINQRSKYQEEYIEITKEIIN 253
>gi|13508427|ref|NP_110377.1| ParA family ATPase [Mycoplasma pneumoniae M129] >gi|2498931|sp|Q50314|PARA_MYCPN ParA family protein MPN_688 >gi|1209518|gb|AAC43646.1| Soj protein >gi|1673815|gb|AAB95802.1| ParA family of ATPase [Mycoplasma pneumoniae M129] (270 aa)
Score = 518, Expect = 7.8e-51, Identities = 121/259 (46%), Positives = 171/259 (66%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLS--LDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL---------KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPI--VMSVFKSKYQDEYHNLKKEILNYVIFGRE 259
           M I  VNNKGGVLKTT++TN+A SL      ++ +I+DLDGQGNV A+FG+ P+ L   ++D L               +D L+   E L ILP N ELN+ D  + +K+   S++  ++ +L   YD+V++DTPP M+ +V+T +S+ DV ++PFEPDQY+ LGL RI+     FKEKN  N+K + +PTKVN R  +HND+IE  +K K     V  + +F+S T+KS+AAVGYE++PI  V      KYQ EY  + KEILN V  G +
  S:     1 MIISFVNNKGGVLKTTMATNVAGSLVKLCPEQRKVILDLDGQGNVSASFGQNPERLNNTLIDILLKVPKFNGANSSIEIDDCLLPVYEGLDILPCNFELNFADIDIARKKYKASDIAEIVKQLTRRYDFVLLDTPPNMATLVSTAMSLSDVIVIPFEPDQYSMLGLMRIVETIDTFKEKNP-NLKTILVPTKVNMRTRLHNDVIEL-VKSKAHKNNVAFSEHFVSLTSKSSAAVGYEKLPISLVSPTSNKKYQTEYLEITKEILNLVNHGHQ 270
>gi|116874486|gb|ABK30885.1| ATPase [Mycoplasma imitans] (254 aa)
Score = 506, Expect = 1.8e-49, Identities = 110/253 (43%), Positives = 168/253 (66%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLS--LDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           M I  +NNKGGVLKTTL+TN+    S      + +IVDLDGQGNV ATFG+ P+ L+  ++D  +G+   +D ++    ++ ILP N EL++ D  + +K+   S +K LI KL+E YD+V +DTPPAMS +V+ ++ I D+ ++PFEPDQY+ LGL R+I+  + F+E+ N ++K++ +PTKVN R  +HND++   +K KL  + V ++ N +S TTKS+A+VGYE++PIV+             L K+ L Y
  S:     2 MIISFINNKGGVLKTTLATNICGVFSKFFPNSRSVIVDLDGQGNVSATFGQHPERLKNTLIDIFRGEKDIDDCVLNVFPSIDILPSNHELSFVDMDVARKEYKLSVIKNLIEKLEETYDFVFLDTPPAMSTIVSVSMHISDMIVIPFEPDQYSILGLLRVIDTIETFRER-NEDLKVLVVPTKVNARTRLHNDVL-SIVKTKLNKKDVPLSKNIVSFTTKSSASVGYEKLPIVLITSVQNINKNISKLPKKSLIY 254
>gi|12045330|ref|NP_073141.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein [Mycoplasma genitalium G37] >gi|66880409|ref|ZP_00405390.1| COG1192: ATPases involved in chromosome partitioning [Mycoplasma genitalium G-37] >gi|1351592|sp|P47706|PARA_MYCGE ParA family protein MG470 >gi|3845067|gb|AAC72491.1| CobQ/CobB/MinD/ParA nucleotide binding domain [Mycoplasma genitalium G37] >gi|166078823|gb|ABY79441.1| CobQ/CobB/MinD/ParA nucleotide binding domain [synthetic Mycoplasma genitalium JCVI-1.0] (269 aa)
Score = 504, Expect = 3.2e-49, Identities = 117/252 (46%), Positives = 173/252 (68%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLS--LDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL---------KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPI-VMSVFKSKYQDEYHNLKKEILN 252
           M I  VNNKGGVLKTT++TN+A SL      ++ +I+DLDGQGNV A+FG+ P+ L   ++D L               +D L+   E L ILP N ELN+ D  +++K+   S++  ++ +L + Y++V++DTPP M+ +V+T +S+ DV ++PFEPDQY+ LGL RI+     FKEKN  N+K + +PTKVN R  +HN++I+ + K K K   V  + NF+S T+KS+AAVGYE++PI ++S    KY +EY  + KEILN
  S:     1 MIISFVNNKGGVLKTTMATNVAGSLVKLCPERRKVILDLDGQGNVSASFGQNPERLNNTLIDILLKVPKFSGSNNFIEIDDCLLSVYEGLDILPCNFELNFADIDISRKKYKASDIAEIVKQLAKRYEFVLLDTPPNMATLVSTAMSLSDVIVIPFEPDQYSMLGLMRIVETIDTFKEKNT-NLKTILVPTKVNVRTRLHNEVIDLA-KTKAKKNNVAFSKNFVSLTSKSSAAVGYEKLPISLVSSPSKKYLNEYLEITKEILN 262
>gi|41057058|ref|NP_957661.1| putative partition protein/ATPase [Bacillus methanolicus] >gi|40074243|gb|AAR39407.1| putative partition protein/ATPase [Bacillus methanolicus] (256 aa)
Score = 380, Expect = 6.9e-35, Identities = 87/248 (35%), Positives = 151/248 (60%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKL---DELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I V  NKGGVLKT+++TNLA +L  + KKV+I+D D QGNV+ +FG  PD +E  + D L      ++ +I    N+ +LP ND++++ +F +L+ ++   +  KML N +   ++ YDY++ID+PP + ++    LS  +  L+PF+P+ Y+   L +I+NA   FKE++N  +KI   + T V+ R T+H+++++Q  +      G+ +    I  + +  A+V YER P  ++  K+     Y NL +E+
  S:     4 IAVSTNKGGVLKTSITTNLAGALC-NNKKVLIIDTDNQGNVLVSFGINPDSVEQTLYDVLVEGLDPKEAIINVHPNIDVLPSNDDMSFLEFDVLSNREKYPTPFKMLKNAMGTIEKEYDYILIDSPPNLGLIQGNILSYAESVLIPFQPEGYSMRSLIKILNAIYNFKEQHNPKLKIKGVVATLVDQRTTLHSEVLQQC-RRFCAENGIRMFETVIPRSVRFAASVAYERKPATLTDSKNSLVKAYFNLLQEV 254
>gi|67153581|ref|ZP_00415326.1| ATPase, ParA type [Azotobacter vinelandii AvOP] >gi|67087714|gb|EAM07180.1| ATPase, ParA type [Azotobacter vinelandii AvOP] (262 aa)
Score = 281, Expect = 2.5e-23, Identities = 61/193 (31%), Positives = 107/193 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT   NLAASL    ++V+++DLD QGN     G    +LE ++ D L G C + E +   +     +LP N +L   + +L  K   +  L+  +  + E YDY++ID PP++S++    L+  D  ++P + + YA  GL  ++N+ +   +  N N++I   + T  + R+++ N++ EQ
  S:     5 LAIANQKGGVAKTTTCINLAASLVATRRRVLLIDLDPQGNATTGSGVDKLNLEHSVYDVLTGDCSFAEAMHFSEHGGYQLLPANRDLTAAEVVLLDKPGKEHRLREALAPIRENYDYILIDCPPSLSMLTVNALAASDGVIIPMQCEYYALEGLSDLVNSIQRIGQALNPNLQIEGLLRTMYDPRISLTNEVSEQ 199
>gi|171325314|ref|ZP_02913820.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. WCH70] >gi|171088738|gb|EDT35083.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. WCH70] (253 aa)
Score = 279, Expect = 3.9e-23, Identities = 75/249 (30%), Positives = 135/249 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAA L+  GKKV++VD+D QGN  +  G +  D++  I + + G    +D++     ENLHI+P   +L   +  L      +  LK  ++ L E YD++IID PP++ ++    L+  +  L+P + + YA  GL +++N  +  ++  NH++++  +  T ++ R  +   +I Q +K   + +   V +  I    + + A  + + PI++   KS+  + Y  L KE+L
  S:     5 IAIANQKGGVGKTTTAVNLAACLAHIGKKVLLVDIDPQGNATSGIGIEKGDVDECIYNVIIGDLKAKDVIRPTNIENLHIIPATIQLAGAEIELVSVISREIRLKNALDPLREAYDFIIIDCPPSLGLLTLNALTAANSVLIPVQCEYYALEGLSQLLNTIRLVQKHLNHDLRLEGVLLTMLDARTNLGIQVI-QEVKKYFREK---VYNTIIPRNVRLSEAPSHGK-PIILYDVKSRGAEVYLELAKEVL 250
>gi|167036426|ref|YP_001671657.1| cobyrinic acid ac-diamide synthase [Pseudomonas putida GB-1] >gi|166862914|gb|ABZ01322.1| Cobyrinic acid ac-diamide synthase [Pseudomonas putida GB-1] (263 aa)
Score = 279, Expect = 3.9e-23, Identities = 61/192 (31%), Positives = 107/192 (55%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL+   ++V+++DLD QGN     G    +LE ++ D L G+C   + +   +     +LP N +L   + +L + Q+ +S L+  +  + E YDY++ID PP++S++    L   D  ++P + + YA  GL  +++  K    + N  +KI   + T  + R++++ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSVYDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPIRENYDYILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEGLLRTMYDPRLSLNNDVSAQ 199
>gi|60677317|ref|YP_209675.1| chromosome partitioning related protein [Clostridium perfringens] >gi|60417952|dbj|BAD90619.1| Soj protein [Clostridium perfringens] (250 aa)
Score = 278, Expect = 5.0e-23, Identities = 84/250 (33%), Positives = 136/250 (54%)
  Q:     2 KIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           KI V N KGGV KTT + N  A L   G +V++VDLD Q N+   F K     + +I D L  K    + +IKKT  EN+ ILP N  L + +   LL+  +  Q+ L   + ++++ YDY +ID PPA++++    L   D  LVP + D++A  GL+ ++++ +E KE+ N N+        +++  T+ N++I+Q LK  L  +    + +      +ST    +E  P+V S  K++    Y +L KEI 
  S:     3 KISVFNIKGGVAKTTSTANFGACLEEKGDRVLLVDLDPQSNLTKLF-KAYSMEDVSIADVLLDKNLDIEKVIKKTDFENIDILPSNVTLAFAERKILLDVNRSQQNRLAKALEEIEDKYDYCLIDCPPALNMITVNALCASDEVLVPIKIDKFALDGLEYLLDSIEEIKEEFNPNLNFKGCFITMDSSTTV-NNVIKQELKSVLGEKMFNTSIHQNIKVVEST----FEECPVVFSSKKARASLNYKDLSKEIF 250
>gi|104784443|ref|YP_610941.1| chromosome partitioning ATPase ParA [Pseudomonas entomophila L48] >gi|95113430|emb|CAK18158.1| chromosome partitioning ATPase ParA [Pseudomonas entomophila L48] (263 aa)
Score = 276, Expect = 9.2e-23, Identities = 61/192 (31%), Positives = 107/192 (55%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL+   ++V+++DLD QGN     G    +LE ++ D L G+C   + +   +     +LP N +L   + +L + Q+ +S L+  +  + E YDY++ID PP++S++    L   D  ++P + + YA  GL  +++  K    + N  +KI   + T  + R++++ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSVYDLLIGECDLAQAMHYSEHGGYQLLPANRDLTAAEVVLLEMQMKESRLRNALAPIRENYDYILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEGLLRTMYDPRLSLNNDVSAQ 199
>gi|149375655|ref|ZP_01893424.1| ParA family protein [Marinobacter algicola DG893] >gi|149360057|gb|EDM48512.1| ParA family protein [Marinobacter algicola DG893] (264 aa)
Score = 276, Expect = 9.3e-23, Identities = 63/193 (32%), Positives = 106/193 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   ++V++VD+D QGN     G   + LE +  D L  +    +++ +       ILP N +L   +  L  +   +  L++ +NK+ E YDY++ID PP++S++    LS  D  L+P + + YA  GL  ++N  ++ +E  N ++++  I  T  + R ++  D+  Q
  S:     5 IAVTNQKGGVGKTTTCVNLAASLAATKRRVLLVDMDPQGNATMGSGVDKNALELSGYDMLTKRAAAAEVIFRADVSGFDILPANGDLTAAEVELMNEIGREHRLRLALNKVRENYDYILIDCPPSLSLLTVNALSAADTVLIPMQCEYYALEGLAALMNTVEQIQETVNPDLQVEGILRTMYDPRNSLTLDVSSQ 199
>gi|26986747|ref|NP_742172.1| ParA family protein [Pseudomonas putida KT2440] >gi|148550504|ref|YP_001270606.1| cobyrinic acid a,c-diamide synthase [Pseudomonas putida F1] >gi|60416315|sp|P0A150|YGIDB_PSEPU Uncharacterized protein in gidB 3'region >gi|60416274|sp|P0A149|Y002_PSEPK Uncharacterized protein PP_0002 >gi|24981337|gb|AAN65636.1|AE016190_2 ParA family protein [Pseudomonas putida KT2440] >gi|45713|emb|CAA44421.1| unnamed protein product [Pseudomonas putida] >gi|148514562|gb|ABQ81422.1| chromosome segregation ATPase [Pseudomonas putida F1] (263 aa)
Score = 275, Expect = 1.0e-22, Identities = 60/192 (31%), Positives = 107/192 (55%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL+   ++V+++DLD QGN     G    +LE ++ D L G+C   + +   +     +LP N +L   + +L + Q+ +S L+  +  + + YDY++ID PP++S++    L   D  ++P + + YA  GL  +++  K    + N  +KI   + T  + R++++ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSVYDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPIRDNYDYILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEGLLRTMYDPRLSLNNDVSAQ 199
>gi|170724365|ref|YP_001752053.1| cobyrinic acid ac-diamide synthase [Pseudomonas putida W619] >gi|169762368|gb|ACA75684.1| Cobyrinic acid ac-diamide synthase [Pseudomonas putida W619] (263 aa)
Score = 275, Expect = 1.2e-22, Identities = 60/192 (31%), Positives = 107/192 (55%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL+   ++V+++DLD QGN     G    +LE ++ D L G+C   + +   +     +LP N +L   + +L + Q+ +S L+  +  + E YD+++ID PP++S++    L   D  ++P + + YA  GL  +++  K    + N  +KI   + T  + R++++ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSVYDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPIRENYDFILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEGLLRTMYDPRLSLNNDVSAQ 199
>gi|78043660|ref|YP_358881.1| sporulation initiation inhibitor protein soj [Carboxydothermus hydrogenoformans Z-2901] >gi|77995775|gb|ABB14674.1| sporulation initiation inhibitor protein soj [Carboxydothermus hydrogenoformans Z-2901] (254 aa)
Score = 274, Expect = 1.6e-22, Identities = 75/249 (30%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVY---VTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL A+L+L GKKV++VD D Q N+ +  G   + L   I D L      E +L  +   L+++P   EL   +  L   +  +  LK +++ L + YDY +ID+PP++ ++    L+  D  L+P + + YA  G+ ++IN     K++ N ++KI  +  T  + R  +   ++E+        +G +   V    I    + + A  Y + PI +   K +  + YH L KE++
  S:     5 IAVANQKGGVAKTTTAINLGAALALAGKKVLLVDTDPQANMTSGLGFPKEGLPVTIYDMLVDGFKEEGVLETEISGLYLIPSTVELAGAEIELVMLEERELRLKKVLHPLKDKYDYTLIDSPPSLGLITLNGLAAADTILIPIQCEYYALEGVTQLINTIDLVKKRLNPDLKIEGVLLTMFDGRTNLSIQVVEE-------VKGFFKGLVYGTVIPRNVRLSEAPSYGK-PIFLYDPKCRGAEVYHELAKEVM 249
>gi|15610349|ref|NP_217729.1| SOJ/PARA-like protein [Mycobacterium tuberculosis H37Rv] >gi|148663074|ref|YP_001284597.1| soj/parA-related protein [Mycobacterium tuberculosis H37Ra] >gi|167966992|ref|ZP_02549269.1| soj/parA-related protein [Mycobacterium tuberculosis H37Ra] >gi|2072672|emb|CAB08303.1| POSSIBLE SOJ/PARA-RELATED PROTEIN [Mycobacterium tuberculosis H37Rv] >gi|148507226|gb|ABQ75035.1| soj/parA-related protein [Mycobacterium tuberculosis H37Ra] (266 aa)
Score = 273, Expect = 1.8e-22, Identities = 58/191 (30%), Positives = 107/191 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++   G++V++VDLD QG +  + G+ PD L  ++ + L G+     +L+   E + +LP N +L   + +L  +   +  LK  + K  + +D VIID PP++ V+    L+  D A+VP + +  A  G+ + +    + ++  N N++++ A+PT  ++R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADKAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVL 198
>gi|169344625|ref|ZP_02865591.1| sporulation initiation inhibitor protein soj [Clostridium perfringens C str. JGS1495] >gi|169297235|gb|EDS79347.1| sporulation initiation inhibitor protein soj [Clostridium perfringens C str. JGS1495] (250 aa)
Score = 273, Expect = 1.9e-22, Identities = 83/250 (33%), Positives = 135/250 (54%)
  Q:     2 KIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           KI V N KGGV KTT + N  A L   G +V++VDLD Q N+   F K     + +I D L  K    + +IKKT+  N+ ILP N  L + +   LL+  +  Q+ L   + ++++ YDY +ID PPA++++    L   D  LVP + D++A  GL+ ++++ +E KE+ N N+        +++  T+ N +I+Q LK  L  +    + +      +ST    +E  P+V S  K++    Y +L KEI 
  S:     3 KISVFNIKGGVAKTTSTANFGACLEEKGDRVLLVDLDPQSNLTKLF-KAYSMEDVSIADVLLDKNLDIEKVIKKTDFDNIDILPSNVTLAFAERKILLDVNRSQQNRLAKALEEIEDKYDYCLIDCPPALNMITVNALCASDEVLVPIKIDKFALDGLEYLLDSIEEIKEEFNPNLNFKGCFITMDSSTTV-NKVIKQELKSVLGEKMFNTSIHQNIKVVEST----FEECPVVFSSKKARASLNYKDLSKEIF 250
>gi|15081480|ref|NP_149993.1| Soj protein [Clostridium perfringens str. 13] >gi|15076713|dbj|BAB62438.1| Soj protein [Clostridium perfringens str. 13] (250 aa)
Score = 273, Expect = 1.9e-22, Identities = 83/250 (33%), Positives = 135/250 (54%)
  Q:     2 KIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           KI V N KGGV KTT + N  A L   G +V++VDLD Q N+   F K     + +I D L  K    + +IKKT  EN+ ILP N  L + +   LL+  +  Q+ L   + ++++ YDY +ID PPA++++    L   D  LVP + D++A  GL+ ++++ +E K++ N N+        +++  T+ N +I+Q LK  L  +    + +      +ST    +E  P+V S  K++    Y +L KEI 
  S:     3 KISVFNIKGGVAKTTSTANFGACLEEKGDRVLLVDLDPQSNLTKLF-KAYSMEDVSIADVLLDKNLDIEKVIKKTDFENIDILPSNVTLAFAERKILLDVNRSQQNRLAKALEEIEDKYDYCLIDCPPALNMITVNALCASDEVLVPIKIDKFALDGLEYLLDSIEEIKDEFNPNLNFKGCFITMDSSTTV-NKVIKQELKSVLGEKMFNTSIHQNIKVVEST----FEECPVVFSSKKARASLNYKDLSKEIF 250
>gi|134151352|gb|EBA43397.1| hypothetical soj/para-related protein [Mycobacterium tuberculosis str. Haarlem] (266 aa)
Score = 273, Expect = 1.9e-22, Identities = 58/191 (30%), Positives = 107/191 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++   G++V++VDLD QG +  + G+ PD L  ++ + L G+     +L+   E + +LP N +L   + +L  +   +  LK  + K  + +D VIID PP++ V+    L+  D A+VP + +  A  G+ + +    + ++  N N++++ A+PT  ++R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVL 198
>gi|15842800|ref|NP_337837.1| Soj family protein [Mycobacterium tuberculosis CDC1551] >gi|31794391|ref|NP_856884.1| SOJ/PARA-like protein [Mycobacterium bovis AF2122/97] >gi|121639100|ref|YP_979324.1| putative soj/parA-related protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148824412|ref|YP_001289166.1| hypothetical protein TBFG_13239 [Mycobacterium tuberculosis F11] >gi|13883127|gb|AAK47651.1| Soj family protein [Mycobacterium tuberculosis CDC1551] >gi|31619987|emb|CAD95331.1| POSSIBLE SOJ/PARA-RELATED PROTEIN [Mycobacterium bovis AF2122/97] >gi|121494748|emb|CAL73229.1| Possible soj/parA-related protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148722939|gb|ABR07564.1| hypothetical soj/para-related protein [Mycobacterium tuberculosis F11] (266 aa)
Score = 273, Expect = 1.9e-22, Identities = 58/191 (30%), Positives = 107/191 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++   G++V++VDLD QG +  + G+ PD L  ++ + L G+     +L+   E + +LP N +L   + +L  +   +  LK  + K  + +D VIID PP++ V+    L+  D A+VP + +  A  G+ + +    + ++  N N++++ A+PT  ++R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVL 198
>gi|194541884|ref|YP_002076915.1| hypothetical protein TBCG_03150 [Mycobacterium tuberculosis C] >gi|124599354|gb|EAY58458.1| hypothetical protein TBCG_03150 [Mycobacterium tuberculosis C] (267 aa)
Score = 273, Expect = 1.9e-22, Identities = 58/191 (30%), Positives = 107/191 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++   G++V++VDLD QG +  + G+ PD L  ++ + L G+     +L+   E + +LP N +L   + +L  +   +  LK  + K  + +D VIID PP++ V+    L+  D A+VP + +  A  G+ + +    + ++  N N++++ A+PT  ++R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVL 198
>gi|120556788|ref|YP_961139.1| cobyrinic acid a,c-diamide synthase [Marinobacter aquaeolei VT8] >gi|120326637|gb|ABM20952.1| chromosome segregation ATPase [Marinobacter aquaeolei VT8] (264 aa)
Score = 273, Expect = 2.0e-22, Identities = 59/176 (33%), Positives = 98/176 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I V N KGGV KTT   NLAASL+   ++V++VD+D QGN     G   + LE +  D L  +    ++++  +     +LP N +L   +  L  +   +  L++ +N + E YDY++ID PP++S++    LS  D  L+P + + YA  GL  ++N  ++ +E  N N++I  I
  S:     5 IAVTNQKGGVGKTTTCVNLAASLAATKRRVLLVDMDPQGNATMGSGVDKNSLELSGYDVLTKRATPAEVIVHAEASGFDLLPANGDLTAAEVELMNEIGREHRLRLTLNTVRENYDYILIDCPPSLSLLTVNALSAADSVLIPMQCEYYALEGLAALMNTVQQIQETVNPNLEIEGI 181
>gi|49082946|gb|AAT50873.1| PA5563 [synthetic construct] (263 aa)
Score = 272, Expect = 2.5e-22, Identities = 61/192 (31%), Positives = 106/192 (55%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G    +LE +I D L G+C   E +   +     +LP N +L   + +L +  + ++ L+  +  + E YDY++ID PP++S++    L+  D  ++P + + YA  GL  ++N+ +   +  N  +KI   + T  + R+++ ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLVATKRRVLLLDLDPQGNATTGSGIDKHNLEHSIYDVLTGECNLAEAMQFSEHGGYQLLPANRDLTAAEVVLLEMDMKENRLRNALAPIRENYDYILIDCPPSLSMLTVNALTAADGVIIPMQCEYYALEGLTDLMNSIQRIGQLLNPTLKIEGLLRTMYDPRISLTNDVSAQ 199
>gi|126667599|ref|ZP_01738568.1| ParA family protein [Marinobacter sp. ELB17] >gi|126627868|gb|EAZ98496.1| ParA family protein [Marinobacter sp. ELB17] (264 aa)
Score = 272, Expect = 2.6e-22, Identities = 64/193 (33%), Positives = 106/193 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   ++V++VD+D QGN     G   + L+ +  D L  +    +I+I  +     I+PGN +L   +  L  +   +  L+  +N L + YDYV+ID PP+++++    LS  D  L+P + + YA  GL  ++N  ++ +E  N N+++  I  T  + R ++  D+  Q
  S:     5 IAVTNQKGGVGKTTTCVNLAASLAATKRRVLLVDMDPQGNATMGSGIDKNALQLSGYDLLTKRASASEIIIYNEMGGYDIMPGNGDLTAAEVELMTEIGREHRLRQALNPLRDNYDYVLIDCPPSLNLLTVNALSFADSILIPMQCEYYALEGLAALMNTVQQIQETVNPNLQVEGILRTMYDPRSSLTRDVSGQ 199
>gi|167759567|ref|ZP_02431694.1| hypothetical protein CLOSCI_01924 [Clostridium scindens ATCC 35704] >gi|167662794|gb|EDS06924.1| hypothetical protein CLOSCI_01924 [Clostridium scindens ATCC 35704] (254 aa)
Score = 272, Expect = 2.6e-22, Identities = 81/250 (32%), Positives = 139/250 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL+A L+  GKKV+ VD+D QGN+ +  G   + LE  + D + G+   E++L K+T ENL +LP N +L+  +  L   +  +  ++  I K+ + YD+VIID PP++S++    ++  D  LVP + + YA  GL ++I+  +  K++ N +++I  +  T  + R  +   ++E ++K  L+ Q +Y T   I    +   A  Y  +PI     KS   + Y  L  E+++
  S:     5 IAIANQKGGVGKTTTAINLSACLADKGKKVLAVDMDPQGNMTSGLGLDKEFLEKTVYDMIIGESDIEEVLQKETMENLDVLPTNIDLSAAEIELIDVENKEFIVRNSIQKIRDNYDFVIIDCPPSLSMLTINAMTTADSVLVPIQCEYYALEGLSQLIHTVELVKDRLNPDLEIEGVVFTMYDARTNLSLQVVE-NVKDNLQ-QNIYKT--IIPRNIRLAEAPSYG-MPINQYDPKSAGSESYMRLADEVIS 251
>gi|15600756|ref|NP_254250.1| chromosome partitioning protein Soj [Pseudomonas aeruginosa PAO1] >gi|107104664|ref|ZP_01368582.1| hypothetical protein PaerPA_01005743 [Pseudomonas aeruginosa PACS2] >gi|116053714|ref|YP_794041.1| chromosome partitioning protein Soj [Pseudomonas aeruginosa UCBPP-PA14] >gi|194554093|ref|YP_002089120.1| chromosome partitioning protein Soj [Pseudomonas aeruginosa 2192] >gi|9951904|gb|AAG08948.1|AE004968_2 chromosome partitioning protein Soj [Pseudomonas aeruginosa PAO1] >gi|115588935|gb|ABJ14950.1| chromosome partitioning protein [Pseudomonas aeruginosa UCBPP-PA14] >gi|126196486|gb|EAZ60549.1| chromosome partitioning protein Soj [Pseudomonas aeruginosa 2192] (262 aa)
Score = 272, Expect = 2.7e-22, Identities = 61/192 (31%), Positives = 106/192 (55%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G    +LE +I D L G+C   E +   +     +LP N +L   + +L +  + ++ L+  +  + E YDY++ID PP++S++    L+  D  ++P + + YA  GL  ++N+ +   +  N  +KI   + T  + R+++ ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLVATKRRVLLLDLDPQGNATTGSGIDKHNLEHSIYDVLTGECNLAEAMQFSEHGGYQLLPANRDLTAAEVVLLEMDMKENRLRNALAPIRENYDYILIDCPPSLSMLTVNALTAADGVIIPMQCEYYALEGLTDLMNSIQRIGQLLNPTLKIEGLLRTMYDPRISLTNDVSAQ 199
>gi|146284511|ref|YP_001174664.1| ParA family protein [Pseudomonas stutzeri A1501] >gi|145572716|gb|ABP81822.1| ParA family protein [Pseudomonas stutzeri A1501] (262 aa)
Score = 272, Expect = 2.7e-22, Identities = 62/192 (32%), Positives = 103/192 (53%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G     LE++I D L G+C   D +   +     +LP N +L   +  L      +  L+  +  + E YDY++ID PP++S++    L+  D  ++P + + YA  GL  ++N+ +   +  N ++KI   + T  + R ++ ND+ EQ
  S:     6 AIANQKGGVAKTTTCINLAASLVATRRRVLLIDLDPQGNATTGSGVDKLGLEYSIYDVLIGECSLVDAMQFSEHGGYQLLPANRDLTAAEVALLNLPAKEKRLREALAPVRENYDYILIDCPPSLSMLTINALAAADGVIIPMQCEYYALEGLSDLVNSIQRIGQALNPSLKIEGLLRTMYDPRSSLTNDVSEQ 199
>gi|150392468|ref|YP_001322517.1| cobyrinic acid a,c-diamide synthase [Alkaliphilus metalliredigens QYMF] >gi|149952330|gb|ABR50858.1| Cobyrinic acid a,c-diamide synthase [Alkaliphilus metalliredigens QYMF] (257 aa)
Score = 272, Expect = 2.7e-22, Identities = 78/250 (31%), Positives = 136/250 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKV-NTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I V N KGGV KTT + NL+A ++ +GK+V ++D+D QGN  + FG     LE++I D L      E+ I+    ENL I+P + +L   +  L   Q  +  LK  IN++ + YDY+ ID PP++ ++   +L+ VD  L+P + + YA  G+ +++N  +  K+  N +++I  +   + + R  +   ++++ +K   K + VY T   I    +   A  + + PI+    KSK  + Y +L  E L+
  S:     5 IAVFNQKGGVGKTTTNVNLSACIAQEGKRVCVIDIDPQGNTTSGFGIDKKQLEYSIYDVLINDLPIEETIMHTDYENLDIVPSSAQLAGAEIELTTIQKRELRLKESINRIRDNYDYIFIDCPPSLGLLTINSLAAVDSVLIPIQCEYYALEGVSQLMNTIQLIKKSLNKDLEIQGVVLSMFDGRTNLSIQVVDE-VKNYFKGK-VYAT--IIPRNVRLAEAPSFGQ-PIIYYDNKSKGAEAYTDLAVEFLD 251
>gi|152987266|ref|YP_001351676.1| chromosome partitioning protein Soj [Pseudomonas aeruginosa PA7] >gi|150962424|gb|ABR84449.1| chromosome partitioning protein Soj [Pseudomonas aeruginosa PA7] (262 aa)
Score = 271, Expect = 2.9e-22, Identities = 61/192 (31%), Positives = 106/192 (55%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G    +LE +I D L G+C   E +   +     +LP N +L   + +L +  + ++ L+  +  + E YDY++ID PP++S++    L+  D  ++P + + YA  GL  ++N+ +   +  N  +KI   + T  + R+++ ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLVATKRRVLLLDLDPQGNATTGSGIDKHNLEHSIYDVLTGECNLAEAMQFSEHGGYQLLPANRDLTAAEVVLLEMDMKENRLRNALAPIRENYDYILIDCPPSLSMLTVNALTAADGVIIPMQCEYYALEGLTDLMNSIQRIGQLLNPTLKIEGLLRTMYDPRISLTNDVSAQ 199
>gi|121639192|ref|YP_979416.1| putative soj/parA-related protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|121494840|emb|CAL73322.1| Possible soj/parA-related protein [Mycobacterium bovis BCG str. Pasteur 1173P2] (198 aa)
Score = 271, Expect = 2.9e-22, Identities = 58/190 (30%), Positives = 106/190 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDI 192
           + V N KGGV KTT   +L A++   G++V++VDLD QG +  + G+ PD L  ++ + L G+     +L+   E + +LP N +L   + +L  +   +  LK  + K  + +D VIID PP++ V+    L+  D A+VP + +  A  G+ + +    + ++  N N++++ A+PT  ++R T   D+
  S:     7 LAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDV 197
>gi|70733507|ref|YP_263282.1| chromosome partitioning protein ParA [Pseudomonas fluorescens Pf-5] >gi|68347806|gb|AAY95412.1| chromosome partitioning protein ParA [Pseudomonas fluorescens Pf-5] (271 aa)
Score = 271, Expect = 3.1e-22, Identities = 62/192 (32%), Positives = 104/192 (54%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G     LE ++ D L G+C   + +   +     +LP N +L   + +L + Q+ +S L+  +  + E YDY++ID PP++S++    L   D  ++P + + YA  GL  +++  K   E  N  +KI   + T  + R+++ ND+  Q
  S:    12 AIANQKGGVGKTTTCINLAASLVATKRRVLLIDLDPQGNATMGSGVDKHGLENSVYDLLIGECDLAQAMHFSEHGGYQLLPANRDLTAAEVVLLEMQMKESRLRSALAPIRENYDYILIDCPPSLSMLTLNALVAADGVIIPMQCEYYALEGLSDLVDNIKRIAELLNPELKIEGLLRTMFDPRLSLMNDVSAQ 205
>gi|153815413|ref|ZP_01968081.1| hypothetical protein RUMTOR_01648 [Ruminococcus torques ATCC 27756] >gi|145847272|gb|EDK24190.1| hypothetical protein RUMTOR_01648 [Ruminococcus torques ATCC 27756] (255 aa)
Score = 270, Expect = 4.1e-22, Identities = 80/250 (32%), Positives = 135/250 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT S NL+A+L+  GKKV+ +D+D QGN+ +  G   D+ E  + D + G    E+ + K   ENL +LP N  L+  +  L   +  +  LK  + K+ + YD+V+ID PPA+S++    ++  D  +VP + + YA  GL ++I+  +  +E+ N N++I  +  T  + R  +   ++E ++K  L  Q +Y T   I    +   A  Y  +PI +   KS     Y  L +E+++
  S:     5 IAIANQKGGVGKTTTSINLSAALASKGKKVLALDMDPQGNMTSGLGVDKDEAEKTVYDLIIGNAGIEECICKDALENLDVLPSNINLSAAEIELIGVENKEYILKTEVEKVKDEYDFVVIDCPPALSMLTINAMTTADSIIVPIQCEYYALEGLSQLIHTIELVQERLNPNLEIEGVVFTMYDARTNLSLQVVE-NVKDNL-NQNIYKT--IIPRNIRLAEAPSYG-MPINLYDPKSTGATSYMLLAEEVIH 251
>gi|120402788|ref|YP_952617.1| cobyrinic acid a,c-diamide synthase [Mycobacterium vanbaalenii PYR-1] >gi|119955606|gb|ABM12611.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium vanbaalenii PYR-1] (264 aa)
Score = 270, Expect = 4.6e-22, Identities = 58/191 (30%), Positives = 108/191 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++   GKKV++VDLD QG +  + G+ PD L  ++ + L G    E  L++ +E + +LP N +L   + +L  +   +  LK  + K+ + +D ++ID PP++ V+    L+  D  +VP + +  A  G+ + +    + ++  N ++K++ A+PT  ++R T   D++
  S:     5 LAVANQKGGVAKTTTVASLGAAMVELGKKVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGDVEPEAALVETSEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKISDAFDVILIDCPPSLGVLTLNGLTAADDVIVPLQCETLAHRGVGQFLRTINDVQQITNADLKLLGALPTLYDSRTTHSRDVL 196
>gi|77461956|ref|YP_351463.1| chromosome segregation ATPase [Pseudomonas fluorescens PfO-1] >gi|77385959|gb|ABA77472.1| chromosome segregation ATPase [Pseudomonas fluorescens PfO-1] (265 aa)
Score = 268, Expect = 6.4e-22, Identities = 61/192 (31%), Positives = 105/192 (54%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G     LE ++ D L G+C   + +   +     +LP N +L   + +L + Q+ +S L+  +  + E YDY++ID PP++S++    L   D  ++P + + +A  GL  +++  K   E  N N+K+   + T  + R+++ ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLVATKRRVLLIDLDPQGNATMGSGVDKHGLENSVYDLLIGECDLAQAMHYSEHGGYQLLPANRDLTAAEVVLLEMQMKESRLRSALAPIRENYDYILIDCPPSLSMLTLNALVAADGVIIPMQCEYFALEGLSDLVDNIKRIAELLNPNLKVEGLLRTMYDPRLSLMNDVSAQ 199
>gi|154483913|ref|ZP_02026361.1| hypothetical protein EUBVEN_01619 [Eubacterium ventriosum ATCC 27560] >gi|149735404|gb|EDM51290.1| hypothetical protein EUBVEN_01619 [Eubacterium ventriosum ATCC 27560] (254 aa)
Score = 268, Expect = 6.8e-22, Identities = 73/249 (29%), Positives = 135/249 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL++ L+  GKKV++VD+D QGN  +  G     LE  + +   G+C + + L     +NL+++P N  L+  +  L   +  +  LK +++ + +LY+Y+IID PP+++V+    +   D  +VP + + YA  GL ++I+     +++ N N++I  I  T  ++R  +  +++E ++K  +    +++    I    +   A  Y  +PI M   KS     Y NL +E++
  S:     5 IAIANQKGGVGKTTTAINLSSCLADAGKKVLLVDIDPQGNATSGVGIMKQTLENTVYELFIGECTFSECLTDSAVDNLNVIPSNVNLSGAEIDLIGVENREYILKNILDTIKDLYEYIIIDCPPSLNVLTVNAMVAADSVIVPIQCEYYALEGLSQLIHTINLIQDRLNKNLEIDGIVFTMYDSRTNLSTEVVE-NVKENIH---LHIYKTLIPRNVRLAEAPSYG-IPIHMYDGKSAGAIAYKNLAQEVI 250
>gi|168211160|ref|ZP_02636785.1| sporulation initiation inhibitor protein soj [Clostridium perfringens B str. ATCC 3626] >gi|169344633|ref|ZP_02865599.1| sporulation initiation inhibitor protein soj [Clostridium perfringens C str. JGS1495] >gi|169297243|gb|EDS79355.1| sporulation initiation inhibitor protein soj [Clostridium perfringens C str. JGS1495] >gi|170710815|gb|EDT22997.1| sporulation initiation inhibitor protein soj [Clostridium perfringens B str. ATCC 3626] (250 aa)
Score = 268, Expect = 7.4e-22, Identities = 82/250 (32%), Positives = 134/250 (53%)
  Q:     2 KIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           KI V N KGGV KTT + N  A L   G +V++VDLD Q N+   F K     + +I D L  K    + +IKKT+  N+ ILP N  L + +   LL+  +  Q+ L   + +++  YDY +ID PPA++++    L   D  LVP + D++A  GL+ ++++ +E K++ N N+        +++  T+ N +I+Q LK  L  +    + +      +ST    +E  P+V S  K++    Y +L KEI 
  S:     3 KISVFNIKGGVAKTTSTANFGACLEEKGDRVLLVDLDPQSNLTKLF-KAYSMEDVSIADVLLDKNLEIEKVIKKTDFDNIDILPSNVTLAFAERKILLDVNRSQQNRLSKALEEIEYKYDYCLIDCPPALNMITVNALCASDEVLVPIKIDKFALDGLEYLLDSIEEIKDEFNPNLNFKGCFITMDSSTTV-NKVIKQELKSVLGEKMFNTSIHQNIKVVEST----FEECPVVFSSKKARASLNYKDLSKEIF 250
>gi|66048354|ref|YP_238195.1| cobyrinic acid a,c-diamide synthase [Pseudomonas syringae pv. syringae B728a] >gi|71735519|ref|YP_277289.1| chromosome partitioning protein ParA [Pseudomonas syringae pv. phaseolicola 1448A] >gi|63259061|gb|AAY40157.1| Cobyrinic acid a,c-diamide synthase [Pseudomonas syringae pv. syringae B728a] >gi|71556072|gb|AAZ35283.1| chromosome partitioning protein ParA [Pseudomonas syringae pv. phaseolicola 1448A] (263 aa)
Score = 268, Expect = 8.2e-22, Identities = 62/192 (32%), Positives = 105/192 (54%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G    +LE ++ D L G+C   E +   +     +LP N +L   + +L + Q+ +S L+  +  + E YDY++ID PP++S++    L   D  ++P + + +A  GL  +++  K   E  N  +KI   + T  + R+++ ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLVATKRRVLLIDLDPQGNATMGSGVDKHNLENSVYDLLIGECDLGEAMQFSEHGGYQLLPANRDLTAGEVVLLEMQMKESRLRNALAPIRENYDYILIDCPPSLSMLTLNALVAADGVIIPMQCEYFALEGLSDLVDNIKRIAELLNPQLKIEGLLRTMYDPRLSLINDVSAQ 199
>gi|163815003|ref|ZP_02206390.1| hypothetical protein COPEUT_01157 [Coprococcus eutactus ATCC 27759] >gi|158449686|gb|EDP26681.1| hypothetical protein COPEUT_01157 [Coprococcus eutactus ATCC 27759] (256 aa)
Score = 267, Expect = 8.4e-22, Identities = 78/249 (31%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAA L+  GKKV+ VD+D QGN+ +  G   D LE+ + D L+ +C   E +LI     L++LP N EL   +      +  Q  LK  I K+   +DY+IID PPA+ ++    L+  +  LVP + + +A  GL +++   +  ++  N  + I  +  T  ++R  +   ++E +++  L  Q +Y T   I    +   A  Y  +PI+    +S   + Y  L  E++
  S:     5 IAIANQKGGVGKTTTAINLAACLAAKGKKVLAVDMDPQGNMTSGLGVDRDSLEYTVYDMLRNECNIGECMLINVYPGLNLLPANRELAGAEVEFVGMEDMQHILKTHIRKVKNKFDYIIIDCPPALGMLTVNALTAANTVLVPIQCEFFALDGLSQLVYTIELIRKNLNRLLTIEGVVFTMFDSRTNLSVQVVE-NVRDNL-NQHIYNT--VIPRNVRLAEAPSYG-MPIIEYDPRSAGAEHYMMLADEVI 250
>gi|16801982|ref|NP_472250.1| partition protein, ParA-like protein [Listeria innocua Clip11262] >gi|16804828|ref|NP_466313.1| partition protein, ParA-like protein [Listeria monocytogenes EGD-e] >gi|46908978|ref|YP_015367.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes str. 4b F2365] >gi|47095598|ref|ZP_00233206.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes str. 1/2a F6854] >gi|153168972|ref|ZP_01928711.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes FSL N1-017] >gi|153180972|ref|ZP_01933939.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes F6900] >gi|153184287|ref|ZP_01935046.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes J0161] >gi|153192578|ref|ZP_01939538.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes J2818] >gi|153197372|ref|ZP_01941622.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes 10403S] >gi|153204428|ref|ZP_01945225.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes HPB2262] >gi|168266991|ref|ZP_02688956.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes FSL J2-071] >gi|16412291|emb|CAD01004.1| Partition protein, ParA homolog [Listeria monocytogenes] >gi|16415464|emb|CAC98148.1| Partition protein, ParA homolog [Listeria innocua] >gi|46882251|gb|AAT05544.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes str. 4b F2365] >gi|47016028|gb|EAL06953.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes str. 1/2a F6854] >gi|126942790|gb|EBA20524.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes J0161] >gi|127633091|gb|EBA22509.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes 10403S] >gi|127763615|gb|EBA24449.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes J2818] >gi|133725920|gb|EBA27618.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes FSL N1-017] >gi|133731490|gb|EBA33188.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes F6900] >gi|133734208|gb|EBA35906.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes HPB2262] (253 aa)
Score = 267, Expect = 9.0e-22, Identities = 77/251 (30%), Positives = 136/251 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT S NL++SL+  GKKV++VD+D QGN  +  G    ++E  I D L      +D+L K   +NL+++P   +L   +  L      +  LK  I+ + + YDYVIID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N +++I  +  T ++ R  +   +IE+ +K   + +   V +  I    + + A  + + PI++   KSK  + Y  L KE++ +
  S:     5 IALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIYDVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAIDSIRDDYDYVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEGVLLTMLDARTNLGIQVIEE-VKKYFQNK---VFNTIIPRNVRLSEAPSHGK-PILLYDAKSKGAEVYLELAKEVVAH 252
>gi|153176097|ref|ZP_01931356.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes FSL N3-165] >gi|133728810|gb|EBA30508.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes FSL N3-165] (253 aa)
Score = 267, Expect = 1.0e-21, Identities = 77/251 (30%), Positives = 136/251 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT S NL++SL+  GKKV++VD+D QGN  +  G    ++E  I D L      +D+L K   +NL+++P   +L   +  L      +  LK  I+ + + YDYVIID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N +++I  +  T ++ R  +   +IE+ +K   + +   V +  I    + + A  + + PI++   KSK  + Y  L KE++ +
  S:     5 IALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIYDVLVDDIAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAIDSIRDDYDYVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEGVLLTMLDARTNLGIQVIEE-VKKYFQNK---VFNTIIPRNVRLSEAPSHGK-PILLYDAKSKGAEVYLELAKEVVAH 252
>gi|116874150|ref|YP_850931.1| sporulation initiation inhibitor protein SOJ [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116743028|emb|CAK22152.1| soj [Listeria welshimeri serovar 6b str. SLCC5334] (253 aa)
Score = 267, Expect = 1.1e-21, Identities = 77/251 (30%), Positives = 136/251 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT S NL++SL+  GKKV++VD+D QGN  +  G    ++E  I D L      +D+L K   +NL+++P   +L   +  L      +  LK  I+ + + YDYVIID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N +++I  +  T ++ R  +   +IE+ +K   + +   V +  I    + + A  + + PI++   KSK  + Y  L KE++ +
  S:     5 IALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIYDVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAIDSIRDDYDYVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLEIEGVLLTMLDARTNLGIQVIEE-VKKYFQNK---VFNTIIPRNVRLSEAPSHGK-PILLYDAKSKGAEVYLELAKEVVAH 252
>gi|163791210|ref|ZP_02185627.1| ATPase, ParA family protein [Carnobacterium sp. AT7] >gi|159873541|gb|EDP67628.1| ATPase, ParA family protein [Carnobacterium sp. AT7] (253 aa)
Score = 266, Expect = 1.2e-21, Identities = 60/196 (30%), Positives = 109/196 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK 198
           I V N KGGV KTT + NL A L+  GKK+++VD+D QGN  +  G +  D+E  I D L  +    ++++  + ENL ++P   +L   +  L  +   +S LK  + K+ + YDY++ID PP++  +     +  D  L+P + + YA  GL +++N  +  ++  N  +KI  +  T ++ R  +  +++++  K
  S:     5 ISVANQKGGVGKTTTTVNLGACLAYFGKKILLVDIDAQGNATSGLGVRKSDVEKDIYDILVNETLVTEVVLPSSRENLWVVPATIQLAGAEIELTSQMARESRLKQALEKVRDDYDYILIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELKIEGVLLTMLDARTNLGYEVVDEVKK 202
>gi|9968459|emb|CAC06097.1| ParA protein [Listeria monocytogenes] (250 aa)
Score = 266, Expect = 1.3e-21, Identities = 77/251 (30%), Positives = 136/251 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT S NL++SL+  GKKV++VD+D QGN  +  G    ++E  I D L      +D+L K   +NL+++P   +L   +  L      +  LK  I+ + + YDYVIID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N +++I  +  T ++ R  +   +IE+ +K   + +   V +  I    + + A  + + PI++   KSK  + Y  L KE++ +
  S:     2 IALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIYDVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAIDSIRDDYDYVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEGVLLTMLDARTNLGIQVIEE-VKKYFQNK---VFNTIIPWNVRLSEAPSHGK-PILLYDAKSKGAEVYLELAKEVVAH 249
>gi|28872707|ref|NP_795326.1| ParA family protein [Pseudomonas syringae pv. tomato str. DC3000] >gi|28855963|gb|AAO59021.1| ParA family protein [Pseudomonas syringae pv. tomato str. DC3000] (263 aa)
Score = 265, Expect = 1.5e-21, Identities = 62/192 (32%), Positives = 104/192 (54%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G     LE ++ D L G+C   E +   +     +LP N +L   + +L + Q+ +S L+  +  + E YDY++ID PP++S++    L   D  ++P + + +A  GL  +++  K   E  N  +KI   + T  + R+++ ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLVATKRRVLLIDLDPQGNATMGSGVDKHTLENSVYDLLIGECDLGEAMQFSEHGGYQLLPANRDLTAGEVVLLEMQMKESRLRNALAPIRENYDYILIDCPPSLSMLTLNALVAADGVIIPMQCEYFALEGLSDLVDNIKRIGELLNPQLKIEGLLRTMYDPRLSLINDVSAQ 199
>gi|153854266|ref|ZP_01995565.1| hypothetical protein DORLON_01559 [Dorea longicatena DSM 13814] >gi|149753041|gb|EDM62972.1| hypothetical protein DORLON_01559 [Dorea longicatena DSM 13814] (253 aa)
Score = 265, Expect = 1.7e-21, Identities = 77/250 (30%), Positives = 136/250 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I V N KGGV KTT + NL+A L+  G+KV+ +D+D QGN+ +  G   D++E  I D + G+   +++L K+  ENL ++P + +L+  +  L      +  ++  +  + + YDY+IID PP++S++    ++  D  LVP + + YA  GL ++I+  +  KE+ N  ++I  +  T  + R  +   ++E ++K  L+ Q +Y T   I    +   A  Y  +PI +   KS     Y  L  E++N
  S:     5 IAVANQKGGVGKTTTAINLSACLAEKGQKVLAIDMDPQGNMTSGLGIDKDEVEKNIYDLMIGQAGVDEVLQKEAIENLDVIPTSIDLSAAEIELIGVDDKEFIIRNAVQPIKDDYDYIIIDCPPSLSMLTINAMTTADSVLVPIQCEYYALEGLSQLIHTVELVKERLNPVLEIEGVVFTMYDARTNLSLQVVE-NVKENLQ-QNIYKT--IIPRNIRLAEAPSYG-MPINLYDPKSTGASAYQRLADEVMN 251
>gi|138897063|ref|YP_001127516.1| centromere-like function involved in forespore chromosome partition [Geobacillus thermodenitrificans NG80-2] >gi|196249884|ref|ZP_03148580.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. G11MC16] >gi|134268576|gb|ABO68771.1| Centromere-like function involved in forespore chromosome partition [Geobacillus thermodenitrificans NG80-2] >gi|196210760|gb|EDY05523.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. G11MC16] (253 aa)
Score = 265, Expect = 1.7e-21, Identities = 72/249 (28%), Positives = 134/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL+A L+  GKKV++VD+D QGN  +  G +  D++  I + + G    +D++     ENL+++P   +L   +  L      +  LK  ++ L  +YD++IID PP++ ++    L+  D  L+P + + YA  GL +++N  +  +   N+++++  +  T ++ R  +   +I++    K   + VY T   I    + + A  + + PI++   KS+  + Y  L KE+L
  S:     5 IAIANQKGGVGKTTTAVNLSACLAYLGKKVLLVDVDPQGNATSGIGIEKGDVDECIYNVIIGDMKAKDVIRPTNIENLYVIPATIQLAGAEIELVSVISREIRLKNALDPLKTVYDFIIIDCPPSLGLLTLNALTAADAVLIPVQCEYYALEGLSQLLNTIRLVQRHLNYDLRLEGVLLTMLDARTNLGLQVIQEV--KKYFREKVYET--IIPRNVRLSEAPSHGK-PIILYDVKSRGAEVYLELAKEVL 250
>gi|160940860|ref|ZP_02088201.1| hypothetical protein CLOBOL_05753 [Clostridium bolteae ATCC BAA-613] >gi|158436234|gb|EDP14001.1| hypothetical protein CLOBOL_05753 [Clostridium bolteae ATCC BAA-613] (254 aa)
Score = 263, Expect = 2.5e-21, Identities = 76/252 (30%), Positives = 129/252 (51%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLK-GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           M I + N KGGV KTT + NL   L+ + K+V+ VD DGQ ++  +FGK+P D E +I D LK      E+ +    +NL I+P N  L   +  L  +   +  L   + K++  YDY++ID PP +S++    L+  D  L+P +P   +  GL+++ N   + +E  N  ++I+  I T    RV   N+I+   L+ K    G+      I  T+++   + Y+ + +V    K     EY  + + I++
  S:     8 MIIAISNQKGGVGKTTTTHNLGVELAANNKRVLEVDADGQSSLTISFGKEPFDFEHSICDILKRDPIGIEECIYNIKDNLDIIPSNLFLASMELELTGRTAREQVLARALKKVEANYDYILIDCPPQLSILTLNALAAADKVLIPCQPTYLSYRGLEQLENTINDIRELVNPELEIMGVIATLYKVRVKDQNEIL-GLLQEKYNVIGI------IRETSEAVKGI-YDGLAVVERNPKLPISQEYKKIAEYIMS 253
>gi|126434025|ref|YP_001069716.1| cobyrinic acid a,c-diamide synthase [Mycobacterium sp. JLS] >gi|126233825|gb|ABN97225.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium sp. JLS] (328 aa)
Score = 263, Expect = 2.8e-21, Identities = 58/191 (30%), Positives = 105/191 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A+++  GK+V++VDLD QG++  + G  PD L  ++ + L G+   +  L+   E + +LP N +L   + +L  +   +  LK  + KL   YD V+ID PP++ V+    L+     +VP + +  A  G+ + +    + +   N ++K++ A+PT  ++R T   D++
  S:     8 LAVANQKGGVAKTTTVASLGAAMAESGKRVLLVDLDPQGSLTFSLGHDPDKLPVSVHEVLLGEVEPDAALVDTPEGMTLLPANIDLAGAEAMLLMRAGREHALKRAMAKLTGTYDVVLIDCPPSLGVLTLNGLTAAHEVIVPLQCETLAHRGVGQFLRTVSDVQAITNPDLKMLGALPTLYDSRTTHSRDVL 199
>gi|118462223|ref|YP_883308.1| cobyrinic acid a,c-diamide synthase [Mycobacterium avium 104] >gi|118163510|gb|ABK64407.1| cobyrinic Acid a,c-diamide synthase [Mycobacterium avium 104] (266 aa)
Score = 263, Expect = 3.1e-21, Identities = 57/191 (29%), Positives = 106/191 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++  +GK+V++VDLD QG +  + G  PD L  ++ + L G+      L+   E + +LP N +L   + +L  +   +  LK  + KL + +D VI+D PP++ V+    L+  D  +VP + +  A  G+ + +    + ++  N +++++ A+PT  ++R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVDEGKRVLLVDLDPQGCLTFSLGHDPDKLPVSVHEVLLGEVEPNAALVDTAEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLADRFDVVIVDCPPSLGVLTLNGLTAADEVIVPLQCETLAHRGVGQFLRTVTDVQQITNPDLRLLGALPTLYDSRTTHTRDVL 198
>gi|146309629|ref|YP_001190094.1| chromosome segregation ATPase [Pseudomonas mendocina ymp] >gi|145577830|gb|ABP87362.1| chromosome segregation ATPase [Pseudomonas mendocina ymp] (262 aa)
Score = 263, Expect = 3.1e-21, Identities = 59/192 (30%), Positives = 103/192 (53%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    ++V+++DLD QGN     G     LE +I D L G+C     +   +     +LP N +L   +  L + ++ +S L+  +  + E YDY++ID PP+++++    L   D  ++P + + YA  GL  ++N+ +   +  N  ++I   + T  + R+++ ND+  Q
  S:     6 AIANQKGGVGKTTTCINLAASLVATKRRVLLIDLDPQGNATMGSGVDKHGLEHSIYDVLIGECDLSQAMQFSEHGGYQLLPANRDLTAAEVALLEMKMKESRLRYALAPIRENYDYILIDCPPSLNMLTINALVAADGVIIPMQCEYYALEGLSDLVNSIQRIGQLLNPKLQIEGLLRTMYDPRISLTNDVTAQ 199
>gi|41409412|ref|NP_962248.1| hypothetical protein MAP3314c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41398243|gb|AAS05864.1| hypothetical protein MAP_3314c [Mycobacterium avium subsp. paratuberculosis K-10] (266 aa)
Score = 262, Expect = 3.2e-21, Identities = 57/191 (29%), Positives = 106/191 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++  +GK+V++VDLD QG +  + G  PD L  ++ + L G+      L+   E + +LP N +L   + +L  +   +  LK  + KL + +D VI+D PP++ V+    L+  D  +VP + +  A  G+ + +    + ++  N +++++ A+PT  ++R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVDEGKRVLLVDLDPQGCLTFSLGHDPDKLPVSVHEVLLGEVEPNAALVDTAEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLADRFDVVIVDCPPSLGVLTLNGLTAADEVIVPLQCETLAHRGVGQFLRTVADVQQITNPDLRLLGALPTLYDSRTTHTRDVL 198
>gi|91201966|emb|CAJ75026.1| strongly similar ATPase involved in chromosome partitioning [Candidatus Kuenenia stuttgartiensis] (262 aa)
Score = 262, Expect = 4.1e-21, Identities = 75/249 (30%), Positives = 124/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A LS  GKKV++VDLD QGN+ + FG     LE ++ +    + Y+E+IL      NL + P N  L   + +L  ++     L+  I  +   YDY+++D PP++ ++    L+ V    +P E    A  GL  ++N  +  KE+ NH +++   I  + ++R  + N++ +Q +K +   +      N I       A       PI M   +S    +Y  L KE++
  S:     4 IALTNQKGGVAKTTTTVNLGACLSEMGKKVLLVDLDPQGNMSSWFGLDIHSLEKSMYNVFLQEVYFEEILKDTCVHNLTLAPSNVALAGVERILANEKERDLILRKRIAPVANNYDYILLDCPPSLGLITINALTFVKEVFIPLETKVLALNGLVTLVNTVQIIKERLNHKLEVTGIIACRFDSRTNLSNEVYKQ-VKERFHEK----VFNTIIRENVRLAECPISSKPITMYAPESSGAKDYIALAKEVV 249
>gi|91777101|ref|YP_546857.1| chromosome segregation ATPase [Methylobacillus flagellatus KT] >gi|91711088|gb|ABE51016.1| chromosome segregation ATPase [Methylobacillus flagellatus KT] (262 aa)
Score = 262, Expect = 4.1e-21, Identities = 74/261 (28%), Positives = 126/261 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTEN-LHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN-YVIFGRETSVN 263
           + + N KGGV KTT   NLAASL+   +KV+++DLD QGN     G     ++  I   L G+    D++ +       ++P N EL   +  L  +   ++ LK  + +L + YDYV+ID PPA+++     L+     ++P + + YA  GL  ++N  K+ +   N +++I  +   + T     N + +Q      +  G  V    I    +   A  Y  VP+++    SK    Y  L  EI+N +V+  R+ + N
  S:     4 LAITNQKGGVGKTTTCVNLAASLAATKRKVLVIDLDPQGNATTGCGIDKSKMQHTIYHVLIGEKSLRDVMQRSERGRFDVVPANRELAGAEVELVNEFARETRLKSALAELGDAYDYVLIDCPPALNLTTVNALTAAHAVMIPMQCEYYALEGLSDLVNTIKKVRAHLNPHLEIEGL---LRTLFDNRNTLAQQVSNELAQHFGDKVYRTVIPRNIRLAEAPSYG-VPVLLHDKTSKGAKAYLALAGEIINRHVVSNRQVAAN 262
>gi|145225256|ref|YP_001135934.1| cobyrinic acid a,c-diamide synthase [Mycobacterium gilvum PYR-GCK] >gi|145217742|gb|ABP47146.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium gilvum PYR-GCK] (267 aa)
Score = 261, Expect = 4.2e-21, Identities = 57/191 (29%), Positives = 106/191 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   ++ A++   GKKV++VDLD QG++  + G  PD L  ++ + L G    +  +++  E + +LP N +L   + +L  +   +  LK  ++K+   +D VIID PP++ V+    L+  D  +VP + +  A  G+ + +    + +   N ++K++ A+PT  ++R T   D++
  S:     8 LAVANQKGGVAKTTTVASVGAAMVEQGKKVLLVDLDPQGSLTFSLGHDPDKLPVSVHEVLLGDVEPDVAIVETPEGMSLLPANIDLAGAEAMLLMRAGREHALKRALDKVSAEFDVVIIDCPPSLGVLTLNGLTAADEVVVPLQCETLAHRGVGQFLRTVSDVQAITNPDLKMLGALPTLYDSRTTHSRDVL 199
>gi|89100942|ref|ZP_01173789.1| chromosome partitioning protein; transcriptional regulator [Bacillus sp. NRRL B-14911] >gi|89084351|gb|EAR63505.1| chromosome partitioning protein; transcriptional regulator [Bacillus sp. NRRL B-14911] (253 aa)
Score = 261, Expect = 4.3e-21, Identities = 79/250 (31%), Positives = 136/250 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDI----LIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN  +  G +  D++  I D L      +D+    +IK T  ENL+ +P   +L   +  L      +  LK  + ++ + +DY+IID PP++ ++   +L+  D  L+P + + YA  GL +++N  +  ++  NH++KI  +  T ++ R  +   +IE+    K     VY T   I    + + A  +   PI++   KS+  + Y +L KE+++
  S:     5 IAIANQKGGVGKTTTSVNLGACLAYIGKKVLLVDIDPQGNATSGIGIEKADVDQCIYDVLV-----DDVEALKVIKPTAVENLYAIPATIQLAGAEIELVPTISREVRLKRALEEVKKDFDYIIIDCPPSLGLLTINSLTASDAVLIPVQCEYYALEGLSQLLNTVRLVQKHLNHDLKIEGVLLTMLDARTNLGIQVIEEV--KKYFQDKVYKT--IIPRNVRLSEAPSHGE-PIIIYDAKSRGAEVYLDLAKEVIS 251
>gi|69247497|ref|ZP_00604367.1| Cobyrinic acid a,c-diamide synthase [Enterococcus faecium DO] >gi|68194822|gb|EAN09297.1| Cobyrinic acid a,c-diamide synthase [Enterococcus faecium DO] (255 aa)
Score = 261, Expect = 4.3e-21, Identities = 76/250 (30%), Positives = 130/250 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYW-EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I V N KGGV KTT + NL A L+  GKKV++VD+D QGN  +  G +  D+   I D L  +    E  LI + ENL I+P   +L   +  L      +S LK  + ++   YDY++ID PP++  +   + +  D  L+P + + YA  GL +++N  +  ++  N  ++I  +  T  + R  + N+++E+    K   + VY T   I    + + A  + + PI+    +S+  + Y  L KE+++
  S:     5 ISVANQKGGVGKTTTTVNLGACLASLGKKVLLVDMDAQGNATSGVGIRKPDVTRDIYDVLVNELPIDEATLITEHENLSIVPATLQLAGAEIELTSMMARESRLKGSLAEVSSQYDYILIDCPPSLGHLTINSFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELEIEGVLLTMYDARTNLGNEVVEEV--RKYFREKVYET--IIPRNIRLSEAPSHGK-PIIDYDPRSRGAEVYQALAKEVVS 251
>gi|116334624|ref|YP_796151.1| chromosome partitioning ATPase [Lactobacillus brevis ATCC 367] >gi|116099971|gb|ABJ65120.1| chromosome segregation ATPase [Lactobacillus brevis ATCC 367] (255 aa)
Score = 261, Expect = 4.3e-21, Identities = 74/249 (29%), Positives = 124/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT   NL A+L+  GK+V++VD D QGN  +  G +   +E  I D L  +    E IL  +  +L I+P   +L+  +  L      ++ LK  ++++ + YDY++ID PP++ ++     +  D  L+P + + YA  GL +++N  K  ++  N N+KI  +   +    T     + + +K   + + VY T   I       A      +PI+    KSK  + Y  L KE+L
  S:     5 IALANQKGGVGKTTTGVNLGAALASAGKRVLLVDTDAQGNATSGVGIQKATIEREIYDVLVNETPIKEAILQTEHPDLDIVPATIQLSGAEIELTPMMARETRLKAALDEVRDQYDYILIDCPPSLGLLTINAFTAADSILIPVQSEYYALEGLTQLLNTVKLVQKHFNRNLKIEGVLLTLYDARTNLGKQVNEEVKKYFQNK-VYAT---IIPRNVQLAEAPSHGMPIIDYAPKSKGAEVYSELAKEVL 250
>gi|116493783|ref|YP_805517.1| chromosome partitioning ATPase [Lactobacillus casei ATCC 334] >gi|191637025|ref|YP_001986191.1| Chromosome partitioning ATPase [Lactobacillus casei] >gi|116103933|gb|ABJ69075.1| chromosome segregation ATPase [Lactobacillus casei ATCC 334] >gi|190711327|emb|CAQ65333.1| Chromosome partitioning ATPase [Lactobacillus casei BL23] (255 aa)
Score = 261, Expect = 4.6e-21, Identities = 77/249 (30%), Positives = 127/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL A L+  GKK++IVD D QGN  +  G +   +E  I D L   +   E IL  K +N+ I+P   +L   +  L  +   +  LK+ ++ +++ YDY++ID PP++  +     +  D  L+P + + YA  GL +++N  +  ++  N ++ I  +  T  + R  +   +I++      K  G  V +  I   T+   A  Y  +PIV    KS+  + Y  L KE+L
  S:     5 IAVANQKGGVGKTTTTVNLGACLANLGKKILIVDADAQGNATSGVGVQKAQVEKDIYDVLVNEEPITEAILPTKHKNMSIVPATIQLAGAEIELTSQMAREMRLKLGLHPVEDQYDYILIDCPPSLGQLSINAFTASDSILIPVQSEYYALEGLSQLLNTVRLVQKHFNPSLAIEGVLLTMYDARTNLGAQVIDEV----RKYFGDKVYATVIPRITRLAEAPSYG-LPIVDFDPKSRGSEVYEALAKEVL 250
>gi|118467510|ref|YP_886293.1| cobyrinic acid a,c-diamide synthase [Mycobacterium smegmatis str. MC2 155] >gi|118168797|gb|ABK69693.1| cobyrinic Acid a,c-diamide synthase [Mycobacterium smegmatis str. MC2 155] (265 aa)
Score = 261, Expect = 5.0e-21, Identities = 58/191 (30%), Positives = 105/191 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   ++ A+L+  G++V++VDLD QG +  + G  PD L  ++ + L G       L++  E + +LP N +L   + +L  +   +  LK  + KLD  +D VIID PP++ V+    L+     +VP + +  A  G+ + +    + ++  N ++K++ A+PT  ++R T   D++
  S:     5 LAVANQKGGVAKTTTVASIGAALTEQGRRVLLVDLDPQGCLTFSLGHDPDKLPVSVHEVLLGDVEPSAALVRTDEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLDGDFDVVIIDCPPSLGVLTLNGLTAAHDVIVPLQCETLAHRGVGQFLRTISDVQQITNPDLKLLGALPTLYDSRTTHSRDVL 196
>gi|166032902|ref|ZP_02235731.1| hypothetical protein DORFOR_02623 [Dorea formicigenerans ATCC 27755] >gi|166027259|gb|EDR46016.1| hypothetical protein DORFOR_02623 [Dorea formicigenerans ATCC 27755] (254 aa)
Score = 260, Expect = 5.9e-21, Identities = 79/249 (31%), Positives = 137/249 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT S NLAA L+  GKKV+ VD+D QGN+ +  G   D +E +I + + G+   ++++ K+  ENL I+P + +L+  +  L      +  L+  I+++ + YD+VIID PP++S++    ++  D  +VP + + YA  GL ++I+  +  K++ N  ++I  +  T  + R  +   ++E ++K  L+ Q +Y T   I    +   A  Y  +PI     KS   + Y  L  E++
  S:     5 IAVANQKGGVGKTTTSINLAACLAEKGKKVLAVDMDPQGNLTSGLGVDKDSVEKSIYELIIGEVDIKEVINKEVLENLDIIPTSIDLSAAEIELIGVDDKEYILRNAIDQVKDQYDFVIIDCPPSLSMLTINAMTTADSVIVPIQCEYYALEGLSQLIHTVELVKDRLNSKLEIEGVVFTMYDARTNLSLQVVE-NVKDNLQ-QNIYKT--IIPRNIRLAEAPSYG-LPINKYDPKSTGAESYMRLADEVI 250
>gi|163764990|ref|ZP_02172039.1| ATPase involved in chromosome partitioning-like protein [Bacillus selenitireducens MLS10] >gi|160354528|gb|EDP81192.1| ATPase involved in chromosome partitioning-like protein [Bacillus selenitireducens MLS10] (253 aa)
Score = 260, Expect = 6.8e-21, Identities = 62/196 (31%), Positives = 112/196 (57%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT + NL+A L+ +GKKV+I+D+D QGN  +  G +  D++  I + L      +DI++   TE+L+I+P   +L   +  L      +  LK  I  + + YD++IID PP++ ++   +L+  +  L+P + + YA  GL +++N  +  ++  NH+++I  +  T  + R  +   +IE+  K
  S:     5 IAIANQKGGVGKTTTAVNLSAGLAYEGKKVLIIDIDPQGNTTSGIGIEKGDVDECIYNILVEDSDVKDIILPTNTEHLYIVPSTIQLAGAEIELVPTISREVRLKNAIESIRDEYDFIIIDCPPSLGLLTLNSLTAANSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNHDLEIEGVLLTMFDARTNLGIQVIEEVKK 202
>gi|119867457|ref|YP_937409.1| cobyrinic acid a,c-diamide synthase [Mycobacterium sp. KMS] >gi|119693546|gb|ABL90619.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium sp. KMS] (267 aa)
Score = 259, Expect = 8.0e-21, Identities = 57/191 (29%), Positives = 105/191 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A+++  GK+V++VDLD QG++  + G  PD L  ++ + L G+   +  L+   E + +LP N +L   + +L  +   +  LK  + KL   +D V+ID PP++ V+    L+     +VP + +  A  G+ + +    + +   N ++K++ A+PT  ++R T   D++
  S:     8 LAVANQKGGVAKTTTVASLGAAMAESGKRVLLVDLDPQGSLTFSLGHDPDKLPVSVHEVLLGEVEPDAALVDTPEGMTLLPANIDLAGAEAMLLMRAGREHALKRAMAKLTGTFDVVLIDCPPSLGVLTLNGLTAAHEVIVPLQCETLAHRGVGQFLRTVSDVQAITNPDLKMLGALPTLYDSRTTHSRDVL 199
>gi|89210805|ref|ZP_01189189.1| Cobyrinic acid a,c-diamide synthase [Halothermothrix orenii H 168] >gi|89159546|gb|EAR79210.1| Cobyrinic acid a,c-diamide synthase [Halothermothrix orenii H 168] (249 aa)
Score = 259, Expect = 8.2e-21, Identities = 77/251 (30%), Positives = 128/251 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           + +VN KGGV K+T + NL AS+S  GKKV++VD+D QGN  +       +LE +I D L  +   E+ +I     N HILP N +L   +  L      +S LK +++ + E YDY++ID PP++ ++    L+  D  LVP + + YA  GL ++I      ++  N +++I  +  T  + R  +   +I++ +K   K +   V    I    + + A  + + PI      S     Y NL KE+  +
  S:     1 MAIVNQKGGVGKSTTAVNLGASISELGKKVLLVDIDPQGNATSGVSLDKSNLEKSIYDVLIEEVDIEESIIPTDITNFHILPANIDLAGAEIELVSMMSRESKLKRVLDPVKEKYDYILIDCPPSLGLLTLNALTAADGVLVPIQCEYYALEGLGQLIQTVNLVQKNLNSDLEIEGVLLTMYDARTNLSQQVIDE-VKNYFKNK---VYETIIPRNVRLSEAPSFGK-PITSYDSASTGAKAYRNLAKEVTGH 248
>gi|146297750|ref|YP_001181521.1| cobyrinic acid a,c-diamide synthase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411326|gb|ABP68330.1| chromosome segregation ATPase [Caldicellulosiruptor saccharolyticus DSM 8903] (256 aa)
Score = 259, Expect = 8.4e-21, Identities = 67/196 (34%), Positives = 107/196 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLK 198
           + VVN KGGV KTT   NL+A++S  GKKV+ VD D QGN+ + FG     LE  I D L G    ++++IK K ENL ILP N  L   +  L      +  LK  I  +   YDY+ ID PP++ ++    L+  D  ++P + + YA  GL ++ +     ++  N +++I  +  T  ++R  +  +++E+  K
  S:     5 VAVVNQKGGVGKTTTCVNLSAAISKKGKKVLAVDCDPQGNLTSGFGIDKKSLEKTIYDVLIGSADIKEVIIKDKFENLDILPSNVNLAGSEIELVSVIAREYRLKSAIESVKSEYDYIFIDCPPSLGLLTLNALAASDSVVIPIQCEYYALEGLSQLSSTINLVRKHLNKHLEIDGVVLTMFDSRTNLSLEVVEEVKK 202
>gi|183981367|ref|YP_001849658.1| Soj/ParA-related protein [Mycobacterium marinum M] >gi|183174693|gb|ACC39803.1| Soj/ParA-related protein [Mycobacterium marinum M] (266 aa)
Score = 258, Expect = 1.2e-20, Identities = 57/191 (29%), Positives = 104/191 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++   G++V++VDLD QG +  + G  PD L  ++ + L G+      L+   E + +LP N +L   + +L  +   +  LK  + KL + +D VIID PP++ V+    L+  D  +VP + +  A  G+ + +    + ++  N +++++ A+PT  + R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVDKGRRVLLVDLDPQGCLTFSLGHDPDKLTVSVHEVLLGEVEPSAALVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLSDEFDVVIIDCPPSLGVLTLNGLTAADEVIVPLQCETLAHRGVGQFLRTVSDVQQITNPDLRLLGALPTLYDPRTTHTRDVL 198
>gi|169796153|ref|YP_001713946.1| chromosome partitioning protein [Acinetobacter baumannii AYE] >gi|184157918|ref|YP_001846257.1| ATPase [Acinetobacter baumannii ACICU] >gi|169149080|emb|CAM86957.1| chromosome partitioning protein [Acinetobacter baumannii] >gi|183209512|gb|ACC56910.1| ATPase [Acinetobacter baumannii ACICU] >gi|193077186|gb|ABO11978.2| chromosome partitioning protein [Acinetobacter baumannii ATCC 17978] (260 aa)
Score = 258, Expect = 1.2e-20, Identities = 62/199 (31%), Positives = 112/199 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI---IEQSLKPKL 201
           I + N KGGV KTT + NLAASL++  K+V++VD+D QGN     G + +DL ++I D L G+   E  + K      +L  N EL+  +  + +++  +  LK  +N++ + +DY+I+D  P++S++    L+ VD  ++P + + YA  GL  +       ++  N +++I+ +  T  + R  +  D+   +EQ    KL
  S:     5 IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDIDSQGNATMGSGIQKNDLLYSITDVLLGEVPIETAIQKAEVGYKVLGSNRELSGVELAIAEQEGREFILKNALNEIRDSFDYIIVDCAPSLSLITVNALAAVDGVIIPMQCEYYALEGLADLTQTIDRIQKALNPDLEIIGVLRTMYDARNALTRDVSAELEQYFGKKL 207
>gi|154503061|ref|ZP_02040121.1| hypothetical protein RUMGNA_00883 [Ruminococcus gnavus ATCC 29149] >gi|153796302|gb|EDN78722.1| hypothetical protein RUMGNA_00883 [Ruminococcus gnavus ATCC 29149] (255 aa)
Score = 257, Expect = 1.2e-20, Identities = 78/250 (31%), Positives = 135/250 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL+ASL+  G+KV+ +D+D QGN+ +      D++E  + D + G    E+ + K+  ENL +LP N  L+  +  L      +  +K  + K+ + YDY+IID PPA+S++    ++  +  LVP + + YA  GL ++I+  +  +E+ N  ++I  +  T  + R  +   ++E ++K  L  Q +Y T   I    +   A  Y  +PI +   KS   + Y  L +E++N
  S:     5 IAIANQKGGVGKTTTAINLSASLASLGQKVLALDMDPQGNMTSGLSVNKDEVENTVYDLIIGNIGIEECICKEVYENLDVLPSNVNLSAAEIELIGVDNKEYIIKNEVEKVKDRYDYIIIDCPPALSMLTINAMTTANSVLVPIQCEYYALEGLSQLIHTIELVQERLNPKLEIEGVVFTMYDARTNLSLQVVE-NVKDNL-NQNIYKT--IIPRNVRLAEAPSYG-MPINLYDPKSSGAESYLLLAEEVIN 251
>gi|29377740|ref|NP_816894.1| ParaA family ATPase [Enterococcus faecalis V583] >gi|29345208|gb|AAO82964.1| ATPase, ParA family [Enterococcus faecalis V583] (253 aa)
Score = 257, Expect = 1.3e-20, Identities = 74/249 (29%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL A L+  GKKV+++D+D QGN  +  G    D+   + D L  +     ++   + ENL I+P   +L   +  L      +S LK+ I+++ ++YD+V+ID PP++  +     +  D  L+P + + YA  GL +++N  +  ++  N  +KI  +  T  + R  +  +++E+    K   + VY T   I    + + A  +  +PI+    +SK  + Y  L KE+L
  S:     5 ISVANQKGGVGKTTTTVNLGACLANLGKKVLLIDIDAQGNATSGMGVPKPDVAHDVYDVLVNEEPITSVVQHTSRENLDIVPATIQLAGAEIELTSMMARESRLKLAIDEVRDMYDFVLIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTIRLVQKHFNPELKIEGVLLTMYDARTNLGAEVVEEV--RKYFREKVYDT--IIPRNVRLSEAPSHG-LPIIDYDIRSKGAEVYQALAKEVL 250
>gi|118618017|ref|YP_906349.1| Soj/ParA-related protein [Mycobacterium ulcerans Agy99] >gi|118570127|gb|ABL04878.1| Soj/ParA-related protein [Mycobacterium ulcerans Agy99] (266 aa)
Score = 257, Expect = 1.4e-20, Identities = 57/191 (29%), Positives = 104/191 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A++   G++V++VDLD QG +  + G  PD L  ++ + L G+      L+   E + +LP N +L   + +L  +   +  LK  + KL + +D VIID PP++ V+    L+  D  +VP + +  A  G+ + +    + ++  N +++++ A+PT  + R T   D++
  S:     7 LAVANQKGGVAKTTTVASLGAAMVDKGRRVLLVDLDPQGCLTFSLGHDPDKLTVSVHEVLLGEVEPSAALVTTLEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLSDEFDVVIIDCPPSLGVLTLNGLTAADEVIVPLQCETLAHRGVGQFLRTVSDVQQITNPDLRLLGALPTLYDPRTTHTRDVL 198
>gi|167215423|ref|ZP_02285730.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes FSL R2-503] (209 aa)
Score = 256, Expect = 2.0e-20, Identities = 65/196 (33%), Positives = 110/196 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NL++SL+  GKKV++VD+D QGN  +  G    ++E  I D L      +D+L K   +NL+++P   +L   +  L      +  LK  I+ + + YDYVIID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N +++I  +  T ++ R  +   +IE+  K
  S:     5 IALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIYDVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAIDSIRDDYDYVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEGVLLTMLDARTNLGIQVIEEVEK 202
>gi|69935598|ref|ZP_00630534.1| Cobyrinic acid a,c-diamide synthase [Paracoccus denitrificans PD1222] >gi|119382763|ref|YP_913819.1| cobyrinic acid a,c-diamide synthase [Paracoccus denitrificans PD1222] >gi|119372530|gb|ABL68123.1| Cobyrinic acid a,c-diamide synthase [Paracoccus denitrificans PD1222] (258 aa)
Score = 255, Expect = 2.1e-20, Identities = 70/250 (28%), Positives = 121/250 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG-KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I V N KGGV KTT + NL A+L+  G++V I+DLD QGN     G   ++ E    D L G +   E +      NL ++P N +L   DF L+ +      L+  ++   E +DY++ID PPA+ ++    +   D  LVP + + YA  GL +++   +E ++  N +++I  +   ++      N++ +Q       T    V    I    + + A  +  +P++     SK    Y +L +E L+
  S:     7 IAVANQKGGVGKTTTAINLGAALAEQGQRVAIIDLDPQGNASTGLGVPLEERELTSYDLLTGERALQETLRDTAIANLRVVPSNRDLASADFELSNRPGRTQLLRRKLSAPSE-FDYILIDCPPALGLLTVNAMVASDSVLVPLQAEFYALEGLSQLLMTVREVRQTANPDLRIEGVLLTMSDN---RNNLSQQVEADARSTLSGLVYRTVIPRNVRLSEAPSHA-MPVLQYDPNSKGSHAYRDLAREFLS 252
>gi|125974862|ref|YP_001038772.1| chromosome segregation ATPase [Clostridium thermocellum ATCC 27405] >gi|196251628|ref|ZP_03150296.1| Cobyrinic acid ac-diamide synthase [Clostridium thermocellum DSM 4150] >gi|125715087|gb|ABN53579.1| chromosome segregation ATPase [Clostridium thermocellum ATCC 27405] >gi|196199005|gb|EDX93834.1| Cobyrinic acid ac-diamide synthase [Clostridium thermocellum DSM 4150] (258 aa)
Score = 255, Expect = 2.2e-20, Identities = 76/251 (30%), Positives = 130/251 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I V N KGGV KTT + NL++ L+  GKKV+I+D+D QGN  +  G     +  +I D L  +    D+L+    ENL + P N EL   +  L      ++ LK  +  +   YD+++ID PP++ ++   +L+  D  LVP + + YA  GL +++   K  ++  N N+ +  +  T  + R  +   ++E+ +K   K + VY T   I    + + A  +  +PI++   KSK  + Y  L  E++ Y
  S:     5 IAVANQKGGVGKTTTAVNLSSCLAYKGKKVLILDIDPQGNTTSGLGIDKKKINKSIYDILINEADINDVLVDTPVENLKLCPSNIELAGAEVELVSSISRETRLKSALEPVRNDYDFILIDCPPSLGLLTLNSLTAADKILVPIQCEYYALEGLSQLMETVKLVQKHLNKNLDVEGVVLTMFDARTNLSIQVVEE-VKKYFKNK-VYRT--IIPRNVRLSEAPSFG-LPIILYDPKSKGAECYLELADEVIEY 252
>gi|158321886|ref|YP_001514393.1| cobyrinic acid ac-diamide synthase [Alkaliphilus oremlandii OhILAs] >gi|158142085|gb|ABW20397.1| Cobyrinic acid ac-diamide synthase [Alkaliphilus oremlandii OhILAs] (257 aa)
Score = 255, Expect = 2.5e-20, Identities = 73/250 (29%), Positives = 135/250 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKV-NTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL+A ++  GKKV ++D+D QGN  +  G   + LE  I D + G+    E IL  + ENLH++P + +L   +  L   +  +  L+  I+++   YDY+ ID PP++ ++   +L+ VD  L+P + + YA  G+ +++N  +  K+  N +++I  +   + + R  +   ++++ +K   + + VY T   I    +   A  + + PI+    +SK  + Y  L +E L+
  S:     5 IAIFNQKGGVGKTTTNVNLSACIAEKGKKVCVIDIDPQGNTTSGLGVDKNTLENTIYDIIIGETNIKEAILPTEYENLHLIPSSVQLAGAEIELTGMKNREIKLRKAIDEIRADYDYIFIDCPPSLGLLTINSLAAVDSVLIPIQCEYYALEGVSQLMNTIQLIKKNLNPSLEIQGVVLSMFDGRTNLSIQVVDE-VKNYFRGK-VYTT--IIPRNVRLAEAPSFGQ-PIIYYDARSKGAEAYTELAEEFLD 251
>gi|167462787|ref|ZP_02327876.1| Soj [Paenibacillus larvae subsp. larvae BRL-230010] (257 aa)
Score = 254, Expect = 3.1e-20, Identities = 76/250 (30%), Positives = 127/250 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN  +  G    D+E+ I D L    + +D  ++ K  NL I+P   +L   +  L      +  LK  +  L   YDY++ID PP++ ++   +L+  D  ++P + + YA  GL +++N  +  ++  N  ++I  +  T  + R  +   +IE+    K   Q VY T   I    + + A  + +  I+    +SK    Y  L KE+++
  S:     5 IAITNQKGGVGKTTTSVNLGACLASLGKKVLLVDIDPQGNTTSGIGINKADVEYCIYDVLINDIHPKDAAVETKIPNLSIIPATIQLAGAEIELVPTISREVRLKKSLQLLKHNYDYILIDCPPSLGILTVNSLTAADSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTTLQIEGVLLTMFDARTNLGIQVIEEV--KKYFQQKVYQT--IIPRNVRLSEAPSHGQ-SIITYDPRSKGAGVYLELAKEVIS 251
>gi|56422025|ref|YP_149343.1| sporulation initiation inhibitor protein [Geobacillus kaustophilus HTA426] >gi|56381867|dbj|BAD77775.1| sporulation initiation inhibitor protein [Geobacillus kaustophilus HTA426] (253 aa)
Score = 254, Expect = 3.3e-20, Identities = 73/249 (29%), Positives = 134/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL+A L+  GKKV++VD D QGN  +  G +  D++  I + + G    +D+ I+ T  ENL+++P   +L   +  L      +  L+  I  L + YD++IID PP++ ++    L+  +  L+P + + YA  GL +++N  +  +   N+++++  +  T ++ R  +   +I++    K   + VY T   I    + + A  + + PI++   KS+  + Y  L KE+L
  S:     5 IAIANQKGGVGKTTTAVNLSACLAHLGKKVLLVDADPQGNATSGIGIERGDVDECIYNVIIGDMKAKDV-IRPTDIENLYVIPATIQLAGAEIELVSVISREIRLRNAIEPLKDKYDFIIIDCPPSLGLLTLNALTAANSVLIPVQCEYYALEGLSQLLNTIRLVQRHLNYDLRLEGVLLTMLDARTNLGLQVIQEV--KKYFREKVYQT--IIPRNVRLSEAPSHGK-PIILYDVKSRGAEVYLELAKEVL 250
>gi|194335118|ref|YP_002019684.1| Cobyrinic acid ac-diamide synthase [Prosthecochloris aestuarii DSM 271] >gi|194312936|gb|ACF47330.1| Cobyrinic acid ac-diamide synthase [Prosthecochloris aestuarii DSM 271] (261 aa)
Score = 254, Expect = 3.4e-20, Identities = 80/249 (32%), Positives = 137/249 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDG-KKVIIVDLDGQGNVI-ATFGKKPDDLEFAIMDFLK-----GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKN-NHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGG  KTT + NL A+L+ D  + V+++D+D QG+       + PDDL F + + L+     GK    D++I    N+ + P N EL+  +  +  +   +++LK  I+++   YDY+IID PP + ++    L   D  +VP + + YA   LK++    ++ + K  N N+ I+ I  T  + R+TI   +++ + K   K   V+ T+  I +++K   A G +R PI+     SK  ++Y  L KEIL
  S:     5 IAIANQKGGSGKTTTAVNLGAALAHDKTRNVLVIDMDPQGHTTDHLIEQDPDDLNFTLYNVLRDFDSIGKSI-ADLVISTDFNVDLWPANIELSGLEAAIANEAGREAHLKAAISRVRSKYDYIIIDVPPQLGLLSLNALMAADKVIVPIQTEYYAYKALKQLFEIIRKIRNKGLNDNLDIMGILLTMYDARLTICKQVVDMARKNFDKK--VFKTT--IRTSSKLKEAAGSKR-PIIYYDSGSKGSEDYIALAKEIL 256
>gi|149182301|ref|ZP_01860780.1| chromosome partitioning protein; transcriptional regulator [Bacillus sp. SG-1] >gi|148849993|gb|EDL64164.1| chromosome partitioning protein; transcriptional regulator [Bacillus sp. SG-1] (253 aa)
Score = 253, Expect = 4.1e-20, Identities = 74/248 (29%), Positives = 128/248 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN  +  G +  D++  I D L      +D++   T E L+ +P    L   +  L      +  LK  + K+ + YD++IID PP++ ++    L+  D  ++P + + YA  GL ++++  +  ++  NH++ I  +  T ++ R  +   +IE+    K     VY T   I    + + A  +   PI++   KS+  + Y +L KE+
  S:     5 IAITNQKGGVGKTTTSVNLGACLAYIGKKVLLVDIDPQGNATSGVGIEKGDVQECIYDVLVDDAEVKDLVKPTTVERLYAVPATISLAGAEIELVPTISREVRLKRALEKVKDEYDFIIIDCPPSLGLLTINALTASDAVIIPVQCEYYALEGLSQLLSTVRLVQKHLNHDLMIDGVLLTMLDARTNLGIQVIEEV--KKYFQDKVYRT--IIPRNIRLSEAPSHGE-PIIIYDAKSRGAEVYLDLAKEV 249
>gi|169633363|ref|YP_001707099.1| chromosome partitioning protein [Acinetobacter baumannii SDF] >gi|169152155|emb|CAP01057.1| chromosome partitioning protein [Acinetobacter baumannii] (260 aa)
Score = 253, Expect = 4.3e-20, Identities = 61/199 (30%), Positives = 112/199 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI---IEQSLKPKL 201
           I + N KGGV KTT + NLAASL++  K+V++VD+D QGN     G + +DL ++I D L G+   E  + K      +L  N EL+  +  + +++  +  LK  ++++ + +DY+I+D  P++S++    L+ VD  ++P + + YA  GL  +       ++  N +++I+ +  T  + R  +  D+   +EQ    KL
  S:     5 IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDIDSQGNATMGSGIQKNDLLYSITDVLLGEVPIETAIQKAEVGYKVLGSNRELSGVELAIAEQEGREFILKNALSEIRDSFDYIIVDCAPSLSLITVNALAAVDGVIIPMQCEYYALEGLADLTQTIDRIQKALNPDLEIIGVLRTMYDVRNALTRDVSAELEQYFGKKL 207
>gi|157694470|ref|YP_001488932.1| chromosome partitioning protein transcriptional regulator [Bacillus pumilus SAFR-032] >gi|157683228|gb|ABV64372.1| chromosome partitioning protein transcriptional regulator [Bacillus pumilus SAFR-032] (266 aa)
Score = 252, Expect = 4.6e-20, Identities = 74/248 (29%), Positives = 129/248 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I + N KGGV KTT S NL+A L+  GK+V++VD+D QGN  +  G +  D+E  + D L       D++   + ENL ++P   +L   +  L      +  LK  +  + + YDY+IID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N ++ I  +  T ++ R  +   +IE+    K     VY T   I    + + A  + + PI++   +S+  D Y +L KE+
  S:    18 IAITNQKGGVGKTTTSVNLSACLAYIGKRVLLVDIDPQGNATSGIGIEKADVEKCVYDILVDDADVLDVIKTTEVENLDVIPATIQLAGAEIELVPTISREVRLKRALESVKQNYDYMIIDCPPSLGLLTINALTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEGVLLTMLDARTNLGIQVIEEV--KKYFRDKVYQT--VIPRNVRLSEAPSHGK-PIILYDPRSRGADVYLDLAKEV 262
>gi|134301150|ref|YP_001114646.1| cobyrinic acid a,c-diamide synthase [Desulfotomaculum reducens MI-1] >gi|134053850|gb|ABO51821.1| chromosome segregation ATPase [Desulfotomaculum reducens MI-1] (253 aa)
Score = 252, Expect = 4.7e-20, Identities = 73/249 (29%), Positives = 127/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I   N KGGV KTT + NL ASLSL G+ V++VD+D QGN  +  G     LE  + D L      ++ +I    + L +LP   +L   +  +      +  LK  ++ L E Y+Y+IID PP++ ++    L+  D  L+P + + YA  G+ +++N  +  K+  N +++I  +  T  + R+ +   ++++      K  G  V  N I    + + A  +  +P+V+   KSK  + Y  L KE++
  S:     5 IATANQKGGVAKTTTAVNLGASLSLMGQPVLLVDIDPQGNASSGLGIDKTRLERCVYDVLINDMTAKEAIIHTGIKYLDVLPSTIQLAGAEVEMVSLMAREQILKRALSPLKEKYNYIIIDCPPSLGLLTLNALAASDSLLIPIQCEFYALEGVGQLMNTVQLVKKHLNPSLEIEGVLLTMFDARLNLSIQVVDEV----KKVFGTKVFQNIIPRNVRLSEAPSHG-MPVVLYDPKSKGSEAYQELAKEVM 250
>gi|160893426|ref|ZP_02074211.1| hypothetical protein CLOL250_00976 [Clostridium sp. L2-50] >gi|156864821|gb|EDO58252.1| hypothetical protein CLOL250_00976 [Clostridium sp. L2-50] (259 aa)
Score = 252, Expect = 4.7e-20, Identities = 77/249 (30%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI----KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAA L+  GKKV+ VD+D QGN+ +  G   + LE+++ D L G C   + +I       + L++LP + EL   +      +  Q  LK  +  +   +DY+IID PPA+ ++    L+  +  LVP + + +A  GL ++I      +++ N  + I  I  T  ++R  +   ++E ++K  L  Q +Y T   I    +   A  Y  +PI+    KS   + Y  L  E++
  S:     5 IAIANQKGGVGKTTTAINLAACLAKKGKKVLAVDMDPQGNMTSGLGIDKNALEYSVYDMLNGDCNLGECMIIDAYPDIKGLNLLPASRELAGAEVEFVTVEDPQYVLKNHLKSVRRKFDYIIIDCPPALGMLTVNALTAANTVLVPIQCEFFALDGLSQLIYTVNLIRKQLNRLLTIEGIVFTMYDSRTNLSMQVVE-NVKENL-NQHIYNT--MIPRNVRLAEAPSYG-MPIIEYDPKSAGAEHYMMLADEVI 253
>gi|71909714|ref|YP_287301.1| chromosome segregation ATPase [Dechloromonas aromatica RCB] >gi|71849335|gb|AAZ48831.1| chromosome segregation ATPase [Dechloromonas aromatica RCB] (253 aa)
Score = 252, Expect = 5.0e-20, Identities = 72/252 (28%), Positives = 123/252 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQ-GVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           + + N KGGV KTT + NLAASL+ +GK+V+++D+D QGN     G    +    +   L G     D+ IK      ILP N EL   +  + + +  +  LK  + +    YD+V+ID PPA++++    L   D  L+P + + YA  GL  ++   ++ ++  N  ++I   + T  N++ T     + Q +  +L++  G  V    +    +   A  Y + P++     SK    Y  L +EIL  V
  S:     4 LAITNQKGGVGKTTTAVNLAASLAAEGKRVLLIDMDPQGNATTGSGITKKEALPTVYQLLIGAATLIDVCIKTDFYFDILPANRELAGAEVEMIELEQREYRLKKALAQNHAEYDFVLIDCPPALNMLTVNALVAADSVLIPMQCEYYALEGLSDLVETLRKVRQHLNSRLEIEGLLRTMYNSQST-----LTQQVSSELESHFGEKVYKTIVPRNVRLAEAPSYGK-PVIAFDKNSKGAQAYSALAQEILERV 251
>gi|147679249|ref|YP_001213464.1| ATPase [Pelotomaculum thermopropionicum SI] >gi|146275346|dbj|BAF61095.1| ATPase [Pelotomaculum thermopropionicum SI] (256 aa)
Score = 252, Expect = 6.0e-20, Identities = 72/249 (28%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A LSL GKKV++VD D QGN     G   + LE  + D  ++G    E I+    ENL ++P   EL   +  L      +  LK  ++ + + Y+Y++ID PP++ ++    L+  D  L+P + + YA  GL +++N  K  +++ N ++ +  +  T  + R  +   ++E+ +K   + +   V    I    + + A  Y + P+++   +S+  + Y  L KE++
  S:     8 IAIANQKGGVAKTTTAVNLGAWLSLMGKKVLLVDTDSQGNATTGVGVDKNSLEKCLYDAIIEGVPLREIIVQSAVENLDLVPATIELAGAEIELVGVPEREKILKAALSGVKDDYEYILIDCPPSLGLMTINALAAADSLLIPIQCEFYALEGLSQLLNTFKMVQQRLNSSLVLEGVLLTMFDGRTNLSIQVVEE-VKKHFRDK---VFKAIIPRNVRLSEAPSYGK-PVMVYDRRSRGAEVYRELAKEVM 253
>gi|172040771|ref|YP_001800485.1| putative partitioning protein [Corynebacterium urealyticum DSM 7109] >gi|171852075|emb|CAQ05051.1| putative partitioning protein [Corynebacterium urealyticum DSM 7109] (295 aa)
Score = 251, Expect = 6.2e-20, Identities = 69/252 (27%), Positives = 131/252 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL--KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + N+ A+L+  G+KV++VDLD QG + A  G   ++L+  + + L       ++ IL    ENL ++P N +L+  +  L  +   +  L   +  + + YD++IID  P++ ++    LS  D  ++P E + ++  GL  +++  ++ +++ N  ++++ I   +  R T+H   + + L   ++  G  V  + I+ T +   T+  G    PI     KS    +Y NL  E++  V
  S:    42 IAMCNQKGGVGKTTSTINMGAALAEFGRKVLLVDLDPQGALSAGLGISHEELDVTVHNLLVDNSSSIFDAILPSGVENLDLVPANIDLSAAEIQLVNEVGREQALARALRPVMKDYDFIIIDCQPSLGLLTVNALSCADSVMIPVESEYFSLRGLALLMDTVEKVRDRLNFKLEVLGILVTMFDRRTLHAREVMERL---VEAFGDKVFDSVITRTVRFPETSVAGE---PISTWAPKSSGAIQYRNLAAEVIQRV 291
>gi|182626705|ref|ZP_02954447.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|182627041|ref|ZP_02954768.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|182627069|ref|ZP_02954792.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|182627262|ref|ZP_02954958.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|177907330|gb|EDT70044.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|177907566|gb|EDT70210.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|177907605|gb|EDT70238.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|177907979|gb|EDT70565.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] (251 aa)
Score = 251, Expect = 6.3e-20, Identities = 82/249 (32%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + + N KGGV KTT + N  A LS +GKKV++VDLD Q N+   F K     + +I D L  K      +IKKT  EN+ ILP N  L + +   LL+  +  Q+ L   +  +   YDY +ID PPA++++    L      LVP + D++A  GL+ ++++ +E K++ N ++        +++  T+ N +I+Q LK  L   G  V +  I    K   +  +E  P+V S  K++    Y  L  EI 
  S:     5 LSIFNIKGGVAKTTSTANFGACLSQNGKKVLLVDLDPQSNLTKLF-KAYSMEDLSIADVLLNKNLDLHKVIKKTDFENIDILPANVNLAFAERKILLDVSRSQQNRLSKALESIKNEYDYCLIDCPPALNMITVNALCSSHDVLVPIKIDKFALDGLEYLLDSIEEIKDEFNPSLNFKGCFITMDSATTV-NKVIKQELKNIL---GDKVFNTTIKQNVKVVEST-FEECPVVFSSKKARASLNYIELSNEIF 251
>gi|78049574|ref|YP_365749.1| chromosome partitioning protein [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78038004|emb|CAJ25749.1| chromosome partitioning protein [Xanthomonas campestris pv. vesicatoria str. 85-10] (265 aa)
Score = 251, Expect = 6.6e-20, Identities = 59/190 (31%), Positives = 97/190 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L+   K+V++VDLD QGN     G    D+  +  D L G+     I +   E   +LPGN +L   +  L  +   +  LK  +  + + YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTCDLLLGENTAAQIRVAAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALAPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPTLEIEGV---LRTMFDIRNNL 191
>gi|88797176|ref|ZP_01112766.1| ParA family protein [Reinekea sp. MED297] >gi|88780045|gb|EAR11230.1| ParA family protein [Reinekea sp. MED297] (271 aa)
Score = 251, Expect = 6.7e-20, Identities = 59/193 (30%), Positives = 103/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT + NL ASL    ++V++VD+D QGN     G   ++LE +  D L GKC+  D +I   +    +LP N +L   +  L   ++ +  L+  + ++   YDY+ ID PP+++++    L+      +P + + YA  GL  ++    E ++  N  ++I  I  T  + R T+ ND+ +Q
  S:     5 LAITNQKGGVGKTTTAINLPASLVAMKRRVLVVDMDPQGNATMGSGIDKNELEQSAYDVLTGKCHCTDAIIPAPQAGYDLLPANGDLTAAEVELLDMKMKEHRLQYALAEIKHKYDYIFIDCPPSLNMLTVNALTAAHHIFIPMQCEYYALEGLAALLETITEIQKVVNPALEIGGILRTMYDPRNTLTNDVSDQ 199
>gi|86131723|ref|ZP_01050320.1| putative ParA chromosome partitioning protein [Cellulophaga sp. MED134] >gi|85817545|gb|EAQ38719.1| putative ParA chromosome partitioning protein [Dokdonia donghaensis MED134] (255 aa)
Score = 251, Expect = 7.4e-20, Identities = 60/196 (30%), Positives = 110/196 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +E      L+     ED ++K +  NL ++P + +L   +  L  K+  +  LK  I+ L ++YDY++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N ++ I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVESVEVGTYQLLEHTNKAEDAIVKTSSPNLDLIPAHIDLVAIEIELVDKEAREYMLKKAISHLKDVYDYILIDCAPSLGLLTLNALTSADSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNKDLDIEGLLLTMFDSRLRLSNQVVEEVQK 202
>gi|166713820|ref|ZP_02245027.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzicola BLS256] (265 aa)
Score = 251, Expect = 7.8e-20, Identities = 59/190 (31%), Positives = 97/190 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L+   K+V++VDLD QGN     G    D+  +  D L G+     I +   E   +LPGN +L   +  L  +   +  LK  +  + + YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLARVPKRVLLVDLDSQGNATMGSGIDKRDVAASTCDLLLGENTAAQIRVTAPEGFDLLPGNIDLTAAEIQLMHQGEREQRLKRALTPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEGV---LRTMFDIRNNL 191
>gi|152977679|ref|YP_001377196.1| cobyrinic acid ac-diamide synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026431|gb|ABS24201.1| Cobyrinic acid ac-diamide synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] (253 aa)
Score = 250, Expect = 8.2e-20, Identities = 72/249 (28%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN     G +  +L+  I + L      ++++ K  TENL +LP   +L   +  L      +  L+  +  +   YDYVIID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N N+ I  +  T ++ R  +   +I++ +K   + +   V  + I    + + A  + + PI+    KS+  + Y +L +E++
  S:     5 IAIANQKGGVGKTTTSVNLGAGLAQMGKKVLLVDIDAQGNATTGVGIEKSELDQCIYNVLVEDTAVQEVIKKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQPVRTEYDYVIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQGVLLTMLDARTNLGIQVIDE-VKKYFRDK---VYRSIIPRNVRLSEAPSHGK-PIMQYDAKSRGAEVYIDLAEEVI 250
>gi|21233272|ref|NP_639189.1| chromosome partitioning protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66770230|ref|YP_244992.1| chromosome partitioning protein [Xanthomonas campestris pv. campestris str. 8004] >gi|21115109|gb|AAM43080.1| chromosome partitioning protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575562|gb|AAY50972.1| chromosome partitioning protein [Xanthomonas campestris pv. campestris str. 8004] (265 aa)
Score = 250, Expect = 8.5e-20, Identities = 63/190 (33%), Positives = 100/190 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFA--IMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L+   K+V++VDLD QGN  AT G   D  E A    D L G+    +I +   E   +LPGN +L   +  L  +   +  LK  +  + + YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGN--ATMGSGIDKREVAASTCDLLLGENTAAEIRVTAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALAPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEGV---LRTMFDIRNNL 191
>gi|188993428|ref|YP_001905438.1| chromosome partitioning protein [Xanthomonas campestris pv. campestris] >gi|167735188|emb|CAP53400.1| chromosome partitioning protein [Xanthomonas campestris pv. campestris] (265 aa)
Score = 250, Expect = 9.1e-20, Identities = 63/190 (33%), Positives = 100/190 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFA--IMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L+   K+V++VDLD QGN  AT G   D  E A    D L G+    +I +   E   +LPGN +L   +  L  +   +  LK  +  + + YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGN--ATMGSGIDKREVAASTCDLLLGENTAAEIRVTAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALAPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEGV---LRTMFDIRNNL 191
>gi|16081149|ref|NP_391977.1| chromosome partitioning protein; transcriptional regulator [Bacillus subtilis subsp. subtilis str. 168] >gi|586852|sp|P37522|SOJ_BACSU Sporulation initiation inhibitor protein soj >gi|467381|dbj|BAA05227.1| regulation of Spo0J and Orf283 (probable) [Bacillus subtilis] >gi|580906|emb|CAA44408.1| unnamed protein product [Bacillus subtilis] >gi|2636644|emb|CAB16134.1| chromosome partitioning protein; transcriptional regulator [Bacillus subtilis subsp. subtilis str. 168] (253 aa)
Score = 250, Expect = 9.2e-20, Identities = 74/248 (29%), Positives = 128/248 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I + N KGGV KTT S NL A L+  GK+V++VD+D QGN  +  G +  D+E  + D L       DI+   T ENL ++P   +L   +  L      +  LK  +  + + YDY+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N ++ I  +  T ++ R  +   +IE+    K     VY T   I    + + A  + + PI++   +S+  + Y +L KE+
  S:     5 IAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVEQCVYDILVDDADVIDIIKATTVENLDVIPATIQLAGAEIELVPTISREVRLKRALEAVKQNYDYIIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEGVLLTMLDARTNLGIQVIEEV--KKYFRDKVYKT--VIPRNVRLSEAPSHGK-PIILYDPRSRGAEVYLDLAKEV 249
>gi|21244624|ref|NP_644206.1| chromosome partitioning protein [Xanthomonas axonopodis pv. citri str. 306] >gi|21110307|gb|AAM38742.1| chromosome partitioning protein [Xanthomonas axonopodis pv. citri str. 306] (265 aa)
Score = 250, Expect = 9.3e-20, Identities = 59/190 (31%), Positives = 97/190 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L+   K+V++VDLD QGN     G    D+  +  D L G+     I +   E   +LPGN +L   +  L  +   +  LK  +  + + YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTCDLLLGENSAAQIRVTAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALAPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEGV---LRTMFDIRNNL 191
>gi|166033002|ref|ZP_02235831.1| hypothetical protein DORFOR_02723 [Dorea formicigenerans ATCC 27755] >gi|166027359|gb|EDR46116.1| hypothetical protein DORFOR_02723 [Dorea formicigenerans ATCC 27755] (261 aa)
Score = 249, Expect = 1.0e-19, Identities = 78/249 (31%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAI----MDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I VVN KGGV KTT + N+   L+ +GKKV+++D D QG++ A+ G ++PDDL   +    MD + + +   ED ++   EN+ +LP N EL+  +  +      +  +K  I+ +   YDY++ID  P++ ++    L   D  L+P +       GL+++I      K++ N  + I  I  T V+ R     DI  + +     +Q + V  N I  + K+ A    E   I M   K K  + Y NL +E+L
  S:     5 ISVVNQKGGVGKTTTTVNVGIGLAREGKKVLLIDADPQGSLTASLGYEEPDDLRITLATIMMDVINEEEISLEDGILHHQENVDLLPANIELSALEVTMGNVMSREMIMKEYIDAIRGRYDYILIDCMPSLGMMTINALVSSDSVLIPVQAAYLPVKGLQQLIKTILTVKKRLNRKLAIEGILLTMVDFRTNYARDIASR-VHTTYGSQ-IEVFENVIPMSVKA-AETSAEGKSIYMHCPKGKVAEAYKNLTQEVL 257
>gi|150019903|ref|YP_001312157.1| cobyrinic acid a,c-diamide synthase [Clostridium beijerinckii NCIMB 8052] >gi|149906368|gb|ABR37201.1| Cobyrinic acid a,c-diamide synthase [Clostridium beijerinckii NCIMB 8052] (253 aa)
Score = 249, Expect = 1.0e-19, Identities = 73/249 (29%), Positives = 133/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK--TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A L+++G +V+ +D+D QGN  +  G    +L+ +I D L      ++ +++    +NL+I P   EL   +  L  +   ++ +K  + +++  YDYV ID PP++ V+    L+  D  L+P + + YA  G+ ++IN  +  K+  N  ++I  +  T  + R  + N+++++ +K   K + VY  +  IS   +   A  +  +PI++   K K  + Y  L KE L
  S:     4 ICIFNQKGGVGKTTTNINLCAYLAMEGYRVLTIDIDPQGNTTSGLGLDKSNLDLSIYDVLISDATMKESIVRSDLVQNLYISPSTMELAGAEVELINRSDRENIMKNKLKEIESEYDYVFIDCPPSLGVLTINALTCADSVLIPIQCEFYALEGVSQLINTIQLVKKSLNKKLEIEGVVMTMFDYRTNLSNEVLKE-VKKYFKNK-VYEAT--ISRNVRLAEAPSFG-LPIMLYDEKCKGAEAYVKLTKEFL 250
>gi|73543037|ref|YP_297557.1| chromosome segregation ATPase [Ralstonia eutropha JMP134] >gi|72120450|gb|AAZ62713.1| chromosome segregation ATPase [Ralstonia eutropha JMP134] (268 aa)
Score = 249, Expect = 1.1e-19, Identities = 61/191 (31%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  G++V++VDLD QGN     G     LE ++   L G    E    + +T    +LP N EL   +  L +    +  LK  I ++D+ YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N  +K++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQGQRVLLVDLDPQGNASMGSGIDKQSLEHSVYQVLVGLASVEQARQRSETGKYDVLPANRELAGAEVELVELDQRERKLKHAIAEVDDQYDFVLIDCPPSLSLLTLNGLCAAHGVIVPMQCEYFALEGLSDLVNTIKQVHANLNRELKVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|51894467|ref|YP_077158.1| ParA family ATPase [Symbiobacterium thermophilum IAM 14863] >gi|51858156|dbj|BAD42314.1| ParA, ParA family ATPase [Symbiobacterium thermophilum IAM 14863] (258 aa)
Score = 249, Expect = 1.1e-19, Identities = 66/252 (26%), Positives = 134/252 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + NL+A L+  GK+V+++D+D QGN  +  G     L+ ++ D L  +   ++ ++  +   L ++P   +L   +  L  +   +S LK  ++ + + YD+V++D PP++ ++    L+  D  L+P + + YA  GL ++++  +  +E  N N+++  +  T  + R  +   ++E+ +K   K Q   V  + I+   + + A  +  +PI +   +SK  + Y  L +E++  V
  S:     5 IAIANQKGGVGKTTTAVNLSACLADLGKRVLLIDVDPQGNATSGLGLDRRRLKASVYDVLLDELPLQEAVVNTRVRGLQVVPATIDLAGAEIELVPRIARESRLKQALDPVRDQYDFVLMDCPPSLGLLTINALTAADSILIPIQCEYYALEGLTQLMDTFRLVREALNPNLEVEGVVLTMFDGRTNLSIQVVEE-VKRFFKGQ---VYRSIITRNVRLSEAPSHG-LPITLYDPRSKGAEAYMELAREVIERV 253
>gi|58580128|ref|YP_199144.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84622129|ref|YP_449501.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58424722|gb|AAW73759.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84366069|dbj|BAE67227.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae MAFF 311018] (265 aa)
Score = 249, Expect = 1.1e-19, Identities = 59/190 (31%), Positives = 97/190 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L+   K+V++VDLD QGN     G    D+  +  D L G+     I +   E   +LPGN +L   +  L  +   +  LK  +  + + YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLARVPKRVLLVDLDSQGNATMGSGIDKRDVAASTCDLLLGENTAAQIRVTAPEGFDLLPGNIDLTAAEIQLMHQGEREQRLKRALTPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRGNLNPALEIEGV---LRTMFDIRNNL 191
>gi|116490229|ref|YP_809773.1| chromosome segregation ATPase [Oenococcus oeni PSU-1] >gi|116090954|gb|ABJ56108.1| chromosome segregation ATPase [Oenococcus oeni PSU-1] (256 aa)
Score = 249, Expect = 1.1e-19, Identities = 62/193 (32%), Positives = 98/193 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAA L    +KV+++DLD Q N  +  G   +++ F   D L      +  +I + +N  ILP + EL   +  L +K+  Q  LK  I K  E YD+V+ID PPA+ ++   +L   D  L+P + + +A  GL +++      KE  N  + I  I   + T   I   ++ +
  S:     5 IALANQKGGVGKTTTALNLAAGLLRRDQKVLLIDLDPQSNATSGAGITKEEIVFNSYDVLISNRAVKSAIIHRADNFDILPSSTELAGAEIELTKKKDRQKILKRKIAKEKEKYDFVLIDNPPALGLLSLNSLMAADSVLIPVQAEYFALEGLAQLMKTINLVKEHGNSGLTIEGILMTMTTHTKISRQVVSE 197
>gi|154688203|ref|YP_001423364.1| hypothetical protein RBAM_038080 [Bacillus amyloliquefaciens FZB42] >gi|154354054|gb|ABS76133.1| Soj [Bacillus amyloliquefaciens FZB42] (253 aa)
Score = 249, Expect = 1.2e-19, Identities = 75/248 (30%), Positives = 129/248 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I + N KGGV KTT S NL A L+  GK+V++VD+D QGN  +  G +  D++  + D L       DI IK T  ENL ++P   +L   +  L      +  LK  +  + + YDY+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N ++ I  +  T ++ R  +   +IE+    K     VY T   I    + + A  + + PI++   +S+  + Y +L KE+
  S:     5 IAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVDHCVYDILVDDADVTDI-IKPTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALESVKQNYDYMIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEGVLLTMLDARTNLGIQVIEEV--KKYFRDKVYQT--IIPRNVRLSEAPSHGK-PIILYDPRSRGAEVYLDLAKEV 249
>gi|188578887|ref|YP_001915816.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188523339|gb|ACD61284.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae PXO99A] (265 aa)
Score = 249, Expect = 1.2e-19, Identities = 59/190 (31%), Positives = 97/190 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L+   K+V++VDLD QGN     G    D+  +  D L G+     I +   E   +LPGN +L   +  L  +   +  LK  +  + + YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLARVPKRVLLVDLDSQGNATMGSGIDKRDVAASTCDLLLGENTAAQIRVTAPEGFDLLPGNIDLTAAEIQLMHQGEREQRLKRALTPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRGNLNPALEIEGV---LRTMFDIRNNL 191
>gi|84684650|ref|ZP_01012551.1| chromosome partitioning protein ParA [Rhodobacterales bacterium HTCC2654] >gi|84667629|gb|EAQ14098.1| chromosome partitioning protein ParA [Rhodobacterales bacterium HTCC2654] (259 aa)
Score = 249, Expect = 1.3e-19, Identities = 73/249 (29%), Positives = 125/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL A+L++ G KV+IVDLD QGN     G +P D E    D L  +   E ++++   ENL I P   +L+  D  L  N+K+    +  +     + L  DY++ID PP+++++    L      L+P + + +A  GL +++   +E +E  N  ++I  +   V T   + N++ +Q       T G  V    +    + + A  +  +P++     SK    Y +L +E++
  S:     7 IAVTNQKGGVGKTTTAINLGAALAMKGNKVLIVDLDPQGNASTGLGIEPQDRESTTYDLLLEESPLESVVLQTVIENLWIAPATTDLSSADIELVANEKRSHLLHDSLRAPTAERLGLDYILIDCPPSLNLLTVNALVAAHSVLIPLQSEFFALEGLSQLMLTIREVREAANPKLRIEGV---VLTMHDMRNNLAQQVEADARDTLGELVFKTVVPRNVRVSEAPSFA-MPVISYDPSSKGSQAYISLAQELM 255
>gi|56965870|ref|YP_177604.1| sporulation initiation inhibitor protein Soj [Bacillus clausii KSM-K16] >gi|56912116|dbj|BAD66644.1| sporulation initiation inhibitor protein Soj [Bacillus clausii KSM-K16] (253 aa)
Score = 249, Expect = 1.3e-19, Identities = 75/249 (30%), Positives = 133/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDI----LIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NLAA L+  GK+V++VD+D QGN  +  G +  D++  + D L      ED+    +++ TE  NL ++P   +L+  +  L      +  LK  +  L   YDY+ ID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N ++ I  +  T ++ R  +   +IE+ +K   + +   V    I  T +   A  Y + PI++   KS+  + Y +L KE++
  S:     5 IAIANQKGGVGKTTTSVNLAACLAHLGKRVLLVDIDPQGNATSGVGIEKGDVDECVYDLL-----IEDLDARKVVRSTEVNNLDVIPATIQLSGAEIELVPTISREVRLKKALTPLKSHYDYIFIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEGVLLTMLDARTNLGIQVIEE-VKKYFRDK---VFDTIIPRTIRLGEAPSYGK-PIIVYDAKSRGAEVYIDLAKEVV 250
>gi|30023504|ref|NP_835135.1| sporulation initiation inhibitor protein soj [Bacillus cereus ATCC 14579] >gi|30265498|ref|NP_847875.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. Ames] >gi|42784676|ref|NP_981923.1| sporulation initiation inhibitor protein Soj [Bacillus cereus ATCC 10987] >gi|47531066|ref|YP_022415.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. 'Ames Ancestor'] >gi|47568679|ref|ZP_00239376.1| ATPase, ParA family [Bacillus cereus G9241] >gi|49188317|ref|YP_031570.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. Sterne] >gi|49481157|ref|YP_039470.1| sporulation initiation inhibitor [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|165873029|ref|ZP_02217650.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0488] >gi|166982566|ref|ZP_02253998.1| chromosome partitioning protein [Bacillus cereus AH187] >gi|166997079|ref|ZP_02263538.1| chromosome partitioning protein [Bacillus cereus AH820] >gi|167635048|ref|ZP_02393365.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0442] >gi|167641742|ref|ZP_02399985.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0193] >gi|167937966|ref|ZP_02525041.1| chromosome partitioning protein [Bacillus cereus AH1134] >gi|168137555|ref|ZP_02580784.1| chromosome partitioning protein [Bacillus cereus B4264] >gi|168143817|ref|ZP_02587046.1| chromosome partitioning protein [Bacillus cereus G9842] >gi|168160943|ref|ZP_02596176.1| chromosome partitioning protein [Bacillus cereus H3081.97] >gi|170689476|ref|ZP_02880666.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0465] >gi|170707524|ref|ZP_02897977.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0389] >gi|177655267|ref|ZP_02936821.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0174] >gi|190569284|ref|ZP_03022178.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis Tsiankovskii-I] >gi|196036112|ref|ZP_03103512.1| sporulation initiation inhibitor protein Soj [Bacillus cereus W] >gi|196041958|ref|ZP_03109245.1| sporulation initiation inhibitor protein Soj [Bacillus cereus NVH0597-99] >gi|29899065|gb|AAP12336.1| Sporulation initiation inhibitor protein soj [Bacillus cereus ATCC 14579] >gi|30260176|gb|AAP29361.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. Ames] >gi|42740608|gb|AAS44531.1| sporulation initiation inhibitor protein Soj [Bacillus cereus ATCC 10987] >gi|47506214|gb|AAT34890.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. 'Ames Ancestor'] >gi|47554667|gb|EAL13021.1| ATPase, ParA family [Bacillus cereus G9241] >gi|49182244|gb|AAT57620.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. Sterne] >gi|49332713|gb|AAT63359.1| sporulation initiation inhibitor [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|164711241|gb|EDR16797.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0488] >gi|167510296|gb|EDR85699.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0193] >gi|167529522|gb|EDR92272.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0442] >gi|170127520|gb|EDS96394.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0389] >gi|170666578|gb|EDT17351.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0465] >gi|172080194|gb|EDT65286.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis str. A0174] >gi|190559591|gb|EDV13582.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis Tsiankovskii-I] >gi|195991279|gb|EDX55247.1| sporulation initiation inhibitor protein Soj [Bacillus cereus W] >gi|196027213|gb|EDX65833.1| sporulation initiation inhibitor protein Soj [Bacillus cereus NVH0597-99] (253 aa)
Score = 248, Expect = 1.5e-19, Identities = 71/249 (28%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN     G +  +L+  I + L      + ++ K  TENL +LP   +L   +  L      +  L+  +  + + YDY+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N N+ I  +  T ++ R  +   +I++ +K   + +   V  + I    + + A  + + PI+    KS+  + Y +L +E++
  S:     5 IAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIYNVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQPVRDEYDYIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQGVLLTMLDARTNLGIQVIDE-VKKYFRDK---VYRSIIPRNVRLSEAPSHGK-PIMQYDAKSRGAEVYIDLAEEVI 250
>gi|182416764|ref|ZP_02948161.1| sporulation initiation inhibitor protein soj [Clostridium butyricum 5521] >gi|182379421|gb|EDT76916.1| sporulation initiation inhibitor protein soj [Clostridium butyricum 5521] (253 aa)
Score = 248, Expect = 1.5e-19, Identities = 74/249 (29%), Positives = 132/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK--TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL + L+++G KV+ +D+D QGN  +  G   ++L+ +I D L      ++ +++     NL I P   EL   +  L  K   ++ +K  + ++++ YDYV ID PP++ V+    L+  D  L+P + + YA  G+ +++N  +  K+  N  ++I  +  T  + R  + N+++++    K     VY T+  I+   +   A  +  +PIV+   K K  + Y NL KE L
  S:     4 ICIFNQKGGVGKTTTNINLCSYLAMEGFKVLTIDIDPQGNTTSGLGIDKNNLDCSIYDVLISDVSMKESIVQSDLVNNLFISPSTMELAGAEVELINKSDRENIMKNKLKEIEDEYDYVFIDCPPSLGVLTINALTCADSVLIPMQCEFYALEGVSQLMNTVQLVKKSLNKKLEIEGVLMTMFDYRTNLSNEVLKEV--QKYFKDKVYKTT--IARNIRLAEAPSFG-LPIVLYDNKCKGAEAYTNLTKEFL 250
>gi|118586486|ref|ZP_01543930.1| ATPase [Oenococcus oeni ATCC BAA-1163] >gi|118433050|gb|EAV39772.1| ATPase [Oenococcus oeni ATCC BAA-1163] (267 aa)
Score = 248, Expect = 1.6e-19, Identities = 62/193 (32%), Positives = 98/193 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAA L    +KV+++DLD Q N  +  G   +++ F   D L      +  +I + +N  ILP + EL   +  L +K+  Q  LK  I K  E YD+V+ID PPA+ ++   +L   D  L+P + + +A  GL +++      KE  N  + I  I   + T   I   ++ +
  S:    16 IALANQKGGVGKTTTALNLAAGLLRRDQKVLLIDLDPQSNATSGAGITKEEIVFNSYDVLISNRAVKSAIIHRADNFDILPSSTELAGAEIELTKKKDRQKILKRKIAKEKEKYDFVLIDNPPALGLLSLNSLMAADSVLIPVQAEYFALEGLAQLMKTINLVKEHGNSGLTIEGILMTMTTHTKISRQVVSE 208
>gi|75761486|ref|ZP_00741450.1| Chromosome partitioning protein parA [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491025|gb|EAO54277.1| Chromosome partitioning protein parA [Bacillus thuringiensis serovar israelensis ATCC 35646] (259 aa)
Score = 248, Expect = 1.6e-19, Identities = 71/249 (28%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN     G +  +L+  I + L      + ++ K  TENL +LP   +L   +  L      +  L+  +  + + YDY+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N N+ I  +  T ++ R  +   +I++ +K   + +   V  + I    + + A  + + PI+    KS+  + Y +L +E++
  S:    11 IAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIYNVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQPVRDEYDYIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQGVLLTMLDARTNLGIQVIDE-VKKYFRDK---VYRSIIPRNVRLSEAPSHGK-PIMQYDAKSRGAEVYIDLAEEVI 256
>gi|170764044|ref|ZP_02630614.2| SpoOJ regulator protein [Clostridium perfringens E str. JGS1987] >gi|170663787|gb|EDT16470.1| SpoOJ regulator protein [Clostridium perfringens E str. JGS1987] (251 aa)
Score = 247, Expect = 1.7e-19, Identities = 80/249 (32%), Positives = 131/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + + N KGGV KTT + N  A LS +GK+V++VDLD Q N+   F K     + +I D L  K      +IKKT  EN+ I+P N  L + +   LL+  +  Q+ L   +  + + YDY +ID PPA++++    L      LVP + D++A  GL+ ++++ +E K++ N ++        +++  T+ N +I+Q LK  L   G  V +  I    K   +  +E  P+V S  K++    Y  L  EI 
  S:     5 LSIFNIKGGVAKTTSTANFGACLSQNGKRVLLVDLDPQSNLTKLF-KAYSMEDLSIADVLLNKNLDLHNVIKKTDFENIDIIPANVNLAFAERKILLDVSRSQQNRLSKALESIKDEYDYCLIDCPPALNMITVNALCSSHDVLVPIKIDKFALDGLEYLLDSIEEIKDEFNPSLNFKGCFITMDSATTV-NKVIKQELKNIL---GDKVFNTTIKQNVKVIEST-FEECPVVFSSKKARASLNYIELSNEIF 251
>gi|119470010|ref|ZP_01612815.1| putative ParA family protein [Alteromonadales bacterium TW-7] >gi|119446720|gb|EAW27993.1| putative ParA family protein [Alteromonadales bacterium TW-7] (256 aa)
Score = 247, Expect = 1.9e-19, Identities = 73/230 (31%), Positives = 114/230 (49%)
  Q:     1 MKI-GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIK-----KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPI 230
           MKI  V N KGGV KTT + +LA +L+L GK+V+++D D   ++   FG   +DLE ++ D F +G     + +++       ENL ILP    +   D  +  K      LK  + K+ E YDY I+D PP + V++   L+  +  LVP + +  A  GL R++   +  +     + +   IPT  + R         ++ K   KT G  V    I   TK   A   ++VPI
  S:     1 MKIWTVANQKGGVGKTTTAVSLAGTLALQGKRVLLIDTDPHASLTYYFGIDSEDLEVSVYDIFARGTSMQSEEILQALCPSTLENLDILPATMAIATLDRSMGNKTGMGLILKKTLAKISEHYDYAILDCPPVLGVLMVNALAASERILVPVQTEFLALKGLDRMMRTMELMQSSQAKSYEYTIIPTMYDKRTKAS----LEAYKTLQKTYGNRVWPGVIPVDTKLRDASLAQKVPI 233
>gi|118474892|ref|YP_892666.1| SpoOJ regulator protein [Campylobacter fetus subsp. fetus 82-40] >gi|118414118|gb|ABK82538.1| SpoOJ regulator protein [Campylobacter fetus subsp. fetus 82-40] (260 aa)
Score = 247, Expect = 2.1e-19, Identities = 79/249 (31%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTEN-LHILPGNDELNYFDFLLN-QKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN-----FISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL++  KKV++VD+D Q N     G    D EF I   L G+    +I++K   N LH+ P N  L   +   N Q +  ++ L+  I++L + YD++IID+PPA+  +    LS  D  ++P + + YA  GL +I+N  K  K+  N  + I   +PT  + +  +  + +   LK   + +   V  +      I    K   +  + + P+++   KS     Y NL   I+
  S:     5 ITIANQKGGVGKTTTAVNLAASLAVAEKKVLLVDIDPQANATTGLGFSRSDYEFNIYHVLTGRKKLSEIILKTEINTLHLAPSNIGLVGIEQEFNEQNRDYKAILRNKISELRDDYDFLIIDSPPALGSLTINALSASDSVIIPIQCEFYAMEGLAQILNTVKVIKKSINPKLTIKGFLPTMYSAQNNLSKETV-ADLKKHFENKLFKVADSEEGFVIIPRNVKLAESPSFGK-PVILYDIKSSGSIAYQNLAYSIM 259
>gi|71281148|ref|YP_271683.1| parA family protein [Colwellia psychrerythraea 34H] >gi|71146888|gb|AAZ27361.1| parA family protein [Colwellia psychrerythraea 34H] (268 aa)
Score = 246, Expect = 2.3e-19, Identities = 61/193 (31%), Positives = 102/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENL-HILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT + NLAASL+   +KV+++DLD QGN     G     +     + L  +   ED++IK+T  L H++  N ++   +  L +    +  LK  +  + + YD++IID PP+++++    ++  D  LVP + + YA  GL  +++   +     N  + I  I  T  + R  + ND+ EQ
  S:     5 IAVANQKGGVGKTTTAVNLAASLAATKRKVLLIDLDPQGNATMASGVDKYQVHATCYELLVEEQSVEDVVIKETSGLYHLISANADVTAAEIKLMEVYAREQRLKNALAPVKDFYDFIIIDCPPSLNMLTVNAMTAADSVLVPMQCEYYALEGLTALMDTITKLTSVVNDKLHIEGILRTMYDPRNRLANDVSEQ 199
>gi|170763946|ref|ZP_02635928.2| sporulation initiation inhibitor protein soj [Clostridium perfringens B str. ATCC 3626] >gi|170711675|gb|EDT23857.1| sporulation initiation inhibitor protein soj [Clostridium perfringens B str. ATCC 3626] (251 aa)
Score = 246, Expect = 2.5e-19, Identities = 81/249 (32%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + + N KGGV KTT + N  A LS + KKV++VDLD Q N+   F K     + +I D L  K      +IKKT  EN+ ILP N  L + +   LL+  +  Q+ L   +  + + YDY +ID PPA++++    L      LVP + D++A  GL+ ++++ +E K++ N ++        +++  T+ N +I+Q LK  L   G  V +  I    K   +  +E  P+V S  K++    Y  L  EI 
  S:     5 LSIFNIKGGVAKTTSTANFGACLSQNEKKVLLVDLDPQSNLTKLF-KAYSMEDLSIADVLLNKNLDLHKIIKKTDFENIDILPANVNLAFAERKILLDVSRSQQNRLSKALESIKDEYDYCLIDCPPALNMITVNALCSSHDVLVPIKIDKFALDGLEYLLDSIEEIKDEFNPSLNFKGCFITMDSATTV-NKVIKQELKNIL---GDKVFNTTIKQNVKVVEST-FEECPVVFSSKKARASLNYIELSNEIF 251
>gi|126701300|ref|YP_001090197.1| sporulation initiation inhibitor [Clostridium difficile 630] >gi|168714864|ref|ZP_02747141.1| sporulation initiation inhibitor [Clostridium difficile QCD-63q42] >gi|115252737|emb|CAJ70581.1| sporulation initiation inhibitor [Clostridium difficile 630] (257 aa)
Score = 246, Expect = 2.5e-19, Identities = 59/176 (33%), Positives = 100/176 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I V N KGGV KTT + NL+ASL   GKK++++DLD QGN  + +G   +++E  I +  L G    E I+  + EN+ ++P   EL+  +  L  K   +  LK  I  + + YDY+ +D PP++ ++    L+ VD  L+P + + YA  G+ +++   K  K + N +++I  +
  S:     5 IAVFNQKGGVGKTTTNVNLSASLGTLGKKILVLDLDPQGNTTSGYGINKNEVENTIYEIMLDGLHIKEAIISTEFENIDVVPSATELSGAEIELTSKTNREYILKNSIKAVIDEYDYIFLDCPPSLGMLTINCLTAVDSVLIPIQCEYYALEGVSQLMETIKLVKSRLNADIEIQGV 181
>gi|187476517|ref|YP_784541.1| chromosome partitioning protein [Bordetella avium 197N] >gi|115421103|emb|CAJ47587.1| chromosome partitioning protein [Bordetella avium 197N] (265 aa)
Score = 246, Expect = 2.5e-19, Identities = 57/191 (29%), Positives = 103/191 (53%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+   ++V++VDLD QGN     G   + LE  +   L G+   E   ++ ++    +LP N EL+  +  L Q +  +  LK+ I  + + YD+V+ID PP +S++    L+  D  ++P + + +A  GL  ++N  K      N++++++  +    + R+T+   +  Q
  S:    15 IANQKGGVGKTTTAINLAAGLATHQQRVLLVDLDPQGNATMGSGIDKNSLESNLYQVLIGEATIETARVRSESGGYDVLPANRELSGAEIDLVQMEEREQQLKLAIETVADQYDFVLIDCPPTLSLLTLNGLAAADGVIIPMQCEYFALEGLSDLVNTIKRVHRNINNDLRVIGLLRVMFDPRMTLQQQVSAQ 207
>gi|192360732|ref|YP_001984269.1| chromosome partitioning protein Soj [Cellvibrio japonicus Ueda107] >gi|190686897|gb|ACE84575.1| chromosome partitioning protein Soj [Cellvibrio japonicus Ueda107] (267 aa)
Score = 246, Expect = 2.6e-19, Identities = 60/192 (31%), Positives = 104/192 (54%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            + N KGGV KTT   NLAASL    K+V++VDLD QGN     G   ++LE +I D L  +    D L+   +    +LP N +L   +  +   +  +  L+  IN++ + +DY++ID PP+++++    L+  D  ++  + + YA  GL  ++N  ++ +   N N+KI   + T  + R ++ ND+  Q
  S:     6 AIANQKGGVGKTTTCVNLAASLVATKKRVLLVDLDPQGNATMGSGIGKNELEKSIYDVLTEREAIGDCLVFSDSGKYQVLPANGDLTAAEVEMLALENKERRLQNAINQVRDQFDYILIDCPPSLNMLTLNALAACDGVIIAMQCEYYALEGLSALVNTIQQIQRVLNPNLKIEGLLRTMYDPRNSLTNDVSAQ 199
>gi|167838435|ref|ZP_02465294.1| chromosome partitioning protein ParA [Burkholderia thailandensis MSMB43] (256 aa)
Score = 246, Expect = 2.7e-19, Identities = 58/191 (30%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN     G    + E  + + L       D  ++ +     +LP N EL   +  L   +  +  LK  + K+ + YD+V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N N+K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGNATMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENRERQLKAALAKVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRNLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|115374117|ref|ZP_01461405.1| soj protein [Stigmatella aurantiaca DW4/3-1] >gi|115368893|gb|EAU67840.1| soj protein [Stigmatella aurantiaca DW4/3-1] (297 aa)
Score = 246, Expect = 2.9e-19, Identities = 70/250 (28%), Positives = 127/250 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NLAASL+   ++ ++VD+D QGN  +  G K + L+  + D  L G+   E +   +   L ++P   +L   +  L  ++  +  L+  +  L   YDY++ID PP++ ++    L   D  L+P + + YA  GL ++ +     ++  N  +K+  I  T  ++R  I N ++E++ +   K Q   V +  +    +      + + PI++   KSK  + Y  L +EI+N
  S:    39 ICISNQKGGVGKTTTAINLAASLASAERRTLLVDMDPQGNAGSGLGLKREMLQGTVYDAILGGRPMRELLHPTELRFLQVVPATPDLTGAEVELVNQERREFRLREALRPLAADYDYILIDCPPSLGLLTLNALVAADSVLIPLQCEYYALEGLSQLTHTVDLVQQGLNPGLKMEGILLTMFDSRANIANQVVEEA-RGYFKDQ---VFTAVVPRNVRLAECPSFGK-PIILYDIKSKGCESYLALGREIMN 285
>gi|111023313|ref|YP_706285.1| sporulation initiation inhibitor protein [Rhodococcus sp. RHA1] >gi|110822843|gb|ABG98127.1| possible sporulation initiation inhibitor protein [Rhodococcus sp. RHA1] (316 aa)
Score = 245, Expect = 3.0e-19, Identities = 58/191 (30%), Positives = 103/191 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A+L   G+KV++VDLD QG +  + G  PD L+ ++ + L G    ++ +I   + + +LP   +L   + LL  +   +  LK  +  L + YD +IID PP++ V+    L+     LVP + +  A  G+ +++    E ++  N ++ ++ A+PT  + R T   D++
  S:    56 LAVANQKGGVAKTTTVASLGAALVGLGQKVLVVDLDPQGCLTFSLGHNPDRLDASVHEVLTGDLTAQEAVIDTEDGVALLPATIDLAGAEALLLMRPGREFALKRALAPLLDDYDTIIIDCPPSLGVLTLNGLTAAQSVLVPLQCETLAHRGVGQLLRTVTEVQQITNPDLVLLGALPTLYDARTTHSRDVL 247
>gi|145952509|ref|ZP_01801519.1| hypothetical protein CdifQ_04004260 [Clostridium difficile QCD-32g58] >gi|168695988|ref|ZP_02728265.1| sporulation initiation inhibitor [Clostridium difficile QCD-37x79] >gi|168724965|ref|ZP_02757242.1| sporulation initiation inhibitor [Clostridium difficile QCD-76w55] >gi|168732202|ref|ZP_02764479.1| sporulation initiation inhibitor [Clostridium difficile QCD-97b34] >gi|196124296|ref|ZP_03116045.1| sporulation initiation inhibitor [Clostridium difficile ATCC 43255] >gi|196160212|ref|ZP_03120773.1| sporulation initiation inhibitor [Clostridium difficile CIP 107932] >gi|196163210|ref|ZP_03123741.1| sporulation initiation inhibitor [Clostridium difficile QCD-23m63] (257 aa)
Score = 245, Expect = 3.0e-19, Identities = 59/176 (33%), Positives = 100/176 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I V N KGGV KTT + NL+ASL   GKK++++DLD QGN  + +G   +++E  I +  L G    E I+  + EN+ ++P   EL+  +  L  K   +  LK  I  + + YDY+ +D PP++ ++    L+ VD  L+P + + YA  G+ +++   K  K + N +++I  +
  S:     5 IAVFNQKGGVGKTTTNVNLSASLGTLGKKILVLDLDPQGNTTSGYGINKNEVENTIYEIMLDGLHIKEAIISTEFENVDVVPSATELSGAEIELTSKTNREYILKNSIKAVIDEYDYIFLDCPPSLGMLTINCLTAVDSVLIPIQCEYYALEGVSQLMETIKLVKSRLNADIEIQGV 181
>gi|90962566|ref|YP_536482.1| chromosome partitioning protein parA [Lactobacillus salivarius UCC118] >gi|90821760|gb|ABE00399.1| Chromosome partitioning protein parA [Lactobacillus salivarius UCC118] (255 aa)
Score = 245, Expect = 3.3e-19, Identities = 68/249 (27%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  G+KV+++D D QGN  +  G +  ++E  + D +  +    E I+    +NL ++P   +L   +  L  +   +  L   +  + E YD+++ID PP++ ++     +  D  L+P + + YA  GL +++N  +  ++  N +++I  +  T ++ R  + N ++E+    K   + VY T   I    + + A  +  + I+    +S+  +EY  L KE+L
  S:     5 IAIANQKGGVGKTTTSVNLGACLARAGQKVLLIDTDAQGNATSGIGVRKHNIENDVYDVIVSELPIREAIMPTYIDNLDVVPATIQLAGAEIELTAQMAREKKLYDAVQDVKEEYDFILIDCPPSLGLLTINAFTASDSILIPVQSEYYALEGLSQLMNTIQLVQKHFNPDLQIEGVLMTMLDARTNLGNQVVEEV--KKFFKEKVYKT--VIPRNVRLSEAPSHG-MSIIDYDPRSRGAEEYEALAKEVL 250
>gi|120601088|ref|YP_965488.1| cobyrinic acid a,c-diamide synthase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120561317|gb|ABM27061.1| chromosome segregation ATPase [Desulfovibrio vulgaris subsp. vulgaris DP4] (262 aa)
Score = 245, Expect = 3.7e-19, Identities = 69/249 (27%), Positives = 122/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAI-MDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NLAASL++  KKV++VD D Q N  +  G   +D+E ++   F + +   + IL   +  L +LP   +L   +  L  K   +  L  L+  LD  YDY+++D PP++ ++    L      L+P + + +A  G+ +++   ++ K + N N+ ++ +   V T   + N +  Q      K    ++    I    + + A  + +  I+    KSK  + Y  L KE++
  S:     5 IAIANQKGGVGKTTSSVNLAASLAIMEKKVLLVDCDPQANSTSGLGFDQEDIERSLYTSFFQPEEVVDAILTTSSPFLSLLPATTDLVAIELELVDKMAREYYLADLLKPLDSRYDYILLDCPPSLGLITLNALCAARELLIPLQCEFFALEGIVKLLQTYEQVKRRLNQNLSLLGV---VLTMYDVRNKLSRQVKNEVRKCFPDHLFETVIPRNVRLSEAPSHGK-SIIHYDIKSKGAEAYLALAKEVV 250
>gi|89052693|ref|YP_508144.1| chromosome segregation ATPase [Jannaschia sp. CCS1] >gi|88862242|gb|ABD53119.1| chromosome segregation ATPase [Jannaschia sp. CCS1] (259 aa)
Score = 245, Expect = 3.7e-19, Identities = 74/250 (29%), Positives = 120/250 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           + + N KGGV KTT + NL A+L+  GK V+IVDLD QGN     G +         D L      ED+ I  +  NL I P   +L+  D  L Q+      LK  +++  + YDYV+ID PP++S++    L   D  LVP + + +A  GL +++   +E +E  N +++I  +   V T     N +  Q         G  V +  I    + + A  +  +P ++    SK    Y +L +E+++
  S:     4 LSITNQKGGVGKTTTAINLGAALAATGKFVLIVDLDPQGNASTGLGIEARSRSKTTYDLLIDGAALEDVSIPTEIANLSIAPATTDLSSTDVELGQRDNRIFLLKEALSESIDTYDYVLIDCPPSLSLLTLNALVASDALLVPLQAEFFALEGLSQLMLTVREVRETANPSLRIEGV---VLTMHDARNRLSRQVEDDARSNLGELVFNTMIPRNVRLSEAPSFA-LPAIVYDPMSKGSQAYLDLAEELID 250
>gi|124520286|ref|ZP_01695469.1| Cobyrinic acid a,c-diamide synthase [Bacillus coagulans 36D1] >gi|124497776|gb|EAY45329.1| Cobyrinic acid a,c-diamide synthase [Bacillus coagulans 36D1] (253 aa)
Score = 245, Expect = 3.8e-19, Identities = 73/248 (29%), Positives = 130/248 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I + N KGGV KTT S NL A L+  GKKV++VD D QGN  +  G    +++  I D L      +D++     + L+ +P   +L   +  L      +  LK  I+ + + YDY+IID PP++ ++    L+  D  ++P + + YA  GL ++++  +  ++  NHN+ I  +  T ++ R  +   +IE+ +K   + + VY T   I    + + A  + + PI++   KS+  + Y +L KE+
  S:     5 ISIANQKGGVGKTTTSVNLGACLAYIGKKVLLVDTDPQGNATSGAGIDKGEVQQCIYDVLVEDANIKDVIRATAVDGLYSVPATIQLAGAEIELVPTISREVRLKRAISAIKDDYDYIIIDCPPSLGLLTLNALTASDAVIIPVQCEYYALEGLSQLLSTVRLVQKHLNHNLMIDGVLLTMLDARTNLGLQVIEE-VKKYFRDK-VYRT--IIPRNIRLSEAPSHGQ-PIILYDPKSRGAEVYLDLAKEV 249
>gi|167729273|emb|CAO80184.1| soj protein [Candidatus Cloacamonas acidaminovorans] (254 aa)
Score = 244, Expect = 3.9e-19, Identities = 74/250 (29%), Positives = 124/250 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI---IEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I VVN KGGV KTT + NL+A L++  K+ +++D D QGN  +  G   D +E  I D L G+   E  IL   T+NL  +PGN  L   +  L  +   +  LK  +  +   +DY+IID PP++ ++    ++     L+P + + YA  G+ +++   +  ++  N  + I+ +  T  + RV +   +   + +  K K       V    I    K T A G+ + PI +   +S     Y NL  E++N
  S:     5 ITVVNQKGGVGKTTTAVNLSAGLAVLEKRTLLIDFDPQGNATSGVGIDKDKVELQIYDALIGRAPIEKTILSTATKNLFCIPGNINLTGAEIELVHEFAREQKLKEALQPILNSFDYIIIDCPPSLGLLTVNAMTAAMEVLIPIQCEYYALEGVSQLLTTIRLIQKNLNPGLNILGVLLTMFDKRVNLSLQVAKEVHRYFKEK-------VFRTIIPRNIKLTEAPGFGK-PIFLYDIRSPGAMSYLNLANEVIN 251
>gi|157803243|ref|YP_001491792.1| soj protein [Rickettsia canadensis str. McKiel] >gi|157784506|gb|ABV73007.1| soj protein [Rickettsia canadensis str. McKiel] (255 aa)
Score = 244, Expect = 4.2e-19, Identities = 78/249 (31%), Positives = 119/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KKV+++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+ ++  LY+Y+IID PP+++++    L   D  L+P + D Y+  GL  ++   K  ++K N  +KIV I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFAALNKKVLVIDLDPQGNSSTGFGISQQQRKNTIYQVLINLIELKDAIIATNIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLKEIKILYNYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIKIVEKKLNPKIKIVGI---LFTMYDKRNRLTEQVEDDVRKCLGALVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCSGAVAYMELTKEIL 249
>gi|153811690|ref|ZP_01964358.1| hypothetical protein RUMOBE_02083 [Ruminococcus obeum ATCC 29174] >gi|149832093|gb|EDM87178.1| hypothetical protein RUMOBE_02083 [Ruminococcus obeum ATCC 29174] (275 aa)
Score = 244, Expect = 4.4e-19, Identities = 77/249 (30%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAI----MDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I VVN KGGV KTT + N+   L+ +GKKV+++D D QG++ A+ G ++PDDL   +    MD + + +   ED ++   EN+ +LP N EL+  +  +      +  +K  I+ +   YDY++ID  P++ ++    L   D  L+P +       GL+++I      K++ N  + I  I  T V+ R     DI  + +     +Q + V  N I  + K+ A    E   I M   K K  + Y  L +E+L
  S:    19 ISVVNQKGGVGKTTTTVNVGIGLAREGKKVLLIDADPQGSLTASLGYEEPDDLRITLATIMMDVINEEEISLEDGILHHQENVDLLPANIELSALEVTMGNVMSREMIMKEYIDAIRSRYDYILIDCMPSLGMMTINALVSSDSVLIPVQAAYLPVKGLQQLIKTILTVKKRLNRKLAIEGILLTMVDFRTNYARDIASR-VHTTYGSQ-IEVFENVIPMSVKA-AETSAEGKSIYMHCPKGKVAEAYMKLTQEVL 271
>gi|50085457|ref|YP_046967.1| chromosome partitioning protein [Acinetobacter sp. ADP1] >gi|49531433|emb|CAG69145.1| chromosome partitioning protein [Acinetobacter sp. ADP1] (260 aa)
Score = 244, Expect = 4.4e-19, Identities = 60/199 (30%), Positives = 108/199 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI---IEQSLKPKL 201
           I + N KGGV KTT + NLAASL++  K+V++VD+D QGN     G + +DL +++ D L G+   E  + K      +L  N +L   +  +  +   +  LK  + ++ + +DY+IID  P++S++    L+ VD  ++P + + YA  GL  +       ++  N +++I+ +  T  + R  +  D+   +EQ    KL
  S:     5 IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGVLRTMYDARNALTRDVSAELEQFFGKKL 207
>gi|65317461|ref|ZP_00390420.1| COG1192: ATPases involved in chromosome partitioning [Bacillus anthracis str. A2012] >gi|196045433|ref|ZP_03112664.1| sporulation initiation inhibitor protein Soj [Bacillus cereus 03BB108] >gi|196023640|gb|EDX62316.1| sporulation initiation inhibitor protein Soj [Bacillus cereus 03BB108] (287 aa)
Score = 244, Expect = 4.7e-19, Identities = 71/249 (28%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN     G +  +L+  I + L      + ++ K  TENL +LP   +L   +  L      +  L+  +  + + YDY+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N N+ I  +  T ++ R  +   +I++ +K   + +   V  + I    + + A  + + PI+    KS+  + Y +L +E++
  S:    39 IAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIYNVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQPVRDEYDYIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQGVLLTMLDARTNLGIQVIDE-VKKYFRDK---VYRSIIPRNVRLSEAPSHGK-PIMQYDAKSRGAEVYIDLAEEVI 284
>gi|46581759|ref|YP_012567.1| ParA family protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46451182|gb|AAS97827.1| ParA family protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (276 aa)
Score = 244, Expect = 4.8e-19, Identities = 69/249 (27%), Positives = 122/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAI-MDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NLAASL++  KKV++VD D Q N  +  G   +D+E ++   F + +   + IL   +  L +LP   +L   +  L  K   +  L  L+  LD  YDY+++D PP++ ++    L      L+P + + +A  G+ +++   ++ K + N N+ ++ +   V T   + N +  Q      K    ++    I    + + A  + +  I+    KSK  + Y  L KE++
  S:    19 IAIANQKGGVGKTTSSVNLAASLAIMEKKVLLVDCDPQANSTSGLGFDQEDIERSLYTSFFQPEEVVDAILTTSSPFLSLLPATTDLVAIELELVDKMAREYYLADLLKPLDSRYDYILLDCPPSLGLITLNALCAARELLIPLQCEFFALEGIVKLLQTYEQVKRRLNQNLSLLGV---VLTMYDVRNKLSRQVKNEVRKCFPDHLFETVIPRNVRLSEAPSHGK-SIIHYDIKSKGAEAYLALAKEVV 264
>gi|126730101|ref|ZP_01745913.1| chromosome partitioning protein ParA [Sagittula stellata E-37] >gi|126709481|gb|EBA08535.1| chromosome partitioning protein ParA [Sagittula stellata E-37] (280 aa)
Score = 244, Expect = 5.0e-19, Identities = 72/249 (28%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLL--NQKQ--ITQSNLKM-LINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL A+L   G+KV++VDLD QGN     G +P+D E+   + L  +   + +++   T+NLH++P   +L+  D  L  N+K+  +    L+   +++LD  +D V+ID PP+++++    +      LVP + + +A  GL +++   +E ++  N  ++I  I   +       + ++E   +  L   G  V S  I    + + A  Y  +P++     SK    Y  L  E++
  S:    24 IAVANQKGGVGKTTTTINLGAALCELGQKVLVVDLDPQGNASTGLGIEPEDREYTTYELLLDEADLDSVILSTSTDNLHLIPATVDLSSADIELISNEKRSYLLHDALRQPAMSRLD--FDVVLIDCPPSLNLLTVNAMVASHSVLVPLQSEFFALEGLSQLMLTIREVRQSANPGLRIEGIVLTMYDARNNLSQLVEADARSNL---GDLVFSTVIPRNVRVSEAPSYA-LPVLAYDTGSKGAQAYRALAAELI 272
>gi|52145288|ref|YP_086745.1| sporulation initiation inhibitor [Bacillus cereus E33L] >gi|51978757|gb|AAU20307.1| sporulation initiation inhibitor [Bacillus cereus E33L] (253 aa)
Score = 244, Expect = 5.0e-19, Identities = 70/249 (28%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN     G +  +L+  I + L      + ++ K  T+NL +LP   +L   +  L      +  L+  +  + + YDY+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N N+ I  +  T ++ R  +   +I++ +K   + +   V  + I    + + A  + + PI+    KS+  + Y +L +E++
  S:     5 IAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIYNVLVEDADVQGVIQKTATKNLDVLPATIQLAGAEIELVPTISREVRLQRALQPVRDEYDYIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQGVLLTMLDARTNLGIQVIDE-VKKYFRDK---VYRSIIPRNVRLSEAPSHGK-PIMQYDAKSRGAEVYIDLAEEVI 250
>gi|169630614|ref|YP_001704263.1| putative cobyrinic acid a,c-diamide synthase [Mycobacterium abscessus] >gi|169242581|emb|CAM63609.1| Putative cobyrinic acid a,c-diamide synthase [Mycobacterium abscessus] (265 aa)
Score = 243, Expect = 6.4e-19, Identities = 61/191 (31%), Positives = 108/191 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDII 193
           + V N KGGV KTT   +L A+L+  GKKV++VDLD QG +  + G+ PD L  ++ + L G+   ++ L+  TE+L +LP N +L   + +L  +   +  LK  +  L + +D VIID PP++ V+    L+  D  +VP + +  A  G+ + +    + ++  N  + ++ A+PT  ++R T   D++
  S:     5 LAVANQKGGVAKTTTVASLGAALAQAGKKVLLVDLDPQGCLTFSLGQDPDRLGISVHEVLLGQADIKEALLTTTEDLTLLPANIDLAGAEAMLLMRAGREYALKRALESLGDQFDVVIIDCPPSLGVLTLNGLTAADSVMVPLQCETLAHRGVGQFLRTVTDVQQITNPRLTLLGALPTLYDSRTTHSRDVL 196
>gi|158521587|ref|YP_001529457.1| cobyrinic acid ac-diamide synthase [Desulfococcus oleovorans Hxd3] >gi|158510413|gb|ABW67380.1| Cobyrinic acid ac-diamide synthase [Desulfococcus oleovorans Hxd3] (257 aa)
Score = 242, Expect = 6.9e-19, Identities = 70/249 (28%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL---KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFIS-STTKSTAAVGYER---VPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KT ++ NL A+LS + K+V++VD+D Q N     G + DD   ++ D +   +     + I+  + ENL +LP + +L   +  +      +  L   +  +++ YD+V++DTPP++S++     + V   ++P +   Y+   L+ + +     +E  N ++ + AI PT  + R  +   I E+ LK      G Y  S+F+S +  ++  AV Y      P+V +  +S    +Y  L +E+L
  S:     5 IAIANEKGGVGKTAMAINLGAALSQENKRVLVVDMDPQHNATIGLGVQVDDETLSVYDLIVETEDVSAGDTIVQTQWENLDLLPSHPDLAGAEVEIIDTPGRERKLAQALAGVEDAYDFVLVDTPPSLSLLTVNVFAYVREVIIPCQMHPYSYAALESLFDTLDIIREGINSDLSVTAIVPTFYDKRTGLSEMIREKLLK-----DGRY--SDFVSQAVIRTNTAVAYSTEAGKPVVFASRRSYGAWDYTRLAEELL 254
>gi|118480507|ref|YP_897658.1| chromosome segregation ATPase [Bacillus thuringiensis str. Al Hakam] >gi|118419732|gb|ABK88151.1| chromosome segregation ATPase [Bacillus thuringiensis str. Al Hakam] (287 aa)
Score = 242, Expect = 7.4e-19, Identities = 71/249 (28%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN     G +  +L+  I + L      + ++ K  TENL +LP   +L   +  L      +  L+  +  +   YDY+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N N+ I  +  T ++ R  +   +I++ +K   + +   V  + I    + + A  + + PI+    KS+  + Y +L +E++
  S:    39 IAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIYNVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQPVRNEYDYIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQGVLLTMLDARTNLGIQVIDE-VKKYFRDK---VYRSIIPRNVRLSEAPSHGK-PIMQYDAKSRGAEVYIDLAEEVI 284
>gi|91785989|ref|YP_546941.1| chromosome segregation ATPase [Polaromonas sp. JS666] >gi|91695214|gb|ABE42043.1| chromosome segregation ATPase [Polaromonas sp. JS666] (256 aa)
Score = 242, Expect = 7.5e-19, Identities = 59/191 (30%), Positives = 101/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAA L+  G++V+++DLD QGN     G     LE  + D  L+     E  +  +     +L  N EL   +  L + +  +  LK+ +N +D+ YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N +++I+  +    + R+T+   + EQ
  S:     7 VANQKGGVGKTTTTVNLAAGLAKVGQRVLMIDLDPQGNATMGSGVDKRKLELTVYDVLLESASVMEARVHSEKCGYDVLGANRELAGAEVELVEVERRERRLKLALNAVDKDYDFVLIDCPPSLSMLTLNGLCCAHGVIVPMQCEYFALEGLTDLVNTIKQVHANLNKDLQIIGLLRVMFDPRITLQQQVSEQ 199
>gi|163943160|ref|YP_001648044.1| cobyrinic acid ac-diamide synthase [Bacillus weihenstephanensis KBAB4] >gi|163865357|gb|ABY46416.1| Cobyrinic acid ac-diamide synthase [Bacillus weihenstephanensis KBAB4] (253 aa)
Score = 242, Expect = 7.6e-19, Identities = 70/249 (28%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL A L+  GKKV++VD+D QGN     G +  +L+  I + L      +  + K  TENL +LP   +L   +  L      +  L+  +  + + Y+Y+IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N N+ I  +  T ++ R  +   +I++ +K   + +   V  + I    + + A  + + PI+    KS+  + Y +L +E++
  S:     5 IAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIYNVLVEDADVQGAIRKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQPIRDEYEYIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQGVLLTMLDARTNLGIQVIDE-VKKYFRDK---VYRSIIPRNVRLSEAPSHGK-PIMQYDAKSRGAEVYLDLAEEVI 250
>gi|111017945|ref|YP_700917.1| ParaA family ATPase [Rhodococcus sp. RHA1] >gi|110817475|gb|ABG92759.1| probable ATPase, ParA family protein [Rhodococcus sp. RHA1] (319 aa)
Score = 242, Expect = 7.7e-19, Identities = 68/250 (27%), Positives = 130/250 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL ASL+  G++V++VDLD QG + A  G    DLE  + + L + +   +D+L++ + E L +LP N +L+  +  L  +   +  L  +++ + + YDYV+ID  P++ ++    L+  D  ++P E + ++  GL  + +  ++  ++ N  +++  I   +    T+H     + +   ++  G  V    I+ T +   T+  G    PI     KS   + Y  L +E+++
  S:    68 IAMCNQKGGVGKTTSTINLGASLAEFGRRVLLVDLDPQGALSAGLGVAHHDLELTVHNLLVEPRVAIDDVLMRTRVEGLDLLPSNIDLSAAEIQLVTEVGREQTLGRVLHPVLDRYDYVLIDCQPSLGLLTVNALACADSVIIPMECEYFSLRGLALLNDTVEKVHDRLNPRLELAGIVVTMFDSRTLH---AREVMARVVEVFGDLVYDTVINRTVRFPETSVAGE---PITTWAPKSTGAEAYRALAREVIH 315
>gi|78224603|ref|YP_386350.1| chromosome segregation ATPase [Geobacter metallireducens GS-15] >gi|78195858|gb|ABB33625.1| chromosome segregation ATPase [Geobacter metallireducens GS-15] (257 aa)
Score = 242, Expect = 7.8e-19, Identities = 71/250 (28%), Positives = 121/250 (48%)
  Q:     2 KIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQ-GVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           KI + N KGGV KTT + NLAASL+   K+ ++VD+D QGN  +  G     L  ++ D +        ++++     L +LP   +L   +  L      +  LK  +  LD+ YDY+IID PP++ ++    ++  D  L+P + + YA  GL +II   K  ++  N  + I  I  T  + R+ +   + E+     ++T  G       +    + + A  + R PI++    SK    Y  L KE++
  S:     4 KICIANQKGGVGKTTTAVNLAASLAAAEKRTLLVDMDPQGNAGSGVGIDKGSLTESVYDAIINDADPATLIVRTDLACLDLLPATTDLAGAELELVSAMAREWKLKEALAHLDDRYDYIIIDCPPSLGLLTVNAMTAADSVLIPLQCEYYAMEGLSQIIKTIKLVQKGLNPKLAIEGILLTMYDGRINLSRQVSEE-----IRTHFGSLAFQTVVPRNVRLSEAPSHGR-PIILYDITSKGAVTYMELAKELM 250
>gi|57505334|ref|ZP_00371263.1| parA family protein Cj0100 [Campylobacter upsaliensis RM3195] >gi|57016470|gb|EAL53255.1| parA family protein Cj0100 [Campylobacter upsaliensis RM3195] (261 aa)
Score = 242, Expect = 8.2e-19, Identities = 77/249 (30%), Positives = 131/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN-----FISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL++  KKV+++D+D Q N     G   ++ E+ I     G+    DI++K +   LH+ P N  L   +  L + +  +  + ML  +L+E+   YD++IID+PPA+  +     +  D  ++P + + YA  G+  ++N  K  K+  N  +K+   +PT  +++  +  D++E  LK   K Q   + S+      I    K   +  + + PI++   KS     Y NL   IL
  S:     5 ITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANATTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELSQLHLAPSNIGLVGIEQELAKDEGNEKKM-MLKRQLEEVVDKYDFIIIDSPPALGNITINAFAASDSVIIPIQCEFYALEGVAMVLNTIKIIKKTINPKLKVRGFLPTMYSSQNNLSKDVVE-DLKQNFKKQLFKMKSSEDDFIIIPRNVKLAESPSFGK-PIILYDIKSPGSLAYQNLAYCIL 260
>gi|194367738|ref|YP_002030348.1| Cobyrinic acid ac-diamide synthase [Stenotrophomonas maltophilia R551-3] >gi|194350542|gb|ACF53665.1| Cobyrinic acid ac-diamide synthase [Stenotrophomonas maltophilia R551-3] (265 aa)
Score = 242, Expect = 8.4e-19, Identities = 58/176 (32%), Positives = 94/176 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT + NLAASL+   K+V++VDLD QGN     G    +L  +  D L G+    D+ ++  E   +LPGN +L   +  L  +   +  LK  +  + + YDY++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +
  S:     5 IAIANQKGGVGKTTTAVNLAASLANAPKRVLLVDLDSQGNATMGSGVDKRELVSSTYDLLLGESSAADVRVQTAEGYDLLPGNIDLTAAEIQLMAQSEREQRLKRALAPIRDEYDYILIDCPPALSLLTLNALAAADSVIVPMQCEYYALEGLSALVETIEALRANLNPALEIEGV 180
>gi|190576400|ref|YP_001974245.1| putative chromosome partitioning protein [Stenotrophomonas maltophilia K279a] >gi|190014322|emb|CAQ47969.1| putative chromosome partitioning protein [Stenotrophomonas maltophilia K279a] (265 aa)
Score = 242, Expect = 8.6e-19, Identities = 62/176 (35%), Positives = 96/176 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFA--IMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT + NLAASL+   K+V++VDLD QGN  AT G   D  E A    D L G+    D+ ++  E   +LPGN +L   +  L  +   +  LK  +  + + YDY++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +
  S:     5 IAIANQKGGVGKTTTAVNLAASLANAPKRVLLVDLDSQGN--ATMGSGVDKRELAASTCDLLLGENSAADVRVQTAEGYDLLPGNIDLTAAEIQLMGQSEREQRLKRALAPIRDEYDYILIDCPPALSLLTLNALAAADSVIVPMQCEYYALEGLSALVETIEALRTSLNPALEIEGV 180
>gi|157964124|ref|YP_001498948.1| ATPase involved in chromosome partitioning [Rickettsia massiliae MTU5] >gi|157843900|gb|ABV84401.1| ATPase involved in chromosome partitioning [Rickettsia massiliae MTU5] (255 aa)
Score = 241, Expect = 8.7e-19, Identities = 76/249 (30%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+ ++  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  ++K N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGISQQQRKNTIYQVLTNLIELKDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLEEIKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGALVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCSGAVAYIELTKEIL 249
>gi|118727519|ref|ZP_01576117.1| Cobyrinic acid a,c-diamide synthase [Clostridium cellulolyticum H10] >gi|118663096|gb|EAV69759.1| Cobyrinic acid a,c-diamide synthase [Clostridium cellulolyticum H10] (257 aa)
Score = 241, Expect = 9.0e-19, Identities = 68/251 (27%), Positives = 130/251 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT + NL++ L+  GKKV+++D+D QGN  +  G    +++ ++ D +      E+ L++   + L I P N +L   +  L      ++ LK  +  + + +D++IID PP++ ++   +L+  D  LVP + + YA  GL +++N  K  +   N  +++  +  T  + R  +   ++E+      K  G  V    I    + + A  +  +PI++   KSK  + Y +L +E++ Y
  S:     5 IAIANQKGGVGKTTTAVNLSSCLAYKGKKVLVIDIDPQGNTTSGLGIDKKNIKHSVYDVIINDEPIENTLLEACIDGLMICPSNIQLAGAEVELVSMISRENRLKSALYYIRKEFDFIIIDCPPSLGLLTLNSLTASDTILVPIQCEYYALEGLSQLMNTVKLVQRHLNPQLEVEGVVLTMFDARTNLSIQVVEEV----KKYFGNRVYRTIIPRNVRLSEAPSFG-LPIILYDAKSKGAECYIDLAEEVIEY 252
>gi|53724005|ref|YP_104451.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei ATCC 23344] >gi|67643081|ref|ZP_00441830.1| COG1192: ATPases involved in chromosome partitioning [Burkholderia mallei GB8 horse 4] >gi|76810894|ref|YP_331604.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 1710b] >gi|121601597|ref|YP_994644.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei SAVP1] >gi|124385337|ref|YP_001027577.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei NCTC 10229] >gi|126439560|ref|YP_001060973.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein [Burkholderia pseudomallei 668] >gi|126451025|ref|YP_001082525.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei NCTC 10247] >gi|126453932|ref|YP_001068273.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein [Burkholderia pseudomallei 1106a] >gi|134281539|ref|ZP_01768247.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 305] >gi|161359672|ref|ZP_02105539.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 1106b] >gi|161371874|ref|ZP_02111437.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 1710a] >gi|167001262|ref|ZP_02267061.1| chromosome partitioning protein ParA [Burkholderia mallei PRL-20] >gi|167721834|ref|ZP_02405070.1| chromosome partitioning protein ParA [Burkholderia pseudomallei DM98] >gi|167740806|ref|ZP_02413580.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 14] >gi|167818021|ref|ZP_02449701.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 91] >gi|167826384|ref|ZP_02457855.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 9] >gi|167847903|ref|ZP_02473411.1| chromosome partitioning protein ParA [Burkholderia pseudomallei B7210] >gi|167896460|ref|ZP_02483862.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 7894] >gi|167904862|ref|ZP_02492067.1| chromosome partitioning protein ParA [Burkholderia pseudomallei NCTC 13177] >gi|167913140|ref|ZP_02500231.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 112] >gi|167921077|ref|ZP_02508168.1| chromosome partitioning protein ParA [Burkholderia pseudomallei BCC215] >gi|194316839|ref|YP_002012833.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei ATCC 10399] >gi|194502154|ref|YP_002031732.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 1655] >gi|194512643|ref|YP_002025167.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei Pasteur 52237] >gi|194518127|ref|YP_002053670.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei S13] >gi|194523411|ref|YP_002058943.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei FMH] >gi|194528397|ref|YP_002063919.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei JHU] >gi|194569802|ref|YP_002104804.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 406e] >gi|194576160|ref|YP_002111043.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei 2002721280] >gi|52427428|gb|AAU48021.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei ATCC 23344] >gi|76580347|gb|ABA49822.1| chromosome partitioning protein ParA [Burkholderia pseudomallei 1710b] >gi|121230407|gb|ABM52925.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei SAVP1] >gi|124293357|gb|ABN02626.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei NCTC 10229] >gi|126219053|gb|ABN82559.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 668] >gi|126227574|gb|ABN91114.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 1106a] >gi|126243895|gb|ABO06988.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei NCTC 10247] >gi|134247206|gb|EBA47292.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 305] >gi|147747421|gb|EDK54497.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei FMH] >gi|147752407|gb|EDK59473.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei JHU] >gi|148026481|gb|EDK84566.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei 2002721280] >gi|157808546|gb|EDO85716.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 406e] >gi|157934184|gb|EDO89854.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei Pasteur 52237] >gi|160695994|gb|EDP85964.1| sporulation initiation inhibitor protein Soj [Burkholderia mallei ATCC 10399] >gi|169651450|gb|EDS84143.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei S13] >gi|184214566|gb|EDU11609.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Burkholderia pseudomallei 1655] (256 aa)
Score = 241, Expect = 9.0e-19, Identities = 57/191 (29%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN     G    + E  + + L       D  ++ +     +LP N EL   +  L   +  +  LK  + K+ + YD+V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGNATMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENRERQLKAALAKVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|170016608|ref|YP_001727527.1| ParaA family ATPase [Leuconostoc citreum KM20] >gi|169803465|gb|ACA82083.1| ATPase, ParA family [Leuconostoc citreum KM20] (253 aa)
Score = 241, Expect = 9.7e-19, Identities = 52/176 (29%), Positives = 97/176 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT S NL A+L+ DG++V++VD+D QGN  +  G    +L     D +       D+++  T+N  +LP   +L+  +  L  ++  +  L+  +  + + YD+++ID PPA+ ++     +  D  L+P + + YA  GL +++N  +  +++ N ++ I  I
  S:     5 IALANQKGGVGKTTTSINLGAALAQDGQRVLLVDIDAQGNATSGSGIDKSELALDSYDVIVDGAALRDVIVP-TDNYDLLPATIQLSGAEIELATQKQREYRLQKALMTVSDDYDFILIDNPPALGLLTVNAFTAADAILIPVQTEFYALEGLGQLLNTIELVRKQFNESLDIAGI 179
>gi|67458509|ref|YP_246133.1| ATPase involved in chromosome partitioning [Rickettsia felis URRWXCal2] >gi|67004042|gb|AAY60968.1| ATPases involved in chromosome partitioning [Rickettsia felis URRWXCal2] (255 aa)
Score = 241, Expect = 1.1e-18, Identities = 77/249 (30%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+ ++  LYDYVIID PP+++++    L   D  L+P + D Y+  GL  ++   +  ++K N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGISQQQRKNTIYQVLTNLIKLKDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLEEIKILYDYVIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCSGAVAYIELTKEIL 249
>gi|188527922|ref|YP_001910609.1| SpoOJ regulator (soj) [Helicobacter pylori Shi470] >gi|188144162|gb|ACD48579.1| SpoOJ regulator (soj) [Helicobacter pylori Shi470] (265 aa)
Score = 241, Expect = 1.1e-18, Identities = 71/249 (28%), Positives = 132/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGN-----DELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKP------KLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAASL++  KK++++D D Q N  ++ G + D +++ I   L G+     +++K +   L ++P N      E  ++D + ++ +  +  LK  +  +  LYDY+IID+PPA+  +   +LS     ++P + + +A  G K ++N  +  ++  N  +KI   +PT    ++ +   ++ +  K       +  T G Y+    I  + K   +  + + PI++   KS     Y  L + IL
  S:     6 IAVANQKGGVGKTTTAVNLAASLAVHEKKILLIDFDPQANATSSLGFRRDKIDYDIYHVLIGRKQISQVILKTQMPFLDLVPSNLGLAGFEKTFYDSVQDENKRGELMLKNALESVVGLYDYIIIDSPPALGPLTINSLSAAHSVIIPIQCEFFALEGTKLLLNTIRMLQKSTNPKLKIRGFLPTMHVPQLNLTKGVLAELFKYFDSEFFRDSTTGEYI---MIPKSVKLAESPSFGK-PILLYDIKSNGSVAYQKLAQSIL 263
>gi|53721013|ref|YP_109999.1| chromosome partitioning protein ParA [Burkholderia pseudomallei K96243] >gi|52211427|emb|CAH37418.1| chromosome partitioning protein ParA [Burkholderia pseudomallei K96243] (264 aa)
Score = 241, Expect = 1.1e-18, Identities = 57/191 (29%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN     G    + E  + + L       D  ++ +     +LP N EL   +  L   +  +  LK  + K+ + YD+V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:    15 VANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGNATMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENRERQLKAALAKVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 207
>gi|23013874|ref|ZP_00053725.1| COG1192: ATPases involved in chromosome partitioning [Magnetospirillum magnetotacticum MS-1] (363 aa)
Score = 240, Expect = 1.2e-18, Identities = 72/266 (27%), Positives = 123/266 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRETSVNNGNQE 268
           + + N KGG+ KTT STNLA  L+  GK V+++DLD QG+   + G  P   +  I D        ED++++   E + +LP    L   +  L++ Q +Q  L  +++      DYV+ID PPA+ ++    L+     ++P     YA  GL R + + K  +E  N N+ +  +   +N +      I E  ++ +L   G    +     TT   AA    R+P+ +   KS     + +  +E +     GR  ++   N E
  S:     6 VAIFNQKGGISKTTTSTNLAVCLAAFGKSVVVIDLDSQGDSTKSLGIDPKTKQ-GIYDLFTNGAAVEDVMVETMFEGVRVLPSTYSLAGIEIKLSEMQNSQRTLSNILSHTALDCDYVVIDCPPALGILPINALASAHGVIIPVTATPYANDGLLRTLPSIKYVQEGLNKNLLLQGVLFTINDKNKTTRKINEL-IRSRLG--GTVYRTEIPRDTTVIEAATA--RLPVCVFAPKSPAAQAHLDFTEEFI-----GRHVAIAAKNNE 261
>gi|52788041|ref|YP_093870.1| hypothetical protein BLi04369 [Bacillus licheniformis ATCC 14580] >gi|52350543|gb|AAU43177.1| Soj [Bacillus licheniformis DSM 13] (253 aa)
Score = 240, Expect = 1.2e-18, Identities = 70/248 (28%), Positives = 128/248 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I + N KGGV KTT S NL A L+  GK+V++VD+D QGN  +  G +  D++  + D L      +D++     ENL ++P   +L   +  L      +  LK  +  + + YD++IID PP++ ++    L+  D  ++P + + YA  GL +++N+ +  ++  N ++ I  +  T ++ R  +   +IE+    K     VY T   I    + + A  + + PI++   +S+  + Y  L KE+
  S:     5 IAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGIGVEKADVDQCVYDILVDDADVKDVIKTTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALESVKQNYDFMIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNSVRLVQKHLNTDLMIDGVLLTMLDARTNLGIQVIEEV--KKYFRDKVYKT--VIPRNVRLSEAPSHGK-PIILYDPRSRGAEVYLELAKEV 249
>gi|157737836|ref|YP_001490520.1| ATPases involved in chromosome partitioning ParA [Arcobacter butzleri RM4018] >gi|157699690|gb|ABV67850.1| ATPases involved in chromosome partitioning ParA [Arcobacter butzleri RM4018] (258 aa)
Score = 240, Expect = 1.2e-18, Identities = 66/173 (38%), Positives = 99/173 (57%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG-KCYWEDILIKKTENLHILPGNDELNYF--DFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           I + N KGGV KTT + NL+A+L+L+GKKV+++D D Q N   + G   D  E+ I   + G K   E IL  + ENL + P N  L     +F  N K+  +  LK  I+ +   YDYVIID+PPA+  +   TLS     L+P + + +A  GL +++N  K  K+  N +++I
  S:     5 ISIANQKGGVGKTTTAVNLSAALALEGKKVLLIDADPQANATTSLGFHRDTYEYNIYHVMLGTKELNEIILDSEIENLKVAPSNIGLVGIEKEFYKNTKE-RELVLKRKIDTVKSDYDYVIIDSPPALGPITINTLSASTSVLIPIQCEFFALEGLAQLLNTIKLVKQTINQSLQI 179
>gi|77456670|ref|YP_346175.1| cobyrinic acid a,c-diamide synthase [Pseudomonas fluorescens PfO-1] >gi|77380673|gb|ABA72186.1| Cobyrinic acid a,c-diamide synthase [Pseudomonas fluorescens PfO-1] (256 aa)
Score = 240, Expect = 1.3e-18, Identities = 67/211 (31%), Positives = 109/211 (51%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + ++VDLD Q N      G   DD+   I DF K         K    DI     +NLHI+    EL      L  K    + L+ L+++L E YD + +DTPPA++    + L   D  L+PF+ D ++   L  +I    E KE +N ++++  I   +   R ++   I+++ +   L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSASEGYRTLLVDLDAQANSTQYLTGLTGDDIPMGIADFFKQTLSSGPFSKKNQADIYETPFDNLHIITATAELADLQPKLEAKHKI-NKLRKLLDELSEDYDRIYLDTPPALNFYAVSALIAADRVLIPFDCDSFSRQALYGLIAEIDELKEDHNEDLEVEGIVVNQFQARASLPQQILDELIAEGLPVLPVYLASS 220
>gi|159045997|ref|YP_001534791.1| cobyrinic acid ac-diamide synthase [Dinoroseobacter shibae DFL 12] >gi|157913757|gb|ABV95190.1| Cobyrinic acid ac-diamide synthase [Dinoroseobacter shibae DFL 12] (268 aa)
Score = 240, Expect = 1.3e-18, Identities = 69/249 (27%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL  +L++ GK V+I+DLD QGN     G  P+       D L       D+  + + ENL + P   +L+  D  L         L+  + +L+ L    DYV++D PP+++++    +   D  LVP + + +A  GL +++ + +E +E  N  ++I  I   +  R    +  +E+  +  L   G  V    I    + + A  +  +P++     S+    Y  L  EIL
  S:    13 IAIANQKGGVGKTTTTINLGTALTMRGKTVLIIDLDPQGNASTGLGMAPETRSLTTYDLLVENAAIADVSRETSVENLFLAPATTDLSSADIELMSNSRRVFRLRAALTQLNALPKRVDYVLVDCPPSLNLLTVNAMVAADSVLVPLQSEFFALEGLSQLLLSVREVRETANPKLRIEGIVLTMYDRRNNLSRQVEEDARANL---GELVFKTIIPRNVRVSEAPSFA-MPVLRYDPSSQGSQAYLGLADEIL 261
>gi|160941475|ref|ZP_02088810.1| hypothetical protein CLOBOL_06366 [Clostridium bolteae ATCC BAA-613] >gi|158435621|gb|EDP13388.1| hypothetical protein CLOBOL_06366 [Clostridium bolteae ATCC BAA-613] (256 aa)
Score = 240, Expect = 1.4e-18, Identities = 58/199 (29%), Positives = 109/199 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKL 201
           I + N KGGV KTT + NL+A L+  G+ V++VD D QGN  +  G + +D +  + D +  +    + +IK+ + NL +LP +  L   +    + +  +  L   +N++ + YD++IID PP+++++    L+  D  LVP + + YA  GL +++      K K N  +++  +  T  + R  +  +++E S+K  L
  S:     5 ITIANQKGGVGKTTTAINLSACLAEAGQHVMLVDFDPQGNASSGLGLEQEDFDKTVYDMMIEEASVNECIIKEIQPNLDVLPSDMNLAGAEIEFQEVEDKEKLLSSCLNQVRDTYDFIIIDCPPSLNILTINALTAADTVLVPIQCEYYALEGLNQVLKTVDLVKRKLNPELELEGVVFTMYDARTNLSLEVVE-SVKSSL 204
>gi|154484000|ref|ZP_02026448.1| hypothetical protein EUBVEN_01708 [Eubacterium ventriosum ATCC 27560] >gi|149735042|gb|EDM50928.1| hypothetical protein EUBVEN_01708 [Eubacterium ventriosum ATCC 27560] (260 aa)
Score = 240, Expect = 1.4e-18, Identities = 69/249 (27%), Positives = 125/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFL-----KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL   L+  GK+V+++D D QG++  + G  +PD +E+++ + L     + +  +  I++K  EN+  +P N EL   +  +      +  +K  I+ + E YDY++ID  P++ ++    L   +  L+P +       GL+++I      + + N  +KI   + T V+ R     DI+E       +T G++ +   +S     T+A G     I +   K K    Y  L +E+L
  S:     5 IAIANQKGGVGKTTTTVNLGIGLARKGKRVLLIDADPQGSMTVSLGIDEPDKIEYSLANVLMDVVNEEEIDYAKIILKHEENIDFVPANIELAGLEVSMVNVMSRELVMKRFISDIKENYDYILIDCMPSLGMITINALVCANSVLIPVQASYLPVKGLQQLIKTISRVRRQINPELKIEGMVMTMVDMRSNYTKDILEALESTYGETIGIFDSRIPMSVRAAETSAEGKS---IYIHDPKGKVARSYEELTEEVL 257
>gi|167471198|ref|ZP_02335902.1| chromosome partitioning protein [Rickettsia africae ESF-5] (255 aa)
Score = 240, Expect = 1.4e-18, Identities = 76/249 (30%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+ ++  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  ++K N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGVSQQQRKNTIYQVLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLAEIKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCSGAVAYIELTKEIL 249
>gi|54023976|ref|YP_118218.1| putative chromosome partitioning ATPase [Nocardia farcinica IFM 10152] >gi|54015484|dbj|BAD56854.1| putative chromosome partitioning ATPase [Nocardia farcinica IFM 10152] (323 aa)
Score = 240, Expect = 1.4e-18, Identities = 66/250 (26%), Positives = 130/250 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK-STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           + + N KGGV KTT + NL A+L+  G++V++VDLD QG + A  G    DL+  + + L  G+   +D+L++ K EN+ +LP N +L+  +  L  +   +  L   +  + + YDY++ID  P++ ++    L+  D  ++P E + ++  GL  + +  ++ +++ N  + +  I   +     +H+    Q +   ++  G  V    I+ T +   A+V  E  PI     KS   + Y  + +E+++
  S:    72 VAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDLDPQGALSAGLGVAHHDLDLTVHNLLVGGRTSIDDVLMQTKVENMDLLPSNIDLSAAEIQLVNEVGREQTLGRALEPVRDRYDYILIDCQPSLGLLTVNALACSDGVIIPMECEYFSLRGLALLNDTVEKVRDRLNPRLSLYGIVVTMFDARLLHS---RQVMARVVEVFGDLVYDTAIARTVRFPDASVAGE--PITTWAPKSGGAEAYRAMAREVIH 319
>gi|15791488|ref|NP_281311.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237107|ref|YP_178119.1| ParA family chromosome partitioning ATPase [Campylobacter jejuni RM1221] >gi|86149563|ref|ZP_01067793.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151294|ref|ZP_01069509.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni 260.94] >gi|86154036|ref|ZP_01072237.1| sporulation initiation inhibitor protein soj [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88597645|ref|ZP_01100878.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613358|ref|YP_999824.1| ParA family chromosome partitioning ATPase [Campylobacter jejuni subsp. jejuni 81-176] >gi|153952401|ref|YP_001397354.1| ParA family chromosome partitioning ATPase [Campylobacter jejuni subsp. doylei 269.97] >gi|157414413|ref|YP_001481669.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni 81116] >gi|57165911|gb|AAW34690.1| chromosome partitioning protein, ParA family [Campylobacter jejuni RM1221] >gi|85839831|gb|EAQ57090.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841641|gb|EAQ58888.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842450|gb|EAQ59664.1| sporulation initiation inhibitor protein soj [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249072|gb|EAQ72034.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni 81-176] >gi|88189949|gb|EAQ93925.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359487|emb|CAL34271.1| parA family protein [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|152939847|gb|ABS44588.1| chromosome partitioning protein, ParA family [Campylobacter jejuni subsp. doylei 269.97] >gi|157385377|gb|ABV51692.1| parA family protein [Campylobacter jejuni subsp. jejuni 81116] (261 aa)
Score = 240, Expect = 1.5e-18, Identities = 74/249 (29%), Positives = 130/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN-----FISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL++  KKV+++D+D Q N     G   ++ E+ I     G+    DI++K +   LH+ P N  L   +  L + +  +  + +L N++ E+   YD++IID+PPA+  +     +  D  ++P + + YA  G+  ++N  K  K+  N  +++   +PT  +++  +  D+++  LK   K Q   +  N      I    K   +  + + PI++   KS     Y NL   IL
  S:     5 ITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANATTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELPQLHLAPSNIGLVGIEQELAKGENNEKKM-LLKNQIQEVIDEYDFIIIDSPPALGSITINAFAASDSVIIPIQCEFYALEGVAMVLNTIKIIKKTINSKLRVRGFLPTMYSSQNNLSKDVVD-DLKQNFKKQLFTINGNEDDFIVIPRNVKLAESPSFGK-PIILYDIKSPGSVAYQNLAYSIL 260
>gi|83942030|ref|ZP_00954492.1| chromosome partitioning protein ParA [Sulfitobacter sp. EE-36] >gi|83847850|gb|EAP85725.1| chromosome partitioning protein ParA [Sulfitobacter sp. EE-36] (266 aa)
Score = 239, Expect = 1.5e-18, Identities = 71/249 (28%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAA+L    ++V+++DLD QGN     G + DD EF   + L      +  I+  +TE LHI+    +L+  D  L  N+K+    +  +   ++D   +DY++ID PP+++++    +      LVP + + +A  GL +++   +E ++  N +++I  I   +  +    +  +EQ  +  L   G  V    I    + + A  Y  +P++     SK    Y +L KE+L
  S:    13 IAIANQKGGVGKTTTTINLAAALVEQKQRVLVIDLDPQGNASTGLGIELDDREFTTYELLLEDIDLDQVIMTTETEGLHIVAATVDLSSADMELIANEKRSFLLHDALRQTQMDSYAFDYILIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQSGNKDLRIEGILLTMYDQRNNLSQQVEQDARSNL---GELVYRTVIPRNVRVSEAPSYA-MPVLSYDSGSKGAKAYRDLAKEVL 261
>gi|160932441|ref|ZP_02079831.1| hypothetical protein CLOLEP_01276 [Clostridium leptum DSM 753] >gi|156868400|gb|EDO61772.1| hypothetical protein CLOLEP_01276 [Clostridium leptum DSM 753] (254 aa)
Score = 239, Expect = 1.5e-18, Identities = 70/248 (28%), Positives = 127/248 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK--PKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I V N KGGV KTT + NL+A++   G K ++VD+D QGN  +  G     +  +  + L G+   ++ L++ +  NL ILP +  L   +  L      ++ LK  +  L E Y+Y+ ID PP++ ++    L   D  LVP + + YA  GL +++N+ +  K + N  ++I  +  T  + R+ +   ++E+  K  P+       V  + I  + + + A  Y  VPI+     ++  + Y +L +E+
  S:     5 IAVANQKGGVGKTTTAVNLSAAMGERGHKTLLVDIDPQGNASSGVGIDRRSVPKSTYELLIGEAGAKEALVQTQFPNLTILPSSLNLAGAELELVDFDHREARLKTALAPLREEYEYLFIDCPPSLGMITTNALCAADTLLVPIQCEYYALEGLSQLMNSVRRVKRQYNERLEIEGVLLTMYDGRLNLTQQVVEEVKKYFPR------KVFRSVIPRSVRLSEAPSYG-VPIMYFDKSNRGTEAYRSLAEEL 249
>gi|83311060|ref|YP_421324.1| ATPase involved in chromosome partitioning [Magnetospirillum magneticum AMB-1] >gi|82945901|dbj|BAE50765.1| ATPase involved in chromosome partitioning [Magnetospirillum magneticum AMB-1] (363 aa)
Score = 239, Expect = 1.5e-18, Identities = 72/266 (27%), Positives = 122/266 (45%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRETSVNNGNQE 268
           + + N KGG+ KTT STNLA  L+  GK V+++DLD QG+   + G  P   +  I D        ED+++    E + +LP    L   +  L++ Q +Q  L  +++      DYV+ID PPA+ ++    L+     ++P     YA  GL R + + K  +E  N N+ +  +   +N +      I E  ++ +L   G    +     TT   AA    R+P+ +   KS     + +  +E +     GR  ++   N E
  S:     6 VAIFNQKGGISKTTTSTNLAVCLAAFGKSVVVIDLDSQGDSTKSLGIDPKTKQ-GIYDLFTNGAAVEDVMVDTMFEGVRVLPSTYSLAGIEIKLSEMQNSQRTLSNILSHTALDCDYVVIDCPPALGILPINALASAHGVIIPVTATPYANDGLLRTLPSIKYVQEGLNKNLLLQGVLFTINDKNKTTRKINEL-IRSRLG--GTVYRTEIPRDTTVIEAATA--RLPVCVFAPKSPAAQAHLDFTEEFI-----GRHVAIAAKNNE 261
>gi|34580955|ref|ZP_00142435.1| soj protein [Rickettsia sibirica 246] >gi|28262340|gb|EAA25844.1| soj protein [Rickettsia sibirica 246] (255 aa)
Score = 239, Expect = 1.6e-18, Identities = 76/249 (30%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+ ++  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  ++K N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFAAINKKILVIDLDPQGNSSTGFGISQQQRKNTIYQVLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLAEIKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCSGAVAYIELTKEIL 249
>gi|15892009|ref|NP_359723.1| soj protein [Rickettsia conorii str. Malish 7] >gi|157827960|ref|YP_001494202.1| soj protein [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932648|ref|YP_001649437.1| chromosome partitioning protein [Rickettsia rickettsii str. Iowa] >gi|15619124|gb|AAL02624.1| soj protein [Rickettsia conorii str. Malish 7] >gi|157800441|gb|ABV75694.1| soj protein [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165907735|gb|ABY72031.1| chromosome partitioning protein [Rickettsia rickettsii str. Iowa] (255 aa)
Score = 239, Expect = 1.6e-18, Identities = 76/249 (30%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+ ++  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  ++K N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGISQQQRKNTIYQVLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLAEIKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCSGAVAYIELTKEIL 249
>gi|90023650|ref|YP_529477.1| chromosome segregation ATPase [Saccharophagus degradans 2-40] >gi|89953250|gb|ABD83265.1| chromosome segregation ATPase [Saccharophagus degradans 2-40] (266 aa)
Score = 239, Expect = 1.6e-18, Identities = 57/189 (30%), Positives = 99/189 (52%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI 192
            + N KGGV KTT   NLAASL+   K+V+++DLD QGN     G   +  EF I D L G    E+ L K  +  + +LP N +L   +  +      +  LK  ++ +   +DY++ID PP+++++    L+  D  ++P + + YA  G+  ++N     +   N N++I  +  T  + R ++  D+
  S:     6 AIANQKGGVGKTTTCVNLAASLAATKKRVLLIDLDPQGNATMGSGVDKNSQEFTIYDVLVGLTRCENALQKSPDGHYMVLPANGDLTAAEVEMLTLDNKEYRLKTALSSIRNSFDYILIDCPPSLNMLTVNALAACDGVIIPMQCEYYALEGVSALVNTINTIQNALNPNLRIEGVLRTMYDPRNSLTGDV 196
>gi|57504656|ref|ZP_00370734.1| parA family protein Cj0100 [Campylobacter coli RM2228] >gi|57019425|gb|EAL56120.1| parA family protein Cj0100 [Campylobacter coli RM2228] (261 aa)
Score = 239, Expect = 1.8e-18, Identities = 76/249 (30%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN-----FISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL++  KKV+++D+D Q N     G   ++ E+ I     G+    DI++K +   LH+ P N  L   +  L + +  +  + +L N++ E+   YD++IID+PPA+  +        D  ++P + + YA  G+  ++N  K  K+  N  +K+   +PT  +++  +  D++E  LK   K Q   +  N      I    K   +  + + PI++   KS     Y NL   IL
  S:     5 ITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANATTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELPQLHLAPSNIGLVGIEQELAKGENNEKKM-ILKNQIQEVLDEYDFIIIDSPPALGSITINAFVASDSVIIPIQCEFYALEGVAMVLNTIKIIKKTINPKLKVRGFLPTMYSSQNNLSKDVVE-DLKQNFKKQLFTINGNEDDFIVIPRNVKLAESPSFGK-PIILYDIKSPGSLAYQNLAYSIL 260
>gi|161170272|gb|ABX59242.1| partitioning protein ParA [uncultured marine bacterium EB000_55B11] (261 aa)
Score = 239, Expect = 1.9e-18, Identities = 61/165 (36%), Positives = 94/165 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKLDEL--YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKE 167
           + + N KGGV KTT + N+AA+++ +G KV++VDLD QGN     G  PDD EF   D L  G    + I+    +NL I+  N +L+  D  L+N K      L  L N L+ +  +DY+ ID PP+++++     +  D  LVP + + YA  GL ++I   +E +E
  S:     9 VSIANQKGGVGKTTTAINMAAAIARNGHKVLVVDLDPQGNASTGLGISPDDREFTAYDVLVDGVDIQKAIVETNVKNLSIVTSNTDLSSADAELMNDK----GRLIRLRNSLEGIRHFDYIFIDCPPSLNLLTINAFAASDSVLVPLQSEFYALEGLSQLILTVREVRE 173
>gi|114769776|ref|ZP_01447386.1| chromosome partitioning protein ParA [alpha proteobacterium HTCC2255] >gi|114549481|gb|EAU52363.1| chromosome partitioning protein ParA [alpha proteobacterium HTCC2255] (261 aa)
Score = 239, Expect = 1.9e-18, Identities = 61/165 (36%), Positives = 94/165 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKLDEL--YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKE 167
           + + N KGGV KTT + N+AA+++ +G KV++VDLD QGN     G  PDD EF   D L  G    + I+    +NL I+  N +L+  D  L+N K      L  L N L+ +  +DY+ ID PP+++++     +  D  LVP + + YA  GL ++I   +E +E
  S:     9 VSIANQKGGVGKTTTAINMAAAIARNGHKVLVVDLDPQGNASTGLGISPDDREFTAYDVLVDGVDIQKAIVETNVKNLSIVTSNTDLSSADAELMNDK----GRLIRLRNSLEGIRHFDYIFIDCPPSLNLLTINAFAASDSVLVPLQSEFYALEGLSQLILTVREVRE 173
>gi|192809487|ref|ZP_03038162.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. Y412MC10] >gi|192802158|gb|EDV78663.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. Y412MC10] (253 aa)
Score = 238, Expect = 2.0e-18, Identities = 73/251 (29%), Positives = 128/251 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT S NL A L+  GK+V++VD+D QGN  +  G    D+   I D +  + + +D I     E L I+P   +L   +  L      +  LK  +  +   YDY++ID PP++ ++   +L+  D  ++P + + YA  GL +++N  +  ++  N ++KI  +  T ++ R  +   +IE+    K   + VY T   I    + + A  + +  I+    +SK  + Y  L KE+++Y
  S:     5 IAIANQKGGVGKTTTSVNLGAGLASLGKRVLLVDIDPQGNTTSGVGINKADVANCIYDIIINEVHPKDAICGTNIEGLDIIPATIQLAGAEIELVPTISREVRLKKSLQLVKPQYDYILIDCPPSLGILTINSLTAADSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLKIEGVLLTMLDARTNLGIQVIEEV--KKYFQEKVYKT--IIPRNIRLSEAPSHGQ-SIITYDPRSKGAEVYLELAKEVISY 252
>gi|114332387|ref|YP_748609.1| cobyrinic acid a,c-diamide synthase [Nitrosomonas eutropha C91] >gi|114309401|gb|ABI60644.1| chromosome segregation ATPase [Nitrosomonas eutropha C91] (254 aa)
Score = 238, Expect = 2.1e-18, Identities = 73/249 (29%), Positives = 121/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDI-LIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQ-GVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + + N KGGV KTT S NLAASL+  GK+V++VDLD QGN     G     L+  +   L G+     + L  K     +LP N EL   +  +   +  +S LK  +  +   YD+++ID PPA++++    L      ++P + + YA  GL  ++N  K  +   N +++I   + T  + R     +++ Q +  +LK   G  V    I    +   A G+  +P++    +S+    Y  L  EIL
  S:     5 LAIANQKGGVGKTTTSINLAASLASIGKRVLLVDLDPQGNTTMGSGVDKRLLDHTVYQILLGEQTIAKVRLSTKPGKYDLLPANQELAGAEVEMVSLEQRESRLKEALQAIQADYDFILIDCPPALNLLTLNGLCAAHAVIIPMQCEYYALEGLSDLVNTIKRVRMGFNPSIRIEGLLRTMFDPR-----NLLAQQVSDQLKQHFGNKVYQTIIPRNIRLAEAPGFG-LPVLYHDRQSRGARAYLELANEIL 250
>gi|159037539|ref|YP_001536792.1| cobyrinic acid ac-diamide synthase [Salinispora arenicola CNS-205] >gi|157916374|gb|ABV97801.1| Cobyrinic acid ac-diamide synthase [Salinispora arenicola CNS-205] (307 aa)
Score = 238, Expect = 2.1e-18, Identities = 68/249 (27%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK---STAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A+L+  G+KV++VD D QG +    G  P +L+ ++ + L +     +D+LIK     LH+LP N +L+  +  L  +   +  L  ++  + + YD+++ID  P++ ++    L++    L+P E + ++  G+  +++   + +E+ N ++++  I   +    T H     Q L+  ++  G  V    I+ T K   ST A      PI      S     Y  L +E++
  S:    55 IAMANQKGGVGKTTTTINLGAALAEYGRKVLLVDFDPQGALSVGLGVNPHNLDLSVYNLLMQDDVTCDDVLIKTDVAGLHLLPANIDLSAAEIQLVNEVAREMALARVLKSIRKEYDFILIDCQPSLGLLAINALTVSHGVLIPLECEFFSLRGVALLLDTIDKVRERLNFDLELEGILATMYDSRTTH---CRQVLQRVVEAFGDKVYQTVITKTVKFPESTVA----GAPITTLDPASSGARNYRQLAREVI 301
>gi|157825214|ref|YP_001492934.1| soj protein [Rickettsia akari str. Hartford] >gi|157799172|gb|ABV74426.1| soj protein [Rickettsia akari str. Hartford] (255 aa)
Score = 238, Expect = 2.1e-18, Identities = 75/249 (30%), Positives = 119/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG +    +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+ ++  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  +++ N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGIRQQQRKNTIYQVLTNLIELKDAIISTDIPNLAIVTSNTNLSAAELDLTKLKDREYILMKLLEEIKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKRLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCSGAVAYIELTKEIL 249
>gi|52082642|ref|YP_081433.1| chromosome partitioning protein transcriptional regulator [Bacillus licheniformis ATCC 14580] >gi|52005853|gb|AAU25795.1| chromosome partitioning protein transcriptional regulator [Bacillus licheniformis ATCC 14580] (262 aa)
Score = 238, Expect = 2.2e-18, Identities = 70/248 (28%), Positives = 128/248 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           I + N KGGV KTT S NL A L+  GK+V++VD+D QGN  +  G +  D++  + D L      +D++     ENL ++P   +L   +  L      +  LK  +  + + YD++IID PP++ ++    L+  D  ++P + + YA  GL +++N+ +  ++  N ++ I  +  T ++ R  +   +IE+    K     VY T   I    + + A  + + PI++   +S+  + Y  L KE+
  S:    14 IAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGIGVEKADVDQCVYDILVDDADVKDVIKTTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALESVKQNYDFMIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNSVRLVQKHLNTDLMIDGVLLTMLDARTNLGIQVIEEV--KKYFRDKVYKT--VIPRNVRLSEAPSHGK-PIILYDPRSRGAEVYLELAKEV 258
>gi|91206165|ref|YP_538520.1| ATPase [Rickettsia bellii RML369-C] >gi|157826533|ref|YP_001495597.1| ATPase [Rickettsia bellii OSU 85-389] >gi|91069709|gb|ABE05431.1| ATPase [Rickettsia bellii RML369-C] >gi|157801837|gb|ABV78560.1| ATPase [Rickettsia bellii OSU 85-389] (257 aa)
Score = 237, Expect = 2.6e-18, Identities = 76/249 (30%), Positives = 120/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I VVN KGGV KTT + NLA +L+   KKV+++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L + +  +  L  L+  +  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  +++ N  +KI  I   +  R     + +E+ ++  L   G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     6 ISVVNQKGGVAKTTTTVNLATALAAMDKKVLVIDLDPQGNSSTGFGVSQQQRKNTIYQALTNIIKLKDTIISTDIPNLEIITSNTNLSAAELDLIKLEEREYILMKLLEGIKVLYDYIIIDCPPSLNLLTINALVAGDEVLIPMQCDFYSLEGLSHLLKTVEIVEKRLNPKIKITGILFTMYDRRNRLTEQVEEDVRSCL---GELVFKTVIPRNIKLSEAPSYGK-PAIIYDYKCAGAVAYMELTKEIL 251
>gi|83856844|ref|ZP_00950373.1| SpoOJ regulator protein [Croceibacter atlanticus HTCC2559] >gi|83850644|gb|EAP88512.1| SpoOJ regulator protein [Croceibacter atlanticus HTCC2559] (254 aa)
Score = 237, Expect = 2.7e-18, Identities = 60/196 (30%), Positives = 106/196 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +E      L+     E+ +IK ++ NL ILP + +L   +  L  +   +  L+ +I  +   YDYVIID  P++ ++    L+  D  ++P + + +A  GL +++N  K  +  +N ++ I   + T  + R+ + N ++++  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVESVEIGTYQILEHTAKPEEAIIKTESPNLDILPAHIDLVAIEIELVDQDEREYMLRKVIRDIAASYDYVIIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQRIHNKDLDIEGLLLTMYDQRLRLSNQVVDEVKK 202
>gi|20809120|ref|NP_624291.1| ATPase involved in chromosome partitioning [Thermoanaerobacter tengcongensis MB4] >gi|20517799|gb|AAM25895.1| ATPases involved in chromosome partitioning [Thermoanaerobacter tengcongensis MB4] (255 aa)
Score = 237, Expect = 2.7e-18, Identities = 73/249 (29%), Positives = 125/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT   NL  +L++ GKKV+ +D+D Q N+ + FG  P  L+      L  +   E+ ++K  +  L I+P + +L   +  L      +  LK  I  + E YDY++ID PP++ ++    L+  D  +VP + + YA  GL +++N     K+  N +++I  +  T  N R  +   ++++    K   + VY T   I    +   A  Y + PI +    SK  + Y +L +E++
  S:     5 IAVANQKGGVGKTTTVVNLGYALAVKGKKVLCIDIDPQSNMTSGFGVNPASLDHTTYTVLIDEEEIENAILKLEQYGLDIVPSSIQLAGAEIELVPMISREYRLKKAIESVKEKYDYILIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPSLEIEGVVLTMFNARTNLSIQVVDEV--KKFFKEKVYRT--IIPRNIRLGEAPSYGK-PISLYDPTSKGAEAYEDLAEEVI 250
>gi|126463648|ref|YP_001044762.1| cobyrinic acid a,c-diamide synthase [Rhodobacter sphaeroides ATCC 17029] >gi|126105312|gb|ABN77990.1| chromosome segregation ATPase [Rhodobacter sphaeroides ATCC 17029] (274 aa)
Score = 237, Expect = 2.7e-18, Identities = 72/248 (29%), Positives = 122/248 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           + + N KGGV KTT + NLAA L+  G ++++VDLD QGN     G + PD L+ +    L      E +L  +T+NL I P N +L   D  L  N+K+       +    ++   +DY++ID PP++S++    L   D  LVP + + +A  GL +++   +E +   N  +KI  +   +  +    + ++E   +  L   G  V    I    + + A  Y  +P++     SK  + Y  L +EI
  S:    13 LAIANQKGGVGKTTTAINLAAGLAELGARILVVDLDPQGNASTGLGIEAPDRLKTSYDLLLDRPDLDEVVLPTRTDNLFICPANADLASADIELAVNEKRSQLLREALRQQGMERFGFDYILIDCPPSLSLLTVNALIACDSVLVPLQSEFFALEGLSQLMLTIREVRGTANPALKIEGVLLTMYDKRNNLSQLVEGDARQNL---GDLVFRTMIPRNVRVSEAPSYA-LPVLSYDPTSKGSEAYRALAREI 260
>gi|120435163|ref|YP_860849.1| ParA-like ATPase [Gramella forsetii KT0803] >gi|117577313|emb|CAL65782.1| ParA-like ATPase [Gramella forsetii KT0803] (253 aa)
Score = 237, Expect = 2.7e-18, Identities = 59/196 (30%), Positives = 109/196 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  KK++++D D Q N  +  G   +++E      L+     E  + K +  NL I+P + +L   +  L  ++  +S LK  I  L +LYD+++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N+ + I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKILLIDADPQANATSGLGIDVEEVENGTYQLLEHSIKAEKAIQKTSSPNLDIIPAHIDLVAIEIELVDQENRESMLKKAIEPLRDLYDFILIDCAPSLGLLTLNALTASDSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNNKLDIEGLLLTMYDSRLRLSNQVVEEVKK 202
>gi|77464805|ref|YP_354309.1| chromosome segregation ATPase [Rhodobacter sphaeroides 2.4.1] >gi|77389223|gb|ABA80408.1| chromosome segregation ATPase [Rhodobacter sphaeroides 2.4.1] (274 aa)
Score = 237, Expect = 2.7e-18, Identities = 72/248 (29%), Positives = 122/248 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           + + N KGGV KTT + NLAA L+  G ++++VDLD QGN     G + PD L+ +    L      E +L  +T+NL I P N +L   D  L  N+K+       +    ++   +DY++ID PP++S++    L   D  LVP + + +A  GL +++   +E +   N  +KI  +   +  +    + ++E   +  L   G  V    I    + + A  Y  +P++     SK  + Y  L +EI
  S:    13 LAIANQKGGVGKTTTAINLAAGLAELGARILVVDLDPQGNASTGLGIEAPDRLKTSYDLLLDRPDLDEVVLPTRTDNLFICPANADLASADIELAVNEKRSQLLREALRQQGMERFGFDYILIDCPPSLSLLTVNALIACDSVLVPLQSEFFALEGLSQLMLTIREVRGTANPALKIEGVLLTMYDKRNNLSQLVEGDARQNL---GDLVFRTMIPRNVRVSEAPSYA-LPVLSYDPTSKGSEAYRALAREI 260
>gi|116053176|ref|YP_793497.1| hypothetical protein PA14_66480 [Pseudomonas aeruginosa UCBPP-PA14] >gi|115588397|gb|ABJ14412.1| putative ATPase nvolved in chromosome partitioning [Pseudomonas aeruginosa UCBPP-PA14] (255 aa)
Score = 237, Expect = 2.9e-18, Identities = 64/211 (30%), Positives = 113/211 (53%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + ++VDLD Q N      G   +DL   I DF K         K    DI     +NLHI+  + EL      L  K    + L+ L+++LDE YD + +DTPPA++    + L   D  L+PF+ D ++   L  ++   +E ++ +N ++++  I   +   R ++   ++++ +  +L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSAAEGYRTLLVDLDAQANSTHYLTGLTGEDLPVGIADFFKQTLSSGPFSKKGRVDIYETPFDNLHIVTSSPELADLQPKLESKHKI-NKLRKLLDELDEDYDRIYLDTPPALNFYTVSALIAADRCLIPFDCDSFSRQALYGLLQEIEELRDDHNEDLQVEGIVVNQFQPRASLPQQLLDELVAEELPVLPVYLMSS 220
>gi|86134027|ref|ZP_01052609.1| SpoOJ regulator protein [Tenacibaculum sp. MED152] >gi|85820890|gb|EAQ42037.1| SpoOJ regulator protein [Polaribacter dokdonensis MED152] (254 aa)
Score = 237, Expect = 3.0e-18, Identities = 72/249 (28%), Positives = 124/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +E+     L+     +D ++  +  N+ I+P + +L   +  L  KQ  +  LK  I  L   YDY+IID  P++ ++   +L   D  ++P + + +A  GL +++N  K  ++ +N ++ I   + T  ++R+ + N ++++      K     V +  I   T+   A  Y    I      SK    Y NL +E+L
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANASSGLGIDVEAVEYGTYQVLEHTISAKDAIVSTSSPNVDIIPAHIDLVAIEIELVDKQEREYMLKKSIEALKNEYDYIIIDCAPSLGLITLNSLVAADSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNADLDIEGLLLTMFDSRLRLSNQVVDEV----RKHFSSMVFNTIIRRNTRLGEAPSYGESIIAYDA-TSKGAVNYLNLAQELL 250
>gi|15616620|ref|NP_244926.1| centromere-like function involved in forespore chromosome partition [Bacillus halodurans C-125] >gi|12230554|sp|Q9K5N0|SOJ_BACHD Sporulation initiation inhibitor protein soj >gi|10176683|dbj|BAB07777.1| centromere-like function involved in forespore chromosome partition [Bacillus halodurans C-125] (253 aa)
Score = 237, Expect = 3.1e-18, Identities = 68/249 (27%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL+A L+  G++V++VD+D QGN  +  G +  D++  I D L      +D++     ENL +LP   +L+  +  L      +  LK  ++++   YD++ ID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N ++ I  +  T ++ R  +   +I++ +K   + +   V    I    +   A  +   PI+    KS+  + Y +L KE++
  S:     5 ISIANQKGGVGKTTTAVNLSACLAHLGQRVLLVDIDPQGNATSGVGIEKGDIDECIYDVLVEDVDTQDVIRTTNMENLDVLPSTIQLSGAEIELVSTISREVRLKRALDQVGRKYDFIFIDCPPSLGLLTINALTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEGVLLTMLDARTNLGIQVIDE-VKKYFREK---VFDTIIPRNVRLGEAPSHGE-PIIRYDAKSRGAEVYLDLAKEVV 250
>gi|169187381|ref|ZP_02847540.1| Cobyrinic acid ac-diamide synthase [Paenibacillus sp. JDR-2] >gi|169005390|gb|EDS52242.1| Cobyrinic acid ac-diamide synthase [Paenibacillus sp. JDR-2] (257 aa)
Score = 237, Expect = 3.1e-18, Identities = 70/251 (27%), Positives = 127/251 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT S NL A L+  G++V++VD+D QGN  +  G    D+   I D L    + +D + + K + L I+P   +L   +  +      +  LK  ++ + + +DY++ID PP++ ++   +L+  D  ++P + + YA  GL +++N  +  ++  N  ++I  +  T ++ R  +   +IE+    K   Q VY T   I    + + A  +    I     +SK  + Y  L KE++ Y
  S:     5 IAIANQKGGVGKTTTSVNLGACLATLGRRVLLVDIDPQGNTTSGIGINKADVNNCIYDVLINDVHPKDAMFETKIDGLKIIPATIQLAGAEIEMVPTISRELRLKKALSLVKDQFDYILIDCPPSLGLLTINSLTAADSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTALQIEGVLLTMLDARTNLGIQVIEEV--KKYFQQKVYQT--IIPRNVRLSEAPSHGEAIITYDP-RSKGAEVYLELAKEVIMY 252
>gi|89074719|ref|ZP_01161177.1| Putative ParA family protein [Photobacterium sp. SKA34] >gi|89049483|gb|EAR55044.1| Putative ParA family protein [Photobacterium sp. SKA34] (265 aa)
Score = 237, Expect = 3.1e-18, Identities = 58/193 (30%), Positives = 103/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV++VDLD QGN     G     ++    D L  +  + D++IK+T  + H++  N ++   +  L +    +  L+  + K+ + YDY+ ID PP+++++    ++  D  LVP + + +A  GL  +++   +     N  +KI   + T  + R  + N++ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATQRKVLVVDLDPQGNATMASGVDKYQVDATAYDLLVEETPFNDVVIKETTGDYHLIAANGDVTAAEIKLMEVFAREVRLRTALAKVRDDYDYIFIDCPPSLNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLTAVVNSELKIEGLLRTMFDPRNRLANEVSQQ 199
>gi|163726426|ref|ZP_02133939.1| Cobyrinic acid a,c-diamide synthase [Desulfatibacillum alkenivorans AK-01] >gi|161400324|gb|EDQ24579.1| Cobyrinic acid a,c-diamide synthase [Desulfatibacillum alkenivorans AK-01] (253 aa)
Score = 237, Expect = 3.2e-18, Identities = 71/251 (28%), Positives = 126/251 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT + NL+A+L+L  KK ++VD D QGN     G   + LE+++ + L G    +D++++ + + L +LP   EL   +  L      ++ LK ++  L   YDY+++D PP++S++    ++     +VP + + YA  GL ++    +  K   N  + I  I  T  ++R  + + + E++ +   K     V    I    +   A  + + PIV+    S     Y NL KE+L +
  S:     5 ICIANQKGGVGKTTTAVNLSAALALANKKTLLVDCDPQGNATTGMGIDKNSLEYSLYNALIGMAEPKDVVVQTEIDALAVLPAKIELIGSEVELIDSDNRETALKKVLAPLVGSYDYLVLDCPPSLSLLTINAMTAATAMIVPLQCEFYALEGLGQLFQTIRRIKGSVNPGLGIAGILLTMFDSRTNLSSQVAEEA-QSHFKD---LVFKTRIPRNVRLGEAPSFGK-PIVLYDKTSTGAVSYLNLAKEVLAF 252
>gi|114762199|ref|ZP_01441667.1| chromosome partitioning protein ParA [Roseovarius sp. HTCC2601] >gi|114545223|gb|EAU48226.1| chromosome partitioning protein ParA [Roseovarius sp. HTCC2601] (269 aa)
Score = 237, Expect = 3.2e-18, Identities = 74/249 (29%), Positives = 125/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVF----KSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A+L+  G K+++VDLD QGN     G +PDD ++   +  L      + IL    ENLH++P   +L+  D  L  N+K+    +  +   ++D+  +DYV+ID PP+++++    +      LVP + + +A  GL +++   +E ++  N +++I  +   + T     N++  Q         G  V S  I    + + A  Y      MSV     +SK    Y  L  E+L
  S:    13 IAIANQKGGVGKTTTTINLGAALAEKGLKILVVDLDPQGNSSTGLGIEPDDRQYTTYELLLDDVALDDAILPTDQENLHLIPATVDLSSADIELVSNEKRSFLLHDALRQTEIDQFGFDYVLIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTVREIRQSANPDLRIEGV---LLTMYDARNNLSRQVEDDARDNLGDLVFSTVIPRNVRVSEAPSY-----AMSVLNYDSQSKGAAAYRELADELL 261
>gi|110677824|ref|YP_680831.1| chromosome partitioning protein ParA [Roseobacter denitrificans OCh 114] >gi|109453940|gb|ABG30145.1| chromosome partitioning protein ParA [Roseobacter denitrificans OCh 114] (269 aa)
Score = 236, Expect = 3.3e-18, Identities = 71/249 (28%), Positives = 127/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDE---LYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAA+L+  G++V++VDLD QGN     G + +D ++   D L G    +D++++  T NL I+P   +L+  D  L   +     L   + +++      DYV+ID PP+++++    +      LVP + + +A  GL +++   +E ++  N +++I  I   +  +    +  +EQ  +  L   G  V S  I    + + A  +  +P++     SK    Y  L KE++
  S:    13 IAVANQKGGVGKTTTTINLAAALAEAGRRVLVVDLDPQGNASTGLGIEVEDRKYTTYDILLGDVDIKDVVLQTVTPNLLIVPATVDLSSADLELMSSEKRSFLLHDALRQIEMDGFNLDYVLIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTGNKDLRIEGILLTMYDKRNNLSLQVEQDARDNL---GDMVFSTRIPRNVRVSEAPSFA-MPVLTYDTMSKGAQAYRALAKELI 261
>gi|77166529|ref|YP_345054.1| cobyrinic acid a,c-diamide synthase [Nitrosococcus oceani ATCC 19707] >gi|76884843|gb|ABA59524.1| chromosome segregation ATPase [Nitrosococcus oceani ATCC 19707] (264 aa)
Score = 236, Expect = 3.3e-18, Identities = 72/249 (28%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NLAASL+   + V+++D+D QGN     G     L     D L         LIK  E N  +LP N +L   +  L      +  L++ + K+   YD ++ID PPA++++    L+  D  ++P + + YA  GL  ++N  +  +++ N  + I   + T  + R  + N++  Q     +   G  V S  I    +   A  Y + P+++    S+    Y  L KE+L
  S:     5 IAITNQKGGVGKTTTSVNLAASLAAHKRNVLLIDMDPQGNATTGSGIDKSSLLATTYDVLLEDLAPGSALIKLGEPNYTVLPANADLTAAEVELLSAAKREHRLRIALQKIRYDYDEILIDCPPALNMLTINALTAADGVVIPIQCEYYALEGLSALLNTIEGIRQRLNPQLHIAGLLRTMFDPRNNLANEVSSQL----MSHFGEQVYSTIIPRNVRLAEAPSYGK-PVMLYDRSSRGSVAYLVLAKEVL 250
>gi|15645753|ref|NP_207930.1| SpoOJ regulator (soj) [Helicobacter pylori 26695] >gi|2314295|gb|AAD08185.1| SpoOJ regulator (soj) [Helicobacter pylori 26695] (264 aa)
Score = 236, Expect = 3.6e-18, Identities = 75/249 (30%), Positives = 132/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDE---LYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKP------KLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAASL++  KK++++D D Q N  ++ G + D +++ I   L G+     +++K +   L ++P N  L  F+  F  +Q +  +  L ML N L+    LYDY+IID+PPA+  +   +LS     ++P + + +A  G K ++N  +  ++  N  +KI   +PT    ++ +   ++ +  K       +    G Y+    I  + K   +  + + PI++   KS     Y  L + IL
  S:     6 IAVANQKGGVGKTTTAVNLAASLAVHEKKILLIDFDPQANATSSLGFRRDKIDYDIYHVLIGRKQISQVILKTQMPFLDLVPSNLGLAGFEKTFYDSQDENKRGEL-MLKNALESVVGLYDYIIIDSPPALGPLTINSLSAAHSVIIPIQCEFFALEGTKLLLNTIRMLQKSTNPKLKIRGFLPTMHVPQLNLTKGVLAELFKYFDSEFFRDSATGEYI---MIPKSVKLAESPSFGK-PILLYDIKSNGSIAYQKLAQSIL 262
>gi|148543345|ref|YP_001270715.1| chromosome segregation ATPase [Lactobacillus reuteri F275] >gi|184152755|ref|YP_001841096.1| chromosome partitioning protein ParA [Lactobacillus reuteri F275] >gi|148530379|gb|ABQ82378.1| chromosome segregation ATPase [Lactobacillus reuteri F275] >gi|183224099|dbj|BAG24616.1| chromosome partitioning protein ParA [Lactobacillus reuteri F275] (256 aa)
Score = 236, Expect = 3.6e-18, Identities = 54/176 (30%), Positives = 97/176 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT S NL A L+  G++V+++DLD QGN  +  G +  +++ +I D L  +   ED++ K + E + I P    L+  +  L      ++ LK    ++ + YD+++ID PP++ ++     +  D  L+P + + YA  GL +++N  K  ++  N  +KI  +
  S:     5 IALANQKGGVGKTTTSVNLGACLAETGQRVLLIDLDPQGNATSGLGVEKQNIKQSIYDVLINEVPLEDVIQKTSHEGVDIAPTTIALSGAEVELTNLMARETRLKDSFGEIRQKYDFILIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVRKHFNPQLKIEGV 181
>gi|121592465|ref|YP_984361.1| chromosome segregation ATPase [Acidovorax sp. JS42] >gi|120604545|gb|ABM40285.1| chromosome segregation ATPase [Acidovorax sp. JS42] (256 aa)
Score = 236, Expect = 4.0e-18, Identities = 59/191 (30%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT S NLAA L+  G++V++VDLD QGN     G     LE ++ D  L+     E  ++ +     +L  N EL   +  L   +  +  LK  +  +D  YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N +++I+  +    + R+T+ + + EQ
  S:     7 IANQKGGVGKTTTSVNLAAGLAKIGQRVLLVDLDPQGNATMGSGVDKRALELSVYDVLLESASVPEAAVLSEQCGYRVLGANRELAGAEVELVPLEQRERRLKAALAAVDSDYDFVLIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVNTIKQVHANLNPDLQIIGLLRVMFDPRITLQSQVSEQ 199
>gi|145594468|ref|YP_001158765.1| cobyrinic acid a,c-diamide synthase [Salinispora tropica CNB-440] >gi|145303805|gb|ABP54387.1| Cobyrinic acid a,c-diamide synthase [Salinispora tropica CNB-440] (307 aa)
Score = 236, Expect = 4.1e-18, Identities = 67/249 (26%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK---STAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P +L+ ++ + L +     +D+LIK     LH+LP N +L+  +  L  +   +  L  ++  + + YD+++ID  P++ ++    L++    L+P E + ++  G+  +++   + +E+ N ++++  I   +    T H     Q L+  ++  G  V    I+ T K   ST A      PI      S     Y  L +E++
  S:    55 IAMANQKGGVGKTTTTINLGAALAEYGRRVLLVDFDPQGALSVGLGVNPHNLDLSVYNLLMQDDVTCDDVLIKTDVAGLHLLPANIDLSAAEIQLVNEVAREMALARVLKSIRKDYDFILIDCQPSLGLLAINALTVSHGVLIPLECEFFSLRGVALLLDTIDKVRERLNFDLELEGILATMYDSRTTH---CRQVLQRVVEAFGDKVYQTVITKTVKFPESTVA----GAPITTLDPASSGARNYRQLAREVI 301
>gi|149193998|ref|ZP_01871096.1| Cobyrinic acid a,c-diamide synthase [Caminibacter mediatlanticus TB-2] >gi|149135951|gb|EDM24429.1| Cobyrinic acid a,c-diamide synthase [Caminibacter mediatlanticus TB-2] (260 aa)
Score = 236, Expect = 4.1e-18, Identities = 74/249 (29%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDEL----NYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNF--ISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAASL++  KKV+++D D Q N  ++ G   +D E+ +   L G     D+++      L ++P N  L      FD+L +++ I    L+  I  L+  YDY+IIDTPP + ++    L+  D  ++P + + +A  GL +++   K  +   N  ++I   +PT  +++  +   ++   ++   +   +    NF  I    +   A  + + PI++   KSK    Y  L K+IL
  S:     5 ISVANQKGGVGKTTTAVNLAASLAIADKKVLLIDADPQANATSSLGFYKNDYEYNLYHVLIGSKNINDVILNTNLPTLDLIPSNIGLVGIEREFDYLEDKELI----LRKRIKDLNINYDYIIIDTPPTLGLITINALNASDSVIIPIQTEFFALEGLAQLMKTIKLLQHTTNPKLQIKGLLPTMYSSKNNLSKQVLADIIRHFREKLFIDKEGNFLVIPRNVRLAEAPSFGK-PILLYDIKSKGAVAYEMLAKKIL 256
>gi|21325868|dbj|BAC00489.1| ATPases involved in chromosome partitioning [Corynebacterium glutamicum ATCC 13032] (279 aa)
Score = 236, Expect = 4.1e-18, Identities = 68/228 (29%), Positives = 115/228 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGN-----DELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPI 230
           I + N KGGV KTT + NLAASL++ G KV++VDLD QGN     G +      +  + L G+C  ++ +   T  ENL  +P        E+     +  + ++  +  +  I+K D  +DY+IID PP++ ++    ++ V+  L+P + + YA  G+ +++N     ++  N  + I AI   + T      ++ EQ         G  V  N I  + K + A GY +  I
  S:    10 ITIANQKGGVGKTTSTVNLAASLAIHGLKVLVVDLDPQGNASTALGVEHRSGTLSSYELLIGECTADEAMQPSTANENLFCIPATLDLAGAEIELVSLVRREYRLADALGREFIDKHD--FDYMIIDCPPSLGLLTINAMTAVNEVLIPIQCEYYALEGVGQLLNNITMLRQHLNRQLHISAI---LLTMYDARTNLAEQVATEVNDHFGDVVLGNKIPRSVKVSEAPGYGQTVI 239
>gi|42519769|ref|NP_965699.1| chromosome partitioning protein ParA [Lactobacillus johnsonii NCC 533] >gi|41584059|gb|AAS09665.1| chromosome partitioning protein ParA [Lactobacillus johnsonii NCC 533] (257 aa)
Score = 236, Expect = 4.2e-18, Identities = 73/249 (29%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL AS++  G KV+IVD+D QGN  +  G +   ++  I + L  +    E I   +T+NL  +P   +L   +  L      ++ LK  I+++   YD+++ID PP++  +     +  D  L+P + + YA  GL +++N  +  ++  N N+ +  +  T ++ R  +  +++++        + VY T   I   TK   A  Y + PI     KS+    Y +L KE+L
  S:     5 ISVANQKGGVGKTTTTINLGASIANHGYKVLIVDIDPQGNATSGLGIEKSTVDKDIYNVLIDEIPLSETIHHTETKNLDAVPATIQLAGAEMELTSMMARETRLKQGIDEVSHEYDFILIDCPPSLGQLSINAFTASDSILIPVQSEYYAMEGLSQLLNTIRLVQKHFNKNLGVEGVLLTMLDARTNLGAEVVKEV--QSYFNKKVYKT--IIPRITKLAEAPSYGK-PITEYAPKSRGSQVYDSLAKEVL 250
>gi|68535951|ref|YP_250656.1| putative partitioning protein [Corynebacterium jeikeium K411] >gi|68263550|emb|CAI37038.1| putative partitioning protein [Corynebacterium jeikeium K411] (297 aa)
Score = 235, Expect = 4.3e-18, Identities = 67/252 (26%), Positives = 126/252 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL--KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + N+ ASL+  G+KV++VDLD QG + A  G   D+L+  + + L        + I     + L ++P N +L+  +  L  +   +  L   +  +   YD++I+D  P++ ++    LS  D  ++P E + ++  GL  +++   + +++ N  ++++ I   +  R T+H   + + L   ++  G  V  + I+ T +   T+  G    PI      S    +Y NL KE++  V
  S:    44 IAMCNQKGGVGKTTSTINIGASLAAFGRKVLLVDLDPQGALSAGLGISHDELDVTVYNLLVDSSASILDAIHSSPVDGLDVVPANIDLSAAEIQLVNEVGREQALARALRPVMRDYDFIIVDCQPSLGLLTVNALSCADSVIIPVESEYFSLRGLALLMDTVDKVRDRLNFKLEVLGILVTMFDRRTLHAREVMERL---VEAFGDKVFDSVITRTVRFPETSVAGE---PINTWAPSSSGAVQYSNLAKEVIERV 293
>gi|194467505|ref|ZP_03073492.1| Cobyrinic acid ac-diamide synthase [Lactobacillus reuteri 100-23] >gi|194454541|gb|EDX43438.1| Cobyrinic acid ac-diamide synthase [Lactobacillus reuteri 100-23] (256 aa)
Score = 235, Expect = 4.8e-18, Identities = 54/176 (30%), Positives = 97/176 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT S NL A L+  G++V+++DLD QGN  +  G +  +++ +I D L  +   ED++ K + E + I P    L+  +  L      ++ LK    ++ + YD+++ID PP++ ++     +  D  L+P + + YA  GL +++N  K  ++  N  +KI  +
  S:     5 IALANQKGGVGKTTTSVNLGACLAETGQRVLLIDLDPQGNATSGLGVEKQNIKQSIYDVLINEVPIEDVIQKTSHEGVDIAPTTIALSGAEVELTNLMARETRLKDSFGEIRQKYDFILIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVRKHFNPQLKIEGV 181
>gi|89092256|ref|ZP_01165210.1| ParA family protein [Oceanospirillum sp. MED92] >gi|89083344|gb|EAR62562.1| ParA family protein [Oceanospirillum sp. MED92] (264 aa)
Score = 235, Expect = 4.9e-18, Identities = 61/188 (32%), Positives = 102/188 (54%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI 192
           + N KGGV KTT   NLAASL+   K+V++VDLD QGN     G     LE  + + L  K    + ++K T     I+  N +L   +  L Q    +  LKM + ++D+ YDYV+ID PP+++++    L+     ++P + + YA  G+  +I   ++  ++ N N+KI  I  T  + R+++  D+
  S:     7 ITNQKGGVGKTTTCVNLAASLAATKKRVLLVDLDPQGNASMGSGVDKHTLENTVYEVLTDKVKIHEAILKDTPAGYDIIGSNGDLTAAEVELLQIPRREFRLKMALMEVDDEYDYVLIDNPPSLNLLTVNALASSAGVIIPMQCEYYALEGISALIGTIEKINKRLNPNLKIEGILRTMFDPRMSLTKDV 196
>gi|153885480|ref|ZP_02006637.1| Cobyrinic acid a,c-diamide synthase [Ralstonia pickettii 12D] >gi|151578380|gb|EDN42779.1| Cobyrinic acid a,c-diamide synthase [Ralstonia pickettii 12D] (261 aa)
Score = 235, Expect = 4.9e-18, Identities = 57/191 (29%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  G++V++VDLD QGN     G     LEF++   L G         +     + +LP N +L   +  L   +  ++ LK+ + +++  YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N ++K++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQGQRVLLVDLDPQGNASMGSGIDKHTLEFSVYQVLVGLATIPQARQRSEAGRYDVLPANRDLAGAEVELVDLEHRENRLKLALAEVEADYDFVLIDCPPSLSLLTLNGLCAAHGVVVPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|19554285|ref|NP_602287.1| putative cell division protein ParA [Corynebacterium glutamicum ATCC 13032] >gi|62391942|ref|YP_227344.1| ATPase involved in chromosome partitioning [Corynebacterium glutamicum ATCC 13032] >gi|145297089|ref|YP_001139910.1| hypothetical protein cgR_2985 [Corynebacterium glutamicum R] >gi|41223089|emb|CAF19034.1| ATPases involved in chromosome partitioning [Corynebacterium glutamicum ATCC 13032] >gi|140847009|dbj|BAF56008.1| hypothetical protein [Corynebacterium glutamicum R] (307 aa)
Score = 235, Expect = 4.9e-18, Identities = 68/228 (29%), Positives = 115/228 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGN-----DELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPI 230
           I + N KGGV KTT + NLAASL++ G KV++VDLD QGN     G +      +  + L G+C  ++ +   T  ENL  +P        E+     +  + ++  +  +  I+K D  +DY+IID PP++ ++    ++ V+  L+P + + YA  G+ +++N     ++  N  + I AI   + T      ++ EQ         G  V  N I  + K + A GY +  I
  S:    38 ITIANQKGGVGKTTSTVNLAASLAIHGLKVLVVDLDPQGNASTALGVEHRSGTLSSYELLIGECTADEAMQPSTANENLFCIPATLDLAGAEIELVSLVRREYRLADALGREFIDKHD--FDYMIIDCPPSLGLLTINAMTAVNEVLIPIQCEYYALEGVGQLLNNITMLRQHLNRQLHISAI---LLTMYDARTNLAEQVATEVNDHFGDVVLGNKIPRSVKVSEAPGYGQTVI 267
>gi|134096562|ref|YP_001101637.1| chromosome partitioning protein [Herminiimonas arsenicoxydans] >gi|133740465|emb|CAL63516.1| chromosome partitioning protein [Herminiimonas arsenicoxydans] (256 aa)
Score = 235, Expect = 5.0e-18, Identities = 61/191 (31%), Positives = 103/191 (53%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDI----LIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAA+L+   ++V++VDLD QGN     G    +L+ +I + L G     D+    +  +T    +LP N EL   +  + +    +  LK  +N +D  YD+++ID PPA+S++    L      ++P + + YA  GL  ++N  K+   K N ++KI+  +    + R+T+   +  Q
  S:     7 VANQKGGVGKTTTAVNLAAALAQLNQRVLLVDLDPQGNATMGAGINKAELKSSIYEVLLGMA---DVATARVTSETGGFDVLPANRELAGAEVEMVELDNREKRLKDALNAVDAEYDFMLIDCPPALSMLTLNGLCAAHGVIIPMQCEYYALEGLSDLVNTIKKVHAKLNTDLKIIGLLRVMFDPRMTLSQQVSSQ 199
>gi|187930586|ref|YP_001901073.1| Cobyrinic acid ac-diamide synthase [Ralstonia pickettii 12J] >gi|187727476|gb|ACD28641.1| Cobyrinic acid ac-diamide synthase [Ralstonia pickettii 12J] (261 aa)
Score = 235, Expect = 5.0e-18, Identities = 57/191 (29%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  G++V++VDLD QGN     G     LEF++   L G         +     + +LP N +L   +  L   +  ++ LK+ + +++  YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N ++K++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQGQRVLLVDLDPQGNASMGSGIDKHTLEFSVYQVLVGLATIPQARQRSEAGRYDVLPANRDLAGAEVELVDLEHRENRLKLALAEVEADYDFVLIDCPPSLSLLTLNGLCAAHGVVVPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|167564628|ref|ZP_02357544.1| chromosome partitioning protein ParA [Burkholderia oklahomensis EO147] >gi|167571770|ref|ZP_02364644.1| chromosome partitioning protein ParA [Burkholderia oklahomensis C6786] (256 aa)
Score = 235, Expect = 5.2e-18, Identities = 56/191 (29%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN     G    + E  + + L       D  ++ +     +LP N EL   +  L   +  +  LK  +  + + YD+V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGNATMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENRERQLKTALAMVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|161523275|ref|YP_001578287.1| cobyrinic acid ac-diamide synthase [Burkholderia multivorans ATCC 17616] >gi|189351952|ref|YP_001947580.1| chromosome partitioning protein [Burkholderia multivorans ATCC 17616] >gi|160340704|gb|ABX13790.1| Cobyrinic acid ac-diamide synthase [Burkholderia multivorans ATCC 17616] >gi|189335974|dbj|BAG45044.1| chromosome partitioning protein [Burkholderia multivorans ATCC 17616] (259 aa)
Score = 235, Expect = 5.5e-18, Identities = 57/191 (29%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  I+ +     +LP N EL+  +  L   +  +  LK  + ++++ YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACEATVYEVLVDGVSVADARIRPEAVTYDVLPANRELSGAEIELIGIENRERQLKAALERVEDDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|187777376|ref|ZP_02993849.1| hypothetical protein CLOSPO_00932 [Clostridium sporogenes ATCC 15579] >gi|187774304|gb|EDU38106.1| hypothetical protein CLOSPO_00932 [Clostridium sporogenes ATCC 15579] (254 aa)
Score = 234, Expect = 5.7e-18, Identities = 74/249 (29%), Positives = 132/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE---NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL + L+++G K++ +D+D QGN  +  G   + LE ++ D L         +IK++E   N +ILP    L   +  L  K   +   ++L+ KL E+   +DYV ID PP++ ++    L+  D  L+P + + Y+  G+ +++N  +  ++  N N+++   I +  + R  + N++ E+    K     VY T+  I    +   A  +  +PI++   K K  + Y+NL KE +
  S:     4 ISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYDVLTSDEISIREVIKQSELISNFYILPSTMSLAGAEIELINKLDRE---RILLEKLKEIENDFDYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVEGVILSMYDIRTRLCNEVAEEV--KKYFNDKVYKTT--IPRNVRLAEAPSFG-LPIILYDSKCKGAEAYNNLSKEFI 251
>gi|168187287|ref|ZP_02621922.1| SpoOJ regulator protein [Clostridium botulinum C str. Eklund] >gi|169294797|gb|EDS76930.1| SpoOJ regulator protein [Clostridium botulinum C str. Eklund] (261 aa)
Score = 234, Expect = 5.8e-18, Identities = 70/250 (28%), Positives = 132/250 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK--TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKV-NTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL A+L+++G KV+ +D+D QGN  +  G   + ++++I D L  +   ED +I+     N +I+P N +L   +  L   +  ++ LK  I  + + ++Y+ ID PP++  +   +L   +  L+P + + YA  G+ ++IN  +  K+  N ++++  +   + + R  + N++ E+    K     VY T+  I    +   A  +  +PIV+   K K  + Y +L  E L+
  S:     4 ICIFNQKGGVGKTTTNINLCANLAMNGHKVLSIDIDPQGNTTSGLGIDKNKIKYSIYDVLTSEVSIEDAIIESELINNFYIVPSNMDLVGAEVELIDVKERETILKRKIQSIQDKFEYIFIDCPPSLGFLTINSLIAANSVLIPIQCEFYALEGVGQLINTIQLVKKSLNKDLEVEGVLMSMYDNRTKLCNEVAEEV--SKYFKDKVYKTT--IPRNIRLAEAPSFG-LPIVLYDDKCKGAEAYRDLLNEFLS 251
>gi|149370640|ref|ZP_01890329.1| regulator protein; cell division inhibitor [unidentified eubacterium SCB49] >gi|149356191|gb|EDM44748.1| regulator protein; cell division inhibitor [unidentified eubacterium SCB49] (254 aa)
Score = 234, Expect = 5.9e-18, Identities = 59/193 (30%), Positives = 105/193 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +       L+     ED +I   + NL I+P + +L   +  L  K+  +  LK  I+ L   YDY++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N ++ I   + T  ++R+ + N ++E+
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANASSGLGIDVETVMQGTYQLLEHSVSAEDAVIPTNSPNLDIIPAHIDLVAIEIELVDKEEREYMLKKAIHHLKSTYDYILIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTVKSVQKIHNPDLDIEGLLLTMFDSRLRLSNQVVEE 199
>gi|108563502|ref|YP_627818.1| spoOJ regulator [Helicobacter pylori HPAG1] >gi|107837275|gb|ABF85144.1| spoOJ regulator [Helicobacter pylori HPAG1] (264 aa)
Score = 234, Expect = 6.0e-18, Identities = 74/249 (29%), Positives = 132/249 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLDE---LYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKP------KLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL+ASL++  KK++++D D Q N  ++ G + D +++ I   L G+     +++K +   L ++P N  L  F+  F  +Q +  +  L ML N L+    LYDY+IID+PPA+  +   +LS     ++P + + +A  G K ++N  +  ++  N  +KI   +PT    ++ +   ++ +  K       +    G Y+    I  + K   +  + + PI++   KS     Y  L + IL
  S:     6 IAVANQKGGVGKTTTAVNLSASLAVHEKKILLIDFDSQANATSSLGFRRDKIDYDIYHVLIGRKQISQVILKTQMPFLDLVPSNLGLAGFEKTFYDSQDENKRGEL-MLKNALESVVGLYDYIIIDSPPALGPLTINSLSAAHSVIIPIQCEFFALEGTKLLLNTIRMLQKSTNPKLKIRGFLPTMHVPQLNLTKGVLAELFKYFDSEFFRDSATGEYI---MIPKSVKLAESPSFGK-PILLYDIKSNGSIAYQKLAQSIL 262
>gi|109647888|ref|ZP_01371791.1| Cobyrinic acid a,c-diamide synthase [Desulfitobacterium hafniense DCB-2] >gi|109640978|gb|EAT50533.1| Cobyrinic acid a,c-diamide synthase [Desulfitobacterium hafniense DCB-2] (253 aa)
Score = 234, Expect = 6.0e-18, Identities = 75/252 (29%), Positives = 129/252 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + NL+A L   GKKV+++DLD QGN  +  G     L+ +I D L  +   E I IK+TE   L I P   EL   +  L   +  +  L   +  +   YD++IID PP++ ++    L+     L+P + + YA  GL  +++  +  K + N  + I+ A+ T  + R  +   ++++ +K   K++   V S  +    +   A  + + PIV+   +S+  + Y +L +E+L  V
  S:     5 IAIANQKGGVAKTTTAVNLSACLVEQGKKVLLLDLDPQGNATSGCGVIKSKLKNSIYDVLINEVPMERI-IKQTELTGLFIAPAQIELAGAEIELVGLEQREGKLASALMSIKGDYDFIIIDCPPSLGLLTLNALTAATDVLIPVQCEYYALEGLSLLMDTIQRVKGRLNPRLNILGALLTMFDARTNLGIQVVDE-VKKYFKSK---VFSTIVPRNVRLGEAPSHGK-PIVLYDDRSRGAEVYRDLAEEVLQRV 253
>gi|33591278|ref|NP_878922.1| ParA family protein [Bordetella pertussis Tohama I] >gi|33594726|ref|NP_882369.1| ParA family protein [Bordetella parapertussis 12822] >gi|33598996|ref|NP_886556.1| ParA family protein [Bordetella bronchiseptica RB50] >gi|33564802|emb|CAE39744.1| ParA family protein [Bordetella parapertussis] >gi|33570920|emb|CAE40383.1| ParA family protein [Bordetella pertussis Tohama I] >gi|33575042|emb|CAE30505.1| ParA family protein [Bordetella bronchiseptica RB50] (265 aa)
Score = 234, Expect = 6.2e-18, Identities = 57/191 (29%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+   ++V++VDLD QGN     G     LE  +   L G+   E   ++ ++    +LP N EL+  +  L Q    +  LK  I+K+   YD+V+ID PP +S++    L+     ++P + + +A  GL  ++N  K      N+ ++++  +    + R+T+   +  Q
  S:    15 IANQKGGVGKTTTAINLAAGLATHKQRVLLVDLDPQGNATMGSGIDKSTLESNLYQVLIGEAGIEQTRVRSESGGYDVLPANRELSGAEIDLVQMDERERQLKAAIDKIAGEYDFVLIDCPPTLSLLTLNGLAAAHGVIIPMQCEYFALEGLSDLVNTIKRVHRNINNELRVIGLLRVMFDPRMTLQQQVSAQ 207
>gi|90581142|ref|ZP_01236941.1| Putative ParA family protein [Vibrio angustum S14] >gi|90437663|gb|EAS62855.1| Putative ParA family protein [Vibrio angustum S14] (265 aa)
Score = 234, Expect = 6.3e-18, Identities = 58/193 (30%), Positives = 102/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV++VDLD QGN     G     ++    D L  +  + D++IK+T    H++  N ++   +  L +    +  L+  + K+ + YDY+ ID PP+++++    ++  D  LVP + + +A  GL  +++   +     N  +KI   + T  + R  + N++ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATQRKVLVVDLDPQGNATMASGVDKYQVDATAYDLLVEETPFNDVVIKETTGGYHLIAANGDVTAAEIKLMEVFAREVRLRTALAKVRDDYDYIFIDCPPSLNLLTINAMTASDSVLVPMQCEYFALEGLTALMDTISKLTAVVNSELKIEGLLRTMFDPRNRLANEVSQQ 199
>gi|89897798|ref|YP_521285.1| hypothetical protein DSY5052 [Desulfitobacterium hafniense Y51] >gi|89337246|dbj|BAE86841.1| hypothetical protein [Desulfitobacterium hafniense Y51] (253 aa)
Score = 234, Expect = 6.3e-18, Identities = 75/252 (29%), Positives = 129/252 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + NL+A L   GKKV+++DLD QGN  +  G     L+ +I D L  +   E I IK+TE   L I P   EL   +  L   +  +  L   +  +   YD++IID PP++ ++    L+     L+P + + YA  GL  +++  +  K + N  + I+ A+ T  + R  +   ++++ +K   K++   V S  +    +   A  + + PIV+   +S+  + Y +L +E+L  V
  S:     5 IAIANQKGGVAKTTTAVNLSACLVEQGKKVLLLDLDPQGNATSGCGVIKSKLKNSIYDVLINEVPMERI-IKQTELSGLFIAPAQIELAGAEIELVGLEQREGKLASALMSIKGDYDFIIIDCPPSLGLLTLNALTAATDVLIPVQCEYYALEGLSLLMDTIQRVKGRLNPRLNILGALLTMFDARTNLGIQVVDE-VKKYFKSK---VFSTIVPRNVRLGEAPSHGK-PIVLYDDRSRGAEVYRDLAEEVLQRV 253
>gi|187932908|ref|YP_001887730.1| sporulation initiation inhibitor protein soj [Clostridium botulinum B str. Eklund 17B] >gi|188588293|ref|YP_001922713.1| sporulation initiation inhibitor protein soj [Clostridium botulinum E3 str. Alaska E43] >gi|187721061|gb|ACD22282.1| sporulation initiation inhibitor protein soj [Clostridium botulinum B str. Eklund 17B] >gi|188498574|gb|ACD51710.1| sporulation initiation inhibitor protein soj [Clostridium botulinum E3 str. Alaska E43] (254 aa)
Score = 234, Expect = 6.5e-18, Identities = 76/250 (30%), Positives = 133/250 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-------ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I V N KGGV KTT + NL   L++ G +V+ +D+D QGN  +  G    +L  ++ D L       DI IK++       ENL I P   EL   +  +  K+  ++ +K  + +++  YDYV+ID PP++ ++    L+  D  L+P + + YA  G+ +++N  +  K+  N +++I   I T  + R  + N++  + +K   K++ VY T+  I    +   A  +  +PI++   K K  + Y  L KE L+
  S:     4 ICVFNQKGGVGKTTTNINLCGYLAMAGHRVLTIDIDPQGNTTSGLGLDKRNLNVSMYDVLT-----TDIPIKESILRTDLVENLFIAPSTMELAGAEIEVIGKENRENIMKNKLKEIESEYDYVLIDCPPSLGLLTINALTCADSVLIPIQCEFYALEGVSQLVNTIQLVKKSLNKDLEIEGVIMTMYDYRTNLSNEVFSE-VKKYFKSK-VYETT--IPRNIRLAEAPSFG-LPIMLYDDKCKGAEAYVKLTKEFLS 251
>gi|186477783|ref|YP_001859253.1| cobyrinic acid ac-diamide synthase [Burkholderia phymatum STM815] >gi|184194242|gb|ACC72207.1| Cobyrinic acid ac-diamide synthase [Burkholderia phymatum STM815] (256 aa)
Score = 234, Expect = 6.9e-18, Identities = 57/191 (29%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN     G      E  + + L       D  +K ++ +  +LP N EL   +  L   +  +  L+  +  + E YD+V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTAVNLAASLASQGQRVLLIDLDPQGNATMGSGIDKAACENTVYEVLVDGVSVADARVKPESVSYDVLPANRELAGAEVELVSMENRERQLREALAHVVEDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|150391686|ref|YP_001321735.1| cobyrinic acid a,c-diamide synthase [Alkaliphilus metalliredigens QYMF] >gi|149951548|gb|ABR50076.1| Cobyrinic acid a,c-diamide synthase [Alkaliphilus metalliredigens QYMF] (262 aa)
Score = 234, Expect = 6.9e-18, Identities = 77/251 (30%), Positives = 123/251 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFLKGKCYWEDI-----LIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT S NLA SL   GKKV+++D DGQ N+   FG ++P+ +E  I   +  K   EDI      I     + ++P +  L+  D  L  +  ++  L  ++  L   YD++IIDT P++  +    LS  D  ++   P   A +GL+  +   K+ +++ N  ++I  I  T  ++R  +   + EQ  +       ++ T   I  T K   A+ Y +  I      SK    Y +  KEIL Y
  S:     5 IAIANQKGGVAKTTTSLNLAYSLMKLGKKVLMIDFDGQANLTTCFGIEEPNSIETNIAHLMIAKMNEEDIPDKSQYIVSNNGIDLIPSSIYLSVVDANLRLEMGSERILFEILEPLKADYDFIIIDTSPSLGSLTINALSAADSVIITVNPQLLAMMGLQDFLKTTKKIQKRINSKLEIKGILLTMCDSRTNLSKVLSEQMSEAYDGVVNIFETH--IPMTVKVGEAIYYSK-SIAEYSPTSKAGIAYADFAKEILTY 259
>gi|83953079|ref|ZP_00961801.1| chromosome partitioning protein ParA [Sulfitobacter sp. NAS-14.1] >gi|83842047|gb|EAP81215.1| chromosome partitioning protein ParA [Sulfitobacter sp. NAS-14.1] (266 aa)
Score = 234, Expect = 7.2e-18, Identities = 70/249 (28%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAA+L    ++V+++DLD QGN     G + DD EF   + L      +  I+  +TE L+I+    +L+  D  L  N+K+    +  +   ++D   +DY++ID PP+++++    +      LVP + + +A  GL +++   +E ++  N +++I  I   +  +    +  +EQ  +  L   G  V    I    + + A  Y  +P++     SK    Y +L KE+L
  S:    13 IAIANQKGGVGKTTTTINLAAALVEQKQRVLVIDLDPQGNASTGLGIELDDREFTTYELLLEDIDLDQVIMTTETEGLYIVAATVDLSSADMELIANEKRSFLLHDALRQTQMDSYAFDYILIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQSGNKDLRIEGILLTMYDQRNNLSQQVEQDARSNL---GELVYRTVIPRNVRVSEAPSYA-MPVLSYDSGSKGAKAYRDLAKEVL 261
>gi|15603937|ref|NP_220452.1| SOJ protein (soj) [Rickettsia prowazekii str. Madrid E] >gi|3860628|emb|CAA14529.1| SOJ PROTEIN (soj) [Rickettsia prowazekii] (255 aa)
Score = 233, Expect = 7.3e-18, Identities = 76/249 (30%), Positives = 117/249 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L   +  +  L  L+ ++  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  ++K N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 ISIVNQKGGVAKTTTTVNLATAFASVNKKILVIDLDPQGNSSTGFGIIQQQRKNTIYQVLTNLIELKDAIIATNIPNLEIITSNTNLSAAELDLTTLKEREYVLMKLLEEVKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGK-PAILYDYKCAGAVAYIELTKEIL 249
>gi|148643301|ref|YP_001273814.1| chromosome partitioning ATPase [Methanobrevibacter smithii ATCC 35061] >gi|148552318|gb|ABQ87446.1| chromosome partitioning ATPase [Methanobrevibacter smithii ATCC 35061] (258 aa)
Score = 233, Expect = 7.4e-18, Identities = 58/166 (34%), Positives = 88/166 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEK 168
           I V+N KGG  KTT   N A SL++ GK V+++D+D QGN   +FG     LE  I D + G    + + I    +NL I+P N  L+     L++K+     LK  +  L  L+DY+ ID PP++ V+    L   D  L+P + + YA  G+  +IN     K++
  S:     5 IAVMNQKGGCGKTTTVVNTATSLAVMGKSVLVIDMDPQGNATTSFGIDKTKLENTIYDAIIGDVSVKKVTIPTFIKNLFIVPSNISLSGAGVELSKKENYHIVLKETLKDLPPLFDYIFIDLPPSLGVITVNALVAADSVLIPIQAEYYALEGVADLINTINLVKKR 171
>gi|54298883|ref|YP_125252.1| hypothetical protein lpp2950 [Legionella pneumophila str. Paris] >gi|53752668|emb|CAH14103.1| hypothetical protein [Legionella pneumophila str. Paris] (256 aa)
Score = 233, Expect = 8.0e-18, Identities = 51/176 (28%), Positives = 88/176 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT + NL+ASL+   ++V+++DLD QGN     G     L     D L   C  E   +  T    ++PGN++L   +  L ++   ++ L   +  +   YD+++ID PPA++ +        D  L+P + + YA  GL  +++  ++ K   N  + I  +
  S:     5 IAIANQKGGVGKTTTAINLSASLAASKQQVLLIDLDPQGNATMGSGVDKRQLVHTTNDVLLRDCLAEQACLATTCGYDLIPGNEDLTVAEVSLMERNHRETFLYKALQPIQSNYDFILIDCPPALNTLTINAFVAADSVLIPMQCEYYALEGLAALLSTIEQVKSTVNSRLHIEGV 180
>gi|148381576|ref|YP_001256117.1| sporulation initiation inhibitor protein soj [Clostridium botulinum A str. ATCC 3502] >gi|153933036|ref|YP_001385953.1| sporulation initiation inhibitor protein soj [Clostridium botulinum A str. ATCC 19397] >gi|153937312|ref|YP_001389360.1| sporulation initiation inhibitor protein soj [Clostridium botulinum A str. Hall] >gi|170760924|ref|YP_001788981.1| sporulation initiation inhibitor protein soj [Clostridium botulinum A3 str. Loch Maree] >gi|148291060|emb|CAL85197.1| chromosome partitioning protein (sporulation initiation inhibitor protein) [Clostridium botulinum A str. ATCC 3502] >gi|152929080|gb|ABS34580.1| sporulation initiation inhibitor protein soj [Clostridium botulinum A str. ATCC 19397] >gi|152933226|gb|ABS38725.1| sporulation initiation inhibitor protein soj [Clostridium botulinum A str. Hall] >gi|169407913|gb|ACA56324.1| sporulation initiation inhibitor protein soj [Clostridium botulinum A3 str. Loch Maree] (254 aa)
Score = 233, Expect = 8.1e-18, Identities = 71/249 (28%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE---NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL + L+++G K++ +D+D QGN  +  G   + LE ++ D L          IK++E   N +ILP    L   +  L  K   +  L   + +++  +DYV ID PP++ ++    L+  D  L+P + + Y+  G+ +++N  +  ++  N N+++   I +  + R  + N++ E+    K     VY T+  I    +   A  +  +PI++   K K  + Y+NL KE +
  S:     4 ISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYDVLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLKEIENDFDYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVEGVILSMYDIRTRLCNEVAEEV--KKYFNDKVYKTT--IPRNVRLAEAPSFG-LPIILYDSKCKGAEAYNNLSKEFI 251
>gi|124516567|gb|EAY58075.1| ATPase involved in chromosome partitioning [Leptospirillum sp. Group II UBA] (254 aa)
Score = 233, Expect = 8.1e-18, Identities = 72/251 (28%), Positives = 131/251 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLD----ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIE--QSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           + V N KGGV KTT + NLAAS++++ KKV+++DLD QGN  +  G        +  DFL G    ED +I+   + L++LPG+  +  F+   ++    + + ++L  KL     E + Y+++D PP++  +    L      L+P + + +A  GL  ++   +  +++ N ++++  I PT  + R  + N ++E  +   P+L      V  + I        A  Y + P+++    SK    Y +L +EIL Y
  S:     5 VAVANQKGGVGKTTTTINLAASMAVEEKKVLVIDLDPQGNSTSGLGVNATKSTPSAYDFLIGNKSVEDAVIEAHLKYLYVLPGSLNMAGFE---SEAASVKGSQELLRGKLQDPYFEQFQYILLDCPPSLGYITLNALVSASSILIPVQCEFFALEGLSHLLKTIERVRKQWNPDLEVEGILPTMYDKRNKLSNQVLEDLRDHFPEL------VFKSVIPRNVTLGEAPSYGK-PVLLHDALSKGAQSYLHLAREILAY 253
>gi|28379584|ref|NP_786476.1| chromosome partitioning protein, membrane-associated ATPase [Lactobacillus plantarum WCFS1] >gi|28272424|emb|CAD65348.1| chromosome partitioning protein, membrane-associated ATPase [Lactobacillus plantarum WCFS1] (255 aa)
Score = 233, Expect = 8.2e-18, Identities = 54/176 (30%), Positives = 95/176 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT S NL ASL   G+KV+++D D QGN  +  G +   +E  I D L      ++ +I  + + L I+P   +L+  +  L      ++ L+  I+ + + YDY++ID PP++ ++     +  D  L+P + + YA  GL +++N  K  ++  N  ++I  +
  S:     5 IALANQKGGVGKTTTSINLGASLVELGQKVLLIDTDAQGNATSGLGVQKSTIEREIYDVLINDVSIKETIIPTSHKGLDIVPATIQLSGAEIELTPMMARETRLRDAIDDVKDDYDYILIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVQKHFNKQLRIEGV 181
>gi|167751432|ref|ZP_02423559.1| hypothetical protein EUBSIR_02428 [Eubacterium siraeum DSM 15702] >gi|167655678|gb|EDR99807.1| hypothetical protein EUBSIR_02428 [Eubacterium siraeum DSM 15702] (256 aa)
Score = 233, Expect = 8.5e-18, Identities = 68/249 (27%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCY-WEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + N++A+L   GKKV++VD D QGN  + +G    +L+    D +       E ++    +N+ ++P N +L   +  L Q +     LK  + +L + YD +I+D  P++ ++    L   D  +VP + + Y+  GL ++++  K+ K  +N N+ ++ I  T ++ R+   N+I+ + +K       ++ T   I    + + A  +  +P++     SK  + Y  L  EI+
  S:     5 ISIVNQKGGVGKTTSAVNISAALGAKGKKVLLVDFDPQGNATSGYGISKKNLKTTSYDVVMSNVRPQEAVIATNCKNVSLIPANAQLAEAEMHLLQIEQRNHQLKKALIQLKDDYDIIIVDCLPSLGILAINALIASDKFIVPMQCEHYSLEGLAQLLSTVKKVKRTSNKNLSLMGIVFTMLDKRLLQSNEIM-RDIKRNFPPSSIFNT--VIPRNVRISEAPSHG-MPVIYYDKSSKGAESYMKLAGEII 251
>gi|91785743|ref|YP_560949.1| chromosome segregation ATPase [Burkholderia xenovorans LB400] >gi|91689697|gb|ABE32897.1| chromosome segregation ATPase [Burkholderia xenovorans LB400] (263 aa)
Score = 233, Expect = 8.6e-18, Identities = 56/191 (29%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN     G         + + L       D  ++ +     +LP N EL   +  L   Q  +  LK+ ++ ++  YD+V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTAVNLAASLAAQGQRVLLIDLDPQGNATMGSGIDKAACTNTVYEVLVDGVAVADARVRPEAVGYDVLPANRELAGAEVELVSVQNRERQLKVALSAVENEYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|15600221|ref|NP_253715.1| hypothetical protein PA5028 [Pseudomonas aeruginosa PAO1] >gi|107104128|ref|ZP_01368046.1| hypothetical protein PaerPA_01005201 [Pseudomonas aeruginosa PACS2] >gi|194549249|ref|YP_002084277.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|194555073|ref|YP_002090100.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] >gi|9951317|gb|AAG08413.1|AE004916_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] >gi|126170195|gb|EAZ55706.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|126197466|gb|EAZ61529.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] (255 aa)
Score = 233, Expect = 8.6e-18, Identities = 63/211 (29%), Positives = 113/211 (53%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + ++VDLD Q N      G   +DL   I DF K         K    +I     +NLHI+  + EL      L  K    + L+ L+++LDE YD + +DTPPA++    + L   D  L+PF+ D ++   L  ++   +E ++ +N ++++  I   +   R ++   ++++ +  +L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSAAEGYRTLLVDLDAQANSTHYLTGLTGEDLPVGIADFFKQTLSSGPFSKKGRVEIYETPFDNLHIVTSSPELADLQPKLESKHKI-NKLRKLLDELDEDYDRIYLDTPPALNFYTVSALIAADRCLIPFDCDSFSRQALYGLLQEIEELRDDHNEDLQVEGIVVNQFQPRASLPQQLLDELVAEELPVLPVYLMSS 220
>gi|51473285|ref|YP_067042.1| chromosome partitioning protein ParA (Soj protein) [Rickettsia typhi str. Wilmington] >gi|51459597|gb|AAU03560.1| chromosome partitioning protein ParA (Soj protein) [Rickettsia typhi str. Wilmington] (255 aa)
Score = 233, Expect = 8.7e-18, Identities = 76/249 (30%), Positives = 117/249 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NLA + +   KK++++DLD QGN    FG      +  I   L      +D +I     NL I+  N  L+  +  L   +  +  L  L+ ++  LYDY+IID PP+++++    L   D  L+P + D Y+  GL  ++   +  ++K N  +KI  I   + T     N + EQ      K  G  V    I    K + A  Y + P ++  +K      Y  L KEIL
  S:     4 IAIVNQKGGVAKTTTTVNLATAFASVNKKILVIDLDPQGNSSTGFGIIQQQRKNTIYQVLTNLIELKDAIISTNIPNLEIITSNTNLSAAELDLTTLKDREYILMKLLEEVKILYDYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSNLLKTIEIVEKKLNPKIKIAGI---LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGK-PAILYDYKCAGAMAYIELTKEIL 249
>gi|83719053|ref|YP_443810.1| sporulation initiation inhibitor protein Soj [Burkholderia thailandensis E264] >gi|167582844|ref|ZP_02375718.1| sporulation initiation inhibitor protein Soj [Burkholderia thailandensis TXDOH] >gi|167620984|ref|ZP_02389615.1| sporulation initiation inhibitor protein Soj [Burkholderia thailandensis Bt4] >gi|83652878|gb|ABC36941.1| sporulation initiation inhibitor protein Soj [Burkholderia thailandensis E264] (256 aa)
Score = 233, Expect = 9.0e-18, Identities = 56/191 (29%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+   ++V+++DLD QGN     G    + E  + + L       D  ++ +     +LP N EL   +  L   +  +  LK  + K+ + YD+V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENRERQLKAALAKVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|160882053|ref|YP_001561021.1| cobyrinic acid ac-diamide synthase [Clostridium phytofermentans ISDg] >gi|160430719|gb|ABX44282.1| Cobyrinic acid ac-diamide synthase [Clostridium phytofermentans ISDg] (284 aa)
Score = 233, Expect = 9.1e-18, Identities = 75/249 (30%), Positives = 127/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG-----KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAA L+  G KV+ +D+D QGN  +  G     LE  + + + G     KC  + I+     NL ++P +  L   +  L   +  +  LK  IN + + +DY+IID PP+++ +    ++  D  LVP + + YA  GL ++I+     K++ N +++I  +  T  + R  +   ++E +++  L+ Q +Y   N I       A      +PI +   KS   D Y +L  E++
  S:     5 IAVANQKGGVGKTTTAINLAACLAEKGMKVLTIDIDPQGNTTSGLGINKASLENTVYELMIGESNVEKCIHDSIV----PNLVVIPSDVNLAGAEIELIGIEDKEYILKKHINPIKDFFDYIIIDCPPSLNTLTINAMTTADSVLVPIQCEYYALEGLTQLIHTINLVKKRLNASLEIEGVVFTMYDARTNLSLQVVE-NVRSNLE-QNIY---NSIIPRNVRLAEAPSHGLPISIYDPKSAGADAYRDLADEVI 250
>gi|94312435|ref|YP_585645.1| chromosome segregation ATPase [Ralstonia metallidurans CH34] >gi|93356287|gb|ABF10376.1| chromosome segregation ATPase [Ralstonia metallidurans CH34] (257 aa)
Score = 233, Expect = 9.3e-18, Identities = 57/191 (29%), Positives = 98/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+   ++V++VDLD QGN     G     L+ ++   L G     +   +     + +LP N EL   +  L +    +  LK  + ++DE YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N ++K++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQDQRVLLVDLDPQGNASMGSGIDKQALQHSVYQVLVGLATVPEARQRSESGRYDVLPANRELAGAEVELVELDQRERRLKQALAEVDEEYDFVLIDCPPSLSLLTLNGLCAAHGVIVPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|110602397|ref|ZP_01390498.1| Cobyrinic acid a,c-diamide synthase [Geobacter sp. FRC-32] >gi|110546892|gb|EAT60217.1| Cobyrinic acid a,c-diamide synthase [Geobacter sp. FRC-32] (257 aa)
Score = 233, Expect = 9.3e-18, Identities = 70/250 (28%), Positives = 127/250 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT S NLAASL++  K+ ++VD+D QGN  +  G    +LE  + D L      +  ++K +   L ILP N EL   +  L      +  LK  +  L + YDY++ID PP++ ++   +++  +  L+P + + YA  GL  I+      ++  N +++I  I  T  + R  + + + E+ ++   K +     +  +    + + A  + + PI++    S+    Y +L KEI++
  S:     5 ICIANQKGGVGKTTTSVNLAASLAVAEKRTLLVDMDPQGNAGSGVGIDKSNLEATVYDVLIDDVEPDKAILKTSFPFLDILPANGELAGAELELVSIIGRELKLKHALAPLVQAYDYILIDCPPSLGLLTVNSMTAAESVLIPLQCEFYAMEGLSHILKTITLVQKGLNPSLRIEGILLTMFDARNNLSHQVSEE-IRNHFKKE---TFTTVVPRNVRLSEAPSHGK-PIILYDITSRGATSYMDLAKEIIS 251
>gi|120608765|ref|YP_968443.1| chromosome segregation ATPase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120587229|gb|ABM30669.1| chromosome segregation ATPase [Acidovorax avenae subsp. citrulli AAC00-1] (256 aa)
Score = 232, Expect = 9.6e-18, Identities = 57/191 (29%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT S NLAA L+  G++V++VDLD QGN     G     LE  + D  L+     E  ++ +     +L  N EL   +  L   +  +  LK  +  +D+ +D+++ID PP++S++    L      +VP + + +A  GL  ++N  K+     N +++I+  +    + R+T+ + + EQ
  S:     7 IANQKGGVGKTTTSVNLAAGLAKVGQRVLLVDLDPQGNATMGSGVDKRALELTVYDVLLESASVQEAAVLSEQCGYRVLGANRELAGAEVELVALEQRERRLKSALAPVDKDFDFILIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVNTIKQVHANLNKDLQIIGLLRVMFDPRITLQSQVSEQ 199
>gi|14590636|ref|NP_142704.1| SOJ protein [Pyrococcus horikoshii OT3] >gi|3257176|dbj|BAA29859.1| 256aa long hypothetical SOJ protein [Pyrococcus horikoshii OT3] (256 aa)
Score = 232, Expect = 9.7e-18, Identities = 62/196 (31%), Positives = 106/196 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNV-IATFGKKPDDLEFA-IMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT++ NL  SLS  GKKV++VD+D Q N+  A  G    + E   +   +  +   ED+LI+  EN+H++P +  L+  +  +      +  L+  +  +   YDY+IID PP+M + +  +L+  D  L+P E   +  +G++ + N  K  K++ N  ++++ I   V  + T    I E+ LK
  S:     5 ISIANQKGGVGKTTIALNLGYSLSKFGKKVLLVDIDPQFNLTFALIGMDVINYENKNVGTLMTKESTVEDVLIEINENIHLIPSHLTLSAKEIEILNTYNRERRLEKALKPVYPEYDYIIIDNPPSMGIFLVNSLTASDYVLIPLELSYFGVIGMQLMFNLMKMIKDETNEGLRLLGI---VPNKFTRQTKIPEKRLK 199
>gi|158320953|ref|YP_001513460.1| cobyrinic acid ac-diamide synthase [Alkaliphilus oremlandii OhILAs] >gi|158141152|gb|ABW19464.1| Cobyrinic acid ac-diamide synthase [Alkaliphilus oremlandii OhILAs] (265 aa)
Score = 232, Expect = 1.1e-17, Identities = 70/249 (28%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDD---LEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNF----------ISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT + NL  +LS  G KV+++D D QG++  + G K D+   ++  + D ++ +   +D +I+  ENLH++P N +L   +  L      +  L+  +  +   YDY++ID  P++  +    L+  D  ++P  P+  +  GL  +    K+ K++ N N+KI  +  T +N R  +  ++I+      +     Y+   F          I  + K+  A+   R  I+    K+K  + Y    KE++
  S:     6 IAIVNQKGGVGKTTTTLNLGYALSQMGSKVLLIDFDPQGSLTVSLGYKADNKPGIQTIMADSIEEREIEKDCIIEVNENLHLIPANLQLAGIEMTLVNVMCKEQILRSALEYIKGDYDYILIDCSPSLGTLTINALAACDSIIIPVTPEFLSAKGLGDLTATIKKTKKRINPNIKIDGVLMTMLNERTNLSKEMIK-----TVNESASYIKDKFDLDMKIFHSKIPVSVKAGEAI-LNRKSIIEYDPKNKVSEAYQRFAKELI 262
>gi|54295716|ref|YP_128131.1| hypothetical protein lpl2804 [Legionella pneumophila str. Lens] >gi|53755548|emb|CAH17047.1| hypothetical protein [Legionella pneumophila str. Lens] (256 aa)
Score = 232, Expect = 1.1e-17, Identities = 51/176 (28%), Positives = 88/176 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT + NL+ASL+   ++V+++DLD QGN     G     L     D L   C  E   +  T    ++PGN++L   +  L ++   ++ L   +  +   YD+++ID PPA++ +        D  L+P + + YA  GL  +++  ++ K   N  + I  +
  S:     5 IAIANQKGGVGKTTTAINLSASLAASKQQVLLIDLDPQGNATMGSGVDKRQLVHTTNDVLLRDCLAEQACLATTCGYDLIPGNEDLTVAEVSLMERNHRETFLFKALQPIQSNYDFILIDCPPALNTLTINAFVAADSVLIPMQCEYYALEGLAALLSTIEQVKSTVNSRLHIEGV 180
>gi|145621196|ref|ZP_01777185.1| Cobyrinic acid a,c-diamide synthase [Geobacter bemidjiensis Bem] >gi|144942496|gb|EDJ77632.1| Cobyrinic acid a,c-diamide synthase [Geobacter bemidjiensis Bem] >gi|197089678|gb|ACH40949.1| Cobyrinic acid ac-diamide synthase [Geobacter bemidjiensis Bem] (257 aa)
Score = 232, Expect = 1.1e-17, Identities = 75/259 (28%), Positives = 131/259 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVT-SNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRETS 261
           I V N KGGV KTT + NL+ASL++  ++V++VD+D QGN  +  G   + LE +I D L        I I++TE   LH+ P   +L   +  L      +  LK +++ + + YDY+ ID PP+++++    ++  +  L+P + + YA  GL +I+      ++  N ++ I  I   + T     N++  Q +  +++T     T    I    + + A  + + PI +    S+    Y +L KEI+     GRE S
  S:     5 ICVANQKGGVGKTTTAVNLSASLAVAERRVLLVDMDPQGNAGSGVGADKELLEESIYDALIDDAPAARI-IQRTELPYLHLFPATSDLAGAELELVSVTDRERKLKRILSSVSDSYDYIFIDCPPSLNLLTINAMTAANSVLIPLQCEFYAMEGLSQILKTINLIQQGLNSSLIIEGI---LLTMFDARNNLSRQ-VGEEIRTHFAKETLQTVIPRNVRLSEAPSHGK-PICLYDITSRGATSYMDLAKEII-----GREVS 255
>gi|119471636|ref|ZP_01614021.1| transcriptional regulator of chromosome partitioning protein; ParA family protein; could be a protein tyrosine kinase [Alteromonadales bacterium TW-7] >gi|119445415|gb|EAW26702.1| transcriptional regulator of chromosome partitioning protein; ParA family protein; could be a protein tyrosine kinase [Alteromonadales bacterium TW-7] (261 aa)
Score = 232, Expect = 1.2e-17, Identities = 63/193 (32%), Positives = 107/193 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPD---DLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAAS++   +KV+++DLD QGN  AT G   D   D+   I D L      ED++IK+T    H++  N ++   +  L +    +  L+  + K+ + Y+++ ID PP+++++    ++  D  LVP + + YA  GL  +++   +  +  N  +KI  I  T  + R  + ND+ EQ
  S:     5 IALANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGN--ATMGSGVDKYGDVP-TIYDLLIEDKPIEDVIIKETSGEYHMIAANGDVTAAEVKLMELFAREVRLRNALEKIQDQYEFIFIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMDTITQLAKLVNPELKIEGILRTMYDPRNRLANDVSEQ 199
>gi|187925872|ref|YP_001897514.1| Cobyrinic acid ac-diamide synthase [Burkholderia phytofirmans PsJN] >gi|187717066|gb|ACD18290.1| Cobyrinic acid ac-diamide synthase [Burkholderia phytofirmans PsJN] (263 aa)
Score = 232, Expect = 1.2e-17, Identities = 59/191 (30%), Positives = 103/191 (53%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFA--IMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN  AT G   D    A  + + L       D  ++ +  +  +LP N EL   +  L   Q  +  LK+ +  ++  Y++V+ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGN--ATMGSGIDKAACANTVYEVLVDGVAVADARVRPEAVDYDVLPANRELAGAEVELVSVQNRERQLKIALAAVENEYEFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|187729861|ref|YP_001789035.1| partition protein [Tetragenococcus halophilus] >gi|170676053|dbj|BAG14323.1| partition protein [Tetragenococcus halophilus] (255 aa)
Score = 232, Expect = 1.2e-17, Identities = 78/248 (31%), Positives = 129/248 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYW-----EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSN--LKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKY---QDEYHNLKKEI 250
           I   NNKGGV KTT +TN+A +LSL  KKV+++D D QG+   TFG   D+L+  +  +L    +W      D  I   + L ++P N  L+ F   ++ ++    N  LK  I+ +   YDY+I D  PA+ +++   + IVD  +V   P+ YA      + NA    K  ++ ++ + +I PTK       H  ++  +LK   +   + +T  +I +    + AV    +P+ + V  S+Y   Q    NL KE+
  S:     5 IAFYNNKGGVAKTTTATNVAGALSLQHKKVLLIDGDPQGHTSLTFGVNADNLQTTLGAYLSS--HWTAKQASDYFINVNDYLDVVPSNQSLSDFIISVSAEETKFRNKYLKNFIDPIKNDYDYIIFDMAPAVDIILENIVEIVDDLIVVAVPETYA------VKNAETTLKITDDKHVTVRSIVPTKTQLNTNTHKFML-NNLKEVAEAHNIKMTDTYIPNLIAFSEAVSIYELPLAL-VKDSRYKKTQKYCQNLVKEL 253
>gi|168181106|ref|ZP_02615770.1| sporulation initiation inhibitor protein soj [Clostridium botulinum NCTC 2916] >gi|168183717|ref|ZP_02618381.1| sporulation initiation inhibitor protein soj [Clostridium botulinum Bf] >gi|182668106|gb|EDT80085.1| sporulation initiation inhibitor protein soj [Clostridium botulinum NCTC 2916] >gi|182673194|gb|EDT85155.1| sporulation initiation inhibitor protein soj [Clostridium botulinum Bf] (254 aa)
Score = 232, Expect = 1.2e-17, Identities = 70/249 (28%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE---NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + + N KGGV KTT S NL + L+++G K++ +D+D QGN  +  G   + LE ++ D L          IK++E   N +ILP    L   +  L  K   +  L   + +++  +DYV ID PP++ ++    L+  D  L+P + + Y+  G+ +++N  +  ++  N N+++   I +  + R  + N++ E+    K     VY T+  I    +   A  +  +PI++   K K  + Y+NL KE +
  S:     4 VSIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYDVLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLKEIENDFDYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVEGVILSMYDIRTRLCNEVAEEV--KKYFNDKVYKTT--IPRNVRLAEAPSFG-LPIILYDSKCKGAEAYNNLSKEFI 251
>gi|15612132|ref|NP_223784.1| hypothetical protein jhp1067 [Helicobacter pylori J99] >gi|4155660|gb|AAD06647.1| putative [Helicobacter pylori J99] (264 aa)
Score = 232, Expect = 1.2e-17, Identities = 75/249 (30%), Positives = 131/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLD---ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKP------KLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAASL+   KK++++D D Q N  ++ G + D +++ I   L G+     +++K +   L ++P N  L  F+  F  +Q +  +  L ML N L    +LYDY+IID+PPA+  +   +LS     ++P + + +A  G K ++N  +  ++  N  +KI   +PT    ++ +   ++ +  K       +    G Y+    I  + K   +  + + PI++   KS     Y  L + IL
  S:     6 IAVANQKGGVGKTTTAVNLAASLAAHEKKILLIDFDPQANATSSLGFRRDKIDYDIYHVLIGRKQISQVILKTQMPFLDLVPSNLGLAGFEKTFYDSQDENKRGEL-MLKNALGSVVKLYDYIIIDSPPALGPLTINSLSAAHSVIIPIQCEFFALEGTKLLLNTIRMLQKSTNPKLKIRGFLPTMHVPQLNLTKGVLAELFKYFDSEFFRDSATGEYI---MIPKSVKLAESPSFGK-PILLYDIKSNGSIAYQKLAQSIL 262
>gi|170694311|ref|ZP_02885465.1| Cobyrinic acid ac-diamide synthase [Burkholderia graminis C4D1M] >gi|170140734|gb|EDT08908.1| Cobyrinic acid ac-diamide synthase [Burkholderia graminis C4D1M] (263 aa)
Score = 231, Expect = 1.3e-17, Identities = 59/191 (30%), Positives = 102/191 (53%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFA--IMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+  G++V+++DLD QGN  AT G   D    A  + + L       D  ++ +  +  +LP N EL   +  L   Q  +  LK  +  ++  YD+++ID PPA+S++    L      ++P + + +A  GL  ++N  K+     N ++K++  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGN--ATMGSGIDKAACANTVYEVLVDGVSVADARMRPEAVDYDVLPANRELAGAEVELVSVQNRERQLKAALAAVEGEYDFILIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQ 199
>gi|191163790|ref|ZP_03025662.1| Cobyrinic acid ac-diamide synthase [Geobacter sp. M21] >gi|190995235|gb|EDV70691.1| Cobyrinic acid ac-diamide synthase [Geobacter sp. M21] (257 aa)
Score = 231, Expect = 1.3e-17, Identities = 75/259 (28%), Positives = 129/259 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQ-GVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRETS 261
           I V N KGGV KTT + NL+ASL++  ++V++VD+D QGN  +  G   + LE +I D L        I I++TE   LH+ P   +L   +  L      +  LK ++  + + YDY+ ID PP+++++    ++  +  L+P + + YA  GL +I+      ++  N ++ I  I   + T     N++  Q +  +++T          I    + + A  + + PI +    SK    Y +L KEI+     GRE S
  S:     5 ICVANQKGGVGKTTTAVNLSASLAVAERRVLLVDMDPQGNAGSGVGADKELLEESIYDALIDDAPAARI-IQRTELPYLHLFPATSDLAGAELELVSVTDRERKLKRILASVSDSYDYIFIDCPPSLNLLTINAMTAANSVLIPLQCEFYAMEGLSQILKTINLIQQGLNSSLTIEGI---LLTMFDARNNLSRQ-VGEEIRTHFAKECLQTVIPRNVRLSEAPSHGK-PICLYDITSKGATSYMDLAKEII-----GREAS 255
>gi|52843086|ref|YP_096885.1| sporulation initiation inhibitor protein Soj [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|148361203|ref|YP_001252410.1| sporulation initiation inhibitor protein Soj [Legionella pneumophila str. Corby] >gi|52630197|gb|AAU28938.1| sporulation initiation inhibitor protein Soj [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|148282976|gb|ABQ57064.1| sporulation initiation inhibitor protein Soj [Legionella pneumophila str. Corby] (256 aa)
Score = 231, Expect = 1.3e-17, Identities = 51/176 (28%), Positives = 88/176 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT + NL+ASL+   ++V+++DLD QGN     G     L     D L   C  E   +  T    ++PGN++L   +  L ++   ++ L   +  +   YD+++ID PPA++ +        D  L+P + + YA  GL  +++  ++ K   N  + I  +
  S:     5 IAIANQKGGVGKTTTAINLSASLAASKQQVLLIDLDPQGNATMGSGVDKRQLVHTTNDVLLRDCLAEQACLATTCGYDLIPGNEDLTVAEVSLMERNHRETFLFKALQPIQSNYDFILIDCPPALNTLTINAFVAADSVLIPMQCEYYALEGLAALLSTIEQVKSTVNSRLHIEGV 180
>gi|119896435|ref|YP_931648.1| ParA family protein [Azoarcus sp. BH72] >gi|119668848|emb|CAL92761.1| ParA family protein [Azoarcus sp. BH72] (256 aa)
Score = 231, Expect = 1.3e-17, Identities = 59/191 (30%), Positives = 96/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG-KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT   NLAA+L   G++ ++VDLD QGN     G     LE ++   L G     E  +   T    +LP N +L   +  L   +  ++ L+  + + D  YD+V+ID PP++S++    L      ++P + + YA  GL  ++N  K+     N ++KI+  +    + RVT+   +  Q
  S:     7 VANQKGGVGKTTTCVNLAAALHQCGQRTLLVDLDPQGNATMGSGVDKRSLEQSVYHLLVGLTGLAEARVTSPTGGYDVLPANRDLAGAEVELVSLENRENRLREALQQFDADYDFVLIDCPPSLSMLTLNGLCAAHGVIIPMQCEYYALEGLSDLVNTIKKVHANLNRDLKIIGLLRVMFDPRVTLQQQVSAQ 199
>gi|104779644|ref|YP_606142.1| ParA family chromosome partitioning ATPase [Pseudomonas entomophila L48] >gi|95108631|emb|CAK13325.1| putative chromosome partitioning protein, ParA family [Pseudomonas entomophila L48] (257 aa)
Score = 231, Expect = 1.4e-17, Identities = 65/211 (30%), Positives = 108/211 (51%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + +++DLD Q N      G   DD+   I DF K         K    DI     +NLH++    EL      L  K    + L+ L+ +LDE YD + IDTPPA++    + L   D  L+PF+ D ++   L  ++    E K+ +N  + +  I   +  +R ++   ++++ L   L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSASEGYRTLLIDLDAQANSTQYLTGLTGDDIPMGIADFFKQSLSSGPFAKKNKVDIYETPFDNLHVVTATAELADLQPKLEAKHKI-NKLRKLLEELDEDYDRIYIDTPPALNFYAVSALIAADRVLIPFDCDSFSRQALYGLLAEIDELKDDHNEELVVEGIVVNQFQSRASLPQQMLDELLAEGLPVLPVYLGSS 220
>gi|194291175|ref|YP_002007082.1| ATPase involved in chromosome partitioning, PARA protein [Cupriavidus taiwanensis] >gi|193225010|emb|CAQ71021.1| ATPase involved in chromosome partitioning, PARA protein [Cupriavidus taiwanensis] (257 aa)
Score = 231, Expect = 1.4e-17, Identities = 58/191 (30%), Positives = 98/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  G++V++VDLD QGN     G     LE ++   L G         + +T    +LP N EL   +  L +    +  L+  I ++D  YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N +++++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQGQRVLLVDLDPQGNASMGSGIDKQALETSVYQVLVGLAGIPQARQRSETGKYDVLPANRELAGAEVELVELDQRERRLRQAIAEVDGDYDFVLIDCPPSLSLLTLNGLCAAHGVIVPMQCEYFALEGLSDLVNTIKQVHANLNRDLQVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|15896961|ref|NP_350310.1| chromosome partitioning MinD-family ATPase [Clostridium acetobutylicum ATCC 824] >gi|15026837|gb|AAK81650.1|AE007868_6 Chromosome partitioning MinD-family ATPase, SOJ [Clostridium acetobutylicum ATCC 824] (253 aa)
Score = 231, Expect = 1.4e-17, Identities = 73/250 (29%), Positives = 125/250 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I V N KGGV KTT + NL   L++ G KV+ +D+D QGN  +  G     LE +  D L      EDI+ +    +NL+I P   EL   +  L      +  LK  I  +++ +DY+ ID PP++  +   +L+  +  L+P + + YA  G+ +++N  +  K+  N  +++   I T  + R  + N++ ++    K  +  +Y T+  I    +   A  Y  +PIV+   K +  + Y NL  E L+
  S:     4 ISVFNQKGGVGKTTTNINLCTYLAMKGLKVLTIDIDPQGNTTSGLGIDKSTLELSTYDALTTDVALEDIIQESQLIKNLYIAPSTVELAGAEVELINIDNRERILKNKIKAMNKKFDYIFIDCPPSLGFITINSLTASNSVLIPIQTEFYALEGVGQLVNTVQLVKKSLNKQLEVEGVILTMCDNRTKLSNEVAQEV--KKYFSGKLYNTT--IPRNIRLAEAPSYG-LPIVLYDDKCRGAECYRNLANEFLS 251
>gi|88811302|ref|ZP_01126558.1| ParA family protein [Nitrococcus mobilis Nb-231] >gi|88791841|gb|EAR22952.1| ParA family protein [Nitrococcus mobilis Nb-231] (262 aa)
Score = 231, Expect = 1.4e-17, Identities = 59/196 (30%), Positives = 99/196 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I V N KGGV KTT   NLAASL+ + ++V++VD+D QGN     G   DDLE    D L + +   E +         +LP N +L   +  L      +  L+ L+  L + Y YV+ID PP+++++    L      L+P + + YA  GL  +++  ++ +   N  ++I   + T  + R  + N +  Q ++
  S:     5 IAVANQKGGVGKTTTCVNLAASLAANRRRVLLVDMDPQGNATIGSGLDKDDLEVTNYDILMRERSVAEALHRLAPPGYDLLPANGDLTVAEVALMDSAGRERRLRELLQPLLDEYAYVLIDCPPSLNILTVNALVAAHRVLIPIQCEYYALEGLSALLDTIRQIQGSVNRELEIEGLLRTMFDPRNNLANQVGAQLIQ 202
>gi|149925399|ref|ZP_01913663.1| Cobyrinic acid a,c-diamide synthase [Limnobacter sp. MED105] >gi|149825516|gb|EDM84724.1| Cobyrinic acid a,c-diamide synthase [Limnobacter sp. MED105] (258 aa)
Score = 231, Expect = 1.4e-17, Identities = 50/174 (28%), Positives = 93/174 (53%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           + N KGGV KTT + NLAA L++  ++V++VDLD QGN     G     ++  +   L G     +  ++      +L  N EL   +  + + +  +  L+  I+++D+ YD+++ID PPA+S++    L   +  ++P + + YA  GL  ++N  K+  +  N N+ I+ +
  S:     7 IANQKGGVGKTTTAVNLAAGLAMAKQRVLLVDLDPQGNATMGCGIDKRSVKHTVYQVLVGMVGVAEATVRAEGEFDVLAANRELAGAEVEMVEFEDREIKLREAISEVDDQYDFILIDCPPALSLLTLNALCCANGVVIPMQCEYYALEGLSDLVNTIKQVCKNLNPNLTIIGL 180
>gi|167748069|ref|ZP_02420196.1| hypothetical protein ANACAC_02813 [Anaerostipes caccae DSM 14662] >gi|167652061|gb|EDR96190.1| hypothetical protein ANACAC_02813 [Anaerostipes caccae DSM 14662] (257 aa)
Score = 231, Expect = 1.6e-17, Identities = 70/249 (28%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIV-AIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL+A+L+  GKK +I+D+D QGN     G   ++LE  + + +  +  +++ +  +  ENL + P N  L   +  L      Q  LK  +    E ++++IID PPA+ ++    ++  D  +VP + + YA  GL +++   +  ++  N ++KI  A+ T  + R  +   ++E ++K  L  Q +Y T   I       A      +PI +   KS   + Y  L +E++
  S:     5 IAIANQKGGVGKTTTAVNLSAALAAAGKKTLIIDMDPQGNTTTGLGLDKNELEHTVYEVISSEITFDECICPEVIENLSLAPANRNLAGAEIELMTVDRMQYILKEKLQPTVENFEFIIIDCPPALGMLTVNAMTAADTVIVPIQCEFYALDGLTQLMYTIELIQKSLNPDLKIEGAVFTMYDARTNLSLQVVE-NVKSYL-NQNIYKT---IIPRNVRLAEAPSHGLPINLYDPKSVGAESYQMLAEEVI 250
>gi|82703881|ref|YP_413447.1| cobyrinic acid a,c-diamide synthase [Nitrosospira multiformis ATCC 25196] >gi|82411946|gb|ABB76055.1| chromosome segregation ATPase [Nitrosospira multiformis ATCC 25196] (270 aa)
Score = 231, Expect = 1.6e-17, Identities = 53/173 (30%), Positives = 90/173 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           + V N KGGV KTT S NLAASL    ++V+++DLD QGN     G     LE  +   L G     D+ +      + +LP N EL   +  L      ++ L+  + +++  YD+++ID PPA++++    L   +  ++P + + YA  GL  ++N  K+ +   N  ++I
  S:     5 LAVTNQKGGVGKTTTSVNLAASLEAVKRRVLLIDLDPQGNATMGSGVDKGQLEHTVYQVLLGSASVVDVRVSSPSGKYDLLPANRELAGAEIELIDLPGRETRLREALREVEREYDFILIDCPPALNLLTLNGLCAAEAVVIPMQCEYYALEGLSDLVNTIKKVRAHFNSKLEI 178
>gi|146282901|ref|YP_001173054.1| plasmid partitioning protein [Pseudomonas stutzeri A1501] >gi|145571106|gb|ABP80212.1| probable plasmid partitioning protein [Pseudomonas stutzeri A1501] (262 aa)
Score = 230, Expect = 1.7e-17, Identities = 56/182 (30%), Positives = 98/182 (53%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCY------WEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINK-LDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
            V N KGGV KTT S  LA  L+  GK+V+++DLD  G++ + FG  PD+LE ++ D  + +        W+ +L    E + ++P +  L      L ++   Q+ L ++I K L +L   +DY IID+PP + V++   L+     ++P + +  A  GL+R+++            +    +PT  + R
  S:     5 AVANQKGGVGKTTTSVALAGLLADSGKRVVVLDLDPHGSMTSYFGHDPDNLEHSVFDLFQHQGTVPEGLPWQLLLATSHERISLMPSSTVLA----TLERQSPGQNGLGLVIAKSLSQLWQDFDYAIIDSPPLLGVLMVNALAASQQLVIPVQTEFLAMKGLERMVSTLAMINRSRKQALPYTIVPTLFDRR 192
>gi|163756812|ref|ZP_02163921.1| SpoOJ regulator protein [Kordia algicida OT-1] >gi|161323201|gb|EDP94541.1| SpoOJ regulator protein [Kordia algicida OT-1] (256 aa)
Score = 230, Expect = 1.7e-17, Identities = 56/196 (28%), Positives = 106/196 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +E      L+      D++++ +  NL I+P + +L   +  L  K   +  L+  +  + + YDY++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N  + I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVESIEKGTYQLLEHTVNAADVVMETSSPNLSIIPAHIDLVAIEIELVDKDQREYMLRKALKPIKDQYDYILIDCAPSLGLLTLNALTAADAVMIPIQCEYFALEGLGKLLNTIKSVQKIHNPALDIEGLLLTMYDSRLRLSNQVVEEVQK 202
>gi|116630296|ref|YP_815526.1| chromosome partitioning ATPase [Lactobacillus gasseri ATCC 33323] >gi|116095878|gb|ABJ61030.1| chromosome segregation ATPase [Lactobacillus gasseri ATCC 33323] (257 aa)
Score = 230, Expect = 1.8e-17, Identities = 72/249 (28%), Positives = 125/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL AS++  G KV+IVD+D QGN  +  G +   ++  I + L  +    E I   + +NL  +P   +L   +  L      ++ LK  I+++   YD+++ID PP++  +     +  D  L+P + + YA  GL +++N  +  ++  N N+ +  +  T ++ R  +  +++++        + VY T   I   TK   A  Y + PI     KS+    Y +L KE+L
  S:     5 ISVANQKGGVGKTTTTINLGASIANHGYKVLIVDIDPQGNATSGLGIEKSTVDKDIYNVLIDEIPLSETIHHTEIKNLDAVPATIQLAGAEMELTSMMARETRLKQGIDEVSHEYDFILIDCPPSLGQLSINAFTASDSILIPVQSEYYAMEGLSQLLNTIRLVQKHFNKNLGVEGVLLTMLDARTNLGAEVVKEV--QSYFNKKVYKT--IIPRITKLAEAPSYGK-PITEYAPKSRGSQVYDSLAKEVL 250
>gi|187251945|ref|YP_001876427.1| cobyrinic acid ac-diamide synthase [Elusimicrobium minutum Pei191] >gi|186972105|gb|ACC99090.1| Cobyrinic acid ac-diamide synthase [Elusimicrobium minutum Pei191] (274 aa)
Score = 230, Expect = 1.8e-17, Identities = 61/193 (31%), Positives = 103/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTEN--LHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI-VAIPTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT S NLA +L+  G++V++VD D QGN  +  G    D E ++   L      E++L K+T N  L ILP   +L   +  L   +  ++ L   +  L  +Y Y+IID PP++S++    +   +  + P + + YA  GL   IN A + K+  N  + I   + T  ++R+ + N ++E+
  S:     5 VSIANQKGGVGKTTTSINLAYALATLGQEVLLVDFDPQGNASSGIGINLKDGEKSVYHLLTKTAKVEEVL-KRTSNEMLDILPACKDLAGAEVELVNIEGRENMLTQALAPLQNMYKYIIIDCPPSLSLLTLNAMVASNSVITPIQCEYYAMEGLAHFINTASKIKQVLNPKLNIDGGLLTMYDSRMNLSNQVLEE 199
>gi|18311634|ref|NP_563568.1| sporulation initiation inhibitor protein soj [Clostridium perfringens str. 13] >gi|110798938|ref|YP_697342.1| sporulation initiation inhibitor protein soj [Clostridium perfringens ATCC 13124] >gi|110801513|ref|YP_699901.1| sporulation initiation inhibitor protein soj [Clostridium perfringens SM101] >gi|168207746|ref|ZP_02633751.1| sporulation initiation inhibitor protein soj [Clostridium perfringens E str. JGS1987] >gi|168211561|ref|ZP_02637186.1| sporulation initiation inhibitor protein soj [Clostridium perfringens B str. ATCC 3626] >gi|168218047|ref|ZP_02643672.1| sporulation initiation inhibitor protein soj [Clostridium perfringens NCTC 8239] >gi|169343459|ref|ZP_02864459.1| sporulation initiation inhibitor protein soj [Clostridium perfringens C str. JGS1495] >gi|182626402|ref|ZP_02954155.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|18146318|dbj|BAB82358.1| Spo0A activation inhibitor [Clostridium perfringens str. 13] >gi|110673585|gb|ABG82572.1| sporulation initiation inhibitor protein soj [Clostridium perfringens ATCC 13124] >gi|110682014|gb|ABG85384.1| sporulation initiation inhibitor protein soj [Clostridium perfringens SM101] >gi|169298411|gb|EDS80500.1| sporulation initiation inhibitor protein soj [Clostridium perfringens C str. JGS1495] >gi|170660933|gb|EDT13616.1| sporulation initiation inhibitor protein soj [Clostridium perfringens E str. JGS1987] >gi|170710429|gb|EDT22611.1| sporulation initiation inhibitor protein soj [Clostridium perfringens B str. ATCC 3626] >gi|177908276|gb|EDT70829.1| sporulation initiation inhibitor protein soj [Clostridium perfringens D str. JGS1721] >gi|182379927|gb|EDT77406.1| sporulation initiation inhibitor protein soj [Clostridium perfringens NCTC 8239] (257 aa)
Score = 230, Expect = 1.9e-17, Identities = 59/193 (30%), Positives = 104/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK--TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT + N+ + L++ G KV+ +D+D QGN  +  G     L+ +I D L      E I++K    ENL+++P   EL   +  +  ++  +  LK  INK+ + +DY+ ID PP++ V+    L      L+P + + YA  G+ ++IN     K+  N ++ I  +  T  ++R  +  ++ ++
  S:     4 ICVFNQKGGVGKTTTNINICSYLAMQGFKVLAIDIDPQGNTTSGLGIDKRKLDKSIYDLLTAGEEIETIIMKSELVENLYVVPATMELAGAEVEIIDRKDREYILKNEINKIRDKFDYIFIDCPPSLGVLTINALVASHSVLIPIQAEYYALEGVGQLINTINLVKKSLNKDLDIEGVVMTMYDSRTNLSTEVYKE 199
>gi|168214839|ref|ZP_02640464.1| sporulation initiation inhibitor protein soj [Clostridium perfringens CPE str. F4969] >gi|170713728|gb|EDT25910.1| sporulation initiation inhibitor protein soj [Clostridium perfringens CPE str. F4969] (257 aa)
Score = 230, Expect = 1.9e-17, Identities = 59/193 (30%), Positives = 104/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK--TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT + N+ + L++ G KV+ +D+D QGN  +  G     L+ +I D L      E I++K    ENL+++P   EL   +  +  ++  +  LK  INK+ + +DY+ ID PP++ V+    L      L+P + + YA  G+ ++IN     K+  N ++ I  +  T  ++R  +  ++ ++
  S:     4 ICVFNQKGGVGKTTTNINICSYLAMQGFKVLAIDIDPQGNTTSGLGIDKRKLDKSIYDLLTAGEEIETIIMKSELVENLYVVPATMELAGAEVEIIDRKDREYILKNEINKIRDKFDYIFIDCPPSLGVLTINALVASHSVLIPIQAEYYALEGVGQLINTINLVKKSLNKDLDIEGVVMTMYDSRTNLSTEVYKE 199
>gi|88806962|ref|ZP_01122477.1| SpoOJ regulator protein [Robiginitalea biformata HTCC2501] >gi|88782908|gb|EAR14082.1| SpoOJ regulator protein [Robiginitalea biformata HTCC2501] (257 aa)
Score = 230, Expect = 2.0e-17, Identities = 55/196 (28%), Positives = 106/196 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLK-GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT + NLAA+L +  KKV+++D D Q N  +  G   D++       L+  +   E I+   + N+ ++P + +L   +  L  +   +S LK+ + ++   YDYV+ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  +  +N ++ I   + T  + R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTTVNLAAALGVLEKKVLLIDADPQANATSGLGIDADNISLGSYQLLEHTRAASECIIPTNSPNVDLIPAHIDLVAIEIELVDQDRRESMLKVALEEVRHQYDYVLIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQRIHNPDLDIEGMLLTMYDARLRLSNQVVEEVKK 202
>gi|84490349|ref|YP_448581.1| ATPase [Methanosphaera stadtmanae DSM 3091] >gi|84373668|gb|ABC57938.1| predicted ATPase [Methanosphaera stadtmanae DSM 3091] (260 aa)
Score = 230, Expect = 2.0e-17, Identities = 57/192 (29%), Positives = 101/192 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYW-EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIE 194
           I ++N KGG  KTT + NL A+L+  G+KV+++D+D QGN   + G    ++E +    L GKC + E I+   T NL+++P N  L+  +  L ++      L   I     ++DYV ID PP++S++    L   D  ++P + + YA  G+  ++      + + N+   I  I  T  + R  +  D+++
  S:     5 ITILNQKGGCGKTTTAVNLGAALAQLGRKVLVIDIDPQGNATTSLGINKSEIETSTYALLLGKCSFDEAIMETSTPNLYVIPSNISLSGAEMELTKEIGYHYILNEKIEDKCNMFDYVFIDAPPSLSILTLNALVATDSVIIPIQSEFYALEGMADLLKTINLVESRLNNPCPIKGILITLYDPRTRLARDVVD 198
>gi|144897336|emb|CAM74200.1| ATPases involved in chromosome partitioning [Magnetospirillum gryphiswaldense MSR-1] (362 aa)
Score = 230, Expect = 2.0e-17, Identities = 65/250 (26%), Positives = 116/250 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           + + N KGG+ KTT STNLA  L+  GK V+++DLD QG+   + G  P+  +  I D   G    +++ I+ T    + ++P    L   +  L++ + +Q  L  ++N+     DYV+ID PPA+ ++    L+     ++P     YA  GL R + + K  +E  N ++ +  +   ++ R   H    + S   + +  G    S          AA    R+P+ +   +S     + N   E L+
  S:     6 VAIFNQKGGISKTTTSTNLAVCLAAHGKSVVLIDLDSQGDSTKSLGVDPNSKK-GIYDLFIGTAQLDEV-IQDTMFSGVRVVPSTYSLAGIEIKLSEMKDSQRTLSAIVNQAQMDCDYVVIDCPPALGILPINALATAHAVIIPVTATPYANDGLLRTLPSIKYVQEGLNKSLLLQGVLFTIHDR---HKSARKISQLIRSRLGGTVYASEIPRDNMVIEAAAA--RLPVCVYAPRSSAGQAHLNFTGEFLD 250
>gi|150009157|ref|YP_001303900.1| ParaA family ATPase [Parabacteroides distasonis ATCC 8503] >gi|149937581|gb|ABR44278.1| ATPase, ParA family [Parabacteroides distasonis ATCC 8503] (259 aa)
Score = 230, Expect = 2.1e-17, Identities = 71/249 (28%), Positives = 127/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL+   KKV++VD D Q N  +  G    ++E +I + L  G+     I   + E L I+P + +L   +  +   +  +  LK ++  L E YD+++ID  P++ ++    L+  D  ++P + + +A  G+ +++N  K  K K N  ++I   + T  ++R+ + N I E+  +P        V +  I    K + A  Y + P+++    SK    +  L +EI+
  S:     5 IALANQKGGVGKTTTTINLAASLAALEKKVLVVDADPQANASSGLGVDIRNVELSIYECLVNGEDASGAITQTEVEGLDIIPSHIDLVGAEIEMLNLENRERILKQILTPLKEKYDFILIDCSPSLGLITVNALTAADSVIIPVQCEYFALEGISKLLNTIKIIKSKLNPALEIEGFLLTMYDSRLRLANQIYEEVKRPFRD----LVFTTVIQRNVKLSEASSYGK-PVLLYDADSKGSINHMQLAQEIV 250
>gi|57240721|ref|ZP_00368669.1| SpoOJ regulator (soj) [Campylobacter lari RM2100] >gi|57018340|gb|EAL55114.1| SpoOJ regulator (soj) [Campylobacter lari RM2100] (260 aa)
Score = 230, Expect = 2.1e-17, Identities = 75/249 (30%), Positives = 124/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSN-----LKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIE---QSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL++  KKV+++D+D Q N     G    + E+ I     G+    +I++K +   L++ P N  L      + Q+ + +S      L+  I ++ + YD++IID+PPA+  +     +  D  ++P + + YA  G+  ++N  K  K+  N  +KI   +PT  +++  +  D +E   Q+ K KL   G       I       A       PI++   KS     Y NL   IL
  S:     5 ITIANQKGGVGKTTTAINLAASLAVAEKKVLLIDIDPQANATTGLGFNRSNYEYNIYHVFIGRKKLSEIILKTELPQLYLAPSNISL----VGIEQEVVKESGEYRTILREKIKEIAKDYDFIIIDSPPALGSITVNAFAASDSVIIPIQCEFYALEGVAMVLNTIKFVKKTINPKLKIKGFLPTMYSSQNNLSKDTVEDLKQNFKQKLFRTGDNEDDFIIIPRNVKLAESPSYGKPIILYDIKSPGSVAYQNLAHSIL 259
>gi|109947162|ref|YP_664390.1| partition protein, ParA-like protein [Helicobacter acinonychis str. Sheeba] >gi|109714383|emb|CAJ99391.1| Partition protein, ParA homolog [Helicobacter acinonychis str. Sheeba] (264 aa)
Score = 230, Expect = 2.1e-17, Identities = 60/173 (34%), Positives = 101/173 (58%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFD--FLLNQKQITQSNLKMLINKLD---ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           I V N KGGV KTT + NLAASL++  KK++++D D Q N  ++ G + D +++ I   L G+     +++K +   L ++P N  L  F+  F  +Q +  +  L ML N L    +LYDY+IID+PPA+  +   +LS     ++P + + +A  G K ++N  +  ++  N  +KI
  S:     6 IAVANQKGGVGKTTTAVNLAASLAVFEKKILLIDFDPQANATSSLGFRRDKIDYDIYHVLIGRKQISQVILKTQMPFLDLVPSNLGLAGFEKTFYDSQDENKRGEL-MLKNALGGVIKLYDYIIIDSPPALGPLTINSLSAAHSVIIPIQCEFFALEGTKLLLNTIRMLQKSTNPKLKI 183
>gi|89898873|ref|YP_521344.1| cobyrinic acid a,c-diamide synthase [Rhodoferax ferrireducens T118] >gi|89343610|gb|ABD67813.1| chromosome segregation ATPase [Rhodoferax ferrireducens T118] (261 aa)
Score = 230, Expect = 2.1e-17, Identities = 61/191 (31%), Positives = 100/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWE-----DILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAA L+  G++V++VDLD QGN     G     LE  I D  L+     E     D LI+      IL  N EL   +  +   +  +  LK  + ++++ YD+++ID PP++S++    L      +VP + + +A  GL  ++N  K+     N ++ I+  +    + R+T+   + EQ
  S:     7 VANQKGGVGKTTTTVNLAAGLAKVGQRVLMVDLDPQGNATMGSGVDKRQLELTIYDVLLEAASVAEARVKSDRLIEAGCGYDILGANRELTGAEVEMVAMERRERRLKEALTEVEKDYDFILIDCPPSLSMLTLNGLCCAHGVIVPMQCEYFALEGLTDLVNTIKQVHANLNKDLAIIGLLRVMFDPRITLQQQVSEQ 204
>gi|21220264|ref|NP_626043.1| partitioning or sporulation protein [Streptomyces coelicolor A3(2)] >gi|5738488|emb|CAB52836.1| putative partitioning or sporulation protein [Streptomyces coelicolor A3(2)] (340 aa)
Score = 229, Expect = 2.1e-17, Identities = 53/188 (28%), Positives = 102/188 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHN 190
           I + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P +L+  + + L  +    D ++ KT   N+ +LP N +L+  +  L  +   +S L+  +  L + YDY++ID  P++ ++    L+     +VP E + +A  G+  +    ++ +E+ N ++++  I   +    T+H+
  S:    88 IAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGVNPMELDLTVYNLLMERGMAADEVLLKTAVPNMDLLPSNIDLSAAEVQLVSEVARESTLQRALKPLMDDYDYIVIDCQPSLGLLTVNALTAAHKVIVPLECEFFALRGVALLTETIEKVQERLNPDLELDGILATMYDSRTVHS 277
>gi|15838873|ref|NP_299561.1| chromosome partitioning protein [Xylella fastidiosa 9a5c] >gi|9107443|gb|AAF85081.1|AE004040_6 chromosome partitioning protein [Xylella fastidiosa 9a5c] (264 aa)
Score = 229, Expect = 2.3e-17, Identities = 56/190 (29%), Positives = 96/190 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L    ++V++VDLD QGN     G   + L  +  + L G+    +   +  E   +LPGN +L      L ++   +  LK  ++ +   YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLVRASERVLLVDLDSQGNATMGSGVDKNGLISSTCEVLLGERSVAESRARAPEGFDLLPGNIDLTAAAIQLMEQSEREQRLKRALSPIRHEYDFILIDCPPALSLLTVNALTAADSVIVPMQCEYYALEGLSALLETIEALRVNLNPRLEIEGV---LRTMFDIRNNL 191
>gi|71274486|ref|ZP_00650774.1| Cobyrinic acid a,c-diamide synthase [Xylella fastidiosa Dixon] >gi|71898319|ref|ZP_00680492.1| Cobyrinic acid a,c-diamide synthase [Xylella fastidiosa Ann-1] >gi|71899893|ref|ZP_00682041.1| Cobyrinic acid a,c-diamide synthase [Xylella fastidiosa Ann-1] >gi|170730589|ref|YP_001776022.1| chromosome partitioning protein [Xylella fastidiosa M12] >gi|182681932|ref|YP_001830092.1| cobyrinic acid ac-diamide synthase [Xylella fastidiosa M23] >gi|71164218|gb|EAO13932.1| Cobyrinic acid a,c-diamide synthase [Xylella fastidiosa Dixon] >gi|71730333|gb|EAO32416.1| Cobyrinic acid a,c-diamide synthase [Xylella fastidiosa Ann-1] >gi|71731842|gb|EAO33900.1| Cobyrinic acid a,c-diamide synthase [Xylella fastidiosa Ann-1] >gi|167965382|gb|ACA12392.1| chromosome partitioning protein [Xylella fastidiosa M12] >gi|182632042|gb|ACB92818.1| Cobyrinic acid ac-diamide synthase [Xylella fastidiosa M23] (273 aa)
Score = 229, Expect = 2.3e-17, Identities = 56/190 (29%), Positives = 96/190 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L    ++V++VDLD QGN     G   + L  +  + L G+    +   +  E   +LPGN +L      L ++   +  LK  ++ +   YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:    14 IAIANQKGGVGKTTTAVNLAAGLVRASERVLLVDLDSQGNATMGSGVDKNGLISSTCEVLLGERSVAESRARAPEGFDLLPGNIDLTAAAIQLMEQSEREQRLKRALSPIRREYDFILIDCPPALSLLTVNALTAADSVIVPMQCEYYALEGLSALLETIEALRVNLNPRLEIEGV---LRTMFDIRNNL 200
>gi|28199202|ref|NP_779516.1| chromosome partitioning protein [Xylella fastidiosa Temecula1] >gi|28057308|gb|AAO29165.1| chromosome partitioning protein [Xylella fastidiosa Temecula1] (264 aa)
Score = 229, Expect = 2.5e-17, Identities = 56/190 (29%), Positives = 96/190 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDI 192
           I + N KGGV KTT + NLAA L    ++V++VDLD QGN     G   + L  +  + L G+    +   +  E   +LPGN +L      L ++   +  LK  ++ +   YD+++ID PPA+S++    L+  D  +VP + + YA  GL  ++   +  +   N  ++I  +   + T   I N++
  S:     5 IAIANQKGGVGKTTTAVNLAAGLVRASERVLLVDLDSQGNATMGSGVDKNGLISSTCEVLLGERSVAESRARAPEGFDLLPGNIDLTAAAIQLMEQSEREQRLKRALSPIRREYDFILIDCPPALSLLTVNALTAADSVIVPMQCEYYALEGLSALLETIEALRVNLNPRLEIEGV---LRTMFDIRNNL 191
>gi|23100942|ref|NP_694409.1| sporulation initiation inhibitor [Oceanobacillus iheyensis HTE831] >gi|22779177|dbj|BAC15443.1| sporulation initiation inhibitor [Oceanobacillus iheyensis HTE831] (257 aa)
Score = 229, Expect = 2.5e-17, Identities = 71/249 (28%), Positives = 124/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL+A L+  G +V++VD D QGN  +  G    D+   I + L      E++++  + E L I+P   +L   +  L      +  LK  I  + + YD++IID PP++ ++    L+  D  ++P + + YA  GL +++N  +  ++  N  + I  +  T ++ R  +   +IE+    K     VY T   I    +   A  +  +PI+    KS+  + Y +L KE++
  S:     5 ISIANQKGGVGKTTSSVNLSACLASLGNRVLLVDTDPQGNATSGVGVNKADVSQCIYNILVEDATAEEVIVHSEMEQLDIIPATIQLAGAEIELVPIISREIRLKSAIEAVKDQYDFIIIDCPPSLGLLTINALTASDTVMIPVQCEYYALEGLSQLLNTIRLVQKHLNQQLMIEGVLLTMLDARTNLGIQVIEEV--KKYFQDKVYQT--IIPRNVRLGEAPSHG-LPIISYDPKSRGAEVYLDLAKEVM 250
>gi|152998466|ref|YP_001343301.1| cobyrinic acid ac-diamide synthase [Marinomonas sp. MWYL1] >gi|150839390|gb|ABR73366.1| Cobyrinic acid ac-diamide synthase [Marinomonas sp. MWYL1] (255 aa)
Score = 229, Expect = 2.5e-17, Identities = 55/193 (28%), Positives = 105/193 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   ++V+++DLD QGN     G   ++L+ ++ D L G    ++++ K    +  +LP N +L   + +L      ++ L+  + ++D  +DY+++D PPA++++    L+     L+P + + YA  GL  ++       +  N ++++  I  T  + R ++ +D+  Q
  S:     5 IAVTNQKGGVGKTTTCVNLAASLAAMKRRVLLIDLDPQGNATTGSGFTKEELDTSVYDVLIGSHGVKEVMKKSMPGDYWVLPANGDLTGAEVVLLDLPSKETRLRAGLYEVDSDFDYILLDCPPALNMLTVNALAASQGVLIPVQCEYYALEGLTALLQTINRITQALNPSLEVEGILRTMYDPRPSLTHDVSSQ 199
>gi|144901043|emb|CAM77907.1| similar to sporulation initiation inhibitor protein soj [Magnetospirillum gryphiswaldense MSR-1] (368 aa)
Score = 229, Expect = 2.5e-17, Identities = 58/176 (32%), Positives = 87/176 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           + V N KGGV KTT S NLA  ++  GK+V+++DLD Q N     G  P  +       L G+   ++ L K   ENL ++ G+DEL + D  L  +   Q  L   + KL +  D ++ID PPA  +V    L   DV ++P  P  +A  GL +        +   NH++  + I
  S:    25 VTVFNQKGGVGKTTTSVNLAVCMAALGKRVVLLDLDSQSNATTNVGVTPP-ISTGAYQLLTGRAPADECLRKTDYENLRLIGGSDELAWADIELALQPECQGILGKALEKLPDNIDILVIDCPPAPGIVSVNALVAADVVVMPVMPSPHALDGLHKAWWNVNRVRSSYNHDLHTINI 200
>gi|170719583|ref|YP_001747271.1| cobyrinic acid ac-diamide synthase [Pseudomonas putida W619] >gi|169757586|gb|ACA70902.1| Cobyrinic acid ac-diamide synthase [Pseudomonas putida W619] (257 aa)
Score = 229, Expect = 2.6e-17, Identities = 63/211 (29%), Positives = 111/211 (52%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + +++DLD Q N      G   +D+   I DF K         K    DI     +NLH++    EL      L  K    + L+ L+++LDE Y+ + IDTPPA++    + L   D  L+PF+ D ++   L  ++   +E K+ +N  + +  I   +  +R ++   ++++ L   L    VY++S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSASEGYRTLLIDLDAQANSTQYLTGLTGEDIPMGIADFFKQSLSSGPFSKKNKVDIYETPFDNLHVITATSELADLQPKLEAKHKI-NKLRKLLDELDEDYERIYIDTPPALNFYAVSALIAADRVLIPFDCDSFSRQALYGLLAEIEELKDDHNEELVVEGIVVNQFQSRASLPQQMLDELLAEGLPVLPVYLSSS 220
>gi|14521493|ref|NP_126969.1| hypothetical protein PAB0852 [Pyrococcus abyssi GE5] >gi|5458712|emb|CAB50199.1| ATPase involved in chromosome partitioning, minD/MRP superfamily [Pyrococcus abyssi GE5] (257 aa)
Score = 229, Expect = 2.7e-17, Identities = 58/186 (31%), Positives = 101/186 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNV-IATFGKKPDDLEFA-IMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTI 188
           I + N KGGV KTT++ NL  SLS  GKKV++VD+D Q N+  A  G    + E   +   +  +   ED+LI+  ENLH++P +  L+  +  +      +  L+  +  +   YDY+IID PP+M + +  +L+  D  L+P E   +  +G++ + N     +E+ N  ++++ I P K   +  +
  S:     5 ISIANQKGGVGKTTIALNLGYSLSRLGKKVLLVDVDPQFNLTFALIGMDVVNYEDKNVGTLMTRESSVEDVLIEVEENLHLIPSHLTLSAKEIEIMNTYNRERRLEKALKPIFPDYDYIIIDNPPSMGIFLVNSLTASDYVLIPLELSYFGVIGMQLMFNLMSMIREETNEGLRLLGIVPNKFTKQTKV 193
>gi|188589512|ref|YP_001921138.1| sporulation initiation inhibitor protein soj [Clostridium botulinum E3 str. Alaska E43] >gi|188499793|gb|ACD52929.1| sporulation initiation inhibitor protein soj [Clostridium botulinum E3 str. Alaska E43] (251 aa)
Score = 228, Expect = 2.8e-17, Identities = 69/221 (31%), Positives = 122/221 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDEL--NYFDFLLNQKQITQSNLKMLINKLDE-LYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLK----TQGVYVTSNFISSTTKSTAAV 223
           I  +N KGGV KTT   N+AA L  +GK V+I+D+D Q N           ++    + L+G    EDI I+ T  + L +LPGN  L  +  + L + K++ ++ LK  ++  D+  +DY++ID PP++ ++    L   D  +VP + D++   G + ++++ +   E+ NHN+ ++ I   ++    IH + I+Q LK +L      Q +    + + ST +ST  V
  S:     4 ISFLNIKGGVAKTTSCVNVAAQLGKEGKNVLIIDIDPQSNATKYLNMYDSHVK-GTYEVLRG----EDISIQPTKYDGLWLLPGNINLIMSEGEILTDTKRVKETRLKTWLSVKDQKAFDYILIDCPPSLGMLSTNALVASDYVIVPLKIDKFGLDGFEYLMSSIEGVGEQFNHNLNLLGILITMDKSTRIHKE-IKQELKEELGDLIFNQTIRDNVDIVKSTFESTPVV 227
>gi|146297967|ref|YP_001192558.1| cobyrinic acid a,c-diamide synthase [Flavobacterium johnsoniae UW101] >gi|146152385|gb|ABQ03239.1| Cobyrinic acid a,c-diamide synthase [Flavobacterium johnsoniae UW101] (255 aa)
Score = 228, Expect = 2.8e-17, Identities = 58/196 (29%), Positives = 108/196 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +E      L+     ++ ++K T  N+ ++P + +L   +  L  K+  +  LK  + +  E YDY+IID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N ++ I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVETVETGTYQILEHTVTPKEAILKCTSPNVDVIPAHIDLVAIEIELVDKENREYMLKKALEEAKEEYDYIIIDCAPSLGLLTLNALTAADSVVIPIQCEYFALEGLGKLLNTIKSIQKIHNPDLDIEGLLLTMYDSRLRLSNQVVEEVQK 202
>gi|91795106|ref|YP_564757.1| cobyrinic acid a,c-diamide synthase [Shewanella denitrificans OS217] >gi|91717108|gb|ABE57034.1| Cobyrinic acid a,c-diamide synthase [Shewanella denitrificans OS217] (261 aa)
Score = 228, Expect = 2.9e-17, Identities = 59/193 (30%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G     +E    + L  +  +++I++K T   + ++ GN ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + YA  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYGVEHTAYELLVEEKSFDEIVVKNTIGKYDLIAGNGDVTAAEIKLMEFYAREIRLRNALAPIKDQYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTISKLATMVNPGLTIEGILRTMYDPRNRLSNDVSDQ 199
>gi|158316823|ref|YP_001509331.1| cobyrinic acid ac-diamide synthase [Frankia sp. EAN1pec] >gi|158112228|gb|ABW14425.1| Cobyrinic acid ac-diamide synthase [Frankia sp. EAN1pec] (329 aa)
Score = 228, Expect = 2.9e-17, Identities = 52/187 (27%), Positives = 100/187 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIH 189
           + + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P   E  + D L  G    +D +++ + E L +LP N +L+  + LL  +   + +L   +  + ++YD ++ID  P++ ++    L+  D  +VP E + +A  G+  ++    + +E+ N  +++  I   +    T+H
  S:    73 VAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGINPMQFEVTVHDLLLGGDADIQDTIVETQVEGLDLLPSNIDLSAAEVLLVTEVGREHSLARTLAPVMDVYDVILIDCQPSLGLLTVNALTAADAVMVPLECEYFALRGVALLLQTIDKVRERLNSRLELAGILATMYDARTLH 261
>gi|171462845|ref|YP_001796958.1| cobyrinic acid ac-diamide synthase [Polynucleobacter necessarius STIR1] >gi|171192383|gb|ACB43344.1| Cobyrinic acid ac-diamide synthase [Polynucleobacter necessarius STIR1] (256 aa)
Score = 228, Expect = 2.9e-17, Identities = 56/194 (28%), Positives = 104/194 (53%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           + N KGGV KTT + NLAA L+   ++V++VDLD QGN     G +  DL F++   L G    ++   + ++    +LP N +L   +  L    + +  LK  + ++ + YD+++ID PPA+S++    L   +  +VP + + +A  GL  ++N  K+     N ++ I+  +    + R+T+   + +Q L+
  S:     7 IANQKGGVGKTTTAVNLAAGLAGLKQRVLLVDLDPQGNATMGSGVEKADLNFSVYQVLIGMASVKECAQRCESSGFDVLPANRDLVGAEIELVDLDLREVRLKDALAQVADDYDFILIDCPPALSLLTLNGLCAANGVIVPMQCEYFALEGLSDLVNTIKQVHANLNPDLVIIGLLRVMFDARMTLQQQVSDQLLE 202
>gi|153940635|ref|YP_001392995.1| sporulation initiation inhibitor protein soj [Clostridium botulinum F str. Langeland] >gi|152936531|gb|ABS42029.1| sporulation initiation inhibitor protein soj [Clostridium botulinum F str. Langeland] (254 aa)
Score = 228, Expect = 3.0e-17, Identities = 70/249 (28%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE---NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL + L+++G K++ +D+D QGN  +  G   + LE ++ + L          IK++E   N +ILP    L   +  L  K   +  L   + +++  +DYV ID PP++ ++    L+  D  L+P + + Y+  G+ +++N  +  ++  N N+++   I +  + R  + N++ E+    K     VY T+  I    +   A  +  +PI++   K K  + Y+NL KE +
  S:     4 ISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYNVLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLKEIENDFDYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVEGVILSMYDIRTRLCNEVAEEV--KKYFNDKVYKTT--IPRNVRLAEAPSFG-LPIILYDSKCKGAEAYNNLSKEFI 251
>gi|126663385|ref|ZP_01734383.1| regulator protein; cell division inhibitor [Flavobacteria bacterium BAL38] >gi|126625043|gb|EAZ95733.1| regulator protein; cell division inhibitor [Flavobacteria bacterium BAL38] (254 aa)
Score = 228, Expect = 3.0e-17, Identities = 56/196 (28%), Positives = 105/196 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +E      L+     E  ++     N+ ++P + +L   +  L  K+  +  LK  +  + + YDY++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N N+ I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANASSGLGIDVESVEIGSYQVLEHSATPEQAIVSCSAPNVSVIPAHIDLVAIEIELVDKENREYMLKQALESIKDKYDYILIDCAPSLGLLTLNALTAADSVVIPIQCEYFALEGLGKLLNTIKSVQKIHNPNLDIEGLLLTMYDSRLRLSNQVVEEVQK 202
>gi|114778891|ref|ZP_01453688.1| ParA, ParA family ATPase [Mariprofundus ferrooxydans PV-1] >gi|114550860|gb|EAU53426.1| ParA, ParA family ATPase [Mariprofundus ferrooxydans PV-1] (262 aa)
Score = 228, Expect = 3.1e-17, Identities = 72/249 (28%), Positives = 124/249 (49%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLD-ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
            + N KGGV KTT S NLAASL+   K+V+++DLD QGN  +  G   + +     D L G     D I+    E L +LP + +L   +  L  +   +  L+        E +DYV ID PPA+S++    LS  D  +V  + + YA  GL +++++ +  K+  N ++ +  I  T V+ R  +    +E+ ++    +Q   V +N I    + + A  +  VP++    +SK    Y  + +E ++
  S:    11 AIANQKGGVGKTTTSINLAASLAALEKRVLLIDLDPQGNSTSGLGVNQNTVRSGTYDVLMGDAQLSDAIIATDCERLLLLPASMDLAGAEIELVSELGRELRLEQAFAAYKGEAFDYVFIDCPPALSLLTVNALSASDHVMVTLQTEFYAMEGLTQLMDSIRRIKQALNSSLTMEGILLTMVDGRNRLSTQ-VEEDVRAYFGSQ---VYANTIPRNVRLSEAPSFG-VPVMYHDVRSKGAQAYLVVAQEFMH 257
>gi|149912892|ref|ZP_01901426.1| chromosome partitioning protein ParA [Roseobacter sp. AzwK-3b] >gi|149813298|gb|EDM73124.1| chromosome partitioning protein ParA [Roseobacter sp. AzwK-3b] (269 aa)
Score = 228, Expect = 3.2e-17, Identities = 69/250 (27%), Positives = 120/250 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKL---DELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I V N KGGV KTT + NL A+L+  G+KV+I+DLD QGN     G    D E    + L  +    +++ +   +NL I+P   +L+  D  L   +     L   + +    D   DY++ID PP+++++    +      LVP + + +A  GL +++   +E ++  N N++I  +   V T     N++  Q  +      G  V    I    + + A  Y  VP++     SK    Y +L +E+++
  S:    13 IAVANQKGGVGKTTTTINLGAALAEAGQKVLIIDLDPQGNASTGLGIDASDRELTTYELLLEEIDLSEVVQETAFDNLLIVPATVDLSSADMELIATEKRSFLLHDALRQTAMDDYAIDYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTANPNLRIEGV---VLTMFDARNNLSSQVEQDARDNLGALVFQTRIPRNVRVSEAPSYA-VPVLQYDSASKGAQAYRDLARELMS 262
>gi|17548043|ref|NP_521445.1| putative chromosome partitioning protein PARA [Ralstonia solanacearum GMI1000] >gi|17430349|emb|CAD17114.1| putative chromosome partitioning protein para [Ralstonia solanacearum] (261 aa)
Score = 228, Expect = 3.2e-17, Identities = 57/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  G++V++VDLD QGN     G     LE ++   L G         +     + +LP N +L   +  L      ++ LK  + ++ + YD+V+ID PPA+S++    L      +VP + + +A  GL  ++N  K+     N ++K++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQGQRVLLVDLDPQGNASMGSGIDKHTLEMSVYQVLVGLATIPQARQRSESGRYDVLPANRDLAGAEVELVDLDHRETRLKRALAEVADDYDFVLIDCPPALSLLTLNGLCAAHGVIVPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|152988947|ref|YP_001351084.1| hypothetical protein PSPA7_5765 [Pseudomonas aeruginosa PA7] >gi|150964105|gb|ABR86130.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] (255 aa)
Score = 228, Expect = 3.2e-17, Identities = 62/211 (29%), Positives = 113/211 (53%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + ++VDLD Q N      G   +DL   I DF K         K    DI     +NLHI+  + EL      L  K    + L+ L+++LD+ Y+ + +DTPPA++    + L   D  L+PF+ D ++   L  ++   +E ++ +N ++++  I   +   R ++   ++++ +  +L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSAAEGYRTLLVDLDAQANSTHYLTGLTGEDLPVGIADFFKQTLSSGPFSKKGRVDIHETPFDNLHIVTASPELADLQPKLESKHKI-NKLRKLLDELDDDYERIYLDTPPALNFYTVSALIAADRCLIPFDCDSFSRQALYGLLQEIEELRDDHNEDLQVEGIVVNQFQPRASLPQQLLDELVAEELPVLPVYLMSS 220
>gi|111225405|ref|YP_716199.1| putative partitioning or sporulation protein [Frankia alni ACN14a] >gi|111152937|emb|CAJ64685.1| Putative partitioning or sporulation protein [Frankia alni ACN14a] (319 aa)
Score = 228, Expect = 3.3e-17, Identities = 49/183 (26%), Positives = 100/183 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTR 185
           + V N KGGV KTT   +L A+LS  G++V++VDLD Q  +  + G  PD LE ++ D L G+     ++ + ++ + +LP   EL   + +L  +   +  L++ + ++ + YD+V++D PP++ V+    L+     +VP + +  +  G+ ++++   + +   N  + +  + PT  + R
  S:     5 LAVANQKGGVAKTTSVASLGAALSELGRRVLLVDLDPQACLTFSLGLDPDTLELSVHDVLLGRLSAGIVITRTSDGMDLLPATIELAGCEAVLLSRTGREHALRLALAEVIDAYDFVLVDCPPSLGVLTINGLTAAAEVIVPLQCETLSHRGVGQLLDTVHDVQRLTNPGLGVRGVLPTLFDGR 188
>gi|114322025|ref|YP_743708.1| cobyrinic acid a,c-diamide synthase [Alkalilimnicola ehrlichei MLHE-1] >gi|114228419|gb|ABI58218.1| Cobyrinic acid a,c-diamide synthase [Alkalilimnicola ehrlichei MLHE-1] (277 aa)
Score = 228, Expect = 3.3e-17, Identities = 54/173 (31%), Positives = 90/173 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           I V N KGGV KTT   NLAASL+ + ++V++VDLD QGN     G   +       D L G+    D  ++ K     +LPGN +L   +  L + +  +  L+  +  +   YDY++ID PP+++++    L   D  L+P + + YA  GL  +++  +  +   N ++ I
  S:     5 IAVANQKGGVGKTTTCVNLAASLAANKQRVLLVDLDPQGNATVGCGVDKNREGGVGYDALLGERPLADCRMRLKETGFDLLPGNGDLTAAEVALMESEQREQYLRRALAAVVGEYDYILIDCPPSLNILTVNALVAADGVLIPIQCEYYALEGLTALLDTIRRIQASANRDLSI 178
>gi|169825317|ref|YP_001692928.1| chromosome partitioning protein ParA-like protein [Finegoldia magna ATCC 29328] >gi|167832122|dbj|BAG09038.1| chromosome partitioning protein ParA homolog [Finegoldia magna ATCC 29328] (273 aa)
Score = 228, Expect = 3.4e-17, Identities = 58/176 (32%), Positives = 96/176 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I V N KGGV KTT   NL+A+L L GKKV++VDLD QGN  + FG    +L+ ++ D +  + + ED +IK  E N+ I+P   +L+  +  L      +  L  +++ +   YD+  ID PP++  +    L   +  L+P + + YA  G+ +++N     +   N N++I  I
  S:    29 ICVFNQKGGVGKTTTVVNLSAALGLKGKKVLVVDLDPQGNTTSGFGINKFELQKSVYDLMVHEDFDEDFIIKTEEKNVDIIPATSDLSGVEVELINTNDKEKVLSKILSNVSG-YDFCFIDCPPSLGTLSINALVAANSVLIPIQCEFYALEGVSQLMNTINLVRSSLNENLEIEGI 204
>gi|170755411|ref|YP_001783274.1| sporulation initiation inhibitor protein soj [Clostridium botulinum B1 str. Okra] >gi|169120623|gb|ACA44459.1| sporulation initiation inhibitor protein soj [Clostridium botulinum B1 str. Okra] (254 aa)
Score = 228, Expect = 3.4e-17, Identities = 70/249 (28%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE---NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL + L+++G K++ +D+D QGN  +  G   + LE ++ + L          IK++E   N +ILP    L   +  L  K   +  L   + +++  +DYV ID PP++ ++    L+  D  L+P + + Y+  G+ +++N  +  ++  N N+++   I +  + R  + N++ E+    K     VY T+  I    +   A  +  +PI++   K K  + Y+NL KE +
  S:     4 ISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYNVLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLKEIENDFDYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVEGVILSMYDIRTRLCNEVAEEV--KKYFNDKVYKTT--IPRNVRLAEAPSFG-LPIILYDPKCKGAEAYNNLSKEFI 251
>gi|168334913|ref|ZP_02693033.1| ParA, ParA family ATPase [Epulopiscium sp. 'N.t. morphotype B'] (258 aa)
Score = 228, Expect = 3.4e-17, Identities = 63/193 (32%), Positives = 109/193 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDF----LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQ 195
           I VVN KGGV KTT   NLAA+L++D + V+++D+D QGN  +  G     +++ + D L      ED ++K + E++ I+ G+  L   D     L N+ QI ++ +K ++    + YDY +ID  P ++++    L+  D  L+P + + YA  GL +++   +  KE  N N+ I+ I  T  + R  + N +I +
  S:     5 ISVVNQKGGVGKTTTVMNLAAALAVDAR-VLMIDIDPQGNSSSGLGVNKFQVKYTLYDVLTDNIDIEDAILKAEGESVDIIAGDYNLAGLDIEFINLPNKDQILKNKMKSIL----KYYDYCLIDCSPGVNILNINALNASDFILIPMQCEYYALEGLTQVMRTFRLVKENTNKNLSIIGILFTMYDCRTNLSNAVISE 198
>gi|167760891|ref|ZP_02433018.1| hypothetical protein CLOSCI_03279 [Clostridium scindens ATCC 35704] >gi|167661494|gb|EDS05624.1| hypothetical protein CLOSCI_03279 [Clostridium scindens ATCC 35704] (275 aa)
Score = 228, Expect = 3.5e-17, Identities = 60/190 (31%), Positives = 103/190 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFLKG----KCYWEDI---LIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI 192
           I + N KGGV KTT + NL  SL+  GKKV+++D D Q N+    G  +PDD+   +   ++     K +  D+   ++   E + +LP N EL+ F+  L      +  LK  +N++ + YDYV+ID  P++ ++    L+  D  ++P +P   +  GL+ ++ +    K + N  ++I  I  T V  R  I  +I
  S:     7 IALTNQKGGVGKTTTAVNLGVSLAKQGKKVLLIDADAQANLTMALGYSRPDDIPITLSTMMQSIIDDKAF--DVSQGILHHHEGVDLLPSNIELSGFEVRLINAMSRERVLKTYVNEVKKNYDYVLIDCMPSLGMITINALAAADSVVIPTQPHYLSAKGLELLLRSVSMVKRQINPKLRIDGILMTMVMPRTNISKEI 203
>gi|157964060|ref|YP_001504094.1| cobyrinic acid ac-diamide synthase [Shewanella pealeana ATCC 700345] >gi|157849060|gb|ABV89559.1| Cobyrinic acid ac-diamide synthase [Shewanella pealeana ATCC 700345] (262 aa)
Score = 228, Expect = 3.6e-17, Identities = 57/193 (29%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   ++V+++DLD QGN     G     +E    + L  +  +E+++ + T   + ++ GN ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + YA  GL  +++   +     NH + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRRVLLIDLDPQGNATMGSGIDKYTVENTAYELLVEEKPFEEVVCRDTNGKYDLIAGNGDVTAAEIKLMEFFAREVRLRNALAPIKDDYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKLGAMVNHGLHIEGILRTMYDPRNRLSNDVSDQ 199
>gi|157164247|ref|YP_001466338.1| sporulation initiation inhibitor protein soj [Campylobacter concisus 13826] >gi|112799908|gb|EAT97252.1| sporulation initiation inhibitor protein soj [Campylobacter concisus 13826] (260 aa)
Score = 228, Expect = 3.6e-17, Identities = 81/250 (32%), Positives = 128/250 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLN-QKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDII---EQSLKPKL------KTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NLAASL++  KKV+++D+D Q N     G    D EF I   L  +     I++K +   L + P N  L   +   N Q +  +  LK  I+++ + YD++IID+PPA+  +    LS  D  ++P + + YA  GL +I+N  K  K+  N  + I   +PT  +++  +  + I   +Q  + KL      K + V V  N   + + S         P+++   KS     Y NL   ILN
  S:     5 ITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDIDPQANATTGLGFSRSDYEFNIYHVLTDRKKLSQIVLKTEIPTLFLAPSNIGLVGIEQEFNDQSKDYKLILKNKISEVVDDYDFIIIDSPPALGSITINALSASDSVIIPIQCEFYALEGLAQILNTVKIIKKTINPKLNIKGFLPTMFSSQNNLSKETIANLKQHFENKLFKSKDGKDEFVVVPRNVKLAESPSFGK------PVILYDIKSPGSIAYQNLAYCILN 260
>gi|89067427|ref|ZP_01154940.1| chromosome partitioning protein ParA [Oceanicola granulosus HTCC2516] >gi|89046996|gb|EAR53050.1| chromosome partitioning protein ParA [Oceanicola granulosus HTCC2516] (265 aa)
Score = 228, Expect = 3.6e-17, Identities = 73/249 (29%), Positives = 123/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDE------LYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A+LS  G  V+IVD+D QGN     G + D  E +I D L G+    D  I+ TE  +L I+P   +L+  D  L     T+    +L + L +        DYV+ID PP+++++    L   D  LVP + + +A  GL +++   +E +E  N  ++I  +   +  +    N++ +Q  +   +  G  V    I    + + A  +  +P++     S+    Y  L  E++
  S:    13 IAIANQKGGVGKTTTAINLGAALSHAGHTVLIVDIDPQGNASTGLGVEADARETSIYDVLLGEAELADT-IRSTEVGDLLIIPATTDLSSADIELIS---TEKRSFLLHDALRQPAVDRFALDYVLIDCPPSLNLLTVNALVAADSVLVPLQSEFFALEGLSQLMLTVREVRETANPRLRIEGVALTMYDK---RNNLSQQVEEDARENLGDLVFQTVIPRNVRLSEAPSFA-MPVLDYDPSSRGAQAYQALAAELI 261
>gi|110835596|ref|YP_694455.1| ParA family ATPase [Alcanivorax borkumensis SK2] >gi|110648707|emb|CAL18183.1| ParA family ATPase [Alcanivorax borkumensis SK2] (265 aa)
Score = 228, Expect = 3.6e-17, Identities = 59/192 (30%), Positives = 99/192 (51%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTEN--LHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            V N KGGV KTT S NLAASL+   KKV++VD+D QGN     G    D ++ I D L      E  +    E+    ++  N +L   +  L      +  L+  + ++ + YDY++ID PP+++++    L+  D  +VP + + YA  GL  ++N  ++ +   N  + I   + T  + R ++ ND+  Q
  S:     6 AVANQKGGVGKTTSSVNLAASLAATRKKVMLVDIDPQGNATTGSGVDKFDTDYTIYDVLCDDVAIEQAVTDTPEDSGFDLIAANGDLTAAEVQLLDMSAKEFRLRNALARVRDQYDYILIDCPPSLNMLTVNALTAADSVIVPIQCEYYALEGLTALMNTIEKIRMVLNPKLHIGGLLRTMYDPRNSLSNDVSNQ 200
>gi|34496118|ref|NP_900333.1| ParA family chromosome partitioning ATPase [Chromobacterium violaceum ATCC 12472] >gi|34101972|gb|AAQ58339.1| chromosome partitioning protein, ParA family ATPase [Chromobacterium violaceum ATCC 12472] (263 aa)
Score = 228, Expect = 3.6e-17, Identities = 62/193 (32%), Positives = 98/193 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAA L+  G++V+IVDLD QGN     G     LE +  D L G+   E+     K     +LP N  L   +  L  +   ++ LK  + ++   YDYV+ID+PP+++++    L   D  L+P   + YA  GL  ++   ++ +   N  ++I+  + T  + R  +   + EQ
  S:     6 IAVANQKGGVGKTTTVVNLAAGLAELGRRVLIVDLDPQGNATMGSGIAKQSLEKSGYDVLLGEATIEEARQDAKAGGYQVLPANRNLGGAELELVNELAREARLKNALAEVAGQYDYVLIDSPPSLNLLTLNGLVAADSVLIPMVCEYYALEGLSDLVATLRKVRLAVNPKIEIMGLLRTMFDARNNLSQQVSEQ 200
>gi|126651986|ref|ZP_01724178.1| chromosome partitioning protein; transcriptional regulator [Bacillus sp. B14905] >gi|169830193|ref|YP_001700351.1| sporulation initiation inhibitor protein soj [Lysinibacillus sphaericus C3-41] >gi|126591255|gb|EAZ85364.1| chromosome partitioning protein; transcriptional regulator [Bacillus sp. B14905] >gi|168994681|gb|ACA42221.1| Sporulation initiation inhibitor protein soj [Lysinibacillus sphaericus C3-41] (253 aa)
Score = 227, Expect = 3.9e-17, Identities = 69/249 (27%), Positives = 125/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL+A L+  GKKV+++D D QGN  +  G    D++  I D L      E+++ K   +NL I+P    L   +  L      +  LK  +  + E +DY+IID PP++ ++    L+  D  ++P + + YA  GL ++++  +  ++  N  + I  +  T ++ R  +   +I++    K     VY T   I    + + A  + + PI+    +S+  + Y  + +E++
  S:     5 IAIANQKGGVGKTTTSVNLSACLAYLGKKVLLIDTDPQGNTTSGLGINKGDIQSCIYDVLIDDEDVENVIQKTNVDNLSIVPATISLAGAEIELVSTISREVRLKHALQNVKEDFDYIIIDCPPSLGLLTINALTASDALIIPVQCEYYALEGLSQLLSTVRLVQKHLNQQLYIDGVLLTMLDARTNLGLQVIDEV--KKYFQDKVYKT--IIPRNVRLSEAPSHGQ-PIITYDARSRGAEVYLEMAREVI 250
>gi|167766875|ref|ZP_02438928.1| hypothetical protein CLOSS21_01392 [Clostridium sp. SS2/1] >gi|167711423|gb|EDS22002.1| hypothetical protein CLOSS21_01392 [Clostridium sp. SS2/1] (256 aa)
Score = 227, Expect = 3.9e-17, Identities = 56/192 (29%), Positives = 106/192 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIE 194
           I + N KGGV KTT + NL+A+L+  GKK ++VD+D QGN  +  G + ++L+    + + G+   ++ ++K   +NL +LP N  L   +  L      Q  +K  + K+ + YD++IID PPA+ ++    ++  +  +VP + + YA  GL ++I   +  ++  N ++ I  +  T  + R  +   ++E
  S:     5 IAIANQKGGVGKTTTAVNLSAALAARGKKTLLVDMDPQGNTTSGLGLEKNELDKTTYEVITGEEKIQNCIVKDLFDNLSLLPANRNLAGAEIELMTVDKMQFIMKHNLEKVKKQYDFIIIDCPPALGMLTVNAMTAANTVIVPIQCEFYALDGLTQLIYTIELIQKSLNPDLTIEGVVFTMYDARTNLSLQVVE 198
>gi|113869582|ref|YP_728071.1| ATPase involved in chromosome partitioning [Ralstonia eutropha H16] >gi|113528358|emb|CAJ94703.1| ATPase involved in chromosome partitioning [Ralstonia eutropha H16] (257 aa)
Score = 227, Expect = 4.1e-17, Identities = 56/191 (29%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+   ++V++VDLD QGN     G     LE ++   L G    +    + +T    +LP N EL   +  L +    +  L+  I ++++ YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N +++++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQDQRVLLVDLDPQGNASMGSGIDKQALEHSVYQVLVGLASIKQARQRSETGRYDVLPANRELAGAEVELVELDQRERRLRQAIAEVNDEYDFVLIDCPPSLSLLTLNGLCAAHGVIVPMQCEYFALEGLSDLVNTIKQVHANLNRDLQVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|78064754|ref|YP_367523.1| chromosome segregation ATPase [Burkholderia sp. 383] >gi|77965499|gb|ABB06879.1| chromosome segregation ATPase [Burkholderia sp. 383] (259 aa)
Score = 227, Expect = 4.3e-17, Identities = 57/191 (29%), Positives = 96/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  I+       +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACEATVYEVLVDGVSVTDARIRPDGVTYDVLPANRELSGAEIELISIDNRERRLKAALERVTDDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|87122927|ref|ZP_01078792.1| chromosome partitioning protein Soj [Marinomonas sp. MED121] >gi|86161800|gb|EAQ63100.1| chromosome partitioning protein Soj [Marinomonas sp. MED121] (258 aa)
Score = 227, Expect = 4.5e-17, Identities = 57/196 (29%), Positives = 104/196 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGK-CYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK 198
           I V N KGGV KTT   NLAASL+   ++V+++DLD QGN     G   + LE ++ D L G     E I+  +     +LP N +L   + +L      ++ L+  + ++++ YD++++D PP+++++    L+     L+P + + YA  GL  ++   +   +  N  + I  I  T  + R ++ +D+ +Q  K
  S:     5 IAVTNQKGGVGKTTSCVNLAASLTAMKRRVLLIDLDPQGNATTGSGIDKEGLETSVFDVLVGTHGVKESIVDVEPAGYSVLPANGDLTGAEVVLLDLPSKETRLRSALYEVEQEYDFILLDCPPSLNMLTVNALAASQGVLIPVQCEYYALEGLTALLQTIERIAQALNPTLAIEGILRTMYDPRPSLTHDVSQQLTK 202
>gi|107024502|ref|YP_622829.1| cobyrinic acid a,c-diamide synthase [Burkholderia cenocepacia AU 1054] >gi|116688119|ref|YP_833742.1| cobyrinic acid a,c-diamide synthase [Burkholderia cenocepacia HI2424] >gi|105894691|gb|ABF77856.1| chromosome segregation ATPase [Burkholderia cenocepacia AU 1054] >gi|116646208|gb|ABK06849.1| chromosome segregation ATPase [Burkholderia cenocepacia HI2424] (259 aa)
Score = 227, Expect = 4.5e-17, Identities = 56/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACEATVYEVLVDGVSVADARVRPEGVTYDVLPANRELSGAEIELISIDNRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|170731467|ref|YP_001763414.1| cobyrinic acid ac-diamide synthase [Burkholderia cenocepacia MC0-3] >gi|169814709|gb|ACA89292.1| Cobyrinic acid ac-diamide synthase [Burkholderia cenocepacia MC0-3] (259 aa)
Score = 227, Expect = 4.5e-17, Identities = 56/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACEATVYEVLVDGVSVTDARVRPEGVTYDVLPANRELSGAEIELISIDNRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|163732966|ref|ZP_02140410.1| chromosome partitioning protein ParA [Roseobacter litoralis Och 149] >gi|161393501|gb|EDQ17826.1| chromosome partitioning protein ParA [Roseobacter litoralis Och 149] (269 aa)
Score = 227, Expect = 4.6e-17, Identities = 70/249 (28%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQ----ITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAA+L+  G++V++VDLD QGN     G + +D ++   D L G    + ++++  T NL I+P   +L+  D  L   +    +    L+ +  ++D+   DYV+ID PP+++++    +      LVP + + +A  GL +++   +E ++  N +++I  I   +  +    +  +EQ  +  L   G  V +  I    + + A  +  +P++     SK    Y  L KE++
  S:    13 IAVANQKGGVGKTTTTINLAAALAEAGRRVLVVDLDPQGNASTGLGIEVEDRKYTTYDILLGDVDIKAVVLQTVTPNLLIVPATVDLSSADLELMSSEKRSFLLHDALRQI--QMDDFGLDYVLIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTGNKDLRIEGILLTMYDKRNNLSLQVEQDARDNL---GDMVFNTRIPRNVRVSEAPSFA-MPVLTYDTLSKGAQAYRALAKELI 261
>gi|86143209|ref|ZP_01061611.1| SpoOJ regulator protein [Flavobacterium sp. MED217] >gi|85830114|gb|EAQ48574.1| SpoOJ regulator protein [Leeuwenhoekiella blandensis MED217] (255 aa)
Score = 227, Expect = 4.6e-17, Identities = 55/196 (28%), Positives = 105/196 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  KKV+++D D Q N  +  G   + +E      L+     E+ ++K ++ NL ++P + +L   +  L      +  +   I  L + YDY++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N  + I   + T  ++R+ + N ++++  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVETIEMGTYQLLEHSSKAEETIMKTESPNLDLIPAHIDLVAIEIELVDMDQREYMMARAIRHLKDSYDYILIDCAPSLGLLTLNALTASDSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNQKLDIEGLLLTMFDSRLRLSNQVVDEVQK 202
>gi|169182333|ref|ZP_02842850.1| Cobyrinic acid ac-diamide synthase [Thauera sp. MZ1T] >gi|169010472|gb|EDS57237.1| Cobyrinic acid ac-diamide synthase [Thauera sp. MZ1T] (256 aa)
Score = 227, Expect = 4.6e-17, Identities = 57/191 (29%), Positives = 95/191 (49%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT   NLAA+L   G++V+++DLD QGN     G    DL+ ++   L G      + +   T    +LP N +L   +  L      +  L+  +    + YD+V+ID PP++S++    L      ++P + + YA  GL  ++N  K+     N ++KI+  +    + RVT+   +  Q
  S:     7 VANQKGGVGKTTTCVNLAAALHQAGQRVLLIDLDPQGNATMGSGVDKRDLKSSVYHLLVGMVDLAGVRVASPTGGYDVLPANRDLAGAEVELVNLDQREKRLRNALAAFVDDYDFVLIDCPPSLSMLTLNGLCCATGVIIPMQCEYYALEGLSDLVNTIKKVHANLNRDLKIIGLLRVMFDPRVTLQQQVSNQ 199
>gi|94992655|ref|YP_600754.1| chromosome partitioning protein parA [Streptococcus pyogenes MGAS2096] >gi|153815460|ref|ZP_01968128.1| hypothetical protein RUMTOR_01695 [Ruminococcus torques ATCC 27756] >gi|94546163|gb|ABF36210.1| Chromosome partitioning protein parA [Streptococcus pyogenes MGAS2096] >gi|145847102|gb|EDK24020.1| hypothetical protein RUMTOR_01695 [Ruminococcus torques ATCC 27756] (275 aa)
Score = 227, Expect = 4.7e-17, Identities = 59/190 (31%), Positives = 104/190 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAI----MDFLKGKCY-WEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDI 192
           I + N KGGV KTT + NL   LS  GKKV++VD D Q N+  + G  +PDDL  ++     D +  K +  +  ++  +E + +LP N EL+  +  L      +  L   IN++ + YDYV+ID  P++ ++    L+  D  ++P +P   +  GL+ ++ +  + + + N +++I  I  T V  R  I  ++
  S:     7 IALTNQKGGVGKTTTAVNLGVCLSKQGKKVLLVDADAQANLTMSLGYPRPDDLPISLATIMQDIIDDKPFDVQKGILHHSEGVDLLPSNIELSGLEVRLINAISRERVLTTCINEVKKNYDYVLIDCMPSLGMLTINALAAADSVVIPTQPHYLSAKGLELLLRSVSKVRRQINPHLRIDGILMTMVMPRTNISKEV 203
>gi|78777607|ref|YP_393922.1| cobyrinic acid a,c-diamide synthase [Sulfurimonas denitrificans DSM 1251] >gi|78498147|gb|ABB44687.1| chromosome segregation ATPase [Sulfurimonas denitrificans DSM 1251] (261 aa)
Score = 227, Expect = 4.7e-17, Identities = 61/173 (35%), Positives = 97/173 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGN-----DELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           I + N KGGV KTT + NLAASL++  KKV+++D D Q N   + G   +D EF I   L G    +DI++K +   LH+ P N      E  Y+D      +  +  LK  I+ + + YDY+IID+PPA+  +    LS  +  ++P + + +A  GL +++N  K  ++  N  + I
  S:     5 IVIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDSDPQANATTSLGFHRNDYEFNIYHVLIGTKKLKDIILKSELPTLHLAPSNIGLVGIEKEYYD--AQNSKGRELLLKKAISSVLKDYDYIIIDSPPALGPMTINALSASNSVIIPIQCEFFALEGLAQLLNTVKLVRKSINQKLVI 181
>gi|88798992|ref|ZP_01114573.1| Cobyrinic acid a,c-diamide synthase [Reinekea sp. MED297] >gi|88778219|gb|EAR09413.1| Cobyrinic acid a,c-diamide synthase [Reinekea sp. MED297] (255 aa)
Score = 227, Expect = 4.7e-17, Identities = 55/181 (30%), Positives = 98/181 (54%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           + N KGGV KTT   +L A L+  G +V++ DLD QG++ + F   PD++E +  D F+ G    +D     IL    E + ++P +  L   +  ++Q+      +   + KL + YDY +IDTPP + V++  +L+     LVP + +  A  GL+R+++  +        +++ + IPT  + R
  S:     6 IANQKGGVGKTTSVVSLGALLAQQGHRVLVFDLDPQGSLTSYFRHNPDEMEHSAFDLFMHGGKIPDDVLENVILPTSIEGMDMIPASTALATLERNVSQQDGMGLVVSKTLAKLWDQYDYALIDTPPLLGVLLINSLAACKKLLVPVQTEFLALKGLERMVHTIRMVMRSQQRDLEYLVIPTMFDRR 192
>gi|121535382|ref|ZP_01667194.1| Cobyrinic acid a,c-diamide synthase [Thermosinus carboxydivorans Nor1] >gi|121306074|gb|EAX47004.1| Cobyrinic acid a,c-diamide synthase [Thermosinus carboxydivorans Nor1] (253 aa)
Score = 226, Expect = 4.9e-17, Identities = 68/249 (27%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NL+A L+  GKKV++VD+D QGN  +  G     ++  + D L      E +L+  +  NL +LP   +L   +  L      ++ LK  ++K+   YDY+IID PP++ ++   +L+  +  ++P + + YA  GL +++N     ++  N  + +  +  T  + R  +   ++++ +K   + +   V    I    + + A  + + P++    KSK  + Y +L KE++
  S:     5 IAIANQKGGVGKTTTSVNLSACLAELGKKVLLVDIDPQGNSTSGLGVNKASIKHCVYDALINDVPVETLLLPTELPNLMLLPATIQLAGAEIELVSLMSRETKLKRALDKVKYKYDYIIIDCPPSLGLLTINSLTAANSVIIPIQCEFYALEGLTQLMNTISLVQKNLNPVLTLEGVVLTMFDARTNLSIQVVDE-VKNHFRHK---VYQTIIPRNVRLSEAPSHGK-PVIKYDPKSKGAEVYFDLAKEVI 250
>gi|152981293|ref|YP_001355326.1| chromosome partitioning protein ParA [Janthinobacterium sp. Marseille] >gi|151281370|gb|ABR89780.1| chromosome partitioning protein ParA [Janthinobacterium sp. Marseille] (256 aa)
Score = 226, Expect = 4.9e-17, Identities = 60/191 (31%), Positives = 101/191 (52%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDI----LIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAA L+   ++V++VDLD QGN     G    +L+ +I + L G     D+    +  +T    +LP N EL   +  + +    +  LK  +  +D  YD+++ID PPA+S++    L      ++P + + YA  GL  ++N  K+   K N ++KI+  +    + R+T+   +  Q
  S:     7 VANQKGGVGKTTTAVNLAAGLAQLNQRVLLVDLDPQGNATMGAGINKAELQSSIYEVLLGMA---DVATARVTSETGKFDVLPANRELAGAEVEMVELDNREKRLKDALAVVDAEYDFMLIDCPPALSMLTLNGLCAAHGVIIPMQCEYYALEGLSDLVNTIKKVHAKLNTDLKIIGLLRVMFDPRMTLSQQVSSQ 199
>gi|150025203|ref|YP_001296029.1| chromosome partitioning protein ParA [Flavobacterium psychrophilum JIP02/86] >gi|149771744|emb|CAL43218.1| Chromosome partitioning protein ParA [Flavobacterium psychrophilum JIP02/86] (255 aa)
Score = 226, Expect = 5.0e-17, Identities = 57/196 (29%), Positives = 108/196 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL +  +KV+++D D Q N  +  G   +++E      L+     E+ +IK +  N+ ++P + +L   +  L  K+  +  LK  +  + + YDY+IID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N  + I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTSINLAASLGVLEQKVLLIDADPQANASSGLGIDVENVEIGTYQILEHSNTPEEAIIKSSSPNVDVIPAHIDLVAIEIELVDKENREYMLKQALASVKDKYDYIIIDCAPSLGLLTLNALTSADSVVIPIQCEYFALEGLGKLLNTIKSVQKIHNPELDIEGLLLTMYDSRLRLSNQVVEEVQK 202
>gi|196195976|gb|EDX90935.1| hypothetical protein ADG881_3037 [Alcanivorax sp. DG881] (265 aa)
Score = 226, Expect = 5.8e-17, Identities = 58/192 (30%), Positives = 99/192 (51%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTEN--LHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
            V N KGGV KTT S NLAASL+   KKV++VD+D QGN     G    + ++ I D L      E  +    E+    ++  N +L   +  L      +  L+  + ++ + YDY++ID PP+++++    L+  D  +VP + + YA  GL  ++N  ++ +   N  + I   + T  + R ++ ND+  Q
  S:     6 AVANQKGGVGKTTSSVNLAASLAATRKKVMLVDIDPQGNATTGSGVDKFETDYTIYDVLCDDVAIEQAVTGTPEDSGFDLIAANGDLTAAEVQLLDMSAKEFRLRNALARIRDQYDYILIDCPPSLNMLTVNALTAADSVIVPIQCEYYALEGLTALMNTIEKIRTVLNPKLHIGGLLRTMYDPRNSLSNDVSNQ 200
>gi|91203316|emb|CAJ72955.1| similar to chromosome partitioning protein ParA [Candidatus Kuenenia stuttgartiensis] (257 aa)
Score = 226, Expect = 6.0e-17, Identities = 60/249 (24%), Positives = 131/249 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I ++N KGGV KTT + NL+A L+  G+KV+ +D+D Q N+    G    +L+ ++   + G C   ++++      L I+P   +L+  +  L      ++ LK  +      YDYV+ID PP++ ++    ++ V+   +P + + +A  G++++++  +  K++ NHN++I   I    ++R  + N+++E+ ++     +   V    +    K + +  + + P++     S   ++Y +L KE++
  S:     4 IALLNQKGGVGKTTTTANLSACLAALGRKVLAIDMDPQANLSVHLGVDIHNLQNSVYSLIMGNCSPSEVILHTANIGLDIIPSTIDLSGAEIELVGIVGRETVLKEYLGDSINAYDYVLIDCPPSLGLLTINVMTFVNELFIPVQTEFFALQGVRKLLDTYEIVKKRLNHNLEITGVILCMYSSRARLCNEVVEK-IREYFDEK---VFDTIVRKNIKLSESPSHGK-PVITYAPDSHGSEDYMSLAKEVI 249
>gi|194557673|ref|YP_002092699.1| RepA partitioning protein/ATPase, ParA type [Burkholderia cenocepacia PC184] >gi|124871464|gb|EAY63180.1| RepA partitioning protein/ATPase, ParA type [Burkholderia cenocepacia PC184] (269 aa)
Score = 226, Expect = 6.1e-17, Identities = 56/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:    17 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACEATVYEVLVDGVSVTDARVRPEGVTYDVLPANRELSGAEIELISIDNRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 209
>gi|92115408|ref|YP_575336.1| chromosome segregation ATPase [Chromohalobacter salexigens DSM 3043] >gi|91798498|gb|ABE60637.1| chromosome segregation ATPase [Chromohalobacter salexigens DSM 3043] (255 aa)
Score = 225, Expect = 6.3e-17, Identities = 58/193 (30%), Positives = 104/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAA L+   K+V++VDLD QG+     G    +L+ ++++  L+G+   E IL        +LPGN +L   +  L  +   +  L   +  +   YD VIID PP+++++    L+  D  L+P + + YA  GL  +++  ++ +   N ++++  I  T  + R ++  D+ +Q
  S:     5 IALTNQKGGVGKTTTAVNLAACLAALDKRVLLVDLDPQGHATMGSGIDKHELDGSVLEVLLEGRRASEVILDCPDAGYALLPGNGDLTAAEVDLLDRDGRERCLGEALGSVAASYDVVIIDCPPSLNMLTVNALTAADGVLIPLQCEFYALEGLSALLDTVEQIQASVNPSLEVFGIVRTMYDARNSLTRDVSKQ 199
>gi|182439518|ref|YP_001827237.1| putative partitioning or sporulation protein [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178468034|dbj|BAG22554.1| putative partitioning or sporulation protein [Streptomyces griseus subsp. griseus NBRC 13350] (345 aa)
Score = 225, Expect = 6.5e-17, Identities = 53/188 (28%), Positives = 100/188 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHN 190
           I + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P +L+  + + L  +    D ++ KT   N+ +LP N +L+  +  L  +   +S L+  +  L   YDY++ID  P++ ++    L+     +VP E + +A  G+  +    ++ +E+ N  +++  I   +    T+H+
  S:    93 IAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGVNPMELDLTVYNLLMERGMAADDVLLKTAVPNMDLLPSNIDLSAAEVQLVSEVARESTLQRALKPLMADYDYIVIDCQPSLGLLTVNALTAAHKVIVPLECEFFALRGVALLTETIEKVQERLNPELELDGILATMYDSRTVHS 282
>gi|70733985|ref|YP_257625.1| ParA family protein [Pseudomonas fluorescens Pf-5] >gi|68348284|gb|AAY95890.1| ParA family protein [Pseudomonas fluorescens Pf-5] (256 aa)
Score = 225, Expect = 6.5e-17, Identities = 63/211 (29%), Positives = 109/211 (51%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + ++VDLD Q N      G   +D+   I DF K         K    DI     +NLH++    EL      L  K    + L+ L+++L E YD + +DTPPA++    + L   D  L+PF+ D ++   L  ++   +E KE +N  +++  I   +   R ++   ++++ +   L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSASEGYRTLLVDLDAQANSTQYLTGLTGEDIPMGIADFFKQTLSSGPFAKKNQVDIYETPFDNLHVITATAELADLQPKLEAKHKI-NKLRKLLDELAEDYDRIYLDTPPALNFYAVSALIAADRVLIPFDCDSFSRQALYGLLAEIEELKEDHNEGLEVEGIVVNQFQARASLPQQMLDELISEGLPVLPVYLGSS 220
>gi|167587939|ref|ZP_02380327.1| Cobyrinic acid a,c-diamide synthase [Burkholderia ubonensis Bu] (258 aa)
Score = 225, Expect = 6.6e-17, Identities = 55/191 (28%), Positives = 98/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAASL+   ++V+++DLD QGN     G     +E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAGVESTVYEVLVDGVTVADARVRPEAVTYDVLPANRELSGAEIELIGIDNRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|47092678|ref|ZP_00230465.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes str. 4b H7858] >gi|47018973|gb|EAL09719.1| sporulation initiation inhibitor protein SOJ [Listeria monocytogenes str. 4b H7858] (233 aa)
Score = 225, Expect = 6.6e-17, Identities = 67/234 (28%), Positives = 125/234 (53%)
  Q:    20 NLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           NL++SL+  GKKV++VD+D QGN  +  G    ++E  I D L      +D+L K   +NL+++P   +L   +  L      +  LK  I+ + + YDYVIID PP++ ++    L+  D  L+P + + YA  GL +++N  +  ++  N +++I  +  T ++ R  +   +IE+ +K   + +   V +  I    + + A  + + PI++   KSK  + Y  L KE++ +
  S:     2 NLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIYDVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAIDSIRDDYDYVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEGVLLTMLDARTNLGIQVIEE-VKKYFQNK---VFNTIIPRNVRLSEAPSHGK-PILLYDAKSKGAEVYLELAKEVVAH 232
>gi|29833050|ref|NP_827684.1| partitioning or sporulation protein [Streptomyces avermitilis MA-4680] >gi|29610171|dbj|BAC74219.1| putative partitioning or sporulation protein [Streptomyces avermitilis MA-4680] (346 aa)
Score = 225, Expect = 6.6e-17, Identities = 53/188 (28%), Positives = 100/188 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHN 190
           I + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P +L+  + + L  +    D ++ KT   N+ +LP N +L+  +  L  +   +S L+  +  L   YDY++ID  P++ ++    L+     +VP E + +A  G+  +    ++ +E+ N  +++  I   +    T+H+
  S:    94 IAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGVNPMELDLTVYNLLMERGMAADEVLLKTAVPNMDLLPSNIDLSAAEVQLVSEVARESTLQRALKPLMADYDYIVIDCQPSLGLLTVNALTAAHKVIVPLECEFFALRGVALLTETIEKVQERLNPELELDGILATMYDSRTVHS 283
>gi|126667544|ref|ZP_01738514.1| ParA family protein [Marinobacter sp. ELB17] >gi|126627970|gb|EAZ98597.1| ParA family protein [Marinobacter sp. ELB17] (269 aa)
Score = 225, Expect = 6.7e-17, Identities = 68/218 (31%), Positives = 115/218 (52%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLKGKCYW-------EDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK 218
           M+  V N KGGV K++++ NLAA  +  GK+ ++VDLD QGN      G+   +L+    D L+    +       E+  +  T  ENL +LP + EL + +  L  K      L+  + KLD+ +D + IDT PA++    + L      L+PF+ D +A   L  II+  +E +E +N  + I  I   +   R ++   ++ +     L+ +G+ V S  +SS+ K
  S:     1 MRRVVFNQKGGVGKSSIACNLAAISAARGKRTLVVDLDPQGNSTHYLMGRPATELDNNAADLLEQTLTFTVFNRRPEESFVHTTPFENLWVLPSSPELEFLERKLEAKHKIY-KLREALKKLDQHFDDIYIDTAPALNFYTRSALIGAQRCLIPFDCDDFARQALYSIIHEIRELQEDHNPELSIEGIVANQFQARASLPAKLLAE-----LEQEGLPVLSVRLSSSVK 223
>gi|81427632|ref|YP_394629.1| chromosome partitioning ATPase [Lactobacillus sakei subsp. sakei 23K] >gi|78609271|emb|CAI54318.1| Chromosome partitioning ATPase [Lactobacillus sakei subsp. sakei 23K] (255 aa)
Score = 225, Expect = 6.8e-17, Identities = 70/249 (28%), Positives = 122/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLA  L+  G +V+I+D D QGN  +  G +   +E  I D L  +   ++ ++K   +++ I+P   +L   +  L  +   +  LK+ +  +   YDYV+ID PP++  +     +  +  L+P + + YA  GL +++N  +  ++  N N+ I  +  T  + R  +   +IE+      K  G  V    I   T+   A  +  V I+    KS+  + Y  L KE+L
  S:     5 ISIANQKGGVGKTTTTINLAVCLADAGNRVLIIDSDAQGNATSGIGIQKSQVEKDIYDVLVDEIPIKEAILKTNHQHVDIVPATIQLAGAEIELTAQMAREMRLKLGLEAVLNDYDYVLIDCPPSLGQLSINAFTASNSILIPVQSEYYALEGLSQLLNTVRLVQKHFNPNLAIEGVLLTMYDARTNLGAQVIEEV----RKYFGDRVYDTIIPRNTRLAEAPSHG-VSIIDYDPKSRGAEVYQELAKEVL 250
>gi|145301181|ref|YP_001144022.1| chromosome partitioning protein ParA [Aeromonas salmonicida subsp. salmonicida A449] >gi|142853953|gb|ABO92274.1| chromosome partitioning protein ParA [Aeromonas salmonicida subsp. salmonicida A449] (267 aa)
Score = 225, Expect = 6.9e-17, Identities = 56/193 (29%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L       +++I +T    H++  N ++   +  L +    +  L+  I  + + YDY+ ID PP+++++    ++  D  LVP + + YA  GL  +++   +     N  +KI  +  T  + R  + ND+ +Q
  S:     5 IAIANQKGGVGKTTTCVNLAASLAATRRKVLVIDLDPQGNATMGSGVDKYEVERTAYELLIEDAPIAEVIIPETSGGYHLIAANADVTAAEIRLMEFFAREIRLRNAIASVRDKYDYIFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPELKIEGVLRTMFDHRNRLANDVSDQ 199
>gi|119716719|ref|YP_923684.1| cobyrinic acid a,c-diamide synthase [Nocardioides sp. JS614] >gi|119537380|gb|ABL81997.1| Cobyrinic acid a,c-diamide synthase [Nocardioides sp. JS614] (367 aa)
Score = 225, Expect = 7.0e-17, Identities = 72/263 (27%), Positives = 126/263 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGK--CYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK-STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV----IFGRETSVNNG 265
           + + N KGGV KTT + NL ASL+  G+KV++VD D QG++    G  P +++  I + L  +     E I+      + +LP N +L+  +  L  +   +  L+ ++      YD ++ID  P++ ++    L+  D  +VP E + +A  G+  +     + +E+ N  ++I  +   +    T+H+  + + L   ++  G  V    I  T K S + V  E  PI      S   D Y  L KE+L         GR+T  + G
  S:    87 VSMCNQKGGVGKTTTTINLGASLAELGRKVLLVDFDPQGSLSVGLGLNPHEMDLTIYNLLMQRDVDLHEVIVPTVVSGMDLLPSNIDLSAAEVQLVHEVAREQTLQRVLAPAIAEYDIILIDCQPSLGLLTVNALTASDGVIVPLECEYFALRGVALLKTTIDKVRERLNPKLEIDGVLGTMYDGRTLHSREVMERL---VQAWGDKVFHTVIRRTVKFSDSTVAGE--PITTYASASTGADSYRQLAKEVLARTHSEPAAGRDTERDTG 351
>gi|78486512|ref|YP_392437.1| cobyrinic acid a,c-diamide synthase [Thiomicrospira crunogena XCL-2] >gi|78364798|gb|ABB42763.1| chromosome segregation ATPase [Thiomicrospira crunogena XCL-2] (255 aa)
Score = 225, Expect = 7.0e-17, Identities = 62/190 (32%), Positives = 103/190 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDI 192
           I V N KGGV KTT + NL+A+ +   KKV+++DLD QGN     G + DDL+ +  D L G+    D +L    ENL ++  N +L   +  L ++      L+  + KL E YD V+ID PP ++++    L+  D  LVP + + +A  GL  +++  +  + + N ++ I   + T  + R  + ND+
  S:     5 IAVANQKGGVGKTTSTVNLSAAFARMNKKVLMIDLDPQGNATVAIGVEKDDLDVSAYDVLVGETKARDAVLETAVENLDLIAANGDLTAAEVELIEESKGPKKLRKALKKLRESYDVVLIDCPPTLNMLTLNALTAADGILVPVQCEYFALEGLSALMDTIEAVQSELNPDLSIDGLLRTMYDRRNNLANDV 196
>gi|194344731|gb|EDX25697.1| partitioning or sporulation protein [Streptomyces sp. Mg1] (333 aa)
Score = 225, Expect = 7.1e-17, Identities = 53/188 (28%), Positives = 100/188 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHN 190
           I + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P +L+  + + L  +    D ++ KT   N+ +LP N +L+  +  L  +   +S L+  +  L   YDY++ID  P++ ++    L+     +VP E + +A  G+  +    ++ +E+ N  +++  I   +    T+H+
  S:    81 IAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGVNPMELDLTVYNLLMERGMSADEVLLKTAVPNMDLLPSNIDLSAAEVQLVSEVARESTLQRALKPLMADYDYIVIDCQPSLGLLTVNALTAAHKVIVPLECEFFALRGVALLTETIEKVQERLNPELELDGILATMYDSRTVHS 270
>gi|50842869|ref|YP_056096.1| chromosome partitioning protein [Propionibacterium acnes KPA171202] >gi|50840471|gb|AAT83138.1| chromosome partitioning protein [Propionibacterium acnes KPA171202] (315 aa)
Score = 225, Expect = 7.1e-17, Identities = 67/249 (26%), Positives = 123/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG--KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A L+  G++V++VD D QG++    G  P  LE +I   L        + I   +TE + +LP N +L+  +  L  +   +  LK +I+++   YD ++ID  P++ ++    L+  D  ++P E + +A  G+  + +  ++ +++ N +++++ I   +    T+H     + ++  ++  G  V    I  T K   T   G    PI      S     Y +L KE+L
  S:    63 ISMCNQKGGVGKTTTTINLGAGLAEYGRRVLLVDFDPQGSLSVGLGINPHTLENSIYTLLMSPRDDVHDVIQPTETEGMDLLPANIDLSAAEVQLVSEVAREQTLKRVIDRIRGEYDMILIDCAPSLGLLTINALTASDYVIMPLECEFFALRGIALLTDTIEKVQDRLNPDLEVLGILGTMFDPRTLH---AREVMERVVQAFGDVVFHTVIKRTIKFPETTVAGE---PITSYASSSPGAQAYRDLAKEVL 309
>gi|117619690|ref|YP_858688.1| Soj protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117561097|gb|ABK38045.1| Soj protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (267 aa)
Score = 225, Expect = 7.2e-17, Identities = 56/193 (29%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT   NLAAS++   +KV+++DLD QGN     G    D+E    + L       +++I +T    H++  N ++   +  L +    +  L+  +  + + YDYV ID PP+++++    ++  D  LVP + + YA  GL  +++   +     N  +KI  +  T  + R  + ND+ +Q
  S:     5 IAIANQKGGVGKTTTCVNLAASMAATRRKVLVIDLDPQGNATMGSGVDKYDVERTAYELLIEDAPIGEVIIPETSGGYHLIAANADVTAAEIRLMEFFAREIRLRNALASVRDKYDYVFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPELKIEGVLRTMFDHRNRLANDVSDQ 199
>gi|58579598|ref|YP_197810.1| sporulation initiation inhibitor protein soj [Ehrlichia ruminantium str. Welgevonden] >gi|58418224|emb|CAI27428.1| Sporulation initiation inhibitor protein soj [Ehrlichia ruminantium str. Welgevonden] (260 aa)
Score = 225, Expect = 7.5e-17, Identities = 71/248 (28%), Positives = 122/248 (49%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           G+VN KGGV KTT S NLA + ++  KK +++DLD QGN    FG         + + L         +IK +  NL +LP   +L+  +  L Q Q  +  LK  ++++   YDY+ ID PP++ ++    L   +  ++P + + +A  GL  +I   +  K+  N ++ I  I   +  +    ++ +E+ ++  LK + VY T   I    + + A  + + P ++  FK      Y  L KEIL
  S:    11 GIVNQKGGVGKTTTSINLATAFAIVNKKTLLIDLDPQGNSSTGFGITYQQRTNTVYEVLINNIPTSSAIIKTEIPNLDLLPSTVDLSAAEVELTQVQKREFVLKNSLSEIKTSYDYIFIDCPPSLGLLTVNALIAANAVIIPLQCEFFALEGLSHLIKTIELIKKHLNPSLSIEGIILTMYDKRNKLSEQVEEDIRKYLK-ESVYKT--VIPRNVRLSEAPSHGK-PAIIYDFKCAGSQAYIYLAKEIL 255
>gi|57239609|ref|YP_180745.1| sporulation initiation inhibitor protein soj [Ehrlichia ruminantium str. Welgevonden] >gi|57161688|emb|CAH58618.1| chromosome partitioning protein ParA [Ehrlichia ruminantium str. Welgevonden] (255 aa)
Score = 225, Expect = 7.5e-17, Identities = 71/248 (28%), Positives = 122/248 (49%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           G+VN KGGV KTT S NLA + ++  KK +++DLD QGN    FG         + + L         +IK +  NL +LP   +L+  +  L Q Q  +  LK  ++++   YDY+ ID PP++ ++    L   +  ++P + + +A  GL  +I   +  K+  N ++ I  I   +  +    ++ +E+ ++  LK + VY T   I    + + A  + + P ++  FK      Y  L KEIL
  S:     6 GIVNQKGGVGKTTTSINLATAFAIVNKKTLLIDLDPQGNSSTGFGITYQQRTNTVYEVLINNIPTSSAIIKTEIPNLDLLPSTVDLSAAEVELTQVQKREFVLKNSLSEIKTSYDYIFIDCPPSLGLLTVNALIAANAVIIPLQCEFFALEGLSHLIKTIELIKKHLNPSLSIEGIILTMYDKRNKLSEQVEEDIRKYLK-ESVYKT--VIPRNVRLSEAPSHGK-PAIIYDFKCAGSQAYIYLAKEIL 250
>gi|94501611|ref|ZP_01308128.1| chromosome partitioning protein Soj [Oceanobacter sp. RED65] >gi|94426294|gb|EAT11285.1| chromosome partitioning protein Soj [Oceanobacter sp. RED65] (257 aa)
Score = 224, Expect = 8.3e-17, Identities = 57/193 (29%), Positives = 96/193 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NL+ASL    +KV+++DLD QGN     G    +LE +I D L       D ++K       ILP N +L   +  L      +S L+  ++ L + YDY++ID PP+++++           ++P + + YA  GL  ++N  +  ++ N        + T  + R ++  D+  Q
  S:     5 IAIANQKGGVGKTTTTVNLSASLVATKRKVLVIDLDPQGNATMGSGVNKHELESSIYDVLVDDMPARDAIVKTDPAGYDILPANGDLTAAEVQLIDMDGKESRLRNALDPLVDDYDYIVIDCPPSLNMLTVNAFVAAHGIIIPMQCEYYALEGLTALMNTIERIQQINPELRIDGLLRTMYDPRTSLTTDVSAQ 198
>gi|194540485|ref|YP_002075524.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative [Vibrio sp. Ex25] >gi|151939040|gb|EDN57872.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative [Vibrio sp. Ex25] (259 aa)
Score = 224, Expect = 8.4e-17, Identities = 54/181 (29%), Positives = 91/181 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           V N KGGV KTT +  LA  LS  G +V++VD D   ++    G  PD +  ++ D  + K +  +     IL  K E + I+P +  L   D ++  +      LK  +  + + YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R++      ++      K+  +PT  + R
  S:     6 VANQKGGVGKTTSTVTLAGLLSQKGHRVLMVDTDPHASLTTYLGYDPDAVTSSLFDLFQLKTFSRETVRPLILETKLEGMDIIPAHMSLATLDRVMGNRSGMGLILKRALQAVSQDYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMMRTLTIMQKSRPGGFKVTIVPTMYDKR 191
>gi|189501007|ref|YP_001960477.1| Cobyrinic acid ac-diamide synthase [Chlorobium phaeobacteroides BS1] >gi|189496448|gb|ACE04996.1| Cobyrinic acid ac-diamide synthase [Chlorobium phaeobacteroides BS1] (265 aa)
Score = 224, Expect = 8.7e-17, Identities = 69/249 (27%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + N+AAS+++   K +++D+D Q N  + FG    D++E      + +G    E I     E L +LP N  L   +  L   +  +  ++  + K+ E YDY+IID PP++ ++   +L+  D  L+P + + YA  GL +++N     ++  N  + I  +  T  ++R+ +   + E+ +K   K + VY T  +I    + + A  + + P ++   +S    +Y +L +EI 
  S:     5 IAIANQKGGVGKTTTAVNIAASIAISEFKTLLIDIDPQANATSGFGLDTEDEIENTFYHVMVQGGDINEAIRSSSLEYLDVLPSNVNLVGMEVELVNMREREYVMQKALEKVREKYDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPRLSIEGVLMTMFDSRLRLAGQVAEE-VKKHFKDK-VYAT--YIRRNVRLSEAPSHGK-PALLYDAQSLGSKDYLDLAQEIF 251
>gi|126176556|ref|YP_001052705.1| cobyrinic acid ac-diamide synthase [Shewanella baltica OS155] >gi|149117386|ref|ZP_01844079.1| Cobyrinic acid a,c-diamide synthase [Shewanella baltica OS223] >gi|160877617|ref|YP_001556933.1| cobyrinic acid ac-diamide synthase [Shewanella baltica OS195] >gi|125999761|gb|ABN63836.1| chromosome segregation ATPase [Shewanella baltica OS155] >gi|146862535|gb|EDK48198.1| Cobyrinic acid a,c-diamide synthase [Shewanella baltica OS223] >gi|160863139|gb|ABX51673.1| Cobyrinic acid ac-diamide synthase [Shewanella baltica OS195] (262 aa)
Score = 224, Expect = 8.8e-17, Identities = 59/193 (30%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L  +  +++I+IK T   + ++  N ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + YA  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYELLVEEKTFDEIVIKNTAGKYDLIASNGDVTAAEIKLMEFFAREIRLRNALAPIKDQYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTITKLAAMVNPGLGIEGILRTMYDPRNRLSNDVSDQ 199
>gi|77361913|ref|YP_341488.1| partitioning protein A [Pseudoalteromonas haloplanktis TAC125] >gi|76876824|emb|CAI88046.1| transcriptional regulator of chromosome partitioning protein; ParA family protein; could be a protein tyrosine kinase [Pseudoalteromonas haloplanktis TAC125] (261 aa)
Score = 224, Expect = 9.0e-17, Identities = 61/193 (31%), Positives = 107/193 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPD---DLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAAS++   +KV+++DLD QGN  AT G   D   D+   I D L      E+++IK+T    H++  N ++   +  L +    +  L+  + K+ + Y+++ ID PP+++++    ++  D  LVP + + YA  GL  +++   +  +  N  ++I  I  T  + R  + ND+ EQ
  S:     5 IALANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGN--ATMGSGVDKYGDVP-TIYDLLIENKPIEEVIIKETSGEYHMIAANGDVTAAEVKLMELFAREVRLRNALEKIQDQYEFIFIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMDTITQLAKLVNPKLQIEGILRTMYDPRNRLANDVSEQ 199
>gi|153002870|ref|YP_001368551.1| cobyrinic acid ac-diamide synthase [Shewanella baltica OS185] >gi|151367488|gb|ABS10488.1| Cobyrinic acid ac-diamide synthase [Shewanella baltica OS185] (262 aa)
Score = 224, Expect = 9.2e-17, Identities = 59/193 (30%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L  +  +++I+IK T   + ++  N ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + YA  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYELLVEEKSFDEIVIKNTAGKYDLIASNGDVTAAEIKLMEFFAREIRLRNALAPIKDQYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTITKLAAMVNPGLGIEGILRTMYDPRNRLSNDVSDQ 199
>gi|124268966|ref|YP_001022970.1| chromosome segregation ATPase [Methylibium petroleiphilum PM1] >gi|124261741|gb|ABM96735.1| chromosome segregation ATPase [Methylibium petroleiphilum PM1] (257 aa)
Score = 224, Expect = 9.2e-17, Identities = 58/191 (30%), Positives = 96/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+L G++ ++VDLD QGN     G     LE ++ D  L+     E     +     +L  N EL   +  L   +     LK  +  +D  YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N +++I+  +    + R+T+   + EQ
  S:     7 IANQKGGVGKTTTTVNLAAGLALIGQRTLVVDLDPQGNATMGSGIDKRTLELSVYDVLLESASIAEARRRSEKGGYDVLGANRELAGAEVELVALERRDQRLKTALAAVDGEYDFVLIDCPPSLSLLTLNGLCSAHGVVVPMQCEYFALEGLSDLVNTIKQVHANLNPSLQIIGLLRVMFDPRITLQQQVSEQ 199
>gi|187924210|ref|YP_001895852.1| Cobyrinic acid ac-diamide synthase [Burkholderia phytofirmans PsJN] >gi|187715404|gb|ACD16628.1| Cobyrinic acid ac-diamide synthase [Burkholderia phytofirmans PsJN] (254 aa)
Score = 224, Expect = 9.4e-17, Identities = 70/252 (27%), Positives = 135/252 (53%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIA-TFGKKPDDLEFAIMDFLKGKCYWE------DILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           M+  + N KGGV K+T+  NLAA  + +  + +++DLD QGN      GK+  DL+  + DF +    +          I  T  ENLH++P + +L+     L + +     L+  +N+LDE YD + IDTPPA++    + L  V+  L+PF+ D ++   L  +++  KE ++ +N  +++  I   +   R ++   ++E+     L  +G+ V  + +S++ K   +  Y + P++    + K   E+  L +E+++
  S:     1 MRRVIFNQKGGVGKSTIVCNLAAINASENLRTLVIDLDPQGNSSQYLLGKQASDLKPNVADFFETALSFSFRPTPVSTFIHPTPFENLHVMPSHPDLDTLHGKL-ESRYKIYKLRDALNELDE-YDAIYIDTPPALNFYSRSALIAVERCLIPFDCDDFSRRALYTLLDNVKEIQQDHNPGLEVEGIVINQFQPRASLPLQLVEE-----LIGEGLPVLESRLSTSVKIRESHQYAK-PMIHFDPRHKLAQEFVALHRELID 254
>gi|152993361|ref|YP_001359082.1| chromosome partitioning protein, ATPase ParA [Sulfurovum sp. NBC37-1] >gi|151425222|dbj|BAF72725.1| chromosome partitioning protein, ATPase ParA [Sulfurovum sp. NBC37-1] (261 aa)
Score = 224, Expect = 9.4e-17, Identities = 59/173 (34%), Positives = 100/173 (57%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYF--DFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           I + N KGGV KTT + NLAASL+  GKKV+++D+D Q N   + G   +D E+ I   L G     ++++K + + L ++P N  L     +F  ++K+  +  LK  I ++ + YD++IID+PPA+  +    LS  D  ++P + + +A  GL +++N     K+  N  +KI
  S:     5 ISIANQKGGVGKTTTAVNLAASLAEKGKKVLLLDIDPQSNATTSLGFNRNDYEYNIYHVLIGSKKLSEVILKSQIKKLDLVPSNIGLVGIEKEFYNSRKKNRELILKEKIKEISKKYDFIIIDSPPALGPITINALSASDSVIIPIQCEFFALEGLAQLLNTVSLLKKTINPKLKI 180
>gi|118594206|ref|ZP_01551553.1| Cobyrinic acid a,c-diamide synthase [Methylophilales bacterium HTCC2181] >gi|118439984|gb|EAV46611.1| Cobyrinic acid a,c-diamide synthase [Methylophilales bacterium HTCC2181] (256 aa)
Score = 224, Expect = 9.4e-17, Identities = 72/249 (28%), Positives = 120/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENL-HILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP----TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL+++ KKV+++DLD QGN  +  G     L  +I D L  +   +D+++   + L  + P N  L   +  L   +  +  LK  I  L   YD+++ID PPA++++    L   +  L+P + + YA  GL  ++N  +  K+  N  ++I  +      K NT     +D +     PK+    +        + +   + + Y++         SK    Y  L KEIL
  S:     4 ISISNQKGGVGKTTTTVNLAASLAVNKKKVLLIDLDPQGNATSGAGLNKAVLSSSIYDVLIEQKTIKDVVLHSEDGLFDVAPANQSLAGAEIELVDIKNREFILKKAIETLALNYDFILIDCPPALNLLTVNALVASNSVLIPMQCEYYALEGLSDLVNTIRRVKKNLNPEIEIEGLLRTLFDKRNTLTKQVSDQLSSHFGPKVYETIIPRNVRLAEAPSHGKSVISYDK--------SSKGAKAYLALAKEIL 249
>gi|39995217|ref|NP_951168.1| soj protein [Geobacter sulfurreducens PCA] >gi|39981979|gb|AAR33441.1| soj protein [Geobacter sulfurreducens PCA] (257 aa)
Score = 224, Expect = 9.4e-17, Identities = 55/176 (31%), Positives = 91/176 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT + NLAASL+   K+ ++VD+D QGN  +  G     LE ++ D +        +++     +L +LP   +L   +  L      +  LK  + +L + YDY+IID PP++ ++    ++  D  L+P + + YA  GL +II   K  ++  N  + I  I
  S:     5 ICIANQKGGVGKTTTAVNLAASLAAAEKQTLLVDMDPQGNAGSGVGVDKAGLEESVYDAIINDVDPSGLIVGTDLAHLDLLPSTTDLAGAELELVSMPERERRLKAALARLSQRYDYIIIDCPPSLGLLTVNAMTAADSVLIPLQCEYYAMEGLSQIIKTIKLVQKGLNPGLAIEGI 181
>gi|116617471|ref|YP_817842.1| chromosome segregation ATPase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096318|gb|ABJ61469.1| chromosome segregation ATPase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (253 aa)
Score = 224, Expect = 9.5e-17, Identities = 50/176 (28%), Positives = 97/176 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT S NL A+L+  G++V++VD+D QGN  +  G     LE    D +  +    ++++  T+N  ++P   +L+  +  L ++   +  LK  +  + + YD+++ID PPA+ ++     +  D  L+P + + YA  GL +++N  +  +++ N ++ +  I
  S:     5 IVLANQKGGVGKTTTSINLGAALAQAGQRVLLVDIDAQGNATSGSGVDKSLLEHDSYDVIVEQTPLHEVIVA-TDNYDLVPATIQLSGAEIELAKQPQREYRLKTALETVRDDYDFILIDNPPALGLMTVNAFTAADAILIPVQTEFYALEGLGQLLNTIELVRQQFNPDLDVAGI 179
>gi|26991746|ref|NP_747171.1| ParA family protein [Pseudomonas putida KT2440] >gi|24986853|gb|AAN70635.1|AE016707_5 ParA family protein [Pseudomonas putida KT2440] (257 aa)
Score = 224, Expect = 1.0e-16, Identities = 63/211 (29%), Positives = 111/211 (52%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + +++DLD Q N      G   +D+   I DF K         K    DI     +NLH++    EL      L  K    + L+ L+++LDE Y+ + IDTPPA++    + L   D  L+PF+ D ++   L  ++   ++ KE +N ++ +  I   +  +R ++   ++++ L   L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSANEGYRTLLIDLDAQANSTQYLTGLTGEDIPMGIADFFKQSLSSGPFSKKNKVDIYETPFDNLHVVTATAELADLQPKLEAKHKI-NKLRKLLDELDEDYERIYIDTPPALNFYAVSALIAADRVLIPFDCDSFSRQALYGLLAEIEDLKEDHNEDLVVEGIVVNQFQSRASLPQQMLDELLAEGLPVLPVYLGSS 220
>gi|167036109|ref|YP_001671340.1| cobyrinic acid ac-diamide synthase [Pseudomonas putida GB-1] >gi|166862597|gb|ABZ01005.1| Cobyrinic acid ac-diamide synthase [Pseudomonas putida GB-1] (257 aa)
Score = 224, Expect = 1.1e-16, Identities = 63/211 (29%), Positives = 111/211 (52%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + +++DLD Q N      G   +D+   I DF K         K    DI     +NLH++    EL      L  K    + L+ L+++LDE Y+ + IDTPPA++    + L   D  L+PF+ D ++   L  ++   ++ KE +N ++ +  I   +  +R ++   ++++ L   L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSANEGYRTLLIDLDAQANSTQYLTGLTGEDIPMGIADFFKQSLSSGPFSKKNKVDIYETPFDNLHVVTATAELADLQPKLEAKHKI-NKLRKLLDELDEDYERIYIDTPPALNFYAVSALIAADRVLIPFDCDSFSRQALYGLLAEIEDLKEDHNEDLMVEGIVVNQFQSRASLPQQMLDELLAEGLPVLPVYLGSS 220
>gi|134294227|ref|YP_001117962.1| chromosome segregation ATPase [Burkholderia vietnamiensis G4] >gi|134137384|gb|ABO53127.1| chromosome segregation ATPase [Burkholderia vietnamiensis G4] (259 aa)
Score = 223, Expect = 1.1e-16, Identities = 56/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACESTVYEVLIDGVPVSDARVRPEGVTYDVLPANRELSGAEIELIGIDNRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|189501755|ref|YP_001957472.1| hypothetical protein Aasi_0307 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497196|gb|ACE05743.1| hypothetical protein Aasi_0307 [Candidatus Amoebophilus asiaticus 5a2] (262 aa)
Score = 223, Expect = 1.1e-16, Identities = 67/250 (26%), Positives = 131/250 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQ-GVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NLAASL++   K +I D+D Q N  +  G  P  +  +I + + G+   ++++ K   + L I+P +  L   +  +   +  +  ++  + ++ + Y Y+IID  P++ ++    L+  D  ++P + + +A  GL +++N  K  + + N +++I   + T  ++R+ + N I+E+     +KT     V    I    K + A G+ + P ++   +SK    Y NL +EI+N
  S:     5 IAIANQKGGVGKTTTAINLAASLAVLEHKTLIADVDPQANATSGLGIDPRQVTSSIYECMIGEIAPQNVVQKTALDYLEIIPSHINLVGAEVEMINFEHREERMRGTLAQIKDKYAYIIIDCAPSLGLLTINALTAADSLIIPIQCEYFALEGLGKLLNTIKIIQTRLNPDLEIEGLLMTMYDSRLRLSNQIVEE-----VKTHFNKMVFDTIIPRNIKLSEAPGFGK-PAILYDGESKGAISYLNLAQEIIN 251
>gi|167766465|ref|ZP_02438518.1| hypothetical protein CLOSS21_00971 [Clostridium sp. SS2/1] >gi|167711874|gb|EDS22453.1| hypothetical protein CLOSS21_00971 [Clostridium sp. SS2/1] (258 aa)
Score = 223, Expect = 1.1e-16, Identities = 58/176 (32%), Positives = 95/176 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG---KKPDDLEFAIMDFLKG-KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT + NL   L  +GK+V++VDLD QG++    G   K P  L+  + + + G K    ++++   E + ++P N  L+  D  L   +  +  L+  +  L E YD++IID  P++ ++    L+  D  L+P EP+ YA  GL  ++      K K N ++KI  I
  S:     5 IAIANQKGGVGKTTTAINLGIGLVREGKRVLLVDLDPQGHLTIGLGFSKKVPVTLKNMLENIVMGIKFDPREVILHHEEGVDVIPSNKLLSGLDVSLIMAEDREIILREYLMLLKEDYDFMIIDCMPSLGMLTINALTAADSVLIPMEPEYYAADGLMELLKVYSAIKAKFNPDLKIEGI 184
>gi|86742489|ref|YP_482889.1| cobyrinic acid a,c-diamide synthase [Frankia sp. CcI3] >gi|86569351|gb|ABD13160.1| Cobyrinic acid a,c-diamide synthase [Frankia sp. CcI3] (326 aa)
Score = 223, Expect = 1.2e-16, Identities = 49/183 (26%), Positives = 99/183 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTR 185
           + V N KGGV KTT  ++L A+L    ++V++VDLD Q  +  + G  PD LE ++ D L G+     I+ +  +   +LP   EL   + +L  +   +  L++ + ++ + YD+++ID PP++ V+    L+  D  +VP + +  +  G+ ++++   + +   N  +++  + PT  + R
  S:     5 LAVANQKGGVAKTTSVSSLGAALCELDRRVLLVDLDPQACLTFSLGLDPDALELSVHDVLLGRLSAGIIITRTPDGTDLLPATIELAGCEAVLLSRTGREHALRLALAEIVDEYDFILIDCPPSLGVLTINGLTAADEVIVPLQCETLSHRGVGQLLDTVHDVQRLTNPGLRVRGVLPTLFDGR 188
>gi|117927025|ref|YP_867642.1| chromosome segregation ATPase [Magnetococcus sp. MC-1] >gi|117610781|gb|ABK46236.1| chromosome segregation ATPase [Magnetococcus sp. MC-1] (257 aa)
Score = 223, Expect = 1.2e-16, Identities = 48/176 (27%), Positives = 91/176 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           +GVVN KGGV KTT + N+AA+L     +V++VD D QGN     G      +  + D + G C W+    +    L ++P    L+  +  L      ++ LK  +    +++D +++D+PP++ +V    L+     LVP + + YA  GL ++    +  +++ N +++++ I
  S:     5 VGVVNQKGGVGKTTTAVNVAAALCAAELRVLLVDCDAQGNATTGLGGDKMAEQNHLYDLMMGACRWDQAAKRVVPGLSLIPSTPHLSGVEVELATLDGWENRLKEALAPAQDVFDVILLDSPPSLGMVTVNILAAAHRVLVPLQCEFYALEGLSQLWRTLQMTRKRINPDLEVLGI 180
>gi|194561967|ref|YP_002096990.1| replication protein A [Burkholderia dolosa AUO158] >gi|124893591|gb|EAY67471.1| replication protein A [Burkholderia dolosa AUO158] (259 aa)
Score = 223, Expect = 1.2e-16, Identities = 55/191 (28%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      +  + + L       D  ++ +     +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACDATVYEVLVDGVSVADARVRPEAVTYDVLPANRELSGAEIELIGIDNRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|146280810|ref|YP_001170963.1| ParA family protein [Pseudomonas stutzeri A1501] >gi|145569015|gb|ABP78121.1| ParA family protein [Pseudomonas stutzeri A1501] (257 aa)
Score = 223, Expect = 1.3e-16, Identities = 60/178 (33%), Positives = 93/178 (52%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           M+  V N KGGV K++++ NLAA  +  G + ++VDLD Q N      G   DD+   I DF K        GK     IL    +NLH++    EL      L  K    + L+ L+  L E YD + +DTPPA++    + L   D  L+PF+ D ++   L  ++N  +E K+ +N  +++  I
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSASQGYRTLLVDLDAQANSTHYLTGLTGDDIPTGIADFFKQILAGGNAGKKARPPILETAFDNLHLISATAELADLQPKLEAKHKI-NKLRKLLEGLAEDYDRIYLDTPPALNFYTVSALIAADRCLIPFDCDSFSRQALYGLLNEIEEMKDDHNEALEVEGI 186
>gi|154508822|ref|ZP_02044464.1| hypothetical protein ACTODO_01332 [Actinomyces odontolyticus ATCC 17982] >gi|153798456|gb|EDN80876.1| hypothetical protein ACTODO_01332 [Actinomyces odontolyticus ATCC 17982] (287 aa)
Score = 223, Expect = 1.3e-16, Identities = 74/249 (29%), Positives = 120/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC--YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK-STAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL A+L+  G++V+IVD D QG      G    D+E  I   L          I    TENL I+P N +L+  +  L  +   +S L  ++  ++  YD V+ID  P++ ++    L+     +VP E + +A  G+  ++   +  +++ N  +KI  I  T V++R T+H+  + Q L+      G  V    I  T K   A+V  E  PI+           Y  L +E++
  S:    35 IAMCNQKGGVGKTTTTINLGAALAEYGRRVLIVDFDPQGAASVGLGINALDMEQTIYTLLMNPKADVKATICHTSTENLDIIPANIDLSAAEVQLVNEVARESALARVLRHVESDYDVVLIDCQPSLGLLAVNALTAAHGVIVPVEAEFFALRGVALLVETIETVRDRINPRLKIDGIVATMVDSR-TLHSREVLQRLQEAF---GDLVFDTRIGRTIKFPDASVATE--PIISYAPNHAGAHAYRRLAREVI 281
>gi|75674294|ref|YP_316715.1| cobyrinic acid a,c-diamide synthase [Nitrobacter winogradskyi Nb-255] >gi|74419164|gb|ABA03363.1| chromosome segregation ATPase [Nitrobacter winogradskyi Nb-255] (289 aa)
Score = 223, Expect = 1.3e-16, Identities = 68/249 (27%), Positives = 116/249 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLD------ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL  +L+  G++V+IVDLD QGN     G    D   +  D L G+    D ++      LHI     +L+  +  L   +     L+  I  L+        Y YV+ID PP+++++    ++  D  LVP + + +A  GL +++   ++ +   N N+ I  I   V T     N++  Q +    +  G  V    I    + + A  Y + P+++   K    + Y  L  E++
  S:    28 ISLANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNVSTYDVLIGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELGAAKDRAFRLRDAITALNGNAAYAADYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGI---VLTMFDSRNNLSNQVVADVRQFMGSKVYDTMIPRNVRISEAPSYGK-PVLVYDLKCSGSEAYLKLATEVI 279
>gi|120553882|ref|YP_958233.1| cobyrinic acid a,c-diamide synthase [Marinobacter aquaeolei VT8] >gi|120323731|gb|ABM18046.1| Cobyrinic acid a,c-diamide synthase [Marinobacter aquaeolei VT8] (265 aa)
Score = 223, Expect = 1.3e-16, Identities = 67/248 (27%), Positives = 124/248 (50%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIA-TFGKKPDDLEFAIMDFLKGKCYW--------EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKK 248
           M+  V N KGGV K++++ NLAA  +  GK+ ++VDLD QGN      GK   +L+  + D L+    +        E +     +NL++LP + EL++ +  L  K      L+  + KL + +D + IDT PA++    + L      L+PF+ D ++   L  I++  +E +E +N  + +   I  +   R ++   ++ +     L  +G+ V    +SS+ K   +    R P++    K     +Y +L +
  S:     1 MRRVVFNQKGGVGKSSITCNLAAISAARGKRTLVVDLDPQGNSTHYLLGKPAAELKDTVADLLEQTVAFSVFNRRPDEFVHASSFDNLYVLPSSPELDFLERKLEAKHKIY-KLREFLKKLSDSFDEIYIDTAPALNFYTRSALIAAQRCLIPFDCDDFSRQALYNILHEIRELQEDHNEELVVEGIIANQFQPRASLPRQLVRE-----LTEEGLPVLPVRLSSSVKMKES-HQSRQPLIHMAPKHTLTRQYEDLYR 251
>gi|30250395|ref|NP_842465.1| ParA family ATPase [Nitrosomonas europaea ATCC 19718] >gi|30181190|emb|CAD86386.1| ParA family ATPase [Nitrosomonas europaea ATCC 19718] (254 aa)
Score = 223, Expect = 1.3e-16, Identities = 71/248 (28%), Positives = 119/248 (47%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDI-LIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQ-GVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
            + N KGGV KTT S NLA+SL+   K+V++VDLD QGN     G     L+  +   L G+    ++ L  K     +LP N EL   +  +   +  +S LK  +  +   YD+++ID PPA++++    L      ++P + + YA  GL  ++N  K  +   N  ++I   + T  + R     +++ Q +  +LK   G  V    I    +   A G+  +P++    +S+    Y  L  EIL
  S:     6 AIANQKGGVGKTTTSINLASSLASIDKRVLLVDLDPQGNTTMGSGVDKRLLDRTVYQILLGEQVAAEVRLSTKPGKYDLLPANQELAGAEVEMVALEQRESRLKKALQVIQADYDFILIDCPPALNLLTLNGLCAAHAVIIPMQCEYYALEGLSDLVNTIKRVRTGFNPAIRIEGLLRTMFDPR-----NLLAQQVSDQLKQHFGDKVYRTIIPRNIRLAEAPGFG-LPVLYHDKQSRGAQAYLELANEIL 250
>gi|111221679|ref|YP_712473.1| chromosome partitioning protein (partial match) [Frankia alni ACN14a] >gi|111149211|emb|CAJ60896.1| chromosome partitioning protein (partial match) [Frankia alni ACN14a] (302 aa)
Score = 223, Expect = 1.4e-16, Identities = 50/187 (26%), Positives = 100/187 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIH 189
           + + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P   +  + D L  G     D++++ + +NL +LP N +L+  + LL  +   + +L   +  + + YD +++D  P++ ++    L+  D  +VP E + +A  G+  ++    + +E+ N  +++  I   +    T+H
  S:    46 VAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGINPMQFDLTVHDLLLGGDSDVRDVIVETQVDNLDLLPSNIDLSAAEVLLVTEVGREHSLARALAPILDDYDVILVDCQPSLGLLTVNALTAADAVIVPLECEYFALRGVALLLQTIDKVRERLNSRLELAGILATMYDARTLH 234
>gi|110834283|ref|YP_693142.1| ParA family protein [Alcanivorax borkumensis SK2] >gi|110647394|emb|CAL16870.1| ParA family protein [Alcanivorax borkumensis SK2] (260 aa)
Score = 223, Expect = 1.4e-16, Identities = 75/250 (30%), Positives = 128/250 (51%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF----------GKKPDDLEF--AIMDF-LKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEI 250
           M+  V N KGGV K++++ NLAA  + +GK+ ++VDLD Q N               G KP+   F    + F LK K   + +     ENL +LP + EL   + +L  K      L+ L+  L + YD + +DTPPA +    ++L  VD  L+PF+ D ++   L  ++   +E +E +N  +++  I   +   R       + Q L   L+ +G+ + +N +SS+     +   +  P+V    + K  +EY  L +EI
  S:     1 MRRVVFNQKGGVGKSSITVNLAAISASEGKRTLVVDLDPQCNASQYLLGMEAYSDGHGPKPNIGTFFAQTLSFRLKEKDPRDYVHATPFENLFVLPSDGELGEIEHMLESKHKIY-KLRGLLKTLSKDYDEIFVDTPPAYNFYTLSSLIAVDRVLIPFDCDAFSRKALYTLLENIQEAREDHNDELQVEGIVVNQYQPRAR-----LPQELVASLEEEGLPILTNKLSSSVVMRES-HEQATPLVNMQPRHKLTEEYRALFREI 257
>gi|70729064|ref|YP_258800.1| ParA family protein [Pseudomonas fluorescens Pf-5] >gi|68343363|gb|AAY90969.1| ParA family protein [Pseudomonas fluorescens Pf-5] (262 aa)
Score = 222, Expect = 1.4e-16, Identities = 60/182 (32%), Positives = 95/182 (52%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINK----LDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
            V N KGGV KTT S  LA  L+  GK+V++VDLD  G++ + FG  PD LE +  D FL      +D     +L    E + +LP +  L      L ++   QS L ++I K    L + +DY +ID+PP + V++   L+     ++P + +  A  GL+R++N            +    +PT  + R
  S:     5 AVANQKGGVGKTTSSIALAGLLAEAGKRVVVVDLDPHGSMTSYFGYDPDSLEHSSYDLFLHKGNVPQDLPGQLLLGTSHERISLLPSSTALA----TLERQSPGQSGLGLVIAKSLAQLWQDFDYAVIDSPPLLGVLMVNALAASQQLVIPVQTEHLAVKGLERMVNTLAMVNRSRKQPLPFTIVPTLFDRR 192
>gi|196158887|ref|YP_002128376.1| transcriptional regulator of chromosome partitioning protein; ParA family protein; could be a protein tyrosine kinase [Alteromonas macleodii 'Deep ecotype'] >gi|88771974|gb|EAR03282.1| transcriptional regulator of chromosome partitioning protein; ParA family protein; could be a protein tyrosine kinase [Alteromonas macleodii 'Deep ecotype'] >gi|196114666|gb|ACG68382.1| transcriptional regulator of chromosome partitioning protein; ParA family protein; could be a protein tyrosine kinase [Alteromonas macleodii 'Deep ecotype'] (264 aa)
Score = 222, Expect = 1.4e-16, Identities = 55/193 (28%), Positives = 102/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + N+AAS++   +KV+++DLD QGN     G    D+E    + L  +   +D+++K T   + ++  N ++   +  L +    +  L+  +  + + YD+V ID PP+++ +    L+  D  +VP + + YA  GL  +++  ++     N  +KI  +  T  + R  + ND+ EQ
  S:     5 IAIANQKGGVGKTTTAVNVAASMAATKRKVLLIDLDPQGNATMGSGVDKYDVESTAFELLIEEKPIDDVIVKGTSGKYDLIAANGDVTAAEIKLMEMFAREVRLRNALKPVMDYYDFVFIDCPPSLNQLTVNALAAADSVMVPMQCEYYALEGLTALMDTIQKLASVVNPELKIEGVLRTMYDPRNRLANDVSEQ 199
>gi|188589869|ref|YP_001921516.1| SpoOJ regulator protein [Clostridium botulinum E3 str. Alaska E43] >gi|188500150|gb|ACD53286.1| SpoOJ regulator protein [Clostridium botulinum E3 str. Alaska E43] (251 aa)
Score = 222, Expect = 1.4e-16, Identities = 69/224 (30%), Positives = 124/224 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDEL--NYFDFLLNQKQITQSNLKMLINKLD-ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLK----TQGVYVTSNFISSTTKSTAAVGYE 226
           I  +N KGGV KTT   N+AA L  +GK V+I+D+D Q N           ++    + L+G    EDI I+ T  + L +LPGN  L  +  + L + K++ ++ LK  ++  D E +DY++ID PP++ ++    L   D  +VP + D++   G + ++++ +  +E+ N N+ ++ I   ++    IH + I+Q LK +L      Q +    + + ST +ST  V ++
  S:     4 ISFLNIKGGVAKTTSCVNVAAQLGKEGKNVLIIDIDPQSNATKYLNMYDSHVK-GTYEVLRG----EDIGIQPTKYDGLWLLPGNINLIMSEEEILTDTKRVKETRLKTWLSVKDQEAFDYILIDCPPSLGMLSTNALVASDHVIVPLKIDKFGLDGFEYLMSSIEGVREQFNPNLNLLGILITMDKSTRIHKE-IKQELKEELGDLIFNQTIRDNVDVVKSTFESTPVVYFK 230
>gi|121602984|ref|YP_980313.1| cobyrinic acid a,c-diamide synthase [Polaromonas naphthalenivorans CJ2] >gi|120591953|gb|ABM35392.1| chromosome segregation ATPase [Polaromonas naphthalenivorans CJ2] (254 aa)
Score = 222, Expect = 1.4e-16, Identities = 56/191 (29%), Positives = 99/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L   G++V++VDLD QGN     G     L   + D L       D  +   ++ + +L  N EL+  +  L   +  +  LK  + K+D+ YD+++ID PP++S++    L      +VP + + +A  G+  ++N  K+     N +++I+  +    + R+T+   + EQ
  S:     7 IANQKGGVGKTTTTVNLAAGLVQVGQRVLMVDLDPQGNATMGSGVDKRKLAMTVYDVLLEAASIVDARVHSEKSGYDVLGANRELSGAEIELVPLERREKRLKQALAKVDKDYDFILIDCPPSLSMLTLNGLCAAHGVIVPMQCEYFALEGVTDLVNTIKQVHANLNKDLQIIGLLRVMFDPRITLQQQVSEQ 199
>gi|91783771|ref|YP_558977.1| putative chromosome partitioning protein ParA, ATPase [Burkholderia xenovorans LB400] >gi|91687725|gb|ABE30925.1| Putative chromosome partitioning protein ParA, ATPase [Burkholderia xenovorans LB400] (254 aa)
Score = 222, Expect = 1.5e-16, Identities = 68/251 (27%), Positives = 136/251 (54%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIA-TFGKKPDDLEFAIMDFLKGKCYWE------DILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           M+  + N KGGV K+T+  NLAA  + +  + +++DLD QGN      GK+  DL+  + DF +    +          I +T  ENL ++P + +L+     L + +     L+  +N+LDE YD + IDTPPA++    + L  V+  L+PF+ D ++   L  +++  +E ++ +N  +++  I   +   R ++   ++E+     L ++G+ V ++ +S++ K   +  Y + P++    + K   E+  L +E++
  S:     1 MRRVIFNQKGGVGKSTIVCNLAAINASENLRTLVIDLDPQGNSSQYLLGKEATDLKPNVADFFETALSFSFRPAPVSTFIHRTPFENLDVMPSHPDLDTLHGKL-ESRYKIYKLRDALNELDE-YDAIYIDTPPALNFYTRSALIAVERCLIPFDCDDFSRRALYTLLDNVREIQQDHNAGLEVEGIVINQFQARASLPLRLVEE-----LISEGLPVLASRLSTSVKIRESHQYAK-PMIHFDPRHKLAHEFMALHRELI 253
>gi|78355078|ref|YP_386527.1| chromosome segregation ATPase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78217483|gb|ABB36832.1| chromosome segregation ATPase [Desulfovibrio desulfuricans G20] (259 aa)
Score = 222, Expect = 1.5e-16, Identities = 68/249 (27%), Positives = 119/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDL-EFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL++  K+V++VD D Q N  +  G  PD L E     F + +   E +     E L +LP   +L   +  L  K   +  L  ++  L+  YDY+I+D PP++ ++    L      L+P + + +A  G+ +++   ++ K++ N  + ++ +   V T   + N +  Q      K    ++    +    + + A  Y +  I   V KSK  + Y  L KE++
  S:     5 IAIANQKGGVGKTTTAINLAASLAVMEKRVLLVDCDPQANGTSGLGIDPDQLGESLYTVFFRPEEALEAVHPTNLEYLSVLPTTTDLVAVELELVDKMGREYYLTDVLKNLESRYDYIILDCPPSLGLITLNALCAARELLIPLQCEFFALEGIVKLLQTFEQVKKRLNPGLTLMGV---VLTMYDLRNRLSRQVKNEVRKCFPDHLFETVVPRNVRLSEAPSYGKSIIHYDV-KSKGAEAYLALSKEVV 250
>gi|114568072|ref|YP_755226.1| sporulation initiation inhibitor protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114339007|gb|ABI69855.1| chromosome segregation ATPase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (260 aa)
Score = 222, Expect = 1.5e-16, Identities = 66/258 (25%), Positives = 130/258 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLK--PKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRET 260
           I + N KGGV KTT + NLAAS++L  +KV+++D D QGN  +  G     L+  + ++L +G    E I   + + L I+P   +L   +  L  ++  +  +   +  + E YDY+ +D PP++ ++    L   +  L+P + + YA  GL ++++     +++ N ++K+  I  T  + R  +   ++++  +  PK   Q +      I    + + A  + + P V+   +S+  +EY  L  E+L     G+ +
  S:     5 IAIANQKGGVGKTTTAINLAASIALGEQKVLLIDCDPQGNASSGLGINRKRLKNCVYNWLVEGLPAKEVITATEVDGLEIIPATIQLAGAEVELATRENREHYMANALKPIKEAYDYIFLDCPPSLGLLTINALVASNSVLIPLQCEYYALEGLSQLMDTILLVRKRLNRSLKLEGIAMTMFDGRTNLAIQVVDEVKRYFPKEIYQTI------IPRNVRLSEAPSHGQ-PAVIYDPRSRGAEEYRELAMEVLERAKKGKRS 259
>gi|89890951|ref|ZP_01202460.1| chromosome partitioning protein parA, CbiA family [Flavobacteria bacterium BBFL7] >gi|89517096|gb|EAS19754.1| chromosome partitioning protein parA, CbiA family [Flavobacteria bacterium BBFL7] (256 aa)
Score = 222, Expect = 1.6e-16, Identities = 55/193 (28%), Positives = 106/193 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAASL +  KKV+++D D Q N  +  G   + +E      L+      ++++K ++ NL I+P + +L   +  L  K   +  +   +  L ++YDY+IID  P++ ++    L+  +  L+P + + +A  GL +++N  K  ++ +N  + I   + T  ++R+ + N ++E+
  S:     5 IAIANQKGGVGKTTTAVNLAASLGVLEKKVLLIDADPQANATSGLGIDVETVENGTYQLLEHTVPALELVVKTESPNLDIIPAHIDLVAIEIELVDKDQREYMMSEAVQPLKDVYDYIIIDCAPSLGLLTLNALTASNSVLIPIQCEYFALEGLGKLLNTIKSIQKIHNDQLDIEGLLLTMYDSRLRLSNQVVEE 199
>gi|184201172|ref|YP_001855379.1| putative Soj/ParA-related protein [Kocuria rhizophila DC2201] >gi|183581402|dbj|BAG29873.1| putative Soj/ParA-related protein [Kocuria rhizophila DC2201] (297 aa)
Score = 222, Expect = 1.6e-16, Identities = 62/250 (24%), Positives = 124/250 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC--YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK-STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I +VN KGGV KTT + NL A+L+  G+KV++VD D QG + A FG  P +L+  + + +  +    W+ +     EN+ +LP N +L+  +  L  +   +  L   + K+++ YD ++ID  P++ ++    L+     ++P   + +A   +  ++++  + +++ N  ++I  +   +    T+H+    + +   +   G  V    I  T K   A V  E  PI+         + Y  L +E+++
  S:    45 IAMVNQKGGVGKTTSTINLGAALAELGRKVLLVDFDPQGALSAGFGSNPHELDLTVYNVMMDRSVDVWDVVQQTHVENVDLLPANIDLSAAEVQLVNEVAREQVLASALRKVEDHYDVILIDCQPSLGLLTVNALTASHGVIIPLICEFFALRAVALLVDSISKVQDRINPKLQIDGVLATMFDSRTLHS---REVIARIVDAFGDKVFDTVIKRTVKFPDATVAAE--PILAFATNHPGAESYRQLARELIS 292
>gi|83649683|ref|YP_438118.1| ParA family protein [Hahella chejuensis KCTC 2396] >gi|83637726|gb|ABC33693.1| ParA family protein [Hahella chejuensis KCTC 2396] (263 aa)
Score = 222, Expect = 1.6e-16, Identities = 54/173 (31%), Positives = 94/173 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           + V N KGGV KTT   NLAASL+   +KV++VD+D QGN     G   + +E  + D L  K     + +K +E     ++P N ++   +  L  +   +  L+  I ++   YDYV++D PPA++++    L   +  L+P + + YA  GL  ++N  ++ +E  N +++I
  S:     5 LAVTNQKGGVGKTTTCVNLAASLAATRRKVLLVDIDPQGNATMGSGIDKNSIEHTVYDVLTKKANAAQV-VKTSEAAGYDVMPANGDVTAAEVELMNEIGREYRLRNAIKEVAVNYDYVLLDCPPALNLLTVNALVAANGVLIPMQCEYYALEGLAALMNTIEQIRETVNPSLEI 178
>gi|62424881|ref|ZP_00380021.1| COG1192: ATPases involved in chromosome partitioning [Brevibacterium linens BL2] (283 aa)
Score = 222, Expect = 1.6e-16, Identities = 67/249 (26%), Positives = 124/249 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCY--WEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK-STAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I +VN KGGV KTT S NL ASL+  G+K+++VD D QG +    G  P DLE ++ + L        E I+    +N+ ILP N +L+  +  L  +   +  L  +++K+ + YD ++ID  P++ ++    L+     ++P E + +A  G+  ++   ++ +++ N ++ +  I   +    T+H+  +   +      +   V    I+ T K   A+V  E  PI     K    + Y  L +E++
  S:    31 IAMVNQKGGVGKTTSSINLGASLAAYGRKMLLVDFDPQGALSVGLGVNPYDLEISVYNLLMNSRLDPHEVIVGTDFDNIDILPANIDLSAAEVQLVGEVAREQILSRVLSKVADEYDVILIDCQPSLGLLTVNALTAAHGVIIPLETEFFALRGVALLVETIEKIQDRLNPSLVVDGILATMFDSRTLHSKEVMSRVTEAFDDK---VFETVINRTVKFPDASVAAE--PITSFAPKHAGSEAYRRLARELI 277
>gi|77359765|ref|YP_339340.1| partitioning protein A [Pseudoalteromonas haloplanktis TAC125] >gi|76874676|emb|CAI85897.1| putative ParA family protein [Pseudoalteromonas haloplanktis TAC125] (256 aa)
Score = 222, Expect = 1.6e-16, Identities = 59/185 (31%), Positives = 96/185 (51%)
  Q:     1 MKI-GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIK-----KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           MKI  V N KGGV KTT + +LA  L+  GK+V+++D D   ++   FG   +DLE ++ D F++G     + +++       ENL ILP    +   D  +  K      LK  + K+ E YDY I+D PP + V++   L+  +  LVP + +  A  GL R++   +  +     + +   I T  + R
  S:     1 MKIWTVANQKGGVGKTTTAVSLAGILASQGKRVLLIDTDPHASLTYYFGIDSEDLEVSVYDIFVRGTSMQSEEILQALCPSSIENLDILPATMAIATLDRSMGNKTGMGLILKKALAKISEYYDYAILDCPPVLGVLMVNALAASERILVPVQTEFLALKGLDRMMRTMQLMQTSQAKSYEYTIIATMYDKR 192
>gi|68171523|ref|ZP_00544903.1| Cobyrinic acid a,c-diamide synthase [Ehrlichia chaffeensis str. Sapulpa] >gi|88657765|ref|YP_507940.1| ParA family chromosome partitioning ATPase [Ehrlichia chaffeensis str. Arkansas] >gi|67999051|gb|EAM85722.1| Cobyrinic acid a,c-diamide synthase [Ehrlichia chaffeensis str. Sapulpa] >gi|88599222|gb|ABD44691.1| chromosome partitioning ATPase, ParA family [Ehrlichia chaffeensis str. Arkansas] (256 aa)
Score = 222, Expect = 1.6e-16, Identities = 70/248 (28%), Positives = 122/248 (49%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
            +VN KGGV KTT S NL+ + ++  KK +++DLD QGN    FG   +     + + L         +IK +  NLH+LP   +L+  +  L Q Q  +  LK  ++++   YDY+ ID PP++ ++    L   D  ++P + + +A  GL  ++   +  K+  N  + I  I   +  +    ++ +E+ ++  LK + VY T   I    + + A  + + P ++  FK      Y  L KEIL
  S:     6 AIVNQKGGVGKTTTSINLSTAFAIVNKKTLLIDLDPQGNSSTGFGITYEQRINTVYEVLVNNLPISSTIIKTEIPNLHLLPSTVDLSAAEIELTQVQQREFILKKSLSEVKNSYDYIFIDCPPSLGLLTVNALIAADSIIIPLQCEFFALEGLSHLMKTIEIVKKHLNPLLSIEGIILTMYDKRNKLSEQVEEDIRKYLK-ESVYKT--VIPRNVRLSEAPSHGK-PAIIYDFKCAGSQAYIYLAKEIL 250
>gi|172059162|ref|YP_001806814.1| cobyrinic acid ac-diamide synthase [Burkholderia ambifaria MC40-6] >gi|171991679|gb|ACB62598.1| Cobyrinic acid ac-diamide synthase [Burkholderia ambifaria MC40-6] (259 aa)
Score = 222, Expect = 1.6e-16, Identities = 56/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  + ++ + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACESTVYEVLIDGVSVMDARVRPEGVTYDVLPANRELSGAEIELIGIDNRERRLKAALERVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|23465230|ref|NP_695833.1| chromosome partitioning protein ParA [Bifidobacterium longum NCC2705] >gi|23325859|gb|AAN24469.1| chromosome partitioning protein ParA [Bifidobacterium longum NCC2705] (336 aa)
Score = 222, Expect = 1.6e-16, Identities = 53/169 (31%), Positives = 94/169 (55%)
  Q:     2 KIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDF----LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNN 170
           +I V N KGGV KTT + N AA+L+  G +V+++D+D QGN     G      E ++ D ++G+    D++    +   L ++P + +L+  +     L N+  + +  L + + + D+ YDYV ID PP++ ++V   +  V   L+P + + YA  GL ++IN     +E  N
  S:    69 RIAVANQKGGVGKTTSTVNTAAALANKGAQVLVIDMDPQGNASTALGVSHASGEPSVYDVIEGRSDLGDVITVCPDFPTLDVVPASIDLSGAELEVADLPNRNTLLKEALDLYLRQSDKHYDYVFIDCPPSLGLLVINAMCAVTEMLIPIQAEYYALEGLGQLINTIGLVQEHFN 243
>gi|104774703|ref|YP_619683.1| chromosome partitioning protein ParA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514831|ref|YP_813737.1| chromosome partitioning ATPase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423784|emb|CAI98792.1| Chromosome partitioning protein ParA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116094146|gb|ABJ59299.1| chromosome segregation ATPase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (259 aa)
Score = 222, Expect = 1.7e-16, Identities = 73/249 (29%), Positives = 119/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKC-YWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAAS++  G KV+IVD+D QGN  +  G +   +E+ I + L  +      I    ++ L I+P    L   +  L      ++ LK  I  L + YD+V ID PP++  +     +     L+P + + YA  GL +++N  +  ++  N ++ +  +  T ++ R  +  D+++Q +K      G  V    I   TK   A  Y    I      S+    Y +L KE+L
  S:     5 IAVANQKGGVGKTTTTINLAASIAKRGYKVLIVDIDPQGNATSGLGIEKSTIEYDIYNVLIDEIPIASAIKPTSSKKLDIVPATINLAGAETELISMMARETRLKGAIEDLGDKYDFVFIDCPPSLGQLSINAFTASQSILIPVQSEYYAMEGLSQLLNTIRLVQKHFNKDLGVEGVLLTMLDARTNLGADVVQQ-VKEYF---GDRVYKTIIPRITKLAEAPSYGEA-ITEYAPSSRGAKVYDDLAKEVL 250
>gi|156975408|ref|YP_001446315.1| hypothetical protein VIBHAR_03139 [Vibrio harveyi ATCC BAA-1116] >gi|156527002|gb|ABU72088.1| hypothetical protein VIBHAR_03139 [Vibrio harveyi ATCC BAA-1116] (259 aa)
Score = 222, Expect = 1.7e-16, Identities = 61/218 (27%), Positives = 105/218 (48%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKP---KLKTQGVYVTSNFISSTTKSTAA 222
           V N KGGV KTT +  LA  LS  G +V++VD D   ++    G  PD +  ++ D  + K +  +     IL  + E + I+P +  L   D ++  +      LK  +  + + YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R+I      ++      K+  +PT  + R       + Q  K    ++ T  V + + F  ++ K   A
  S:     6 VANQKGGVGKTTSTVTLAGLLSQKGHRVLMVDTDPHASLTTYLGYDPDAVTSSLFDLFQLKTFSRETVKPLILETELEGMDIIPAHMSLATLDRVMGNRSGMGLILKRALQAVAQDYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMIRTLTIMQKSRPGGFKVTIVPTMYDKRTKASLQTLTQLKKDYPNQVWTSAVPIDTKFRDASLKHLPA 231
>gi|95929978|ref|ZP_01312718.1| Cobyrinic acid a,c-diamide synthase [Desulfuromonas acetoxidans DSM 684] >gi|95133947|gb|EAT15606.1| Cobyrinic acid a,c-diamide synthase [Desulfuromonas acetoxidans DSM 684] (255 aa)
Score = 222, Expect = 1.7e-16, Identities = 51/157 (32%), Positives = 90/157 (57%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRII 159
           I + N KGGV KTT + NL+ASL++  KK ++VD+D QGN  +  G   ++LE  + D L      ++ ++K + + L++LP   +L   +  L      +  L  +IN++   YDY+IID PP++ ++   +L+     +VP + + YA  GL +++
  S:     5 IAIANQKGGVGKTTTAVNLSASLAVAEKKTLLVDMDPQGNACSGVGVVTEELEVTVYDTLHDPLLVKEGIVKTQLDFLNVLPSTTDLIGAELELVAADRREYRLSNVINQVAADYDYIIIDCPPSLGLLTINSLTAAGSVIVPLQCEYYAMEGLSQLM 162
>gi|37785811|gb|AAR02618.1| Soj [Aeromonas hydrophila] (267 aa)
Score = 222, Expect = 1.8e-16, Identities = 55/193 (28%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTEN-LHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT   NLAAS++   +KV+++DLD QGN     G    ++E    + L       +++I +T    H++  N ++   +  L +    +  L+  +  + + YDYV ID PP+++++    ++  D  LVP + + YA  GL  +++   +     N ++KI  +  T  + R  + ND+ +Q
  S:     5 IAIANQKGGVGKTTTCVNLAASMAATRRKVLVIDLDPQGNATMGSGVDKYEVERTAYELLIEDAPIGEVIIPETSGGYHLIAANADVTAAEIRLMEFFAREIRLRNALAAVRDKYDYVFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPDLKIEGVLRTMFDHRNRLANDVSDQ 199
>gi|118443230|ref|YP_876983.1| sporulation initiation inhibitor protein soj [Clostridium novyi NT] >gi|118133686|gb|ABK60730.1| Sporulation initiation inhibitor protein soj [Clostridium novyi NT] (261 aa)
Score = 221, Expect = 1.9e-16, Identities = 66/250 (26%), Positives = 131/250 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK--TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKV-NTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL A+L++ G KV+ +D+D QGN  +  G   + ++++  D L      E+ +I+    +N +++P N +L   +  L   +  ++ LK  I  + + ++Y+ ID PP++ V+   +L      L+P + + YA  G+ +++N  +  K+  N ++++  +   + + R  + N++ ++ +  K     VY T+  I    +   A  +  +PIV+   K K  + Y +L  E L+
  S:     4 ICIFNQKGGVGKTTTNINLCANLAMHGHKVLSIDIDPQGNTTSGLGIDKNKIKYSTYDVLTSDISIEEAIIESELIDNFYVVPSNMDLVGAEVELIDVKGRETILKRKIESIKDKFEYIFIDCPPSLGVLTINSLIAATSVLIPIQCEFYALEGVGQLLNTIQLVKKSLNKDLEVEGVVMSMYDNRTKLCNEVAQEVI--KYFKDKVYNTT--IPRNVRLAEAPSFG-LPIVLYDDKCKGAEAYRDLLNEFLS 251
>gi|161508050|ref|YP_001578017.1| chromosome partitioning protein [Lactobacillus helveticus DPC 4571] >gi|160349039|gb|ABX27713.1| Chromosome partitioning protein [Lactobacillus helveticus DPC 4571] (259 aa)
Score = 221, Expect = 1.9e-16, Identities = 69/249 (27%), Positives = 127/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAAS++  G +V+IVD+D QGN  +  G +  +++  I + L  +   +D I    T  L ++P    L+  +  L      ++ LK  ++ + + YD+V +D PP++  +     +  D  L+P + + YA  GL +++N  +  ++  N ++ +  +  T ++ R  +  +++++       ++ VY T   I   TK   A  Y + PI     +S+    Y +L KE+L
  S:     5 ISVANQKGGVGKTTTTINLAASIADRGYRVLIVDIDPQGNATSGLGIEKSEIDQDIYNVLIDEIPIQDTIHHTSTAKLDMVPATINLSGAETELISMMARETRLKSSLDAISDQYDFVFMDCPPSLGQLSINAFTASDSILIPVQSEYYAMEGLSQLLNTIRLVQKHFNKDLGVEGVLLTMLDARTNLGAEVVKEV--QSYFSKKVYKT--IIPRITKLAEAPSYGQ-PITEYAPRSRGAKVYDDLAKEVL 250
>gi|110004187|emb|CAK98525.1| soj-like partition protein para [Spiroplasma citri] (256 aa)
Score = 221, Expect = 1.9e-16, Identities = 54/176 (30%), Positives = 95/176 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFD-FLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT S NLAA L+  G+K+++VD+D QGN     G   + +  ++ D L G+   ++I+I     N+ + P    L   D +L+ + +  QS L   I  + + YD+++ID PP++ ++    L+  D  L+P + + Y   GL +++      ++  N ++ I  I
  S:     5 IAITNQKGGVGKTTTSINLAAGLARTGRKILLVDIDPQGNATTGTGANKEKIHESMYDVLVGQIPLKNIIISDIITNVDLAPATISLAGADIYLMERTEDNQSILLERIKPVRDKYDFILIDCPPSLGLINRNALACADSVLIPIQAEYYPLEGLAQLLTTIHFVQKMFNESLTIEGI 182
>gi|59713180|ref|YP_205956.1| chromosome partitioning protein ParA [Vibrio fischeri ES114] >gi|163731063|ref|ZP_02138529.1| chromosome partitioning protein ParA [Vibrio fischeri MJ11] >gi|59481281|gb|AAW87068.1| chromosome partitioning protein ParA [Vibrio fischeri ES114] >gi|161395623|gb|EDQ19926.1| chromosome partitioning protein ParA [Vibrio fischeri MJ11] (265 aa)
Score = 221, Expect = 1.9e-16, Identities = 55/193 (28%), Positives = 104/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAAS++   +KV+++DLD QGN     G    D++    + L  +  ++ ++I++T   + ++  N ++   +  L +    +  L+ +I  +   YD++ ID PPA++++    ++  D  LVP + + YA  GL  +I+   +     N ++KI   + T  + R  + ND+ +Q
  S:     5 ISIANQKGGVGKTTTAVNLAASMAATHRKVLLIDLDAQGNATMASGVDKYDVDATAYELLVDEVPFDKVVIEETSGGYDLIAANGDVTAAEIKLMEVFAREVRLRNMIYPIRGNYDFIFIDCPPALNLLTINAMAASDSVLVPMQCEYYALEGLTALIDTIGKLAAVVNADLKIEGLLRTMFDPRNRLANDVSDQ 199
>gi|114565204|ref|YP_752718.1| cobyrinic acid a,c-diamide synthase [Shewanella frigidimarina NCIMB 400] >gi|114336497|gb|ABI73879.1| Cobyrinic acid a,c-diamide synthase [Shewanella frigidimarina NCIMB 400] (262 aa)
Score = 221, Expect = 1.9e-16, Identities = 59/193 (30%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L  +  + +I+IK T   + ++ GN ++   +  L +    +  L+  +  + + YD++ ID PP+++++    +S  D  LVP + + YA  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYELLVEEKPFAEIVIKNTIGKYDLIAGNGDVTAAEIKLMEFYAREIRLRNALAPIKDDYDFIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTITKLGAMVNPTLSIEGILRTMYDPRNRLSNDVSDQ 199
>gi|58338075|ref|YP_194660.1| chromosome partitioning protein [Lactobacillus acidophilus NCFM] >gi|58255392|gb|AAV43629.1| chromosome partitioning protein [Lactobacillus acidophilus NCFM] (259 aa)
Score = 221, Expect = 1.9e-16, Identities = 69/249 (27%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NLAAS++  G +V+IVD+D QGN  +  G +  +++  I + L  +   +D I    T  L ++P    L+  +  L      ++ LK  ++ + + YD++ ID PP++  +     +  D  L+P + + YA  GL +++N  +  ++  N ++ +  +  T ++ R  +  +++++       ++ VY T   I   TK   A  Y + PI     +S+    Y  L KE+L
  S:     5 ISVANQKGGVGKTTTTINLAASIADRGYRVLIVDIDPQGNATSGLGIEKSEIDQDIYNVLIDEVPIQDTIHHTSTAKLDMVPATINLSGAETELISMMARETRLKSSLDAVSDQYDFIFIDCPPSLGQLSINAFTASDSILIPVQSEYYAMEGLSQLLNTIRLVQKHFNKDLGVEGVLLTMLDARTNLGAEVVKEV--QSYFSKKVYKT--IIPRITKLAEAPSYGQ-PITEYAPRSRGAKVYDELAKEVL 250
>gi|28899001|ref|NP_798606.1| Soj-like protein [Vibrio parahaemolyticus RIMD 2210633] >gi|6952818|gb|AAF32419.1| SOJ-like protein [Vibrio parahaemolyticus] >gi|28807220|dbj|BAC60490.1| Soj-like protein [Vibrio parahaemolyticus RIMD 2210633] (259 aa)
Score = 221, Expect = 1.9e-16, Identities = 61/218 (27%), Positives = 104/218 (47%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKP---KLKTQGVYVTSNFISSTTKSTAA 222
           V N KGGV KTT +  LA  LS  G +V++VD D   ++    G   D +  ++ D  + K +  D     IL  + E + I+P +  L   D ++  +      LK  +  + + YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R+I      ++      K+  +PT  + R       + Q  K    ++ T  V + + F  ++ K   A
  S:     6 VANQKGGVGKTTSTVTLAGLLSQKGHRVLMVDTDPHASLTTYLGYDSDTVSSSLFDLFQLKTFTRDTVKPLILETELEGMDIIPAHMSLATLDRVMGNRSGMGLILKRALQAVSQDYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMIRTLTIMQKSRPDGFKVTIVPTMYDKRTRASLQTLTQLKKDYPNQVWTSAVPIDTKFRDASLKHLPA 231
>gi|119869008|ref|YP_938960.1| cobyrinic acid a,c-diamide synthase [Mycobacterium sp. KMS] >gi|126435526|ref|YP_001071217.1| cobyrinic acid a,c-diamide synthase [Mycobacterium sp. JLS] >gi|119695097|gb|ABL92170.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium sp. KMS] >gi|126235326|gb|ABN98726.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium sp. JLS] (290 aa)
Score = 221, Expect = 2.0e-16, Identities = 70/250 (28%), Positives = 128/250 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI------PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL ASL+  G++V++VDLD QG + A  G    +L+  + + L + +   +D+LI  +  NL ++P N +L+  +  L  +   +  L   ++ + + YDYV+ID  P++ ++    L+  D  ++P E + ++  GL  + +   + +++ N  + I  I      P  VN R  +   ++E+         G  V    I+ T +   T+  G    PI     KS   + Y  L +E+++
  S:    39 IAMCNQKGGVGKTTSTINLGASLAEYGRRVLLVDLDPQGALSAGLGVPHYELDHTVHNLLVEPRVSIDDVLISTRVRNLDLVPSNIDLSAAEIQLVNEVGREQTLGRALHPVLDRYDYVLIDCQPSLGLLTVNGLACSDGVIIPTECEYFSLRGLALLTDTVDKVRDRLNPKLDISGILVTRYDPRTVNAR-EVMARVVERF--------GDLVFDTVITRTVRFPETSVAGE---PITTWAPKSAGAEAYRALAREVID 286
>gi|108799898|ref|YP_640095.1| cobyrinic acid a,c-diamide synthase [Mycobacterium sp. MCS] >gi|108770317|gb|ABG09039.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium sp. MCS] (279 aa)
Score = 221, Expect = 2.0e-16, Identities = 70/250 (28%), Positives = 128/250 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI------PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL ASL+  G++V++VDLD QG + A  G    +L+  + + L + +   +D+LI  +  NL ++P N +L+  +  L  +   +  L   ++ + + YDYV+ID  P++ ++    L+  D  ++P E + ++  GL  + +   + +++ N  + I  I      P  VN R  +   ++E+         G  V    I+ T +   T+  G    PI     KS   + Y  L +E+++
  S:    28 IAMCNQKGGVGKTTSTINLGASLAEYGRRVLLVDLDPQGALSAGLGVPHYELDHTVHNLLVEPRVSIDDVLISTRVRNLDLVPSNIDLSAAEIQLVNEVGREQTLGRALHPVLDRYDYVLIDCQPSLGLLTVNGLACSDGVIIPTECEYFSLRGLALLTDTVDKVRDRLNPKLDISGILVTRYDPRTVNAR-EVMARVVERF--------GDLVFDTVITRTVRFPETSVAGE---PITTWAPKSAGAEAYRALAREVID 275
>gi|15676118|ref|NP_273249.1| ParA family protein [Neisseria meningitidis MC58] >gi|7225411|gb|AAF40648.1| ParA family protein [Neisseria meningitidis MC58] (257 aa)
Score = 221, Expect = 2.0e-16, Identities = 57/193 (29%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT + NLAASL+  GK+V++VDLD QGN     G     L+  +   L G    +   ++  E  + +L  N  L   +  L Q+   +  LK  +  ++E YD+++ID PP+++++    L      +VP   + YA  G+  +I   ++ ++  N ++ I  I  T  ++R  +  ++ EQ
  S:     6 LAIANQKGGVGKTTTTVNLAASLASRGKRVLVVDLDPQGNATTGSGIDKAGLQSGVYQVLLGDADVQSAAVRSKEGGYAVLGANRALAGAEIELVQEIAREVRLKNALKAVEEDYDFILIDCPPSLTLLTLNGLVAAGGVIVPMLCEYYALEGISDLIATVRKIRQAVNPDLDITGIVRTMYDSRSRLVAEVSEQ 200
>gi|188587515|ref|YP_001919060.1| chromosome segregation ATPase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352202|gb|ACB86472.1| chromosome segregation ATPase [Natranaerobius thermophilus JW/NM-WN-LF] (253 aa)
Score = 221, Expect = 2.0e-16, Identities = 73/249 (29%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL+A L+  GKKV+++D+D QGN  +  G   + L   + D L  +    +I++  + + L + P   +L   +  L      +  L+ L+  +    DY+IID PP++ ++    L+  D AL+P + + YA  GL +++N  K  +   N  ++I  +  T  ++R  +   + E+ +K   K   VY T   I    + + A  Y + PI+    KSK  + Y  L +E+L
  S:     5 IAITNQKGGVGKTTTAVNLSAGLAHSGKKVLLLDIDPQGNSTSGVGVDKNKLTSCMYDSLINETPVHNIVVNTEIDGLMVAPATIDLAGAEIELVPTISREVKLRNLLRDIHMDLDYIIIDCPPSLGLLTVNALTASDSALIPIQCEYYALEGLSQLLNTIKLVQNHLNTALEIEGVLLTMYDSRTNLSAQVSEE-IKNHFKDD-VYKT--VIPRNVRLSEAPSYGQ-PIITYDNKSKGAEVYLQLAEEVL 250
>gi|153836955|ref|ZP_01989622.1| ParA family protein [Vibrio parahaemolyticus AQ3810] >gi|149749728|gb|EDM60473.1| ParA family protein [Vibrio parahaemolyticus AQ3810] (259 aa)
Score = 221, Expect = 2.0e-16, Identities = 54/181 (29%), Positives = 90/181 (49%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           V N KGGV KTT +  LA  LS  G +V++VD D   ++    G   D +  ++ D  + K +  D     IL  + E + I+P +  L   D ++  +      LK  +  + + YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R+I      ++      K+  +PT  + R
  S:     6 VANQKGGVGKTTSTVTLAGLLSQKGHRVLMVDTDPHASLTTYLGYDSDTVSSSLFDLFQLKTFTRDTVKPLILETELEGMDIIPAHMSLATLDRVMGNRSGMGLILKRALQAVSQDYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMIRTLTIMQKSRADGFKVTIVPTMYDKR 191
>gi|154493971|ref|ZP_02033291.1| hypothetical protein PARMER_03316 [Parabacteroides merdae ATCC 43184] >gi|154086231|gb|EDN85276.1| hypothetical protein PARMER_03316 [Parabacteroides merdae ATCC 43184] (254 aa)
Score = 221, Expect = 2.0e-16, Identities = 70/250 (28%), Positives = 127/250 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NLAASL+   KKV++VD D Q N  +  G     +E +I +  + G      I   + E L I+P + +L   +  +   +  +  LK ++  L E YDY++ID  P++ ++    L+  D  ++P + + +A  G+ +++N  K  K K N  ++I   + T  ++R+ + N I E+  +P        V +  I    K + A  Y + P+++   +SK    +  L +E+++
  S:     5 IALANQKGGVGKTTTTINLAASLAALEKKVLVVDADPQANASSGLGVDIRSVEQSIYECVVNGDDPKGAITNTEVEGLDIIPSHIDLVGAEIEMLNMENREQILKQILVPLKERYDYILIDCSPSLGLITVNALTAADSVMIPVQCEYFALEGISKLLNTIKIIKSKLNPALEIEGFLLTMYDSRLRLANQIYEEVKRPFRD----LVFTTVIQRNVKLSEASSYGK-PVLLYDAESKGALNHMQLAQELID 251
>gi|189440304|ref|YP_001955385.1| ATPase for chromosome partitioning [Bifidobacterium longum DJO10A] >gi|189428739|gb|ACD98887.1| ATPase for chromosome partitioning [Bifidobacterium longum DJO10A] (323 aa)
Score = 221, Expect = 2.0e-16, Identities = 53/169 (31%), Positives = 94/169 (55%)
  Q:     2 KIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDF----LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNN 170
           +I V N KGGV KTT + N AA+L+  G +V+++D+D QGN     G      E ++ D ++G+    D++    +   L ++P + +L+  +     L N+  + +  L + + + D+ YDYV ID PP++ ++V   +  V   L+P + + YA  GL ++IN     +E  N
  S:    56 RIAVANQKGGVGKTTSTVNTAAALANKGAQVLVIDMDPQGNASTALGVSHASGEPSVYDVIEGRSDLGDVITVCPDFPTLDVVPASIDLSGAELEVADLPNRNTLLKEALDLYLRQSDKHYDYVFIDCPPSLGLLVINAMCAVTEMLIPIQAEYYALEGLGQLINTIGLVQEHFN 230
>gi|24376228|ref|NP_720272.1| ParA family protein [Shewanella oneidensis MR-1] >gi|24351288|gb|AAN57715.1|AE015907_13 ParA family protein [Shewanella oneidensis MR-1] (262 aa)
Score = 221, Expect = 2.0e-16, Identities = 58/193 (30%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L  +  ++DI++K T   + ++  N ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + +A  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYELLVEEKPFDDIVVKDTAGKYDLIASNGDVTAAEIKLMEFFAREVRLRNALAPIKDQYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAVVNPGLGIEGILRTMYDPRNRLSNDVSDQ 199
>gi|83746957|ref|ZP_00944003.1| ParA [Ralstonia solanacearum UW551] >gi|83726377|gb|EAP73509.1| ParA [Ralstonia solanacearum UW551] (261 aa)
Score = 221, Expect = 2.0e-16, Identities = 57/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+   ++V++VDLD QGN     G     LE ++   L G     +   +     + +LP N +L   +  L      +S LK  + ++ + YD+V+ID PPA+S++    L      +VP + + +A  GL  ++N  K+     N ++K++  +    + RVT+   +  Q
  S:     7 IANQKGGVGKTTTTVNLAAGLAAQEQRVLLVDLDPQGNASMGSGIDKHTLETSVYQVLVGLATVPEARQRSESGRYDVLPANRDLAGAEVELVDLDHRESRLKRALAEVADDYDFVLIDCPPALSLLTLNGLCAAHGVIVPMQCEYFALEGLSDLVNTIKQVHANLNRDLKVIGLLRVMFDPRVTLQQQVSAQ 199
>gi|85712596|ref|ZP_01043643.1| ATPase involved in chromosome partitioning, Soj/ParA family protein [Idiomarina baltica OS145] >gi|85693587|gb|EAQ31538.1| ATPase involved in chromosome partitioning, Soj/ParA family protein [Idiomarina baltica OS145] (265 aa)
Score = 221, Expect = 2.1e-16, Identities = 53/193 (27%), Positives = 103/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAAS++   +KV+++DLD QGN     G    +++  + + L  +   +++++  T    H++  N ++   +  L +    +  L+  +  + + YD++ ID PP+++++    ++  D  LVP + + YA  GL  ++   ++  E  N ++ I  I  T  + R  + ND+ EQ
  S:     5 IAIANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGNATMGSGVDKYEVDSTVYELLVDEKPIKEVVVTDTNGKYHLIAANSDVTAAEIKLMEFFAREVRLRNALKSVQDDYDFIFIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMETIRQLAEVVNSSLTIEGILRTMYDPRNRLANDVSEQ 199
>gi|163859296|ref|YP_001633594.1| ParA family protein [Bordetella petrii DSM 12804] >gi|163263024|emb|CAP45327.1| ParA family protein [Bordetella petrii] (266 aa)
Score = 221, Expect = 2.1e-16, Identities = 55/191 (28%), Positives = 94/191 (49%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  GK+V+++DLD QGN     G     LE  +   L G        ++ +     +LP N EL   +  L      +  LK  I+ + + YD+V+ID PP +S++    L+     ++P + + +A  GL  ++N  K      N  ++++  +    + R+T+   +  Q
  S:    16 IANQKGGVGKTTTAINLAAGLAKHGKRVLLIDLDPQGNATMGSGIDKSSLESNLYQVLIGDASIAQARVRSEAGGYDVLPANRELAGAEIDLVNMDERERQLKAAIDAIVDQYDFVLIDCPPTLSLLTLNGLAAAHGVIIPMQCEYFALEGLSDLVNTIKRVHRNINGELRLIGLLRVMFDPRMTLQQQVSAQ 208
>gi|15639264|ref|NP_218713.1| SpoOJ regulator (soj) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025506|ref|YP_001933278.1| chromosome partitioning protein [Treponema pallidum subsp. pallidum SS14] >gi|12230549|sp|O83296|SOJ_TREPA Protein soj homolog >gi|3322545|gb|AAC65260.1| SpoOJ regulator (soj) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018081|gb|ACD70699.1| chromosome partitioning protein [Treponema pallidum subsp. pallidum SS14] (253 aa)
Score = 221, Expect = 2.1e-16, Identities = 56/190 (29%), Positives = 99/190 (52%)
  Q:     6 VNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           VN KGGV KTT + NL A L+L GKK ++VD D QGN+ +  G         + D L GK +   +L      NL  +P + +L+     L  +Q  +  LK ++ ++ + YD+++ID PP++ ++    L+  +   +P + + +A  GL  ++   K  +   N  + I  I  T  +TR  +  ++++Q
  S:     8 VNQKGGVGKTTSAINLGAYLALAGKKTLLVDFDPQGNMSSGLGLARG---LTVYDLLAGKAHINSVLRTTPVHNLFAIPASIDLSGATVELVDEQDRELYLKKILAEVKDTYDFILIDCPPSLGILTLNGLAAANEVFIPLQCEYFALEGLTLLLQTVKRVQSGLNTALSIGGIFFTMYDTRTKLAQEVVKQ 196
>gi|154505283|ref|ZP_02042021.1| hypothetical protein RUMGNA_02797 [Ruminococcus gnavus ATCC 29149] >gi|153794481|gb|EDN76901.1| hypothetical protein RUMGNA_02797 [Ruminococcus gnavus ATCC 29149] (224 aa)
Score = 221, Expect = 2.1e-16, Identities = 55/181 (30%), Positives = 99/181 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGK-KPDDLEFAIMDFL-----KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVN 183
           I + N KGGV+KTT + NL   L+ +GKKV+++D D QG++ A+ G  +PD+L   +   +     + +   ED ++   EN+ +LP N EL+  +  +      +  +K  I+ +   YDY++ID  P++ ++    L   D  L+P +       GL+++I      K++ N  + I A+  KV+
  S:    18 ISITNQKGGVVKTTTTVNLGIGLAREGKKVLLIDADPQGSLTASLGYVEPDELGVTLATIMTKVINEDEISEEDGILHHQENVDLLPANIELSTLEVTMGNVMSREMIMKEYIDTIRFRYDYILIDCLPSLGMMTINALVSSDSVLIPVQAAYLPVKGLQQLIKTISMVKKRLNRKLTIEALQWKVS 204
>gi|25029498|ref|NP_739552.1| putative chromosome partitioning protein ParA [Corynebacterium efficiens YS-314] >gi|23494787|dbj|BAC19752.1| putative chromosome partitioning protein ParA [Corynebacterium efficiens YS-314] (310 aa)
Score = 221, Expect = 2.1e-16, Identities = 67/228 (29%), Positives = 117/228 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDF---LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHN---DIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPI 230
           I + N KGGV KTT + NLA+SL++ G+KV++VDLD QGN     G +      +  + L G+C  E+ +   T  ENL  +P   +L   +     L +++   ++   L    +  +DYV+ID PP++ ++    ++ V   L+P + + YA  G+ +++N     ++  N  + I AI       +T+H+   ++ EQ      +  G  V    I  + K + A GY +  I
  S:    39 ITIANQKGGVGKTTSTVNLASSLAIYGQKVLVVDLDPQGNASTALGVEHRSGTLSSYELLIGECTAEEAMQPTTAHENLFCIPATLDLAGAEIELVSLVRREYRLADALGLEFITEHGFDYVLIDCPPSLGLLTINAMTAVTEVLIPIQCEYYALEGVGQLLNNITMLRQHLNRELHISAI------LLTMHDARTNLAEQVATEVNEHFGAVVLQTKIPRSVKVSEAPGYGQTVI 268
>gi|58617652|ref|YP_196851.1| sporulation initiation inhibitor protein soj [Ehrlichia ruminantium str. Gardel] >gi|58417264|emb|CAI28377.1| Sporulation initiation inhibitor protein soj [Ehrlichia ruminantium str. Gardel] (260 aa)
Score = 221, Expect = 2.2e-16, Identities = 71/248 (28%), Positives = 121/248 (48%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           G+VN KGGV KTT S NLA + ++  KK +++DLD QGN    FG         + + L         +IK +  NL +LP   +L+  +  L Q Q  +  LK  + ++   YDY+ ID PP++ ++    L   +  ++P + + +A  GL  +I   +  K+  N ++ I  I   +  +    ++ +E+ ++  LK + VY T   I    + + A  + + P ++  FK      Y  L KEIL
  S:    11 GIVNQKGGVGKTTTSINLATAFAIVNKKTLLIDLDPQGNSSTGFGITYQQRTNTVYEVLINNIPTSSAIIKTEIPNLDLLPSTVDLSAAEVELTQVQKREFVLKNSLLEIKTSYDYIFIDCPPSLGLLTVNALIAANAVIIPLQCEFFALEGLSHLIKTIELIKKHLNPSLSIEGIILTMYDKRNKLSEQVEEDIRKYLK-ESVYKT--VIPRNVRLSEAPSHGK-PAIIYDFKCAGSQAYIYLAKEIL 255
>gi|113972261|ref|YP_736054.1| chromosome segregation ATPase [Shewanella sp. MR-4] >gi|114049510|ref|YP_740060.1| chromosome segregation ATPase [Shewanella sp. MR-7] >gi|113886945|gb|ABI40997.1| Cobyrinic acid a,c-diamide synthase [Shewanella sp. MR-4] >gi|113890952|gb|ABI45003.1| Cobyrinic acid a,c-diamide synthase [Shewanella sp. MR-7] (262 aa)
Score = 221, Expect = 2.2e-16, Identities = 58/193 (30%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L  +  ++DI++K T   + ++  N ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + +A  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYELLVEEKPFDDIVVKDTTGKYDLIASNGDVTAAEIKLMEFFAREVRLRNALAPIKDQYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAVVNPGLGIEGILRTMYDPRNRLSNDVSDQ 199
>gi|77457797|ref|YP_347302.1| cobyrinic acid a,c-diamide synthase [Pseudomonas fluorescens PfO-1] >gi|77381800|gb|ABA73313.1| Cobyrinic acid a,c-diamide synthase [Pseudomonas fluorescens PfO-1] (262 aa)
Score = 221, Expect = 2.2e-16, Identities = 59/182 (32%), Positives = 93/182 (51%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGK------CYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINK----LDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
            V N KGGV KTT S  LA  L+  GK+V++VDLD  G++ + FG  PD LE +  D    K         + +L    E + +LP +  L      L ++   QS L ++I K    L + +DY IID+PP + V++   L+     ++P + +  A  GL+R++N            +    +PT  + R
  S:     5 AVANQKGGVGKTTSSIALAGLLAEAGKRVVVVDLDPHGSMTSYFGYDPDSLEHSNYDLFLHKGGVPQGLPGQLLLSTSDERISLLPSSTALA----TLERQSPGQSGLGLVIAKSLAQLWQDFDYAIIDSPPLLGVLMVNALAASQQLVIPVQTEHLAVKGLERMVNTLAMINRSRKQALPFSIVPTLFDRR 192
>gi|194334687|ref|YP_002016547.1| Cobyrinic acid ac-diamide synthase [Prosthecochloris aestuarii DSM 271] >gi|194312505|gb|ACF46900.1| Cobyrinic acid ac-diamide synthase [Prosthecochloris aestuarii DSM 271] (265 aa)
Score = 221, Expect = 2.2e-16, Identities = 68/250 (27%), Positives = 126/250 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK-PKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT S N+AAS+++   + +++D+D Q N  + FG +  D++E      + +G    + I   K E L ++P N  L   +  L   Q  +  ++  +  + + YDY+IID PP++ ++   +L+  D  L+P + + YA  GL +++N     ++  N  ++I  +  T  ++R+ +   + E+  K  K K    Y+  N   S   S        +P ++   +S    +Y +L +EI N
  S:     5 IAIANQKGGVGKTTTSVNIAASIAISEFRTLLIDIDPQANATSGFGLETEDEIENTFYHVMVQGGDIKDAIRPSKLEYLDVVPSNVNLVGMEVELVNMQEREYVMQKALKGVRDNYDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPRLEIEGVLLTMFDSRLRLAGQVAEEVKKFFKDKVYKTYIRRNVRLSEAPSHG------LPALLYDAQSLGSKDYLDLAQEIFN 252
>gi|163787909|ref|ZP_02182355.1| regulator protein; cell division inhibitor [Flavobacteriales bacterium ALC-1] >gi|159876229|gb|EDP70287.1| regulator protein; cell division inhibitor [Flavobacteriales bacterium ALC-1] (255 aa)
Score = 221, Expect = 2.3e-16, Identities = 59/196 (30%), Positives = 102/196 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLK-GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S NLAASL    KKV+++D D Q N  +  G   D +E      L+  K   E I+     N+ ++P + +L   +  L  K   +  LK  +  L   YDY++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N  + I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTSVNLAASLGALEKKVLLIDADPQANASSGLGIDVDAVEIGSYQVLEHTKPAKEAIVASNAPNVDVIPAHIDLVAIEIELVDKDEREYMLKKAVVDLKSEYDYILIDCAPSLGLLTLNALTASDSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNEALDIEGLLLTMFDSRLRLSNQVVEEVQK 202
>gi|148550145|ref|YP_001270247.1| cobyrinic acid a,c-diamide synthase [Pseudomonas putida F1] >gi|148514203|gb|ABQ81063.1| Cobyrinic acid a,c-diamide synthase [Pseudomonas putida F1] (257 aa)
Score = 221, Expect = 2.3e-16, Identities = 62/211 (29%), Positives = 111/211 (52%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + +++DLD Q N      G   +D+   I DF K         K    DI     +NLH++    EL      L  K    + L+ L+++LD+ Y+ + IDTPPA++    + L   D  L+PF+ D ++   L  ++   ++ KE +N ++ +  I   +  +R ++   ++++ L   L    VY+ S+
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSANEGYRTLLIDLDAQANSTQYLTGLTGEDIPMGIADFFKQSLSSGPFSKKNKVDIYETPFDNLHVVTATAELADLQPKLEAKHKI-NKLRKLLDELDQDYERIYIDTPPALNFYAVSALIAADRVLIPFDCDSFSRQALYGLLAEIEDLKEDHNEDLVVEGIVVNQFQSRASLPQQMLDELLAEGLPVLPVYLGSS 220
>gi|167629162|ref|YP_001679661.1| cobyrinic acid a,c-diamide synthase, putative [Heliobacterium modesticaldum Ice1] >gi|167591902|gb|ABZ83650.1| cobyrinic acid a,c-diamide synthase, putative [Heliobacterium modesticaldum Ice1] (253 aa)
Score = 221, Expect = 2.3e-16, Identities = 67/249 (26%), Positives = 122/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + N++A L+  GK V++VD+D QGN  +  G     +   I D L        IL K   E   +LP   +L   +  L      +  L+  ++ +   +DY+IID PP++ ++   +L+  D  L+P + + YA  GL ++++  K  ++  N  + I+ +  T  + R  +   ++++ +K     +   V    I    + + A  + + PI++   +S+  + Y  L KE+L
  S:     5 IAVANQKGGVAKTTTAVNVSACLAELGKNVLLVDMDPQGNATSGSGIDKLRVRHCIYDVLINGAPSTSILTKTDWERFFVLPATIQLAGAEIELVSAISREVKLRRALDPMRNRFDYIIIDCPPSLGLLTLNSLTAADQLLIPIQCEYYALEGLGQLMSTIKLVQKHLNSELTILGVLLTMFDARTNLAIQVVDE-VKNHFHDK---VFKTIIPRNVRLSEAPSHGQ-PIIVYDTRSRGAEVYRELAKEVL 250
>gi|73667541|ref|YP_303557.1| chromosome segregation ATPase [Ehrlichia canis str. Jake] >gi|72394682|gb|AAZ68959.1| chromosome segregation ATPase [Ehrlichia canis str. Jake] (255 aa)
Score = 220, Expect = 2.4e-16, Identities = 70/248 (28%), Positives = 121/248 (48%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
            +VN KGGV KTT S NL+ + S+  KK +++DLD QGN    FG   +     + + L         ++  +  NLH+LP   +L+  +  L Q Q  +  LK  ++++   YDY+ ID PP++ ++    L   D  ++P + + +A  GL  +I   +  K+  N  + I  I   +  +    ++ +E+ ++  LK + VY T   I    + + A  + + P ++  FK      Y  L KEIL
  S:     6 AIVNQKGGVGKTTTSINLSTAFSIVNKKTLLIDLDPQGNSSTGFGITYEQRTNTVYEVLINNLPISSAVVTTEIPNLHLLPSTVDLSAAEVELTQVQQREFILKKSLSEVKNSYDYIFIDCPPSLGLLTVNALIAADSIMIPLQCEFFALEGLSHLIKTIEIVKKHLNPLLSIEGIILTMYDKRNKLSEQVEEDIRKYLK-ESVYKT--VIPRNVRLSEAPSHGK-PAIIYDFKCAGSQAYIYLAKEIL 250
>gi|108763547|ref|YP_635580.1| ParA family protein [Myxococcus xanthus DK 1622] >gi|108467427|gb|ABF92612.1| ParA family protein [Myxococcus xanthus DK 1622] (283 aa)
Score = 220, Expect = 2.4e-16, Identities = 72/249 (28%), Positives = 125/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQ--GVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLAASL+   ++ ++VD+D QGN  +  G K D++   I +  L  +   E +   +   L ++P   +L   +  L  +   +  L+  +  L   YDY+IID PP++ ++    L+  D  L+P + + YA  GL ++ +     K+  N ++K+  I  T  ++R  I + ++E+ ++   K Q   V V  N   S   S         PI++   KSK  + Y  L +E++
  S:    25 ICISNQKGGVGKTTTAINLAASLASAERRTLLVDMDPQGNAGSGLGIKQDNITGTIYEALLNDRPIQELLHPTELRYLQVVPATPDLTGAEVELVNQDNREFRLRDALRPLAAEYDYIIIDCPPSLGLLTLNALAAADSVLIPLQCEYYALEGLSQLTHTIDLVKQGLNPDLKMEGILLTMFDSRANIAHQVVEE-VRGYFKKQVFEVIVPRNVRLSECPSFGK------PIILYDIKSKGCESYLALGRELM 270
>gi|28209873|ref|NP_780817.1| chromosome partitioning protein parA [Clostridium tetani E88] >gi|28202308|gb|AAO34754.1| chromosome partitioning protein parA [Clostridium tetani E88] (264 aa)
Score = 220, Expect = 2.4e-16, Identities = 74/249 (29%), Positives = 127/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-------ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKV-NTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I V N KGGV KTT + NL + L ++G KV+ +D+D QGN  +  G   + L  ++ D L       DI I++T        NL+++P N +L   +  +   +  +S LK  I K+ + +D+V ID PP++  +    L      LVP + + YA  G+ ++IN  +  K+  N ++++  +   + + R  + +++  + +K   K +   VT   I    K   A  +  +PI +   K K  + Y NL KE L
  S:     9 ISVFNQKGGVGKTTTNINLCSYLCMEGYKVLAIDVDPQGNTTSGLGIDKNSLATSMYDLLT-----SDIDIRETIITCELLNNLYLIPSNLDLAGAEVEIINLKHRESILKNKIEKIKDEFDFVFIDCPPSLGFLTLNALVASHSVLVPMQCEYYALEGVGQLINTVQLVKKSLNQHLELEGVIVNMFDGRTKLSSEVFSE-IKKYFKDKVFDVT---IPRNVKLAEAPSFG-LPIALYDDKCKGAEAYKNLTKEFL 255
>gi|170699464|ref|ZP_02890507.1| Cobyrinic acid ac-diamide synthase [Burkholderia ambifaria IOP40-10] >gi|170135613|gb|EDT03898.1| Cobyrinic acid ac-diamide synthase [Burkholderia ambifaria IOP40-10] (259 aa)
Score = 220, Expect = 2.7e-16, Identities = 56/191 (29%), Positives = 96/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  +  + + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACESTVYEVLIDGVSVTDARVRPEGVTYDVLPANRELSGAEIELIGIDNRERRLKAALEHVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|121608053|ref|YP_995860.1| cobyrinic acid a,c-diamide synthase [Verminephrobacter eiseniae EF01-2] >gi|121552693|gb|ABM56842.1| chromosome segregation ATPase [Verminephrobacter eiseniae EF01-2] (259 aa)
Score = 220, Expect = 2.7e-16, Identities = 52/191 (27%), Positives = 95/191 (49%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  G++V++VD+D QGN     G     L   + D L      ++  +       +L  N EL   +  L   +  +  LK+ +  +D  YD+V++D PP++S++    L      +VP + + +A  GL  ++N  ++     N +++I+  +    + R T+   + +Q
  S:     7 IANQKGGVGKTTTTVNLAAGLARVGQRVLMVDMDPQGNATMGSGVDKRQLALTVYDVLLESASVQEASVASPCGYRVLGANRELAGAEVELVALEQREKRLKVALAAVDAEYDFVLVDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLSDLVNTIRQVHANLNADLQIIGLLRVMFDPRTTLQQQVSDQ 198
>gi|153813036|ref|ZP_01965704.1| hypothetical protein RUMOBE_03444 [Ruminococcus obeum ATCC 29174] >gi|149830838|gb|EDM85928.1| hypothetical protein RUMOBE_03444 [Ruminococcus obeum ATCC 29174] (258 aa)
Score = 220, Expect = 2.8e-16, Identities = 75/251 (29%), Positives = 121/251 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYW-----EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-------------PTKVNTRVTIHND--IIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT + NL A L   GK+V++VD D QG++    G  P +L+  +   ++          ++ ++   E + ++P N  L   D  L   +  +  LK  +  L + YDY++ID  P++ ++    LS  D  L+P +P  YA  GL  ++   K   ++ N +++I  I               K   + T  ND  I EQ++ P+                T+S A    E V I     KSK  D Y  L +E+L +
  S:     5 IAIANQKGGVAKTTTTINLGAGLVKSGKRVVLVDADPQGHLTMGLGF-PKNLKVTLKSMIENIIMGLEFDPKEAILHHEEGVDLIPSNKLLAGMDMSLFTVEDREKVLKEYLELLKDEYDYILIDCMPSLGMLTINALSAADSVLIPVQPQYYAADGLMELLKMVKGIHQRFNPDLQIEGILFTMDNCRYNNAKRNKQAIKTTYGNDIKIFEQTI-PR----------------TESLAETASEGVSIFAYDGKSKGADSYLELVQEVLKH 257
>gi|91223567|ref|ZP_01258832.1| Soj-like protein [Vibrio alginolyticus 12G01] >gi|91191653|gb|EAS77917.1| Soj-like protein [Vibrio alginolyticus 12G01] (259 aa)
Score = 220, Expect = 2.8e-16, Identities = 53/181 (29%), Positives = 91/181 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           V N KGGV KTT +  LA  LS  G +V++VD D   ++    G  PD +  ++ D  + K +  +     IL  + E + I+P +  L   D ++  +      LK  +  + + YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R++      ++      K+  +PT  + R
  S:     6 VANQKGGVGKTTSTVTLAGLLSQKGHRVLMVDTDPHASLTTYLGYDPDAVTSSLFDLFQLKTFSRETVKPLILETELEGMDIIPAHMSLATLDRVMGNRSGMGLILKRALQTVSQDYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMMRTLTIMQKSRPGGFKVTIVPTMYDKR 191
>gi|160944282|ref|ZP_02091511.1| hypothetical protein FAEPRAM212_01791 [Faecalibacterium prausnitzii M21/2] >gi|158444464|gb|EDP21468.1| hypothetical protein FAEPRAM212_01791 [Faecalibacterium prausnitzii M21/2] (292 aa)
Score = 220, Expect = 2.9e-16, Identities = 66/251 (26%), Positives = 116/251 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           + + N KGGV KTT + NL++ ++  GKKV+IVDLD QGN    +G     +E    + L GK      +        ++  N  L      +      +  L+  + ++ + YD++ ID PP++ ++    LS  D  L+P + + YA  GL  +I+  K  ++K N  + I  +   V T  ++  ++  Q ++   K  G  V    I  + + + A  Y + PI     K K  + Y +L  E + +
  S:    20 VAIANQKGGVGKTTTAVNLSSCVAALGKKVLIVDLDPQGNTTTGYGIPKRSVEAGTYEVLIGKATAAQAIRHTEYRTDVIGSNTRLAGASLEMIDLPGREGRLRKALAEVQKDYDFIFIDCPPSLDLLTLNGLSACDSVLIPVQCEYYALEGLSELISTLKTIRKKYNPYLDIEGV---VFTMFSLRYNLTVQVVEQVQKYFGSKVYKTTIPRSIRISEAPSYGQ-PINFYEPKGKGSEAYMDLAIEFVKH 266
>gi|160946576|ref|ZP_02093779.1| hypothetical protein PEPMIC_00534 [Peptostreptococcus micros ATCC 33270] >gi|158446960|gb|EDP23955.1| hypothetical protein PEPMIC_00534 [Peptostreptococcus micros ATCC 33270] (264 aa)
Score = 220, Expect = 3.0e-16, Identities = 56/176 (31%), Positives = 99/176 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I V N KGGV KTT   NLAA+L  + KKV+++D+D QGN  +T G   +D E +I + L  +    D + K K++N+ I+P N +L   +  L      +  LK  I+K+ + YD++++D PP++S++    L      L+P + + YA  G+ +++N     ++  N  +++  +
  S:    16 ISVFNQKGGVGKTTTVVNLAAALGFNKKKVLVIDMDPQGN--STSGLGVEDTELSIYEVLTHEKNINDTIQKTKSKNVDIIPANSDLCGLEIELLSVDKREYLLKSEIDKIPQNYDFILVDCPPSLSILSINALVASQSVLIPIQCEYYALEGVSQLMNTVNIIRKGLNPELEVEGV 190
>gi|149279994|ref|ZP_01886119.1| regulator protein; cell division inhibitor [Pedobacter sp. BAL39] >gi|149229191|gb|EDM34585.1| regulator protein; cell division inhibitor [Pedobacter sp. BAL39] (267 aa)
Score = 220, Expect = 3.0e-16, Identities = 73/249 (29%), Positives = 129/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDI----LIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT S NLAASL++   + ++VD D Q N  +  G  P  ++ +I +     C   DI     I+KTE  NL +LP + +L   +  +      +  +K ++ K+ + YD++IID  P++ ++    L+  D  ++P + + +A  GL +++N  K  + + N  ++I  I  T  + R+ + N ++E+ +K   +     V    I   T+ + A  Y  V ++M     K    Y NL +EI+
  S:     5 IALANQKGGVGKTTSSINLAASLAVLEYRTLLVDADPQANSTSGIGFDPRSIKNSIYE-----CIINDIEPTDAIQKTETPNLDLLPAHIDLVGAEIEMINLTNREYKMKAVLEKIKDQYDFIIIDCSPSLGLITINALTAADSVIIPVQCEYFALEGLGKLLNTIKIVQNRLNTELEIEGILLTMYDVRLRLSNQVVEE-VKTHFQE---LVFETIIQRNTRLSEAPSYG-VSVIMHDANCKGAINYLNLAREIV 250
>gi|160944486|ref|ZP_02091714.1| hypothetical protein FAEPRAM212_01996 [Faecalibacterium prausnitzii M21/2] >gi|158444268|gb|EDP21272.1| hypothetical protein FAEPRAM212_01996 [Faecalibacterium prausnitzii M21/2] (278 aa)
Score = 219, Expect = 3.3e-16, Identities = 63/249 (25%), Positives = 122/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG-KKPDDLEFAIMDFLKGKCYWEDI-----LIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVF----KSKYQDEYHNLKKEIL 251
           I +VN KGG  KTT   NL   L+++GKKV++VD D QG++  + G ++PD+L   +   +      + I     ++  TE + ++P N EL   +  L      +  LK ++      YD++++D  P++ ++    L+  D  L+P +    +  GL++++   ++ + + N  +KI  I   +    T +   I+  ++      G Y +   +   T   +    E   +  S+F    K K  + Y +L KE++
  S:    11 IAIVNQKGGTGKTTTCENLGIGLAMEGKKVLLVDADPQGSLTISMGWQQPDELPTTLSTLIAKAMNDQSIPPGEGVLHHTEGVDLIPANIELAGLEVSLVNCMNREKMLKQVLEGAKHEYDFILLDCTPSLGMLTVNALAAADTTLIPVQAQYLSAKGLEQLLQTVQKVRRQINPRLKIEGILLTMTDSRTNYGQQIDNLIR------GAYGSKIKVFDQTIPRSVRAAEISAVGKSIFQHDPKGKVAEAYRSLTKEVM 263
>gi|194099970|ref|YP_002003109.1| putative parA family protein - putative ATPase [Neisseria gonorrhoeae NCCP11945] >gi|193935260|gb|ACF31084.1| putative parA family protein - putative ATPase [Neisseria gonorrhoeae NCCP11945] (257 aa)
Score = 219, Expect = 3.3e-16, Identities = 57/193 (29%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT + NLAASL+  GK+V++VDLD QGN     G     L+  +   L G    +   ++  E  + +L  N  L   +  L Q+   +  LK  +  + E YD+++ID PP+++++    L      +VP   + YA  G+  +I   ++ ++  N ++ I  I  T  ++R  +  ++ EQ
  S:     6 LAIANQKGGVGKTTTTVNLAASLASRGKRVLVVDLDPQGNATTGSGIDKAGLQSGVYQVLLGDADVQSAAVRSKEGGYAVLGANRALAGAEIELVQEIAREVRLKNALKAVAEDYDFILIDCPPSLTLLTLNGLVAAGGVIVPMLCEYYALEGISDLIATVRKIRQAVNPDLDITGIVRTMYDSRSRLVAEVSEQ 200
>gi|59802109|ref|YP_208821.1| putative parA family protein - putative ATPase [Neisseria gonorrhoeae FA 1090] >gi|59719004|gb|AAW90409.1| putative parA family protein - putative ATPase [Neisseria gonorrhoeae FA 1090] (257 aa)
Score = 219, Expect = 3.3e-16, Identities = 57/193 (29%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT + NLAASL+  GK+V++VDLD QGN     G     L+  +   L G    +   ++  E  + +L  N  L   +  L Q+   +  LK  +  + E YD+++ID PP+++++    L      +VP   + YA  G+  +I   ++ ++  N ++ I  I  T  ++R  +  ++ EQ
  S:     6 LAIANQKGGVGKTTTTVNLAASLASRGKRVLVVDLDPQGNATTGSGIDKAGLQSGVYQVLLGDADVQSAAVRSKEGGYGVLGANRALAGAEIELVQEIAREVRLKNALKAVAEDYDFILIDCPPSLTLLTLNGLVAAGGVIVPMLCEYYALEGISDLIATVRKIRQAVNPDLDITGIVRTMYDSRSRLVAEVSEQ 200
>gi|15642061|ref|NP_231693.1| ParA family protein [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586921|ref|ZP_01676701.1| ParA family protein [Vibrio cholerae 2740-80] >gi|121727375|ref|ZP_01680514.1| ParA family protein [Vibrio cholerae V52] >gi|147675595|ref|YP_001217588.1| ParA family protein [Vibrio cholerae O395] >gi|153213692|ref|ZP_01948944.1| ParA family protein [Vibrio cholerae 1587] >gi|153222239|ref|ZP_01953018.1| ParA family protein [Vibrio cholerae MAK 757] >gi|153819540|ref|ZP_01972207.1| ParA family protein [Vibrio cholerae NCTC 8457] >gi|153821691|ref|ZP_01974358.1| ParA family protein [Vibrio cholerae B33] >gi|153826079|ref|ZP_01978746.1| ParA family protein [Vibrio cholerae MZO-2] >gi|153828894|ref|ZP_01981561.1| ParA family protein [Vibrio cholerae 623-39] >gi|183179701|ref|ZP_02957912.1| ParA family protein [Vibrio cholerae MZO-3] >gi|194531909|ref|YP_002067347.1| ParA family protein [Vibrio cholerae MO10] >gi|194536769|ref|YP_002071924.1| ParA family protein [Vibrio cholerae V51] >gi|9656607|gb|AAF95207.1| ParA family protein [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548857|gb|EAX58900.1| ParA family protein [Vibrio cholerae 2740-80] >gi|121630267|gb|EAX62665.1| ParA family protein [Vibrio cholerae V52] >gi|124115753|gb|EAY34573.1| ParA family protein [Vibrio cholerae 1587] >gi|124119099|gb|EAY37842.1| ParA family protein [Vibrio cholerae MAK 757] >gi|125617863|gb|EAZ46414.1| ParA family protein [Vibrio cholerae MO10] >gi|125621382|gb|EAZ49718.1| ParA family protein [Vibrio cholerae V51] >gi|126509907|gb|EAZ72501.1| ParA family protein [Vibrio cholerae NCTC 8457] >gi|126520789|gb|EAZ78012.1| ParA family protein [Vibrio cholerae B33] >gi|146317478|gb|ABQ22017.1| ParA family protein [Vibrio cholerae O395] >gi|148875600|gb|EDL73735.1| ParA family protein [Vibrio cholerae 623-39] >gi|149740196|gb|EDM54349.1| ParA family protein [Vibrio cholerae MZO-2] >gi|183013112|gb|EDT88412.1| ParA family protein [Vibrio cholerae MZO-3] (258 aa)
Score = 219, Expect = 3.3e-16, Identities = 60/218 (27%), Positives = 105/218 (48%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLK---PKLKTQGVYVTSNFISSTTKSTAA 222
           V N KGGV KTT +  LA  LS  GK+V++VD D   ++    G   D +  ++ D  + + Y E      IL    + + ++P +  L   D ++  +      LK  +  L  +YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R++      ++  +   K+  +PT  + R       + Q  K    K+ T  V + + F  ++ +   A
  S:     6 VANQKGGVGKTTTTITLAGLLSQQGKRVLLVDTDPHASLTTYLGYDSDGVPASLFDLFQLREYNEASVKPLILNTDIQGIDLIPAHMSLATLDRVMGNRSGMGLILKRALLALRHVYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMVRTLAIMQKSRSREFKVTIVPTMYDKRTRASLQTLNQLKKDYPDKVWTSAVPIDTKFRDASLQRLPA 231
>gi|19552637|ref|NP_600639.1| ATPase involved in chromosome partitioning [Corynebacterium glutamicum ATCC 13032] >gi|62390305|ref|YP_225707.1| putative chromosome partitioning ATPase protein [Corynebacterium glutamicum ATCC 13032] >gi|41325642|emb|CAF21431.1| PUTATIVE CHROMOSOME PARTITIONING ATPASE PROTEIN [Corynebacterium glutamicum ATCC 13032] (290 aa)
Score = 219, Expect = 3.6e-16, Identities = 64/252 (25%), Positives = 126/252 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + NL A L+  G+KV++VDLD QG + A  G   DD++  + D +       D  I  T   +L ++P N +L+  +  L  +   +  L   +  + + YD++I+D  P++ ++    L+     ++P E + ++  GL  + +  ++  ++ N +++I+ I   +  R T H     + +   ++     V    I+ T +   T+  G    PI+     S+  ++Y +L +E+++ V
  S:    39 IAMANQKGGVGKTTSTINLGACLAEAGRKVLLVDLDPQGALTAGLGIHYDDVDITVYDLMVDNNSTIDQAIHHTGLPDLDVVPANIDLSAAEIQLVNEVGREQTLARALRPVMKDYDFIILDCQPSLGLLTVNALACAHGVIIPMECEYFSLRGLALLTDTVEKVADRLNFDLEILGILVTMFDRRTSH---AREVMSRVVEVFDEKVFDTVITRTVRFPETSVAGE---PIITWAPTSQGAEQYRSLAREVISRV 288
>gi|32265921|ref|NP_859953.1| ATPase involved in chromosome partitioning ParA [Helicobacter hepaticus ATCC 51449] >gi|32261970|gb|AAP77019.1| ATPases involved in chromosome partitioning ParA [Helicobacter hepaticus ATCC 51449] (261 aa)
Score = 219, Expect = 3.6e-16, Identities = 60/193 (31%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAA L+   K V+I+D D Q N   +FG + + +E  +   L G      I++K    NL I P N  L   +     K   +    +L  K++E+   YD+++ID+PPA+  +    L+  D  +VP + + +A  GL +++N  K  K+  N  + I   +PT  + +  +   + E+
  S:     5 ITIANQKGGVGKTTTTVNLAAFLASANKSVLIIDYDPQANATTSFGIRRNKIESDMYHVLTGSKKLSQIILKTDIPNLDIAPSNIGLAGIEKEFYNKNNIKGRELLLSKKIEEIKNQYDFIVIDSPPALGSLTVNALAAADSVIVPIQCEFFALEGLAQLLNTIKLLKDTINPRLSIKGFLPTMYSGQHNLSRQVFEE 202
>gi|145295555|ref|YP_001138376.1| hypothetical protein cgR_1482 [Corynebacterium glutamicum R] >gi|140845475|dbj|BAF54474.1| hypothetical protein [Corynebacterium glutamicum R] (290 aa)
Score = 219, Expect = 3.7e-16, Identities = 64/252 (25%), Positives = 126/252 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + NL A L+  G+KV++VDLD QG + A  G   DD++  + D +       D  I  T   +L ++P N +L+  +  L  +   +  L   +  + + YD++I+D  P++ ++    L+     ++P E + ++  GL  + +  ++  ++ N +++I+ I   +  R T H     + +   ++     V    I+ T +   T+  G    PI+     S+  ++Y +L +E+++ V
  S:    39 IAMANQKGGVGKTTSTINLGACLAEAGRKVLLVDLDPQGALTAGLGIHYDDVDITVYDLMVDNNSTIDQAIHHTGVPDLDVVPANIDLSAAEIQLVNEVGREQTLARALRPVMKDYDFIILDCQPSLGLLTVNALACAHGVIIPMECEYFSLRGLALLTDTVEKVADRLNFDLEILGILVTMFDRRTSH---AREVMSRVVEVFDEKVFDTVITRTVRFPETSVAGE---PIITWAPTSQGAEQYRSLAREVISRV 288
>gi|112789943|gb|ABI21614.1| Smu17A [uncultured organism] (305 aa)
Score = 219, Expect = 3.7e-16, Identities = 52/188 (27%), Positives = 100/188 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE--NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHN 190
           + + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P +L+  + + L  +    D ++ KT    + +LP N +L+  +  L  +   +S L+  +  L   YDYV+ID  P++ ++    L+     +VP E + +A  G+  +    ++ +E+ N ++++  I   +    T+H+
  S:    53 VAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGVNPMELDITVYNLLMERGLAADEVLLKTAVPGMDLLPSNIDLSAAEVQLVSEVARESALQRALKPLLADYDYVVIDCQPSLGLLTVNALTAATSVIVPLECEFFALRGVALLTETIEKVRERLNPDLELDGILATMYDSRTVHS 242
>gi|56461728|ref|YP_157009.1| Soj family ATPase [Idiomarina loihiensis L2TR] >gi|56180738|gb|AAV83460.1| ATPase involved in chromosome partitioning, Soj/ParA family [Idiomarina loihiensis L2TR] (263 aa)
Score = 219, Expect = 3.7e-16, Identities = 58/193 (30%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAAS++   +KV+++DLD QGN     G    D+E  I + L  +    D+ +K T    H++  N +    +  L +    +  L+  +  + + YDY+ ID PP+++++    ++  D  LVP + + YA  GL  ++   ++  +  N  ++I  I  T  + R  + ND+ EQ
  S:     5 IAIANQKGGVGKTTTAVNLAASMAATRRKVLLIDLDPQGNATMGSGVDKYDVENTIYELLIEEKPVGDVAVKDTNGKYHLIAANADATAAEIKLMEVFARELRLRNALKAVQDSYDYIFIDCPPSLNMLTVNGMAAADSILVPMQCEYYALEGLTALMETIRQLADVVNPGLEIEGILRTMYDPRNRLANDVSEQ 199
>gi|114778767|ref|ZP_01453577.1| ATPase, ParA family protein [Mariprofundus ferrooxydans PV-1] >gi|114551018|gb|EAU53581.1| ATPase, ParA family protein [Mariprofundus ferrooxydans PV-1] (255 aa)
Score = 219, Expect = 3.7e-16, Identities = 64/193 (33%), Positives = 103/193 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF----GKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQ 195
           + V N KGGV KT+ + NLA   S  G++V++ DLD QG          GK+PD L       L+GK   E+I +K T  +NL +LP +  + + D LL+  + +Q  L+ +++ L   YD VI+D PP  +++        D+ +VP  P   +   LK++I+     KE +   ++I A    V+ R  +H  I+ Q
  S:     4 LAVYNIKGGVGKTSTAVNLAWYASSQGQRVLLWDLDPQGASTYCLQVKPGKRPDRL-------LRGKVDAENI-VKPTLYDNLDLLPSDFSMRHADLLLHGMKKSQQQLQKILSPLSRDYDLVIMDCPPGFTLLSEAIFHAADMLIVPTLPSVLSLRMLKQVIDFK---KEHSIGKLRIRAFLNMVDRRKKLHLHILGQ 191
>gi|90421812|ref|YP_530182.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris BisB18] >gi|90103826|gb|ABD85863.1| chromosome segregation ATPase [Rhodopseudomonas palustris BisB18] (284 aa)
Score = 219, Expect = 3.7e-16, Identities = 67/249 (26%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL------YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + + N KGGV KTT + NL  +L+  G++V+IVDLD QGN     G    +   +  D L G+    D ++      LHI P   +L+  +  L   +     L+  I  L++       Y YV+ID PP+++++    ++  D  LVP + + +A  GL +++   ++ +   N N+ I  I   V T     N++  Q +    +  G  V    I    + + A  Y + P+++   K    + Y  L  E++
  S:    23 LALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRNRNCSTYDVLIGEAPLRDAVVPTAVPRLHIAPSTMDLSGLELELGATRDRAFRLRDAIAALNDNIAPPLDYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGI---VLTMFDSRNNLSNQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGK-PVLVYDLKCAGSEAYLKLATEVI 274
>gi|115350142|ref|YP_771981.1| cobyrinic acid a,c-diamide synthase [Burkholderia ambifaria AMMD] >gi|115280130|gb|ABI85647.1| chromosome segregation ATPase [Burkholderia ambifaria AMMD] (259 aa)
Score = 219, Expect = 3.7e-16, Identities = 56/191 (29%), Positives = 96/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT S NLAASL+   ++V+++DLD QGN     G      E  + + L       D  ++ +     +LP N EL+  +  L      +  LK  +  + + YD+V+ID PP +S++    L      ++P + + +A  GL  ++N  K+     N ++KI+  +    + R+T+   + +Q
  S:     7 VANQKGGVGKTTTSVNLAASLAAQEQRVLLIDLDPQGNATMGSGIDKAACESTVYEVLIDGVSVMDARVRPEGVTYDVLPANRELSGAEIELIGIDNRERRLKAALEHVADDYDFVLIDCPPTLSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVNTIKQVHANMNRDLKIIGLLRVMFDPRITLQQQVSDQ 199
>gi|194337450|ref|YP_002019244.1| Cobyrinic acid ac-diamide synthase [Pelodictyon phaeoclathratiforme BU-1] >gi|194309927|gb|ACF44627.1| Cobyrinic acid ac-diamide synthase [Pelodictyon phaeoclathratiforme BU-1] (265 aa)
Score = 219, Expect = 3.8e-16, Identities = 60/209 (28%), Positives = 111/209 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG----KKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK-PKLKTQGVYVTSN 211
           I + N KGGV KTT S N+AAS+++   + +++D+D Q N  + FG     + D+  + +M  +KG    + I     E L +LP N  L   +  L   +  +  ++  +  + +LYDY+IID PP++ ++   +L+  D  L+P + + YA  GL +++N     ++  N  ++I  +  T  + R+ + + + E+  K  K K    Y+  N
  S:     5 IAIANQKGGVGKTTTSVNIAASIAISEFRTLLIDIDPQANATSGFGLEIGDEIDNTFYQVM--VKGGNIQDAIKSSSLEYLDVLPSNVNLVGMEVELVNMREREYVMQKALKGVRDLYDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPKLEIEGVLVTMYDARLRLASQVAEEVKKFFKEKVYKTYIRRN 217
>gi|99082707|ref|YP_614861.1| chromosome segregation ATPase [Silicibacter sp. TM1040] >gi|99038987|gb|ABF65599.1| chromosome segregation ATPase [Silicibacter sp. TM1040] (270 aa)
Score = 219, Expect = 3.8e-16, Identities = 60/199 (30%), Positives = 107/199 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKL 201
           I + N KGGV KTT + NLAA+L  +G +V++VDLD QGN     G + DD E    D L  +     + I++T  E+L I+P N +L+  D  L  N+K+    +  +    + E  +DY++ID PP+++++    +      L+P + + +A  GL +++   +E ++  N  ++I  +   +  R    +  +EQ  +  L
  S:    13 IAIANQKGGVGKTTTAINLAAALVEEGMRVLLVDLDPQGNASTGLGVEVDDREHTTYDLLVEEAELSQV-IRETDLEDLCIVPANVDLSSADIELFSNEKRSFLLHDALRQPAMTEYDWDYILIDCPPSLNLLTVNAMVAAHSVLIPLQSEFFALEGLSQLMLTIREVRQAANPQLRIEGVVLTMYDRRNNLSQQVEQDARDNL 215
>gi|171057753|ref|YP_001790102.1| cobyrinic acid ac-diamide synthase [Leptothrix cholodnii SP-6] >gi|170775198|gb|ACB33337.1| Cobyrinic acid ac-diamide synthase [Leptothrix cholodnii SP-6] (255 aa)
Score = 219, Expect = 3.8e-16, Identities = 72/243 (29%), Positives = 125/243 (51%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIA-TFGKKPDDLEFAIMDFLKG--------KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYER-VPIVMSVFKSKYQDEY 243
           M+  V N KGGV K+T++ NLAA  +  G + +++DLD QGN      G   D LE ++ DF           K   E I     ENLH++P +  L+     L+ K  ++  +  L + LD L   YD + IDTPPA++    + L      L+PF+ D ++   L  +++  KE +  +N  +++  I   +   R ++   ++ +     L  +G+ V   ++SS+ K   +  +ER +P++    K K   E+
  S:     1 MRRVVFNQKGGVGKSTITANLAAISASQGLRTLVLDLDAQGNTTRYLLGNGADGLETSVADFFNQTLSFTFNPKNAGEFIYETPFENLHLMPSSPALDE----LHGKLESRYKIYKLRDALDALAANYDRIYIDTPPALNFYTRSALIASQRCLIPFDCDDFSRRALYALMDNVKEIQADHNRELQVEGIVVNQFQPRASLPQKVVAE-----LIAEGLPVLQPYLSSSVKMKES--HERALPMIHLDAKHKLTQEF 246
>gi|167626208|ref|YP_001676502.1| cobyrinic acid ac-diamide synthase [Shewanella halifaxensis HAW-EB4] >gi|167356230|gb|ABZ78843.1| Cobyrinic acid ac-diamide synthase [Shewanella halifaxensis HAW-EB4] (262 aa)
Score = 219, Expect = 3.8e-16, Identities = 56/193 (29%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   ++V+++DLD QGN     G     +E    + L  +  +ED++ + T   + ++ GN ++   +  L +    +  L+  +  + + YD++ ID PP+++++    +S  D  LVP + + YA  GL  +++   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRRVLLIDLDPQGNATMGSGIDKYTVENTAYELLVEEKPFEDVVCRDTTGKYDLIAGNGDVTAAEIKLMEFFAREVRLRNALAPIKDDYDFIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKLGAMVNSGLHIEGILRTMYDPRNRLSNDVSDQ 199
>gi|160895499|ref|YP_001561081.1| cobyrinic acid ac-diamide synthase [Delftia acidovorans SPH-1] >gi|160361083|gb|ABX32696.1| Cobyrinic acid ac-diamide synthase [Delftia acidovorans SPH-1] (256 aa)
Score = 219, Expect = 3.9e-16, Identities = 56/191 (29%), Positives = 97/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAA L+  G++V+++DLD QGN     G     LE ++ D  L+     E  +  +     +L  N EL+  +  L   +     LK  +  +D  YD+V++D PP++S++    L      +VP + + +A  GL  ++N  K+     N +++I+  +    + R T+   + +Q
  S:     7 VANQKGGVGKTTTAVNLAAGLAKVGQRVLMIDLDPQGNATMGSGVDKRALELSVYDVLLENASVKEAAVRSEAVGYDVLGANRELSGAEIELVTLERRNDRLKGALKAVDADYDFVLVDCPPSLSMLTLNGLCAAHGVVVPMQCEYFALEGLTDLVNTIKQVHANMNPDLQIIGLLRVMFDPRTTLQQQVSDQ 199
>gi|193212022|ref|YP_001997975.1| Cobyrinic acid ac-diamide synthase [Chlorobaculum parvum NCIB 8327] >gi|193085499|gb|ACF10775.1| Cobyrinic acid ac-diamide synthase [Chlorobaculum parvum NCIB 8327] (265 aa)
Score = 218, Expect = 4.0e-16, Identities = 56/196 (28%), Positives = 104/196 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKP-DDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT + N+AAS+++   K ++VD+D Q N  + FG +P D++E      +  G    + I     E L +LP N  L   +  L   +  +  ++  + ++ + YDY+IID PP++ ++   +L+  D  L+P + + YA  GL +++N     ++  N  ++I  +  T  + R+ +   + E+  K
  S:     5 IAIANQKGGVGKTTTAVNIAASIAISEFKTLLVDIDPQANATSGFGLEPGDEIENTFYHVMVNGGQIRDAIKSSSLEYLDVLPSNMNLVGMEVELVNMREREYVMQKALKQVKDQYDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPRLEIEGVLVTMFDARLRLATQVAEEVKK 203
>gi|152990971|ref|YP_001356693.1| chromosome partitioning protein, ATPase ParA [Nitratiruptor sp. SB155-2] >gi|151422832|dbj|BAF70336.1| chromosome partitioning protein, ATPase ParA [Nitratiruptor sp. SB155-2] (263 aa)
Score = 218, Expect = 4.0e-16, Identities = 59/173 (34%), Positives = 93/173 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG-KCYWEDILIKKTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           I + N KGGV KTT + NL+ASL+ +GK V+++D D Q N   + G   +D EF I   + G K   + IL    +NL + P N  L   +    N     +  LK  I+++   YDYVIID+PPA+  +    LS     ++P + + +A  GL +++N  +  ++  N  +KI
  S:     5 IAIANQKGGVGKTTTAVNLSASLAKEGKNVLLIDADPQANATTSLGYSRNDYEFNIYHVMIGTKKLSQIILDTDVDNLFLAPSNIGLVGIEKEFYNSGNKRELMLKEAISEIIAEYDYVIIDSPPALGPMTINALSAAHSVIIPIQCEFFALEGLAQLLNTIRLIRKTINPGLKI 179
>gi|77920729|ref|YP_358544.1| partition protein, Par-like [Pelobacter carbinolicus DSM 2380] >gi|77546812|gb|ABA90374.1| chromosome segregation ATPase [Pelobacter carbinolicus DSM 2380] (254 aa)
Score = 218, Expect = 4.1e-16, Identities = 51/176 (28%), Positives = 93/176 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI 178
           I + N KGGV KTT S NL+ASL++  K+ ++VDLD Q N  +  G   +++++     L G+     ++     E L +LP   +L   +  L  ++  ++ LK  +N++   +DY++ID PP++ ++    L+  D  LVP + + YA  GL ++       + + N  + +  I
  S:     5 IAIANQKGGVGKTTTSINLSASLAVAEKRTLLVDLDPQSNASSGVGIADENIQYTTYQALLGQVETSQVVTTTGIEFLKVLPSTTDLIGAEIELIGEEDRETRLKKALNQIRNDFDYILIDCPPSLGLLTINALTAADSVLVPLQCEYYAMEGLSQLTRTIDLIQRQLNPALSLCGI 181
>gi|146307820|ref|YP_001188285.1| cobyrinic acid a,c-diamide synthase [Pseudomonas mendocina ymp] >gi|145576021|gb|ABP85553.1| Cobyrinic acid a,c-diamide synthase [Pseudomonas mendocina ymp] (262 aa)
Score = 218, Expect = 4.3e-16, Identities = 64/185 (34%), Positives = 99/185 (53%)
  Q:     1 MKI-GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMD-FLKGKCYWEDI---LIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINK----LDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           MK+  V N KGGV KTT S  LA  L+  GK+V++VDLD  G++ + FG  PD LE +  D FL      + +   L+  T  EN+ +LP +  L      L ++   QS L ++I K    L E +D+ IID+PP + V++   L+     ++P + +  A  GL+R+I             +    +PT  + R
  S:     1 MKVWAVANQKGGVGKTTTSIALAGLLADAGKRVVVVDLDPHGSMTSYFGHDPDTLEHSCFDLFLHQGNVPQGLPRQLLHSTSHENISLLPSSTALA----TLERQSPGQSGLGLVIAKSLAQLWEDFDHAIIDSPPLLGVLMVNALAASQQLVIPVQTEFLAVKGLERMITTLAMINRSRKQALPYTIVPTLFDRR 192
>gi|120600844|ref|YP_965418.1| cobyrinic acid a,c-diamide synthase [Shewanella sp. W3-18-1] >gi|124547722|ref|ZP_01706568.1| Cobyrinic acid a,c-diamide synthase [Shewanella putrefaciens 200] >gi|146295045|ref|YP_001185469.1| cobyrinic acid a,c-diamide synthase [Shewanella putrefaciens CN-32] >gi|120560937|gb|ABM26864.1| Cobyrinic acid a,c-diamide synthase [Shewanella sp. W3-18-1] >gi|124508986|gb|EAY53072.1| Cobyrinic acid a,c-diamide synthase [Shewanella putrefaciens 200] >gi|145566735|gb|ABP77670.1| Cobyrinic acid a,c-diamide synthase [Shewanella putrefaciens CN-32] (262 aa)
Score = 218, Expect = 4.3e-16, Identities = 58/193 (30%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    D+E    + L     +++I++K T   + ++  N ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + +A  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYDVENTAYELLVEDKPFDEIVVKNTAGKYDLIASNGDVTAAEIKLMEFFAREIRLRNALAPIKDQYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAFVNPGLGIEGILRTMYDPRNRLSNDVSDQ 199
>gi|149190483|ref|ZP_01868754.1| ParA family protein [Vibrio shilonii AK1] >gi|148835737|gb|EDL52703.1| ParA family protein [Vibrio shilonii AK1] (257 aa)
Score = 218, Expect = 4.5e-16, Identities = 52/193 (26%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT   NLAAS++   +K++++DLD QGN     G     +E    D L  +  +E ++ + T     ++  N ++   +  L +    +  LK  +  + + YD++ ID PP+++++    ++  D  LVP + + +A  GL  +++   +     N N+KI   + T  + R  + N++ EQ
  S:     5 VAIANQKGGVGKTTTCVNLAASMAATKRKILVIDLDPQGNATMASGVDKYQVETTAYDLLVDELPFEQVVCQDTSGQFDLIAANGDVTAAEIKLMEVFAREVRLKHALAPIRDNYDFIFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGLLRTMYDPRNRLANEVSEQ 199
>gi|21324189|dbj|BAB98814.1| ATPases involved in chromosome partitioning [Corynebacterium glutamicum ATCC 13032] (261 aa)
Score = 218, Expect = 4.5e-16, Identities = 64/252 (25%), Positives = 126/252 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT--ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYV 254
           I + N KGGV KTT + NL A L+  G+KV++VDLD QG + A  G   DD++  + D +       D  I  T   +L ++P N +L+  +  L  +   +  L   +  + + YD++I+D  P++ ++    L+     ++P E + ++  GL  + +  ++  ++ N +++I+ I   +  R T H     + +   ++     V    I+ T +   T+  G    PI+     S+  ++Y +L +E+++ V
  S:    10 IAMANQKGGVGKTTSTINLGACLAEAGRKVLLVDLDPQGALTAGLGIHYDDVDITVYDLMVDNNSTIDQAIHHTGLPDLDVVPANIDLSAAEIQLVNEVGREQTLARALRPVMKDYDFIILDCQPSLGLLTVNALACAHGVIIPMECEYFSLRGLALLTDTVEKVADRLNFDLEILGILVTMFDRRTSH---AREVMSRVVEVFDEKVFDTVITRTVRFPETSVAGE---PIITWAPTSQGAEQYRSLAREVISRV 259
>gi|88712889|ref|ZP_01106974.1| SpoOJ regulator protein [Flavobacteriales bacterium HTCC2170] >gi|88708787|gb|EAR01022.1| SpoOJ regulator protein [Flavobacteriales bacterium HTCC2170] (257 aa)
Score = 218, Expect = 4.5e-16, Identities = 57/196 (29%), Positives = 105/196 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLK-GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT + NLAASL +  KKV+++D D Q N  +  G   + +E      L+  K   E I+   + NL ++P + +L   +  L  K   +  +K  I  L   YD+++ID  P++ ++    L+  D  ++P + + +A  GL +++N  K  ++ +N ++ I   + T  ++R+ + N ++E+  K
  S:     5 IAIANQKGGVGKTTTTVNLAASLGVLEKKVLLIDADPQANATSGLGIDVEGVENGTYQLLEHTKTAKETIIPTDSPNLDLIPSHIDLVAIEIELVDKDEREYMMKKAILDLKNHYDFILIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNPDLDIEGLLLTMFDSRLRLSNQVVEEVRK 202
>gi|163801868|ref|ZP_02195765.1| Soj-like protein [Vibrio campbellii AND4] >gi|159174376|gb|EDP59180.1| Soj-like protein [Vibrio campbellii AND4] (225 aa)
Score = 218, Expect = 4.6e-16, Identities = 54/181 (29%), Positives = 90/181 (49%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           V N KGGV KTT +  LA  LS  G +V++VD D   ++    G  PD +  ++ D  + K +  +     IL    E + I+P +  L   D ++  +      LK  +  + + YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R+I      ++      K+  +PT  + R
  S:     6 VANQKGGVGKTTSTVTLAGLLSQKGHRVLMVDTDPHASLTTYLGYDPDAVTSSLFDLFQIKTFSRETVKPLILKSHLEGIDIIPAHMSLATLDRVMGNRGGMGLILKRALQVIAQDYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMIRTLTIMQKSRPGGFKVTIVPTMYDKR 191
>gi|92115735|ref|YP_575464.1| cobyrinic acid a,c-diamide synthase [Nitrobacter hamburgensis X14] >gi|91798629|gb|ABE61004.1| chromosome segregation ATPase [Nitrobacter hamburgensis X14] (286 aa)
Score = 218, Expect = 4.6e-16, Identities = 68/249 (27%), Positives = 116/249 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLD------ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL  +L+  G++V+IVDLD QGN     G    D   +  D L G+    D ++      LHI     +L+  +  L   +     L+  I  L+        Y YV+ID PP+++++    ++  D  LVP + + +A  GL +++   ++ +   N N+ I  I   V T     N++  Q +    +  G  V    I    + + A  Y + P+++   K    + Y  L  E++
  S:    25 ISLANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNVSTYDVLIGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELGTTKDRAFRLRDAIAALNGNAADHSDYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGI---VLTMFDSRNNLSNQVVADVRQFMGSKVYDTMIPRNVRISEAPSYGK-PVLVYDLKCSGSEAYLKLATEVI 276
>gi|84388133|ref|ZP_00991029.1| SOJ-like and chromosome partitioning protein [Vibrio splendidus 12B01] >gi|84377200|gb|EAP94070.1| SOJ-like and chromosome partitioning protein [Vibrio splendidus 12B01] (260 aa)
Score = 218, Expect = 4.9e-16, Identities = 54/181 (29%), Positives = 91/181 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-----ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           V N KGGV KTT +  LA  L+L G +V++VD D   ++    G   D +E ++ D  + + +        IL  + E + I+P +  L   D ++  +      LK  +  L + YDYV+ID PP + V++   L+  D  L+P + +  A  GL+R+I      ++      K+  +PT  + R
  S:     6 VANQKGGVGKTTSTVTLAGLLALKGHRVLLVDTDPHASLTTYLGYDSDTVESSLFDLFQLREFSAPTVRPLILQTEVEGIDIIPAHMSLATLDRVMGNRSGMGLILKRALAALKDDYDYVLIDCPPILGVMMVNALAASDRILIPVQTEFLAMKGLERMIRTLAIMQKSRKTPFKVTIVPTMYDKR 191
>gi|117928447|ref|YP_872998.1| cobyrinic acid a,c-diamide synthase [Acidothermus cellulolyticus 11B] >gi|117648910|gb|ABK53012.1| Cobyrinic acid a,c-diamide synthase [Acidothermus cellulolyticus 11B] (297 aa)
Score = 218, Expect = 5.0e-16, Identities = 52/187 (27%), Positives = 99/187 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIH 189
           + + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P +L+  I + L +     ED+L+K  T  + +LP N +L   +  L  +   +  L  ++  L   YD ++ID  P++ ++    L+  D  ++P E + +A  G+  ++   ++ +E+ N  +++  I   +    T+H
  S:    49 LAMCNQKGGVGKTTTAINLGAALAEFGRRVLLVDFDPQGALSVGLGVNPHELDRTIYNVLMESDVSAEDVLLKTNTPGMDLLPSNIDLAAAELQLVSEVAREQALARVLAPLRPEYDVILIDCQPSLGLLTVNALTAADGVIIPLECEFFALRGVALLMQTIEKVRERLNPRLELTGILATMFDPRTVH 237
>gi|88802440|ref|ZP_01117967.1| SpoOJ regulator protein [Polaribacter irgensii 23-P] >gi|88781298|gb|EAR12476.1| SpoOJ regulator protein [Polaribacter irgensii 23-P] (260 aa)
Score = 218, Expect = 5.0e-16, Identities = 54/196 (27%), Positives = 107/196 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT S +LAASL +  KK++++D D Q N  +  G   + +E      L+        ++K  + N+ I+P + +L   +  L  KQ  +  LK  + ++ + YDY++ID  P++ ++   +L   D  ++P + + +A  GL +++N  K  ++ +N  ++I   + T  ++R+ + N ++++  K
  S:     5 IAIANQKGGVGKTTTSISLAASLGVLEKKILLIDADPQANATSGLGLDVNAVEGGTYHVLEHTLSARKAIVKTASPNVDIIPAHIDLVAIEIELVDKQEREYMLKKALAEVKDDYDYILIDCAPSLGLITLNSLVAADAVIIPIQCEYFALEGLGKLLNTIKSIQKIHNPTLEIEGLLLTMFDSRLRLSNQVVDEVRK 202
>gi|145219203|ref|YP_001129912.1| chromosome segregation ATPase [Prosthecochloris vibrioformis DSM 265] >gi|145205367|gb|ABP36410.1| chromosome segregation ATPase [Prosthecochloris vibrioformis DSM 265] (265 aa)
Score = 218, Expect = 5.0e-16, Identities = 57/196 (29%), Positives = 104/196 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG----KKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT + N+AASL++   + +++D+D Q N  + FG     + D+  + +M  +KG      I+    E L +LP N  L   +  L      +  ++  +    E YDY+IID PP++ ++   +L+  D  L+P + + YA  GL +++N     ++  N N++I  +  T  ++R+ +   + E+  K
  S:     5 IAIANQKGGVGKTTTAVNIAASLAVSEFRTLLIDIDPQANATSGFGIDVTDEIDNTFYQVM--VKGGDLQNAIIPSSLEYLDVLPSNVNLVGMEVELVNMHEREYVMQKALRGAREQYDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPNLEIEGVLVTMFDSRLRLATQVDEEVRK 203
>gi|28872203|ref|NP_794822.1| ParA family protein [Pseudomonas syringae pv. tomato str. DC3000] >gi|28855457|gb|AAO58517.1| ParA family protein [Pseudomonas syringae pv. tomato str. DC3000] (259 aa)
Score = 218, Expect = 5.1e-16, Identities = 60/211 (28%), Positives = 110/211 (52%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK--------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSN 211
           M+  V N KGGV K++++ NLAA  + +G + +++DLD Q N      G   DD+   I +F K         K    DI     +NLH++    EL      L  K    + L+ L+++L E Y+ + +DTPPA++    + L   D  L+PF+ D ++   L  ++   +E KE +N ++++   I  +   R ++   ++++ +   L    VY+ ++
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSAHEGYRTLLIDLDAQANSTQYLTGLTGDDIPMGIAEFFKNTLSAAPFAKKKHVDIYETPFDNLHVVTATAELADLQPKLEAKHKI-NKLRKLLDELSEDYERIYLDTPPALNFYAVSALIASDRVLIPFDCDSFSRQALYGLMREIEELKEDHNEDLQVEGIIVNQFQPRASLPQQMLDELIAEGLPVLPVYLNAS 220
>gi|15793105|ref|NP_282927.1| parA family protein [Neisseria meningitidis Z2491] >gi|121051124|emb|CAM07395.1| parA family protein [Neisseria meningitidis Z2491] (257 aa)
Score = 218, Expect = 5.1e-16, Identities = 57/193 (29%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT + NLAASL+  GK+V++VDLD QGN     G     L+  +   L G    +   ++  E  + +L  N  L   +  L Q+   +  LK  +  + E YD+++ID PP+++++    L      +VP   + YA  G+  +I   ++ ++  N ++ I  I  T  ++R  +  ++ EQ
  S:     6 LAIANQKGGVGKTTTTVNLAASLASRGKRVLVVDLDPQGNATTGSGIDKASLQSGVYQVLLGDADVKSAAVRSKEGGYGVLGANRALAGAEIELVQEIAREVRLKNALKAVAEDYDFILIDCPPSLTLLTLNGLVAAGGVIVPMLCEYYALEGISDLIATVRKIRQAVNPDLDITGIVRTMYDSRSRLVAEVSEQ 200
>gi|88860627|ref|ZP_01135264.1| transcriptional regulator of chromosome partitioning protein [Pseudoalteromonas tunicata D2] >gi|88817222|gb|EAR27040.1| transcriptional regulator of chromosome partitioning protein [Pseudoalteromonas tunicata D2] (261 aa)
Score = 218, Expect = 5.2e-16, Identities = 57/193 (29%), Positives = 105/193 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPD---DLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT + NLAAS++   +KV++VDLD QGN  AT G   D   D+       ++ K + E +  + +   H++  N ++   +  L +    +  L+  ++ + + Y+++IID PP+++++    ++  D  LVP + + YA  GL  +++   +  +  N  ++I  I  T  + R  + ND+ EQ
  S:     5 IAIANQKGGVGKTTTAVNLAASMAATKRKVLLVDLDPQGN--ATMGSGVDKYADIATVYDLLVEEKPFDEVVQTETSGEYHLIAANGDVTAAEVKLMELFAREVRLRNALDLIRDRYEFIIIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALMDTITQLAKLVNPKLQIEGILRTMYDPRNRLANDVSEQ 199
>gi|94496560|ref|ZP_01303136.1| chromosome partitioning protein ATPase component [Sphingomonas sp. SKA58] >gi|94423920|gb|EAT08945.1| chromosome partitioning protein ATPase component [Sphingomonas sp. SKA58] (260 aa)
Score = 217, Expect = 5.3e-16, Identities = 63/251 (25%), Positives = 118/251 (47%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           ++I + N KGGV KTT + NLA  L+  G +V++VDLD QGN     G      E +  D L G C  +D I+  +   L ++P   +L+  +  L+  ++ T    ++L       +D  +ID PP++ ++    +      LVP + + +A  GL +++   +  + + N  + I+ +   +  R     D +   ++  L   G  V S  I    + + A  +  VP ++  F+    + Y  L +E++
  S:     2 IRIAIANQKGGVGKTTTAINLATGLAATGLRVLLVDLDPQGNASTGLGVDQAARERSSYDLLVGNCALDDSIVTTRVPKLDLVPATQDLSGAEIELIEYEERTHRLERVLSEAQPGRWDICLIDCPPSLGLLTINAMVAAQSLLVPLQCEFFALEGLSQLLQTVERIRGRFNPGLSIMGVALTMYDRRNRLTDQVADDVRACL---GDLVFSTVIPRNVRLSEAPSHG-VPALIYDFRCSGSEAYMRLARELI 250
>gi|57642207|ref|YP_184685.1| ParA/MinD family ATPase [Thermococcus kodakarensis KOD1] >gi|57160531|dbj|BAD86461.1| ATPase involved in chromosome partitioning, ParA/MinD family, Soj homolog [Thermococcus kodakarensis KOD1] (256 aa)
Score = 217, Expect = 5.4e-16, Identities = 62/202 (30%), Positives = 110/202 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG----KKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQ 204
           I V N KGGV KTTL+ NL  +LS  GK+V++VD+D Q N+  TFG    K  +     +   +  +   E+ ++   ENL ++P +  L+  +  ++N     +   K LI  L + YDYV+ID PP+M + +  +L+  D  L+P E   +  +G++ + N  +  +E+ N N+K++ +         + N   +Q+  PK++ +
  S:     5 ISVANQKGGVGKTTLTMNLGFALSEMGKRVLLVDVDPQFNL--TFGLIGMKVLEHSSRNVGTLMTRESEIEETIVPVKENLDLIPSHLNLSAKEIEIINAYNRERRLEKALIPVLPD-YDYVLIDNPPSMGIFLVNSLTASDYVLIPLELSYFGVIGMQLMFNLMRMIREETNENLKLLGL---------VPNKFTKQTKVPKMRLK 199
>gi|126738502|ref|ZP_01754207.1| chromosome partitioning protein ParA [Roseobacter sp. SK209-2-6] >gi|126720301|gb|EBA17007.1| chromosome partitioning protein ParA [Roseobacter sp. SK209-2-6] (269 aa)
Score = 217, Expect = 5.6e-16, Identities = 59/199 (29%), Positives = 104/199 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDIL-IKKTENLHILPGNDELNYFDFLL--NQKQITQSNLKMLINKLDEL-YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKL 201
           I V N KGGV KTT + NLAA+L   G +V++VDLD QGN     G +  D      D L      E+++   + E+L I+P   +L+  D  L  N+K+    +  +    +DE  +DYV+ID PP+++++    +      L+P + + +A  G+ +++   +E ++  N N++I  +   +  R    +  +EQ  +  L
  S:    13 IAVANQKGGVGKTTTAINLAAALVETGLRVLVVDLDPQGNASTGLGIEAGDRGLTTYDLLVDDTPLEEVIYATEIEDLCIIPATVDLSSADIELFANEKRSFLLHDALRQTAMDEYDWDYVLIDCPPSLNLLTVNAMVAAHSVLIPLQSEFFALEGVSQLMLTIREVRQAANPNLRIEGVVLTMFDRRNNLSQQVEQDARENL 215
>gi|110596958|ref|ZP_01385248.1| Cobyrinic acid a,c-diamide synthase [Chlorobium ferrooxidans DSM 13031] >gi|110341645|gb|EAT60105.1| Cobyrinic acid a,c-diamide synthase [Chlorobium ferrooxidans DSM 13031] (265 aa)
Score = 217, Expect = 5.7e-16, Identities = 67/249 (26%), Positives = 128/249 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG----KKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + N+AAS+++   K +++D+D Q N  + FG     + D+  + +M  +KG    + I     E L +LP N  L   +  L   +  +  ++  +  +  LYDY+IID PP++ ++   +L+  D  L+P + + YA  GL +++N     ++  N  ++I  +  T  ++R+ +   + E+    K   + VY T  +I    + + A  + + P ++   +S    +Y +L +EI 
  S:     5 IAIANQKGGVGKTTTAVNIAASIAISEFKTLLIDIDPQANATSGFGIETGDEIDNTFYQVM--VKGGNIQDAIKQSSLEYLDVLPSNVNLVGMEVELVNMREREYVMQKALKGVRSLYDYIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPKLEIEGVLVTMYDSRLRLATQVAEEV--KKFFKEKVYRT--YIRRNVRLSEAPSHGK-PALLYDAQSIGSKDYLDLAQEIF 251
>gi|148982409|ref|ZP_01816747.1| ParA family protein [Vibrionales bacterium SWAT-3] >gi|145960491|gb|EDK25861.1| ParA family protein [Vibrionales bacterium SWAT-3] (257 aa)
Score = 217, Expect = 5.7e-16, Identities = 52/193 (26%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT   NLAAS++   +K+++VDLD QGN     G     +E    D L     +++++ + T  N  ++  N ++   +  L +    +  LK  +  + + YD++ ID PP+++++    ++  D  LVP + + +A  GL  +++   +     N N+KI   + T  + R  + N++ +Q
  S:     5 VAIANQKGGVGKTTTCINLAASMAATKRKILVVDLDPQGNATMASGVDKYQVEATAYDLLVEDTPFDEVVCRSTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKNALASIRDNYDFIFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGLLRTMYDPRNRLSNEVSDQ 199
>gi|153810282|ref|ZP_01962950.1| hypothetical protein RUMOBE_00663 [Ruminococcus obeum ATCC 29174] >gi|149833461|gb|EDM88542.1| hypothetical protein RUMOBE_00663 [Ruminococcus obeum ATCC 29174] (258 aa)
Score = 217, Expect = 5.8e-16, Identities = 65/251 (25%), Positives = 119/251 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYW-----EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNY 253
           I + N KGGV KTT + NL   LS  GK+V+++D D QG++    G  P +L   +   ++           + ++   E + ++P N  L+  D  L   +  +  LK  +  L+  YDY++ID  P++ ++    LS  D  L+P +P  YA  GL  ++   K   ++ N +++I  I   +++    ++   +Q+++     + +          T++ A    E V I     K K    Y  L +E+LN+
  S:     5 IAIANQKGGVAKTTTTINLGVGLSKVGKRVMLIDADPQGHLTMGLGF-PKNLRVTLKTMMENIIMGLEFDPREAILHHEEGIDVIPSNKLLSGMDMSLFTVEDREKVLKEYLELLENDYDYILIDCMPSLGMMTINALSAADSVLIPVQPQYYAADGLMELLKVVKGIHQRFNPDLQIEGILFTMDSSHYNNSKRNKQAVRDAYGAEIIIFDQTI--PRTEALAETASEGVSIFSYDAKGKGAYSYQALVQEVLNH 257
>gi|119026643|ref|YP_910488.1| chromosome partitioning protein ParA [Bifidobacterium adolescentis ATCC 15703] >gi|154486337|ref|ZP_02027744.1| hypothetical protein BIFADO_00146 [Bifidobacterium adolescentis L2-32] >gi|118766227|dbj|BAF40406.1| chromosome partitioning protein ParA [Bifidobacterium adolescentis ATCC 15703] >gi|154084200|gb|EDN83245.1| hypothetical protein BIFADO_00146 [Bifidobacterium adolescentis L2-32] (314 aa)
Score = 217, Expect = 5.8e-16, Identities = 57/173 (32%), Positives = 96/173 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG-------KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKL----DELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI 175
           I V N KGGV KTT + NL+A+L+  G KV+++D+D QGN     G      + ++ D ++G       KC   D      +NL ++P + +L+  +  +       S LK  +++     +E YDYVIID PP++ ++V   +  V   L+P + + YA  GL ++IN     +E  N ++ +
  S:    47 IAVANQKGGVGKTTSAVNLSAALARFGCKVLLIDMDPQGNASTALGAPHASGQPSVYDVIEGRKRIAEVKCTCPDF-----DNLDVVPASIDLSGAELEVADMADRNSLLKNAVDEFLATSEEHYDYVIIDCPPSLGLLVINAMCAVHEMLIPIQAEYYALEGLGQLINTIGLVQEHYNPSLLV 225
>gi|118577388|ref|YP_899628.1| cobyrinic acid a,c-diamide synthase [Pelobacter propionicus DSM 2379] >gi|118504893|gb|ABL01375.1| Cobyrinic acid a,c-diamide synthase [Pelobacter propionicus DSM 2379] (255 aa)
Score = 217, Expect = 6.0e-16, Identities = 55/191 (28%), Positives = 109/191 (57%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDL---EFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDII 193
           I V+N KGGV KTT S NL  +L++ GKKV++VD+D Q N+    G KP+D    +  I + L  +   +++++ + +NL +LP + +L+  + ++  K   +  L   +      +D+++ID PP++S++    L      +V  +P+  + +GL ++++   + K + N +++I  I  + V +   +H +II
  S:     4 IAVLNEKGGVGKTTTSYNLGGALAISGKKVLLVDIDPQCNLTQFCGLKPNDNFPGDKTINEVLLDQISAKEVIVSRNKNLWVLPASQKLSDTEHIIYTKLGRELILADAMQDCGN-FDFILIDCPPSLSLLTINALCFATEIIVALQPEPASLVGLAKLLDTYGKIKTRMNKDLEISGIVCSMVESGKLLHREII 197
>gi|114705863|ref|ZP_01438766.1| chromosome partitioning protein, ParA [Fulvimarina pelagi HTCC2506] >gi|114538709|gb|EAU41830.1| chromosome partitioning protein, ParA [Fulvimarina pelagi HTCC2506] (261 aa)
Score = 217, Expect = 6.1e-16, Identities = 64/249 (25%), Positives = 118/249 (47%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLI---NKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NLA +L+  GK+V++VDLD QGN     G + DD E +  D L  +   E+  I      L ++P   +L   +  ++        L+  +    K +  +D+V++D PP+++++    ++  D  LVP + + +A  GL +++   +E ++  N  + +  I   V T     N++  Q ++      G  V    I    + + A  + + P ++   K      Y  L  E++
  S:     4 ITIANQKGGVGKTTTAINLATALAAVGKRVLLVDLDPQGNASTGLGIEKDDREVSSYDLLTERASVEEAAIPTAVPELSLIPSTLDLLGLEMEISSADRRAYRLRDALREHEKREARFDFVLMDCPPSLNLLTINAMAAADSVLVPLQCEFFALEGLSQLLQTVEEVRDSLNPELDLHGI---VLTMFDGRNNLAAQVVRDVRAYMGESVYQTVIPRNVRVSEAPSFGK-PAILYDMKCPGSQAYIALASEVI 252
>gi|119776785|ref|YP_929525.1| ParA family protein [Shewanella amazonensis SB2B] >gi|119769285|gb|ABM01856.1| ParA family protein [Shewanella amazonensis SB2B] (262 aa)
Score = 217, Expect = 6.1e-16, Identities = 56/193 (29%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L  +  + D+++K T+  + ++  N ++   +  L +    +  L+  +  + + YD++ ID PP+++++    +S  D  LVP + + +A  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCINLAASLAATRRKVLLIDLDPQGNATMGSGVDKYEVENTAYELLVEEKPFADVVVKDTQGKYDLIAANGDVTAAEIKLMEFFAREVRLRNALAPIRDQYDFIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTIGKLASMVNPGLGIEGILRTMYDPRNRLANDVSDQ 199
>gi|146305590|ref|YP_001186055.1| cobyrinic acid a,c-diamide synthase [Pseudomonas mendocina ymp] >gi|145573791|gb|ABP83323.1| Cobyrinic acid a,c-diamide synthase [Pseudomonas mendocina ymp] (256 aa)
Score = 217, Expect = 6.3e-16, Identities = 67/218 (30%), Positives = 113/218 (51%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF-GKKPDDLEFAIMDFLK-----------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK 218
           M+  V N KGGV K++++ NLAA  +  G + +++DLD Q N      G   +++   I DF K           GK    DI     +NLH++    EL      L QK    + L+ L+++L E YD++ +DTPPA++    + L   D  L+PF+ D ++   L  ++   +E K+ +N  +++  I   +   R T     + Q L  +L T+G+ V    + S+ K
  S:     1 MRRVVFNQKGGVGKSSIACNLAAVSAAQGYRTLLIDLDAQANSTHYLTGLTGEEIPMGIADFFKQTLSSGPFAKKGKV---DIYETPFDNLHVVTATAELAELQPKLEQKHKI-NKLRKLLDELAEDYDHIYLDTPPALNFYTVSALIAADRVLIPFDCDSFSRNALYGLLAEIEELKDDHNEELEVEGIVVNQFQPRAT-----LPQQLLDELITEGLPVLPVNLMSSVK 222
>gi|120404254|ref|YP_954083.1| cobyrinic acid a,c-diamide synthase [Mycobacterium vanbaalenii PYR-1] >gi|119957072|gb|ABM14077.1| Cobyrinic acid a,c-diamide synthase [Mycobacterium vanbaalenii PYR-1] (298 aa)
Score = 217, Expect = 6.6e-16, Identities = 74/250 (29%), Positives = 130/250 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI------PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL ASL+  G++V++VDLD QG + A  G    +LE  + + L + +   + +LIK +   L ++P N +L+  +  L+N+    QS  + L   LD  YDYV+ID  P++ ++    L+  D  ++P E + ++  GL  + +  ++  ++ N  + I  I      P  VN+R  +   ++E+         G  V    ++ T +   T+  G    PI     KS   + Y  L +E+++
  S:    47 IAMCNQKGGVGKTTSTINLGASLAEYGRRVLLVDLDPQGALSAGLGVPHYELEHTVHNLLVEPRVSIDQVLIKTRVPGLDLVPSNIDLSAAEIQLVNEVGREQSLARALYPVLDR-YDYVLIDCQPSLGLLTVNGLACSDGVIIPTECEFFSLRGLALLTDTVEKVHDRLNPKLSISGILITRYDPRTVNSR-EVMARVVERF--------GDLVFDTVVTRTVRFPETSVAGE---PITTWAPKSAGAEAYRALAREVIH 294
>gi|154148260|ref|YP_001406261.1| sporulation initiation inhibitor protein soj [Campylobacter hominis ATCC BAA-381] >gi|153804269|gb|ABS51276.1| sporulation initiation inhibitor protein soj [Campylobacter hominis ATCC BAA-381] (262 aa)
Score = 217, Expect = 6.8e-16, Identities = 61/178 (34%), Positives = 101/178 (56%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGN-----DELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPT 180
           I + N KGGV KTT + NLA+ L+  GKKV+++D+D Q N     G   +D EF I     G     +IL+K + ENL ++P N      E  + D   N K I +++L     ++++ YD++++DTPP +  +    L   +  ++P + + YA  GL  I+N  K  K+  N +++I+  +PT
  S:     5 ITIANQKGGVGKTTTAVNLASCLANSGKKVLLIDVDPQANATTGLGFSRNDYEFNIYHVFLGVKKISEILLKTEIENLELIPSNIGLVGIEKEFSDMDNNYKTILKNSLM----EVEKNYDFILLDTPPTLGNITVNALISSNSVIIPIQCEFYALEGLALILNTIKFIKKTENKDLQILGFLPT 185
>gi|117922570|ref|YP_871762.1| chromosome segregation ATPase [Shewanella sp. ANA-3] >gi|117614902|gb|ABK50356.1| Cobyrinic acid a,c-diamide synthase [Shewanella sp. ANA-3] (262 aa)
Score = 216, Expect = 7.0e-16, Identities = 57/193 (29%), Positives = 101/193 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G    ++E    + L  +  +++I++K T   + ++  N ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + +A  GL  +I+   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYELLVEEKPFDEIVVKDTTGKYDLIASNGDVTAAEIKLMEFFAREVRLRNALAPIKDQYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAVVNPGLGIEGILRTMYDPRNRLSNDVSDQ 199
>gi|163751413|ref|ZP_02158638.1| ParA family protein [Shewanella benthica KT99] >gi|161328716|gb|EDP99864.1| ParA family protein [Shewanella benthica KT99] (262 aa)
Score = 216, Expect = 7.2e-16, Identities = 56/193 (29%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G     +E    + L  +  +++++ + T   + ++ GN ++   +  L +    +  L+  +  + + YDY+ ID PP+++++    +S  D  LVP + + YA  GL  +++   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGIDKYSVENTAYELLVDEKSFDEVVYRNTSGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALAPIKDDYDYIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKIGAMINPGLHIEGILRTMYDPRNRLANDVSDQ 199
>gi|158521642|ref|YP_001529512.1| cobyrinic acid ac-diamide synthase [Desulfococcus oleovorans Hxd3] >gi|158510468|gb|ABW67435.1| Cobyrinic acid ac-diamide synthase [Desulfococcus oleovorans Hxd3] (263 aa)
Score = 216, Expect = 7.7e-16, Identities = 61/194 (31%), Positives = 100/194 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQS 196
           I + N KGGV KTT S NLAA+L+   +KV++VD D Q N     G     LE  +   L G       +I+   +NL ILP   EL+ F+  +  +   +  L  ++  +   YDYVI+D PP+++++    ++  D  L+P + + YA  GL +++   +  K+  N  +KI  I  T  + R  + N + E +
  S:    13 ICIANQKGGVGKTTTSVNLAAALASLARKVLLVDCDPQANATTGVGVDKAGLEKTLYHVLIGDTPAARAVIQTPVKNLSILPSRVELSGFEVEMVDEPGKEKLLAAVLAPVRNDYDYVILDCPPSLTLLTINAMAAADSILIPLQSEFYALEGLGQLLQTVRRIKQSLNPPLKIAGILLTMFDQRTNLSNQVTEDA 208
>gi|161378125|ref|NP_746449.2| ParA family protein [Pseudomonas putida KT2440] (262 aa)
Score = 216, Expect = 7.8e-16, Identities = 73/250 (29%), Positives = 118/250 (47%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED------ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINK----LDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQD--EYHNLKKEILNY 253
            V N KGGV KTT +  LA  L+  GK+V++VDLD  G++ + FG  PD LE +  D    K    +      +L    E + +LP +  L     +L ++   Q+ L ++I K    L + +DY +ID+PP + V++   L+     ++P + +  A  GL+R++             +    +PT  + R          +LK    T G +V   +I   T+   A    R  +  S F SK +    Y  L K +L Y
  S:     5 AVANQKGGVGKTTTTIALAGLLAEAGKRVVVVDLDPHGSMTSYFGHNPDALEHSCYDLFLHKGTVPEGLPGQLLLPTSDERISLLPSSTALA----VLERQSPGQNGLGLVIAKSLAQLWQDFDYALIDSPPLLGVLMVNALAASQQLVIPVQTEFLAVKGLERMVGTLAMVNRSRKQALPYQIVPTLFDRRTQAS----LGTLKLLRDTYGQHVWQGYIPVDTRLRDA---SRKGVTPSQFDSKSRGLIAYRALLKHLLTY 255
>gi|149378134|ref|ZP_01895853.1| ParA family protein [Marinobacter algicola DG893] >gi|149357579|gb|EDM46082.1| ParA family protein [Marinobacter algicola DG893] (261 aa)
Score = 216, Expect = 7.8e-16, Identities = 66/242 (27%), Positives = 122/242 (50%)
  Q:     7 NNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIA-TFGKKPDDLEFAIMDFLKGKCYW--------EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKK 248
           N KGGV K++++ NLAA  +  GK+ ++VDLD QGN      GK   +L+  I D+L+    +        E +     +NL ++P + EL++ +  L  K      L+  + KL E +D + IDT PA++    + L      L+PF+ D ++   L  I++  +E +E +N ++ +  I   +   R ++   ++ +     L  +G+ V    +SS+ K   +    R P++    K     +Y +L +
  S:     3 NQKGGVGKSSITCNLAAISAARGKRTLVVDLDPQGNSTHYLLGKPAGELKDTIADYLEQTVAFTVFNRRADEFVHASPFDNLFVMPSSPELDFLERKLEAKHKIY-KLREALKKLGESFDEIYIDTAPALNFYTRSALIAAQRCLIPFDCDDFSRQALYSILHEIQELQEDHNEDLVVEGIVANQFQPRASLPKKLVRE-----LMDEGLPVLPVRLSSSVKMKES-HQSRQPLIHMAPKHPLTRQYEDLYR 247
>gi|24986054|gb|AAN69913.1|AE016630_4 ParA family protein [Pseudomonas putida KT2440] (284 aa)
Score = 216, Expect = 7.8e-16, Identities = 73/250 (29%), Positives = 118/250 (47%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED------ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINK----LDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQD--EYHNLKKEILNY 253
            V N KGGV KTT +  LA  L+  GK+V++VDLD  G++ + FG  PD LE +  D    K    +      +L    E + +LP +  L     +L ++   Q+ L ++I K    L + +DY +ID+PP + V++   L+     ++P + +  A  GL+R++             +    +PT  + R          +LK    T G +V   +I   T+   A    R  +  S F SK +    Y  L K +L Y
  S:    27 AVANQKGGVGKTTTTIALAGLLAEAGKRVVVVDLDPHGSMTSYFGHNPDALEHSCYDLFLHKGTVPEGLPGQLLLPTSDERISLLPSSTALA----VLERQSPGQNGLGLVIAKSLAQLWQDFDYALIDSPPLLGVLMVNALAASQQLVIPVQTEFLAVKGLERMVGTLAMVNRSRKQALPYQIVPTLFDRRTQAS----LGTLKLLRDTYGQHVWQGYIPVDTRLRDA---SRKGVTPSQFDSKSRGLIAYRALLKHLLTY 277
>gi|148546772|ref|YP_001266874.1| cobyrinic acid a,c-diamide synthase [Pseudomonas putida F1] >gi|148510830|gb|ABQ77690.1| Cobyrinic acid a,c-diamide synthase [Pseudomonas putida F1] (262 aa)
Score = 216, Expect = 7.8e-16, Identities = 73/250 (29%), Positives = 118/250 (47%)
  Q:     4 GVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED------ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINK----LDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQD--EYHNLKKEILNY 253
            V N KGGV KTT +  LA  L+  GK+V++VDLD  G++ + FG  PD LE +  D    K    +      +L    E + +LP +  L     +L ++   Q+ L ++I K    L + +DY +ID+PP + V++   L+     ++P + +  A  GL+R++             +    +PT  + R          +LK    T G +V   +I   T+   A    R  +  S F SK +    Y  L K +L Y
  S:     5 AVANQKGGVGKTTTTIALAGLLAEAGKRVVVVDLDPHGSMTSYFGHNPDALEHSCYDLFLHKGTVPEGLPGQLLLPTSDERISLLPSSTALA----VLERQSPGQNGLGLVIAKSLAQLWQDFDYALIDSPPLLGVLMVNALAASQQLVIPVQTEFLAVKGLERMVGTLAMVNRSRKQALPYQIVPTLFDRRTQAS----LGTLKLLRDTYGQHVWQGYIPVDTRLRDA---SRKGVTPSQFDSKSRGLIAYRALLKHLLTY 255
>gi|196186812|gb|EDX81788.1| hypothetical protein BBAL3_2945 [Brevundimonas sp. BAL3] (273 aa)
Score = 216, Expect = 8.0e-16, Identities = 58/207 (28%), Positives = 100/207 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDE---LYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVT 209
           + V N KGGV KTT + NL  +L+  GK+V+IVD+D QGN     G   +     I D +  +   +D  ++ T   L I+P + +++  +  L+Q       L+  +   D     YDYV+ID PP+++++    ++  D  LVP + + +A  GL +++                               D+++QSL P L+ QG+ +T
  S:    14 LAVSNQKGGVGKTTTAINLGTALAAIGKRVLIVDMDPQGNASTGLGVPRETRRVTIYDVVVDQRSVDDAAVQTTVPGLWIVPADADMSGVEIELSQADRRSYRLRDALRAHDHGPTAYDYVLIDCPPSLNLLTLNAMAAADAVLVPLQCEFFALEGLSQLMRTI----------------------------DMVKQSLNPALEIQGLVLT 196
>gi|163722199|ref|ZP_02129738.1| Cobyrinic acid a,c-diamide synthase [Desulfatibacillum alkenivorans AK-01] >gi|161404808|gb|EDQ29037.1| Cobyrinic acid a,c-diamide synthase [Desulfatibacillum alkenivorans AK-01] (254 aa)
Score = 216, Expect = 8.4e-16, Identities = 76/252 (30%), Positives = 127/252 (50%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIA-TFGKKPDDLEFAIMDF--------LKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL--YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           M+  V N KGGV K+T+++NLAA  +  GK+ ++VDLD QGN      G    D    + +F        L+ K     I     +NL +LP + E+      L+ K   +  +  L   LD++  YD V +DTPPA++    + L   D  L+PF+ D ++   L  ++ + +E +E +N  +++   I  +   R  + N I+ +     LK++ + V   F+S + K   +   +  P+V    K K   EY  L  E+LN
  S:     1 MRRVVFNQKGGVGKSTIASNLAAMGASKGKRTLLVDLDPQGNATQYLLGNGDLDSRETLAEFFQDMLRISLRRKGAEAYIHHTPFDNLDVLPAHGEMAD----LSSKLEARYKIYKLKEALDQIPYYDAVFMDTPPALNFFTLSALIAADSCLIPFDCDDFSRRALYTLMGSVQEIREDHNPKLRVEGIIVNQFQARAKLPNKIVNE-----LKSENLPVLDAFLSQSIKVRESHD-KATPLVHLAPKHKLSQEYLAL-YEMLN 253
>gi|145588206|ref|YP_001154803.1| cobyrinic acid a,c-diamide synthase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145046612|gb|ABP33239.1| chromosome segregation ATPase [Polynucleobacter sp. QLW-P1DMWA-1] (256 aa)
Score = 216, Expect = 8.5e-16, Identities = 55/194 (28%), Positives = 104/194 (53%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLK 198
           + N KGGV KTT + NLAA L+   ++V++VDLD QGN     G +  DL  ++   L G    ++   + ++    +LP N +L   +  L      ++ LK  ++++ + YD+++ID PPA+S++    L   +  +VP + + +A  GL  ++N  K+     N ++ I+  +    + R+T+   + +Q L+
  S:     7 IANQKGGVGKTTTAVNLAAGLAGLQQRVLLVDLDPQGNATMGSGIEKADLTTSVYQVLIGLASVKECSKQCESSGYDVLPANRDLAGAEIELVDLDTREARLKDALSQVIDDYDFILIDCPPALSLLTLNGLCAANGVIVPMQCEYFALEGLSDLVNTIKQVHANLNPDLVIIGLLRVMFDARMTLQQQVSDQLLE 202
>gi|118051735|ref|ZP_01520283.1| Cobyrinic acid a,c-diamide synthase [Comamonas testosteroni KF-1] >gi|118001078|gb|EAV15234.1| Cobyrinic acid a,c-diamide synthase [Comamonas testosteroni KF-1] (256 aa)
Score = 216, Expect = 8.8e-16, Identities = 56/191 (29%), Positives = 96/191 (50%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           V N KGGV KTT + NLAA L+  G++V+++DLD QGN     G     LE  + D L      +++  K  +    +L  N EL+  +  L   +     LK  +  +   YD+V+ID PP++S++    L      +VP + + +A  GL  ++N  K+     N +++I+  +    + R T+   + +Q
  S:     7 VANQKGGVGKTTTTVNLAAGLAKVGQRVLLIDLDPQGNATMGSGVDKRALELTVYDVLLENASVKEVAQKSEQVGYDVLGANRELSGAEIELVSLERRNERLKTALQAVAADYDFVLIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVNTIKQVHANMNPDLQIIGLLRVMFDPRTTLQQQVSDQ 199
>gi|27375742|ref|NP_767271.1| chromosome partitioning protein A [Bradyrhizobium japonicum USDA 110] >gi|27348880|dbj|BAC45896.1| chromosome partitioning protein A [Bradyrhizobium japonicum USDA 110] (284 aa)
Score = 216, Expect = 8.8e-16, Identities = 68/249 (27%), Positives = 116/249 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYW-EDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKL------DELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + + N KGGV KTT + NL  +L+  G++V+IVDLD QGN     G    +   +  D L G+    E ++      LHI P   +L+  +  L         L+  I  L      D  Y YV+ID PP+++++    ++  D  LVP + + +A  GL +++   ++ +   N N+ I  I   V T     N++  Q +    +  G  V    I    + + A  Y + P+++   K    + Y  L  E++
  S:    23 LALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRNRSCSTYDVLVGEAALREAVVSTAVPRLHIAPSTMDLSGLELELGTTPGRAFKLRDAIGALNNNVSPDADYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGI---VLTMFDSRNNLSNQVVADVRQFMGEKVYKTMIPRNVRISEAPSYGK-PVLVYDLKCVGSEAYLRLATEVI 274
>gi|85714098|ref|ZP_01045087.1| cobyrinic acid a,c-diamide synthase [Nitrobacter sp. Nb-311A] >gi|85699224|gb|EAQ37092.1| cobyrinic acid a,c-diamide synthase [Nitrobacter sp. Nb-311A] (285 aa)
Score = 216, Expect = 8.9e-16, Identities = 68/249 (27%), Positives = 116/249 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILI-KKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLD------ELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL  +L+  G++V+IVDLD QGN     G    D   +  D L G+    D ++      LHI     +L+  +  L   +     L+  I  L+        Y YV+ID PP+++++    ++  D  LVP + + +A  GL +++   ++ +   N N+ I  I   V T     N++  Q +    +  G  V    I    + + A  Y + P+++   K    + Y  L  E++
  S:    24 ISLANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNVSTYDVLIGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELGATKDRAFRLRDAIIALNGNAADTADYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGI---VLTMFDSRNNLSNQVVADVRQFMGSKVYDTMIPRNVRISEAPSYGK-PVLVYDLKCSGSEAYLKLATEVI 275
>gi|167038664|ref|YP_001666242.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857498|gb|ABY95906.1| Cobyrinic acid a,c-diamide synthase [Thermoanaerobacter pseudethanolicus ATCC 33223] (255 aa)
Score = 215, Expect = 9.3e-16, Identities = 57/196 (29%), Positives = 102/196 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT + NL  SL+  GKKV+ +D+D Q N+ + FG  P  L+      L + +     I+  K   + I+P + +L   +  L      +  LK  +N++ + +DY++ID PP++ ++    L+  D  +VP + + YA  GL +++N     K+  N  ++I  +  T  N R  +   ++++  K
  S:     5 IAIANQKGGVGKTTTTINLGYSLATQGKKVLCIDIDPQSNMTSGFGINPASLKHTTYTVLIEDEDIRNAIIPLKDLKVSIVPSSIQLAGAEIELVPMLSREYKLKNAVNQIKDEFDYILIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPELEIEGVVLTMFNARTNLSIQVVDEVKK 202
>gi|118470102|ref|YP_888042.1| SpoOJ regulator protein [Mycobacterium smegmatis str. MC2 155] >gi|118171389|gb|ABK72285.1| SpoOJ regulator protein [Mycobacterium smegmatis str. MC2 155] (277 aa)
Score = 215, Expect = 9.4e-16, Identities = 74/250 (29%), Positives = 129/250 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIK-KTENLHILPGNDELNYFDF-LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI------PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILN 252
           I + N KGGV KTT + NL ASL+  G++V++VDLD QG + A  G    +L+  + + L + +   +D+LIK +   + ++P N +L+  +  L+N+    QS  + L   LD  YDYV+ID  P++ ++    L+  D  ++P E + ++  GL  + +   +  ++ N  + I  I      P  VN R  +   ++E+         G  V    I+ T +   T+  G    PI     KS     Y +L +E+++
  S:    26 IAMCNQKGGVGKTTSTINLGASLAEYGRRVLLVDLDPQGALSAGLGVPHYELDNTVHNLLVEPRVSIDDVLIKTRVSGMDLVPSNIDLSAAEIQLVNEVGREQSLARALYPVLDR-YDYVLIDCQPSLGLLTINGLACADGVVIPTECEYFSLRGLALLTDTVDKVHDRLNPKLSISGILVTRYDPRTVNAR-EVMARVVERF--------GDLVFDTVITRTVRFPETSVAGE---PITTWAPKSSGAAAYRSLAREVIH 273
>gi|86740156|ref|YP_480556.1| cobyrinic acid a,c-diamide synthase [Frankia sp. CcI3] >gi|86567018|gb|ABD10827.1| Cobyrinic acid a,c-diamide synthase [Frankia sp. CcI3] (329 aa)
Score = 215, Expect = 9.5e-16, Identities = 50/187 (26%), Positives = 97/187 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKG--KCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIH 189
           + + N KGGV KTT + NL A+L+  G++V++VD D QG +    G  P   +  + D L G      E I+  + + L +LP N +L+  + LL  +   + +L   +  + + YD +++D  P++ ++    L+  D  +VP E + +A  G+  ++    + +E+ N  +++  I   +    T+H
  S:    73 VAMCNQKGGVGKTTSTINLGAALAEYGRRVLLVDFDPQGALSVGLGVNPMQFDLTVHDLLLGGDADVREVIVETQVDGLDLLPSNIDLSAAEVLLVTEVGREHSLARALAPILDEYDVILVDCQPSLGLLTVNALTAADAVIVPLECEYFALRGVALLLQTIDKVRERLNSRLELAGILATMYDARTLH 261
>gi|196195181|gb|EDX90140.1| hypothetical protein ADG881_2242 [Alcanivorax sp. DG881] (256 aa)
Score = 215, Expect = 9.8e-16, Identities = 73/244 (29%), Positives = 127/244 (52%)
  Q:     7 NNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF----------GKKPDDLEF--AIMDF-LKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYER-VPIVMSVFKSKYQDEYHNLKKEI 250
           N KGGV K++++ NLAA  + +GK+ ++VDLD Q N               G KP+   F    + F LK K   + +     ENL +LP + EL   + +L  K      L+ L+  L + +D + +DTPPA +    ++L   D  L+PF+ D ++   L  ++   +E +E +N ++++  I   +   R       + Q L   L+ +G+ + +N +SS+     +  +E+  P+V    + K  DEY  L +EI
  S:     3 NQKGGVGKSSITVNLAAISASEGKRTLVVDLDPQCNASQYLLGMPAYSNGHGPKPNIGTFFAQTLSFRLKEKDPRDYVHATPFENLFVLPSDGELGEIEHMLESKHKIY-KLRGLLKALAKDFDEIFVDTPPAYNFYTLSSLIAADRVLIPFDCDAFSRKALYTLLENIQEAREDHNDDLQVEGIVVNQYQPRAR-----LPQELVASLEEEGLPILANKLSSSVVMRES--HEKATPLVNMQPRHKLTDEYRALFREI 253
>gi|171741740|ref|ZP_02917547.1| hypothetical protein BIFDEN_00831 [Bifidobacterium dentium ATCC 27678] >gi|171277354|gb|EDT45015.1| hypothetical protein BIFDEN_00831 [Bifidobacterium dentium ATCC 27678] (269 aa)
Score = 215, Expect = 1.0e-15, Identities = 56/196 (28%), Positives = 109/196 (55%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT----ENLHILPGNDELNYFDF----LLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKI-VAIPTKVNTRVTIHNDIIEQSLK 198
           I V N KGGV KTT + N++++L+  G +V+++D+D QGN     G +    E ++ D L+G+    +  +K+T    E L ++P + +L+  +     + ++  + +  +   +N  ++ YDYVIID PP++ ++V   +  V   L+P + + YA  GL ++IN     +E  N  + +   + T  + R  +  ++ E+  K
  S:     2 IAVANQKGGVGKTTTAVNVSSALAQYGARVLLIDMDPQGNASTALGARHTSGEPSVYDVLEGRMSIAE--VKQTCPDCELLDVVPASIDLSGAELEVADMADRNVLLKRAVDEFLNTSEQHYDYVIIDCPPSLGLLVINAMCAVTEMLIPIQAEYYALEGLGQLINTIGLVQEHFNPALLVSTMLVTMFDKRTLLSREVHEEVKK 204
>gi|163796495|ref|ZP_02190455.1| ATPase involved in chromosome partitioning [alpha proteobacterium BAL199] >gi|159178345|gb|EDP62889.1| ATPase involved in chromosome partitioning [alpha proteobacterium BAL199] (263 aa)
Score = 215, Expect = 1.0e-15, Identities = 69/249 (27%), Positives = 122/249 (48%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFG---KKPDDLEFAIMDFLKGKCYWEDILIK-KTENLHILPGNDELNYFDFLLNQKQITQSNLK--MLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           + +VN KGGV KTT + NLA +++   K+V++VDLD QGN    FG   K  D   +A+   L G+    D  I+ +   L ++P +  L+  +  L   +  +  L+  ++ +     YDY++ID PP++ ++    L   D  LVP + + YA  GL ++I   +  ++  N +++I  +   V T     N++ EQ         G  V    I    + + A  Y + P+++          Y +L +E+L
  S:     6 LAIVNQKGGVGKTTTAVNLATAMAACQKRVLVVDLDPQGNASTGFGVPRKARDADSYAV---LIGEASIADAAIQTEVPGLEVVPASPNLSGAEIELVTMEHREFRLREALVRHAAASPYDYILIDCPPSLGLLTLNALVASDAVLVPLQCEFYALEGLSQLIRTVERVRKSLNPDLEIQGV---VLTMFDRRNNLSEQVAADVRGHFGDVVYRTVIPRNVRVSEAPSYGK-PVIVYDMACSGSRAYLDLAREVL 253
>gi|121634066|ref|YP_974311.1| hypothetical protein NMC0182 [Neisseria meningitidis FAM18] >gi|120865772|emb|CAM09501.1| conserved hypothetical protein [Neisseria meningitidis FAM18] (257 aa)
Score = 215, Expect = 1.0e-15, Identities = 57/193 (29%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT + NLAASL+  GK+V++VDLD QGN     G     L+  +   L G    +   ++  E  + +L  N  L   +  L Q+   +  LK  +  + E YD+++ID PP+++++    L      +VP   + YA  G+  +I   ++ ++  N ++ I  I  T  ++R  +  ++ EQ
  S:     6 LAIANQKGGVGKTTTTVNLAASLASRGKRVLVVDLDPQGNATTGSGIDKAGLQSGVYQVLLGDADVKSAAVRGKEGGYAVLGANRALAGAEIELVQEIAREVRLKNALKAVAEDYDFILIDCPPSLTLLTLNGLVAAGGVIVPMLCEYYALEGISDLIATVRKIRQAVNPDLDITGIVRTMYDSRSRLVAEVSEQ 200
>gi|88705408|ref|ZP_01103119.1| sporulation initiation inhibitor protein Soj [gamma proteobacterium KT 71] >gi|88700498|gb|EAQ97606.1| sporulation initiation inhibitor protein Soj [Congregibacter litoralis KT71] (265 aa)
Score = 215, Expect = 1.0e-15, Identities = 55/193 (28%), Positives = 98/193 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT   NLAASL+   K+V++VDLD QGN     G     L+ ++ D L   C   D +    E    +LP N ++   +  L Q    +  L+  + ++   YDY++ID PP+++++    L   D  ++  + + +A  GL  +++  ++ +   N  +++  I  T  + R ++ N +  Q
  S:     5 IAIANQKGGVGKTTTCVNLAASLAAMRKRVLLVDLDPQGNASMGSGVDKYSLKRSVYDVLVEACGVADAVQDAAEGGFMVLPANGDVTAAEVELIQVDGRERRLRAALGQVQSSYDYILIDCPPSLNLLTLNGLVAADGVIIAMQCEYFALEGLSALLDTIEQVRSSVNVGLEVEGILRTMYDPRNSLTNAVSSQ 199
>gi|148266266|ref|YP_001232972.1| cobyrinic acid a,c-diamide synthase [Geobacter uraniireducens Rf4] >gi|146399766|gb|ABQ28399.1| chromosome segregation ATPase [Geobacter uraniireducens Rf4] (257 aa)
Score = 215, Expect = 1.0e-15, Identities = 72/257 (28%), Positives = 128/257 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKT-ENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIFGRE 259
           I + N KGGV KTT S NLAASL++  ++ ++VD+D QGN  +  G    +L   + D L        I++K +   L ILP N +L   +  L      +  LK  +  L + YDY++ID PP++ ++    ++  +  L+P + + YA  GL +I+      ++  N ++KI  I  T  + R  + + + E+ ++   K +     +  +    + + A  + + PI++    S+    Y +L KEI+     GRE
  S:     5 ICIANQKGGVGKTTTSVNLAASLAVAERRTLLVDMDPQGNAGSGVGIDKRNLAETVYDALIDDADAAGIVLKTSFPYLDILPANSDLAGAELELVSIIGRELKLKHALAALVDSYDYILIDCPPSLGLLTVNAMTAAESVLIPLQCEFYAMEGLSQILKTIGLVQKGLNPSLKIEGILLTMFDARNNLSHQVSEE-IRSHFKKE---TFTTVVPRNVRLSEAPSHGK-PIILYDITSRGATSYMDLAKEII-----GRE 253
>gi|158312769|ref|YP_001505277.1| cobyrinic acid ac-diamide synthase [Frankia sp. EAN1pec] >gi|158108174|gb|ABW10371.1| Cobyrinic acid ac-diamide synthase [Frankia sp. EAN1pec] (275 aa)
Score = 215, Expect = 1.1e-15, Identities = 50/188 (26%), Positives = 100/188 (53%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHN 190
           + V N KGGV KTT   +L A+L   G++V++VDLD Q  +  + G  PD LE ++ D L G+     ++    +   +LP   EL   + +L  +   +  L++ + ++   YD+V++D PP++ V+    L+  D  ++P + +  +  G+ ++++   + +   N  +++  + PT  + R T H+
  S:     5 LAVANQKGGVAKTTSVASLGAALCELGRRVLLVDLDPQACLTFSLGLDPDSLELSVHDVLLGRLPAGIVIRSTPDGSDLLPATIELAGCEAILLSRTGREHALRLALVEIVAGYDFVLVDCPPSLGVLTINGLTAADEVVIPMQCETLSHRGVGQLLDTVADVQRLTNPRLRVRGVLPTLFDGR-TAHS 192
>gi|51245103|ref|YP_064987.1| chromosome partitioning protein Soj [Desulfotalea psychrophila LSv54] >gi|50876140|emb|CAG35980.1| related to chromosome partitioning protein Soj [Desulfotalea psychrophila LSv54] (256 aa)
Score = 215, Expect = 1.1e-15, Identities = 70/249 (28%), Positives = 112/249 (44%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I   +NKGGV KT  S NLA + +  GK+ ++ DLD QG     F  KP         F     + E I     +NL +LP N     FD  L   + ++S LK  +  +D  YD VI+D PP +S +      + D  ++P  P    TL  + +    + F+EK     KIV + + V  +  +H    ++S+K   +    ++ S+  S T      +G  R P++     +     Y+ + K+IL
  S:    14 IACYSNKGGVGKTATSVNLAYACAKSGKRTLLCDLDPQGASGFYFRIKPSKELREQAFFTNVDRFSEAIRASDFDNLDLLPANMSYRDFDIFLANMKKSRSRLKQTLKAVDSEYDIVILDCPPNISRLSENVFKVADKIIIPVIP---TTLSERTLGQLYEFFEEKGFKKEKIVPLFSMVQRQKKLH----KESMKRLRQQYPDFLVSDIPSCT--DIERMGIHRAPVLTYAKSNSVAQAYNEVWKDIL 253
>gi|28493016|ref|NP_787177.1| putative sporulation protein Soj [Tropheryma whipplei str. Twist] >gi|28572229|ref|NP_789009.1| sporulation/chromosome partition protein [Tropheryma whipplei TW08/27] >gi|28410360|emb|CAD66746.1| putative sporulation/chromosome partition protein [Tropheryma whipplei TW08/27] >gi|28476056|gb|AAO44146.1| putative sporulation protein Soj [Tropheryma whipplei str. Twist] (260 aa)
Score = 215, Expect = 1.1e-15, Identities = 65/254 (25%), Positives = 125/254 (49%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK--STAAVGYERVPIVMSVFKSKYQDEYHNLKKEILNYVIF 256
           + V N KGGV KTT + NLAA L+  G +V+ VDLD QG + A FG    + E+ + D L G+     ++    + + +LP N +L+  +  L  +   +  L   +      YD ++ID  P++ ++    L+     L+P E + +A  GL  ++   ++ +++ N  +K+  I   +    T+H   + +S+K      G+ +T+  I+ T K   ++  G   +P+ +     +    Y +L  E+++  +F
  S:     9 VAVCNQKGGVGKTTTTINLAACLAERGMRVLTVDLDPQGALTAGFGIS--NFEYTVYDLLLGRNRNAVLIQTSLKGVDVLPANIDLSAAEVYLVSEVAREQILAKELESFSSDYDVILIDCQPSLGLLTINALTASHGLLIPLECEYFAMRGLALLLETVRKIQDRLNTALKVDGIIATMFDMRTLHAREVLESVKKAFP--GLLLTT-VINRTIKFPDSSIAG---MPVTVFAPNHQASKNYRDLTHELVHRGVF 256
>gi|54310651|ref|YP_131671.1| putative ParA family protein [Photobacterium profundum SS9] >gi|46915094|emb|CAG21869.1| Putative ParA family protein [Photobacterium profundum SS9] (264 aa)
Score = 215, Expect = 1.1e-15, Identities = 53/193 (27%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT   NLAASL+   +KV+++DLD QGN     G     ++    + L  +  + D++I  T    H++  N ++   +  L +    +  L+  +  + + YD++ ID PPA++++    ++  D  LVP + + +A  GL  +++   +     N ++KI   + T  + R  + N++ +Q
  S:     5 IAIANQKGGVGKTTTCVNLAASLAATQRKVLVIDLDPQGNATMASGVDKYQVDATAYELLVEETPFNDVVITDTTGGYHLIAANGDVTAAEIKLMEVFAREVRLRNALEVVRDNYDFIFIDCPPALNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLTAVVNADLKIEGLLRTMFDPRNRLSNEVSQQ 199
>gi|39933369|ref|NP_945645.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris CGA009] >gi|192288725|ref|YP_001989330.1| Cobyrinic acid ac-diamide synthase [Rhodopseudomonas palustris TIE-1] >gi|39652994|emb|CAE25736.1| chromosome partitioning protein, ParA [Rhodopseudomonas palustris CGA009] >gi|192282474|gb|ACE98854.1| Cobyrinic acid ac-diamide synthase [Rhodopseudomonas palustris TIE-1] (284 aa)
Score = 215, Expect = 1.1e-15, Identities = 67/249 (26%), Positives = 117/249 (46%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED-ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDE------LYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I + N KGGV KTT + NL  +L+  G++V+IVDLD QGN     G    D   +  D L G+    D ++      LHI     +L+  +  L  +      L+  I  L++       Y YV+ID PP+++++    ++  D  LVP + + +A  GL +++   ++ +   N ++ I  I   V T     N++  Q +    +  G  V    I    + + A  Y + P+++   K    + Y  L  E++
  S:    23 IALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNTSTYDVLAGEAPLRDAVVATAVPRLHIAASTMDLSGLELELGHRGDRAFRLRDAIGVLNKDIDPPLDYTYVLIDCPPSLNLLTVNAMAAADAILVPLQCEFFALEGLSQLLQTVEQVRANLNPSLTIHGI---VLTMFDSRNNLSSQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGK-PVLVYDLKCVGSEAYLKLATEVI 274
>gi|171060866|ref|YP_001793215.1| cobyrinic acid ac-diamide synthase [Leptothrix cholodnii SP-6] >gi|170778311|gb|ACB36450.1| Cobyrinic acid ac-diamide synthase [Leptothrix cholodnii SP-6] (256 aa)
Score = 214, Expect = 1.2e-15, Identities = 54/191 (28%), Positives = 98/191 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGK-CYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + N KGGV KTT + NLAA L+  G++V++VDLD QGN     G     L+ ++ D L G     E     +     +L  N EL   +  L   +     LK  + ++   +D+++ID PP++S++    L+  +  +VP + + +A  GL  ++N  K+     N +++++  +    + R+T+   + EQ
  S:     7 IANQKGGVGKTTTTVNLAAGLAAIGQRVLVVDLDPQGNATMGSGVDKRALKLSVYDVLLGNSTVREARQTSEKVGYDVLGANRELAGAEIELVTMEHRDRRLKHALAEVAGDHDFILIDCPPSLSLLTLNGLNCANGVIVPMQCEYFALEGLSDLVNTVKQVHANLNRDLQLIGLLRVMFDPRITLQQQVSEQ 199
>gi|167041014|ref|YP_001663999.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter sp. X514] >gi|166855254|gb|ABY93663.1| Cobyrinic acid a,c-diamide synthase [Thermoanaerobacter sp. X514] (255 aa)
Score = 214, Expect = 1.2e-15, Identities = 57/196 (29%), Positives = 102/196 (52%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFL-KGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIP-TKVNTRVTIHNDIIEQSLK 198
           I + N KGGV KTT + NL  SL+  GKKV+ +D+D Q N+ + FG  P  L+      L + +     I+  K   + I+P + +L   +  L      +  LK  +N++ + +DY++ID PP++ ++    L+  D  +VP + + YA  GL +++N     K+  N  ++I  +  T  N R  +   ++++  K
  S:     5 IAIANQKGGVGKTTTTINLGYSLATQGKKVLCIDIDPQSNMTSGFGINPASLKHTTYTVLIEDEDIRNAIIPLKDLKVSIVPSSIQLAGAEIELVPMLSREYKLKNAVNQIKDEFDYILIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPELEIEGVVLTMFNARTNLSIQVVDEVKK 202
>gi|26989135|ref|NP_744560.1| ParA family protein [Pseudomonas putida KT2440] >gi|24983970|gb|AAN68024.1|AE016435_1 ParA family protein [Pseudomonas putida KT2440] (263 aa)
Score = 214, Expect = 1.2e-15, Identities = 74/246 (30%), Positives = 131/246 (53%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATF---GKKPDDLEFAIMDFLK---------GKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNT---RVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNL 246
           M+  V N KGGV K++++ NLAA+ + +G + ++VDLD Q N  ATF   G   D +   I DF +         GK +   I   +  NLH++  + +L+     L  K    + L+ L+  L+E Y+ + IDTPPA++    + L   +  L+PF+ D ++   L  ++   +E ++  +HN  +V     VN    R  +H  +++Q     L+ +G+ V   ++SS+ K   +  +  VP+V    + K   E+ +L
  S:     6 MRRVVFNQKGGVGKSSIACNLAAASAAEGYRTLLVDLDPQAN--ATFYLTGLVNDTIPPGIADFFRQTLSPVTAAGKKHRVAITETRYNNLHLVTASPDLSDLQSKLESK-FKINKLRKLLVALEEDYERIYIDTPPALNFYTFSALVAAERLLIPFDCDSFSRQALHSVMAEVEELRQ--DHNPALVVEGVVVNQFAGRTALHQTLVDQ-----LRNEGMPVLPVYLSSSIKMRES-HHASVPLVHLAPRHKLALEFIDL 255
>gi|32471858|ref|NP_864852.1| chromosome partitioning protein parA [Rhodopirellula baltica SH 1] >gi|32397229|emb|CAD72536.1| chromosome partitioning protein parA [Rhodopirellula baltica SH 1] (248 aa)
Score = 214, Expect = 1.2e-15, Identities = 49/162 (30%), Positives = 88/162 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKK-TENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKE 164
           + VVN KGGV KTT S NL+A+L++ GKK ++VD+D Q N  +  G+ P     A    L G     D +++    +L +LPG+   +  D L      + + ++  ++ +   Y+Y++ID PP+   +  T L+     L+P + + +A +G+ ++I   K+
  S:     5 LSVVNQKGGVGKTTTSVNLSAALAMSGKKTLLVDIDPQCNATSALGQSP-----AAHHGLTGTDSLPDSIVETDVPHLGLLPGSRSFHDADVLAETGDRSTARVRKHLDSVMSEYEYILIDCPPSAGAMTETALTASTEVLIPIQCEYFAMVGVTQLIGTIKK 162
>gi|145298370|ref|YP_001141211.1| SOJ-like and chromosome partitioning protein [Aeromonas salmonicida subsp. salmonicida A449] >gi|142851142|gb|ABO89463.1| SOJ-like and chromosome partitioning protein [Aeromonas salmonicida subsp. salmonicida A449] (264 aa)
Score = 214, Expect = 1.3e-15, Identities = 51/181 (28%), Positives = 93/181 (51%)
  Q:     5 VVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIK-----KTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAIPTKVNTR 185
           V N KGGV KTT   +LA  L+  G++V+++D D   ++ A      D L+  + +  +      +++ K     K EN+H+LP +  L   D ++  ++     +K  + ++ + YDYV+ID PP + V++   L+  D  LVP + +  A  GL+R++   +  +       +   IPT  + R
  S:     6 VANQKGGVGKTTTVVSLAGILAQRGQRVLLIDTDPHASLTAYLDFDSDRLDGTLYELFQAAKPTAELVNKLTLRTKFENIHLLPASITLATLDRVMGNREGMGLVIKRALLRIQDQYDYVLIDCPPVLGVMMVNALAACDRILVPVQTEFLALKGLERMMKTFEIMQRSKREKFRFTVIPTMFDKR 191
>gi|157377625|ref|YP_001476225.1| cobyrinic acid a,c-diamide synthase [Shewanella sediminis HAW-EB3] >gi|157319999|gb|ABV39097.1| cobyrinic acid a,c-diamide synthase [Shewanella sediminis HAW-EB3] (262 aa)
Score = 214, Expect = 1.4e-15, Identities = 56/193 (29%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           I V N KGGV KTT   NLAASL+   +KV+++DLD QGN     G     +E    + L  +  +++++ K T   + ++ GN ++   +  L +    +  L+  +  + + YD++ ID PP+++++    +S  D  LVP + + YA  GL  +++   +     N  + I  I  T  + R  + ND+ +Q
  S:     5 IAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGIDKYSVENTAYELLVDEKSFDEVVYKDTTGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALAPIKDDYDFIFIDCPPSLNMLTVNAMSAADSILVPMQCEYYALEGLTALMDTISKLGSMVNPGLHIEGILRTMYDPRNRLSNDVSDQ 199
>gi|86147163|ref|ZP_01065479.1| ParA family protein [Vibrio sp. MED222] >gi|85835047|gb|EAQ53189.1| ParA family protein [Vibrio sp. MED222] (257 aa)
Score = 214, Expect = 1.4e-15, Identities = 52/193 (26%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT   NLAAS++   +K+++VDLD QGN     G     +E    D L     +++++ + T  N  ++  N ++   +  L +    +  LK  +  +   YD++ ID PP+++++    ++  D  LVP + + +A  GL  +++   +     N N+KI   + T  + R  + N++ +Q
  S:     5 VAIANQKGGVGKTTTCINLAASMAATKRKILVVDLDPQGNATMASGVDKYQVEATAYDLLVEDTPFDEVVCRSTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKNALASIRNNYDFIFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGLLRTMYDPRNRLSNEVSDQ 199
>gi|169184091|ref|ZP_02844486.1| Cobyrinic acid ac-diamide synthase [Thauera sp. MZ1T] >gi|169008854|gb|EDS55645.1| Cobyrinic acid ac-diamide synthase [Thauera sp. MZ1T] (259 aa)
Score = 214, Expect = 1.5e-15, Identities = 63/218 (28%), Positives = 116/218 (53%)
  Q:     1 MKIGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIA-TFGKKPDDLEFAIMDF--------LKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDEL---YDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTK 218
           M+  V N KGGV K+T++ NLAA  +  GK+ ++VDLD QGN      G   D L+  + DF        L  +   + ++    E LH++P + +L      L  K  ++  +  L + L+EL   +D V IDTPPA++    + L   D  L+PF+ D+++   L  ++   +E K  +N  +++  I   +   R ++   ++++     L  +G+ V   ++S++ +
  S:     1 MRRVVFNQKGGVGKSTITCNLAAIAAAQGKRTLVVDLDPQGNSTQYLLGAGVDVLDATLADFFDQTLNFKLNPRGTKDFVVATPFERLHVMPSHPQLEE----LQSKLESRYKIYKLRDALEELAKDFDCVFIDTPPALNFFTRSALIAADACLIPFDCDEFSRKALYSLLANVEEIKADHNRALEVEGIVVNQFQPRASLPQKVVQE-----LIDEGLPVLQPYLSASIR 222
>gi|161870872|ref|YP_001600046.1| chromosome partitioning protein, ParA family protein [Neisseria meningitidis 053442] >gi|161596425|gb|ABX74085.1| chromosome partitioning protein, ParA family protein [Neisseria meningitidis 053442] (257 aa)
Score = 214, Expect = 1.5e-15, Identities = 56/193 (29%), Positives = 99/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTENLH-ILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTIHNDIIEQ 195
           + + N KGGV KTT + NLAASL+  GK+V++VDLD QGN     G     L+  +   + G    +   ++  E  + +L  N  L   +  L Q+   +  LK  +  + E YD+++ID PP+++++    L      +VP   + YA  G+  +I   ++ ++  N ++ I  I  T  ++R  +  ++ EQ
  S:     6 LAIANQKGGVGKTTTTVNLAASLASRGKRVLVVDLDPQGNATTGSGIDKASLQSGVYQVVLGDADVKSATVRSKEGGYAVLGANRALAGAEIELVQEIAREVRLKNALKAVAEDYDFILIDCPPSLTLLTLNGLVAAGGVIVPMLCEYYALEGISDLIATVRKIRQAVNPDLDITGIVRTMYDSRSRLVAEVSEQ 200
>gi|18976898|ref|NP_578255.1| soj - like protein [Pyrococcus furiosus DSM 3638] >gi|18892511|gb|AAL80650.1| soj homolog [Pyrococcus furiosus DSM 3638] (258 aa)
Score = 214, Expect = 1.5e-15, Identities = 54/186 (29%), Positives = 102/186 (54%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDL----EFAIMDFLKGKCYWEDILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVAI-PTKVNTRVTI 188
           + + N KGGV KTT++ NL  +LS  GKKV++VD+D Q N+  TF     D+    +  +   +  +   ED +++  +NLH++P +  L   +  +      +  L+  +  +   YDY++ID PP+M V +  +L+  D  L+P E   +  +G++ + N  K  +E+ N +++++ I P K   +  +
  S:     5 VSIANQKGGVGKTTITLNLGYALSKMGKKVLLVDVDPQFNL--TFALIGMDVINYSDKNVGTLMTKESSIEDTIVEINQNLHLIPSHLMLASKEIEIINTYNRERRLEKALKPVFPEYDYILIDNPPSMGVFLVNSLTASDFVLIPLELSYFGVIGMQLMFNLMKMIREETNDSLRLMGIVPNKFTKQTRV 193
>gi|90413745|ref|ZP_01221733.1| Putative ParA family protein [Photobacterium profundum 3TCK] >gi|90325214|gb|EAS41711.1| Putative ParA family protein [Photobacterium profundum 3TCK] (264 aa)
Score = 213, Expect = 1.6e-15, Identities = 53/193 (27%), Positives = 100/193 (51%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWEDILIKKTE-NLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQ 195
           I + N KGGV KTT   NLAASL+   +KV+++DLD QGN     G     ++    + L  +  + D++I  T    H++  N ++   +  L +    +  L+  +  + + YD++ ID PPA++++    ++  D  LVP + + +A  GL  +++   +     N ++KI   + T  + R  + N++ +Q
  S:     5 IAIANQKGGVGKTTTCVNLAASLAATQRKVLVIDLDPQGNATMASGVDKYQVDATAYELLVEETPFNDVVITDTTGGYHLIAANGDVTAAEIKLMEVFAREVRLRNALEVVRDNYDFIFIDCPPALNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLTAVVNADLKIEGLLRTMFDPRNRLSNEVSQQ 199
>gi|163724339|ref|ZP_02131870.1| Cobyrinic acid a,c-diamide synthase [Desulfatibacillum alkenivorans AK-01] >gi|161402540|gb|EDQ26777.1| Cobyrinic acid a,c-diamide synthase [Desulfatibacillum alkenivorans AK-01] (265 aa)
Score = 213, Expect = 1.6e-15, Identities = 70/249 (28%), Positives = 126/249 (50%)
  Q:     3 IGVVNNKGGVLKTTLSTNLAASLSLDGKKVIIVDLDGQGNVIATFGKKPDDLEFAIMDFLKGKCYWED---ILIKKTENLHILPGNDELNYFDFLLNQKQITQSNLKMLINKLDELYDYVIIDTPPAMSVVVATTLSIVDVALVPFEPDQYATLGLKRIINAAKEFKEKNNHNMKIVA-IPTKVNTRVTIHNDIIEQSLKPKLKTQGVYVTSNFISSTTKSTAAVGYERVPIVMSVFKSKYQDEYHNLKKEIL 251
           I VVN KGGV KT    NL A+LS   KKV+IVD+D Q N     G + D+      + + G    +    ++  K   L ++P + +L   +  L  +   ++ LK L   L++ YD++++DTPP++S++     +     L+P +   YA   L  +++  +  +E  N ++ I   +PT  + R  +   I+E  L+   + +G    +   S+ T + +A  +++ P+V    +S    +Y NL KE+L
  S:     9 IAVVNEKGGVGKTATVINLGAALSKQDKKVLIVDMDPQFNATHGLGVELDEDALTTYEVMVGDGDLDPADAVVATKWAGLGLVPSHVDLAGAEAELMDQPGRENRLKRL-RPLEKDYDFILLDTPPSLSLLTINVFTFAKEVLIPCQTHPYALKALDDLLDTIELVRENINPDLNITGLVPTFYDPRTRVSRGIMEL-LQADERFEGKIFDTVIRSNATIAESA--WKQKPVVFFRSRSYGALDYTNLAKELL 257