>gi|26553532|ref|NP_757466.1| DNA-directed RNA polymerase subunit beta' [Mycoplasma penetrans HF-2] >gi|41018047|sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|26453538|dbj|BAC43870.1| DNA-directed RNA polymerase subunit beta' [Mycoplasma penetrans HF-2] (1288 aa)
Score = 6361, Expect = 0.0e+00, Identities = 1288/1288 (100%), Positives = 1288/1288 (100%)
  Q:     1 MNSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           MNSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY
  S:     1 MNSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
>gi|31544418|ref|NP_852996.1| DNA-directed RNA polymerase subunit beta' [Mycoplasma gallisepticum R] >gi|33860206|sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|31541262|gb|AAP56564.1| RpoC [Mycoplasma gallisepticum R] (1286 aa)
Score = 4166, Expect = 0.0e+00, Identities = 829/1282 (64%), Positives = 1022/1282 (79%)
  Q:     7 RITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRK-----SENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           RI  +QI +AS E++R WS+GEV K ETINYKSLKPE DGLFDEAIFGPVKD+ECACGKYKKIK RG+ CEKCGVEITESIVRRER+GHI+LA P+AHIWMTKELP PSKISLVLD+SYKE+E+VVYFVNYI+L+ GN K P  F FKEV+DLS  K SK  R KLRK LREI    D   + +++I +K A  +Y+ L ES++PFSI+EV  FI + TG+R GIGAEAILELL+ +DL KEY  I E+L         N  D K K+ +RRLE IKWLK+S  K   MILK I VTPPDTRPIIQL+G +FTTSDIN+FYR+IIIRNERLK++I+  APS+ILNNEKR+LQE VDALFDNASRKKP+  KDKRPLKSL++ LKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMY+VGIP  MILKLFKPFII ELI + +++G    PI  NIK AE++I  +   IW I++KVIK+RPVLLNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVHVP+S EAVAEAR I+LASWHILGPKDGKP+ TPTQDMVLGNYYLT EK N  G+G++F++ D++   Y+ K+V +H++IG+ T    KK F K GI+ITTVGK I+N ++PEEM+YLN+ DNL EL +++IV  G+D++  + K+ +YK F KKTLS+I+ IL++ +    L+ VP  +DKIK+ GF+YST S+TTIS FD+P Y  K++Y  + ++ + ++K  YQKGLLTDDERY KV+  W+ V + VS+DI+++I +PEY  NSIV++A+SGARGNISNFTQL GMRGLMSKSYNYDQK KS+VI+DTIEVPIK+SFIEGLT++EYFNSSYGARKGMTD AMKTSKSGYMTRKLVDA Q+VI+N+ DC T KG ++  I ++  G V+E+L+ER++ R+ I  +   K+K++L  A  +IT  +A +I  A + K  +RS ++C+   G+CQKCFG DLTTN LV+  TAIGVIAAQSIGEPGTQLTMRTFHTGG ++  NI QGFERLKQ+FD++ PK+WE + I+E EG V SI +   +    ++ IK   E+  Y+VPFD+ + V   D V PGSK+TEGSID+K LL+VAGIE VR Y ++EVQKVYRLQGIEIADKY+EV IRQLTNK+Q+ D G+SD+F+GQ +DIN FRKE   ++++ +K P  A+N +FGLDEAP+KTGSFL+AASFQDTKKILTDA VK QID L GLKENVI GNLIP GTG  S+E+II+ G +  E EY
  S:    12 RIRGLQISIASAEEMRSWSHGEVKKPETINYKSLKPETDGLFDEAIFGPVKDFECACGKYKKIKHRGRTCEKCGVEITESIVRRERMGHIDLAVPVAHIWMTKELPSPSKISLVLDVSYKEVEEVVYFVNYIILNPGNSKNPV-FKFKEVVDLSG-KGSKSARIKLRKVLREIK---DKHQADKHSIIYKRASDYYNKLKESHLPFSIDEVAKFIETHTGIRLGIGAEAILELLEGVDLQKEYDLINEELNSYSKDLKANKEDQKVKRALRRLETIKWLKESGIKASNMILKVIPVTPPDTRPIIQLDGARFTTSDINNFYRRIIIRNERLKKIIELRAPSVILNNEKRMLQEVVDALFDNASRKKPITAKDKRPLKSLTDRLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYEVGIPAPMILKLFKPFIIRELIMRFNEDGQEIKPIAPNIKIAEQMIAQKSERIWDIVDKVIKERPVLLNRAPTLHRLGIQAFEPKIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPISKEAVAEARAIMLASWHILGPKDGKPVATPTQDMVLGNYYLTTEKRNEKGEGLIFSDFDQVILAYEAKQVSIHALIGLSTKCLTKKPFAKQGIVITTVGKAIMNSIMPEEMAYLNDGDNLLELDESNIVFAGEDFKQKLAKRPLYKPFGKKTLSKIIEILYKNF---PLQKVPQVLDKIKEFGFKYSTLSSTTISVFDIPRYDNKQEYITKANEMIAKLKHMYQKGLLTDDERYTKVIRLWADVKDNVSRDIKEIITRPEYKENSIVVIADSGARGNISNFTQLFGMRGLMSKSYNYDQKIKSQVIRDTIEVPIKHSFIEGLTINEYFNSSYGARKGMTDIAMKTSKSGYMTRKLVDAAQEVIINDSDCNTNKGIVVSTITNSLDGGVVETLSERIVTRYTIDPIYDEKTKELLVDADTLITSELAEKIAKANVTKALIRSPIYCQSTKGLCQKCFGNDLTTNDLVQIGTAIGVIAAQSIGEPGTQLTMRTFHTGGTANEGNITQGFERLKQIFDVVSPKEWELATIAENEGVVESITS---DATARIIRIKTRLEAEEYRVPFDAVISVNPKDVVYPGSKLTEGSIDIKHLLRVAGIETVRQYFLEEVQKVYRLQGIEIADKYVEVTIRQLTNKLQVIDVGDSDYFVGQTVDINKFRKEVTNMLIA-NKRPPVAINQVFGLDEAPAKTGSFLSAASFQDTKKILTDAAVKNQIDYLVGLKENVILGNLIPAGTGFMSSEEIIKAGEEALEKEY 1286
>gi|188518527|ref|ZP_02556764.2| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524076|ref|ZP_02557311.2| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530834|ref|ZP_02546576.2| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188997871|gb|EDU66968.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659894|gb|EDX53274.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (1305 aa)
Score = 3966, Expect = 0.0e+00, Identities = 806/1281 (62%), Positives = 1002/1281 (78%)
  Q:     8 ITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKN--FNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENA-----IKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGML-----------------FANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           I S+ I +ASPE+I  WS GE+TK ETINYKSLKPE +GLFDE+IFGP KDYEC CGKY+K+K +GK+CE+C VEITESIVRRER+GHIELAAP+AHIW TKELP PSKISL+LDI+YKE++QVVYFVNYIVLDEGN ++     FN KEV+DL+S K+S  +R+KLR+TLR I E I+ E + E         +++A T+   L +SN+PFS+++V  FI   TG+RFGIGAEAI ELL+ ++L++E++ I + ++ S N  D KTK+L+RRLE ++W+KDS +KPEWM++  I VTP +TRPII L+GG+FTTSD N+FYRKIIIRNERLK++   +AP I+L+NEKRLLQEAVD+LFDN SRKKP++GKDKRPLKSLS HLKGKQGLFRQNLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLF+P+II ELI+K D+ GN   PI +NIK AE+ IL QD+ IWP++ KVIKQRPV+LNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVH+PLS EAVAEAR+I+LASWHILGPKDGKPIITPTQDM+LG YYLT EK   P + M+                 FA  DE    Y++K + ++ +IGI T AF  K F K+GIL+TTVGK+I N   P    Y+N+  NL   +  +I+   +    +++   + +  TKKTLS +++ L   Y  + +E+VP TMDKIK +GF+YS  SAT+ISAFD+P Y +K +YF+ETD+ V +++++Y  G LTDDERY KVV AWS   ++V+ DIEKLI   EY  N IVIMA SGARGN SNFTQL+GMRGLMSKSYNYDQK  S VIKDTIE+PIK+SFIEGL+VSEYFNSS+GARKGMTDTAMKT+KSGYMTRKLVD+TQ V++   DC TK+G I+  I +TK  + IESL +R++ RF I  +   K+K ++    ++IT  +AN I ++GI +VEVRS LHC    G+CQKCFG DL+TNKL+E  TAIGVIAAQSIGEPGTQLTMRTFHTGGV+  TNI QGFER+KQLFD I P++ EK+IIS+++G V  I+   +     VV   N    ++Y    ++ LR++ GD V  G KITEGSIDV +LLK AGIE VR+YIIKEVQKVYR+QGIEI+DKYIEVII QLTNKV I + G+S  F+G+ I IN F  E  + +L + K P +A+N +FGLD APSK+GSFL+AASFQDTKKILTDA  + Q D L GLKENVI GNLIP GTG K  E++I  G +MY+ +Y
  S:     6 IKSLTISIASPEQILSWSKGEITKPETINYKSLKPEPNGLFDESIFGPSKDYECYCGKYRKVKHKGKVCERCHVEITESIVRRERMGHIELAAPVAHIWFTKELPSPSKISLLLDITYKEVDQVVYFVNYIVLDEGNNEYDGKSIFNKKEVLDLTSPKNSIRSRNKLRRTLRNIQERIEEELNHEREALIQDFDYRLAVTYDQMLKDSNIPFSVKDVMAFIEKHTGVRFGIGAEAIHELLEKLNLEEEHEKIKQAIQNSPNAYDQKTKRLLRRLECVRWIKDSGSKPEWMVMTRIPVTPSETRPIISLDGGRFTTSDTNNFYRKIIIRNERLKQMQATDAPEILLDNEKRLLQEAVDSLFDNNSRKKPVVGKDKRPLKSLSNHLKGKQGLFRQNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFRPYIISELIRKRDEFGNEIQPICANIKLAEQKILAQDDEIWPVVEKVIKQRPVILNRAPTLHRLGIQAFEPKMVDGKAIRLHPLVTTAFNADFDGDQMAVHIPLSKEAVAEARSILLASWHILGPKDGKPIITPTQDMILGIYYLTKEKFPQPIEEMMLKDPVQARIEFINHFHIFATQDEAIRAYKLKTIRINDVIGITTKAFDNKSFSKEGILVTTVGKIIFNQAFPTNFPYINDVKNLYGDNQFEIIRMHESILDYLKAYNLKEPLTKKTLSTVIDYL---YKVSEIEVVPQTMDKIKALGFKYSMISATSISAFDIPSYDQKYEYFKETDELVAKLREFYLDGKLTDDERYTKVVQAWSQTKDKVTHDIEKLINSDEYKDNPIVIMAKSGARGNTSNFTQLAGMRGLMSKSYNYDQKNNSGVIKDTIEIPIKHSFIEGLSVSEYFNSSFGARKGMTDTAMKTAKSGYMTRKLVDSTQAVVIKGNDCGTKEGIIVREIRNTKDNTSIESLKDRIVGRFSINPIYDTKNKLIIE-GDKLITNEIANMIQNSGIREVEVRSPLHCSSLYGVCQKCFGLDLSTNKLIETGTAIGVIAAQSIGEPGTQLTMRTFHTGGVAGDTNITQGFERIKQLFDCIQPQENEKAIISQVKGTVDRIEKDSNTNGYNVVIKYNKDNFVSYPTRPNAVLRIKTGDNVVAGQKITEGSIDVNDLLKYAGIENVRHYIIKEVQKVYRMQGIEISDKYIEVIISQLTNKVTITNPGDSGLFVGETISINEF-TEVAQSMLVNKKKPPSAINQVFGLDHAPSKSGSFLSAASFQDTKKILTDAAARSQKDMLIGLKENVILGNLIPAGTGLKDVEEVIAYGEEMYKKQY 1305
>gi|171920800|ref|ZP_02931984.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178761|ref|ZP_02554817.2| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024143|ref|ZP_02570056.2| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039536|ref|ZP_02998265.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 8] >gi|188039660|ref|ZP_02998359.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 8] >gi|188039675|ref|ZP_02998370.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 8] >gi|188568697|ref|ZP_03005460.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 2] >gi|188592507|ref|ZP_03005840.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 10] >gi|195867773|ref|ZP_03079774.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903562|gb|EDT49851.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209373|gb|EDU06416.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018769|gb|EDU56809.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195660628|gb|EDX53884.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (1305 aa)
Score = 3964, Expect = 0.0e+00, Identities = 806/1281 (62%), Positives = 1002/1281 (78%)
  Q:     8 ITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKN--FNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENA-----IKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGM-----------------LFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           I S+ I +ASPE+I  WS GE+TK ETINYKSLKPE +GLFDE+IFGP KDYEC CGKY+K+K +GK+CE+C VEITESIVRRER+GHIELAAP+AHIW TKELP PSKISL+LDI+YKE++QVVYFVNYIVLDEGN ++     FN KEV+DL+S K+S  +R+KLR+TLR I E I+ E + E         +++A T+   L +SN+PFS+++V  FI   TG+RFGIGAEAI ELL+ ++L++E++ I + ++ S N  D KTK+L+RRLE ++W+KDS +KPEWM++  I VTP +TRPII L+GG+FTTSD N+FYRKIIIRNERLK++   +AP I+L+NEKRLLQEAVD+LFDN SRKKP++GKDKRPLKSLS HLKGKQGLFRQNLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLF+P+II ELI+K D+ GN   PI +NIK AE+ IL QD+ IWP++ KVIKQRPV+LNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVH+PLS EAVAEAR+I+LASWHILGPKDGKPIITPTQDM+LG YYLT EK   P + M                 +FA  DE    Y++K + ++ +IGI T AF  K F K+GIL+TTVGK+I N   P    Y+N+  NL   +  +I+   +    +++   + +  TKKTLS +++ L   Y  + +E+VP TMDKIK +GF+YS  SAT+ISAFD+P Y +K +YF+ETD+ V +++++Y  G LTDDERY KVV AWS   ++V+ DIEKLI   EY  N IVIMA SGARGN SNFTQL+GMRGLMSKSYNYDQK  S VIKDTIE+PIK+SFIEGL+VSEYFNSS+GARKGMTDTAMKT+KSGYMTRKLVD+TQ V++   DC TK+G I+  I +TK  + IESL +R++ RF I  +   K+K ++    ++IT  +AN I ++GI +VEVRS LHC    G+CQKCFG DL+TNKL+E  TAIGVIAAQSIGEPGTQLTMRTFHTGGV+  TNI QGFER+KQLFD I P++ EK+IIS+++G V  I+   +     VV   N    ++Y    ++ LR++ GD V  G KITEGSIDV +LLK AGIE VR+YIIKEVQKVYR+QGIEI+DKYIEVII QLTNKV I + G+S  F+G+ I IN F  E  + +L + K P +A+N +FGLD APSK+GSFL+AASFQDTKKILTDA  + Q D L GLKENVI GNLIP GTG K  E++I  G +MY+ +Y
  S:     6 IKSLTISIASPEQILSWSKGEITKPETINYKSLKPEPNGLFDESIFGPSKDYECYCGKYRKVKHKGKVCERCHVEITESIVRRERMGHIELAAPVAHIWFTKELPSPSKISLLLDITYKEVDQVVYFVNYIVLDEGNNEYDGKSIFNKKEVLDLTSPKNSIRSRNKLRRTLRNIQERIEEELNHEREALIQDFDYRLAVTYDQMLKDSNIPFSVKDVMAFIEKHTGVRFGIGAEAIHELLEKLNLEEEHEKIKQAIQNSPNAYDQKTKRLLRRLECVRWIKDSGSKPEWMVMTRIPVTPSETRPIISLDGGRFTTSDTNNFYRKIIIRNERLKQMQATDAPEILLDNEKRLLQEAVDSLFDNNSRKKPVVGKDKRPLKSLSNHLKGKQGLFRQNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFRPYIISELIRKRDEFGNEIQPICANIKLAEQKILAQDDEIWPVVEKVIKQRPVILNRAPTLHRLGIQAFEPKMVDGKAIRLHPLVTTAFNADFDGDQMAVHIPLSKEAVAEARSILLASWHILGPKDGKPIITPTQDMILGIYYLTKEKFPQPIEEMILKDPVQARIEFINHFHIFATQDEAIRAYKLKTIRINDVIGITTKAFDNKSFSKEGILVTTVGKIIFNQAFPTNFPYINDVKNLYGDNQFEIIGMHESILDYLKAYNLKEPLTKKTLSTVIDYL---YKVSEIEVVPQTMDKIKALGFKYSMISATSISAFDIPSYDQKYEYFKETDELVAKLREFYLDGKLTDDERYTKVVQAWSQTKDKVTHDIEKLINSDEYKDNPIVIMAKSGARGNTSNFTQLAGMRGLMSKSYNYDQKNNSGVIKDTIEIPIKHSFIEGLSVSEYFNSSFGARKGMTDTAMKTAKSGYMTRKLVDSTQAVVIKGNDCGTKEGIIVREIRNTKDNTSIESLKDRIVGRFSINPIYDTKNKLIIE-GDKLITNEIANMIQNSGIREVEVRSPLHCSSLYGVCQKCFGLDLSTNKLIETGTAIGVIAAQSIGEPGTQLTMRTFHTGGVAGDTNITQGFERIKQLFDCIQPQENEKAIISQVKGTVDRIEKDSNTNGYNVVIKYNKDNFVSYPTRPNAVLRIKTGDNVVAGQKITEGSIDVNDLLKYAGIENVRHYIIKEVQKVYRMQGIEISDKYIEVIISQLTNKVTITNPGDSGLFVGETISINEF-TEVAQSMLVNKKKPPSAINQVFGLDHAPSKSGSFLSAASFQDTKKILTDAAARSQKDMLIGLKENVILGNLIPAGTGLKDVEEVIAYGEEMYKKQY 1305
>gi|13508254|ref|NP_110203.1| DNA-directed RNA polymerase subunit beta' [Mycoplasma pneumoniae M129] >gi|2500615|sp|P75271|RPOC_MYCPN DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|1674001|gb|AAB95975.1| DNA-directed RNA polymerase beta' chain [Mycoplasma pneumoniae M129] (1290 aa)
Score = 3960, Expect = 0.0e+00, Identities = 773/1279 (60%), Positives = 999/1279 (78%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPK--NFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTS--DIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQN-NAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +I++ +AS + I  WS GEVTK+ETINYKSLKPE  GLFDEAIFGPVKDYECACGK+KKIK+RG  C++CGV +TESIVRRER+GHI L +P+AHIWM+KELP PSKISLVL+ISYKE+EQV+YFVNYIVLD G  K PK   F FKEV+DL+  K S  TR K+R+ +  I+ ++    S E+  K KI   FY++L  S++PFS+ + FN+I  +TG R GIGAEAILELL  IDL+ E+  + + LRK++  S  D K KK++R+LE I W ++S   P+ MIL  + V PPD RPIIQL+G KFTTSDIN+FYR++IIRN+RL+R++++   P+I++NNEKRLLQE+VDALFDN+SR KP L KDKR LKSL++ LKGKQGLFR NLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLFKPFIIH LI K D  GN   PI S+I+ AE +I NQD+ IW I+  VIK RPVLLNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVHVPLS  AV EAR I+LAS HILG KDG+PI+TPTQDMVLGNYYLT E+    G+G++F  V E +  Y+  KVH+H+I+GI T AFP K F   G LITTVGK+I NDVL + + Y+N  +  E       IV    D R  I   +V  AF KK +S+++++L   Y+    + +P  ++ IK +GF+YST S+TT+S FD+P+Y+ K++YF+E D++V + K++Y KGLLTDDERYK+VV  W+ V  +VS +I+ LI++ EY  NSIV+MA+SGARGNISNFTQL GMRGLMSKS+NY++  +SK+IKDTIEVPIK+SF+EGLT++EYFNSSYGARKGMTDTAMKT+KSGYMTRKLVDAT ++I+N++DC T+KG ++E I +TK+ S++ESL +R++NR+ I  ++ P++K  + PA  +IT+ +A +I    I +V VRSV++C+ ENG+CQ CFG DL+T KLVE  TA+GVIAAQSIGEPGTQLTMRTFHTGGVS+  N+AQGFERLKQ+F+++ PK +E+ +ISE++G V SI  + +   +L   I++S +   Y +PF ++LRV+ GD V+ GSKITEGSID+++LL+VAGI+ VR Y+I E+QKVYR+QGIEIADKY+E+IIRQLT+ +Q+ D+G+S+ F+GQ++  +   + N+ L+LS  K+P  A+N +FG+DEA SK+ SFL+AASFQDTKKILTDA VK Q+D L GLKENVI G  IP GTG  ++E++   G K  + EY
  S:    17 AIKLSIASNDTILNWSEGEVTKAETINYKSLKPEPGGLFDEAIFGPVKDYECACGKFKKIKYRGVRCDRCGVWVTESIVRRERMGHIALVSPVAHIWMSKELPSPSKISLVLNISYKEVEQVLYFVNYIVLDTGKIKDPKIMPFKFKEVLDLAG-KGSLTTRQKMRRVIGYIFRNLIKNRSSEDYRKGKI---FYESLKNSSLPFSLNDAFNYIKKYTGFRVGIGAEAILELLNKIDLNYEFSKLNDALRKAKKDSVEDAKVKKILRQLETISWFRNSKLHPKNMILHTVPVIPPDIRPIIQLDGAKFTTSDINNFYRRVIIRNDRLRRILEDGTVPAIVVNNEKRLLQESVDALFDNSSRHKPALSKDKRSLKSLTDRLKGKQGLFRHNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFKPFIIHGLINKFDSNGNEIRPIASSIRQAEDMIKNQDDLIWGIVYDVIKDRPVLLNRAPTLHRLGIQAFEPRIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPLSENAVNEARAILLASKHILGLKDGRPIVTPTQDMVLGNYYLTTERKGQTGEGIIFGTVHEARAAYEAGKVHLHAIVGISTKAFPNKHFEAQGTLITTVGKIIFNDVLGDNIPYINEGEFDEHACPQKFIVPPSGDVRAAIAAHQVLPAFGKKVISKLIDLL---YTVVEFKDLPRILENIKALGFKYSTHSSTTVSVFDIPKYSNKQQYFDEADQQVLKYKQFYNKGLLTDDERYKRVVKLWNGVKEKVSSEIQDLIKREEYRDNSIVVMADSGARGNISNFTQLFGMRGLMSKSFNYERNNQSKIIKDTIEVPIKHSFLEGLTINEYFNSSYGARKGMTDTAMKTAKSGYMTRKLVDATHELIINHDDCGTRKGIVVEAIVETKTRSLVESLFDRIVNRYTIGPILDPETKAEIVPANSLITQELAKQICATSIKQVLVRSVIYCERENGVCQYCFGVDLSTGKLVELGTAVGVIAAQSIGEPGTQLTMRTFHTGGVSTENNLAQGFERLKQIFEVVAPKDYERCVISEVKGVVKSITTTQNAQEVL---IESSVDERTYSIPFSAQLRVKVGDAVELGSKITEGSIDIRQLLRVAGIQRVRQYMIVEIQKVYRIQGIEIADKYVEIIIRQLTSLLQVTDAGSSNLFVGQLVHSHHLNELNKSLLLS-GKMPVIAINQVFGIDEAASKSNSFLSAASFQDTKKILTDAAVKTQVDYLLGLKENVIIGGKIPAGTGFLTDEELAYLGAKTVQEEY 1290
>gi|183508778|ref|ZP_02689962.2| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701975|ref|ZP_02554364.2| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|182675721|gb|EDT87626.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700739|gb|EDU19021.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (1305 aa)
Score = 3949, Expect = 0.0e+00, Identities = 800/1281 (62%), Positives = 1004/1281 (78%)
  Q:     8 ITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKN--FNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENA-----IKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGML-----------------FANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           I S+ I +ASPE+I  WS GE+TK ETINYKSLKPE +GLFDE+IFGP KDYEC CGKY+K+K +GKICE+C VEITESIVRRER+GHIELAAP+AHIW TKELP PSKISL+LDI+YKE++QVVYFVNYIVLDEGN  +     FN KEV+DL+S K+S  +R+KLR+TLR I E I+ E + E         +++A T+   L +SN+PFS+++V  FI   TG+RFGIGAEAI ELL+ ++L++E++ I + ++ S N  D KTK+L+RRLE ++W+KDS +KPEWM++  I VTP +TRPII L+GG+FTTSD N+FYRKIIIRNERLK++   +AP I+L+NEKRLLQEAVD+LFDN SRKKP++GKDKRPLKSLS HLKGKQGLFRQNLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLF+P+II ELI+K D+ GN   PI +NIK AE+ IL QDN IWP++ KVIKQRPV+LNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVH+PLS EAVAEAR+I+LASWHILGPKDGKPIITPTQDM+LG YYLT EK     + M+                 F+  DE    Y++K + ++ +IGI T AF  K F K+GIL+TTVGK+I N   P    Y+N+  NL   +  +I+   +    +++   + +  TKKTLS +++ L   Y  + +E+VP TMDKIK +GF+YS  SAT+ISAFD+P Y +K +YF+ETD+ V +++++Y  G LTDDERY KVV AWS   ++V+ DIEKLI   EY  N IVIMA SGARGN SNFTQL+GMRGLMSKSYNYDQK  + VIKDTIE+PIK+SFIEGL+VSEYFNSS+GARKGMTDTAMKT+KSGYMTRKLVD+TQ V++ + DC TK+G I+  I +TK  + IESL +R++ R+ I + ++    K++  + ++IT  +AN I ++GI +VEVRS LHC    G+CQKCFG DL+TNKL+E  TAIGVIAAQSIGEPGTQLTMRTFHTGGV+  TNI QGFER+KQLFD I P++ EK++IS+++G V  I+   +     VV   N    +NY    ++ LRV+ GD++  G KITEGSIDV +LLK AGIE VR+YIIKEVQKVYR+QGIEI+DKYIEVII QLTNK+ I + G+S  F+G+ I IN F +  + ++++  K P +A+N +FGLD APSK+GSFL+AASFQDTKKILTDA  + Q D L GLKENVI GNLIP GTG K  E++I  G +MY+ +Y
  S:     6 IKSLTISIASPEQILNWSKGEITKPETINYKSLKPEPNGLFDESIFGPSKDYECYCGKYRKVKHKGKICERCHVEITESIVRRERMGHIELAAPVAHIWFTKELPSPSKISLLLDITYKEVDQVVYFVNYIVLDEGNNVYDGKSIFNKKEVLDLTSPKNSIRSRNKLRRTLRNIQERIEDELNHEREALIQDFDYRLAVTYDQMLKDSNIPFSVKDVMAFIEKHTGVRFGIGAEAIRELLEKLNLEEEHEKIKQAIQNSPNAYDQKTKRLLRRLECVRWIKDSGSKPEWMVMTRIPVTPSETRPIISLDGGRFTTSDTNNFYRKIIIRNERLKQMQATDAPEILLDNEKRLLQEAVDSLFDNNSRKKPVVGKDKRPLKSLSNHLKGKQGLFRQNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFRPYIISELIRKRDELGNEIQPICANIKLAEQKILAQDNEIWPVVEKVIKQRPVILNRAPTLHRLGIQAFEPKMVDGKAIRLHPLVTTAFNADFDGDQMAVHIPLSKEAVAEARSILLASWHILGPKDGKPIITPTQDMILGIYYLTKEKFPQVIEEMMAKDPTQARVEFINHFHIFSTQDEAIRAYKLKTIRINDVIGITTKAFNNKTFSKEGILVTTVGKIIFNQAFPVNFPYINDVKNLYGENQFEIIGMHESILDYLKAYNLKEPLTKKTLSTVIDYL---YKVSEIEVVPQTMDKIKALGFKYSMISATSISAFDIPSYDQKYEYFKETDELVSKLREFYLDGKLTDDERYTKVVQAWSQTKDKVTHDIEKLINSNEYKDNPIVIMAKSGARGNTSNFTQLAGMRGLMSKSYNYDQKNNNGVIKDTIEIPIKHSFIEGLSVSEYFNSSFGARKGMTDTAMKTAKSGYMTRKLVDSTQAVVIKDHDCGTKEGIIVREIRNTKDNTSIESLKDRIVGRYSI-NTIYDTKNKLIIESDKLITSEIANIIQNSGIREVEVRSPLHCASLYGVCQKCFGLDLSTNKLIETGTAIGVIAAQSIGEPGTQLTMRTFHTGGVAGDTNITQGFERIKQLFDCIQPQENEKAVISQVKGTVERIEKDSNTNGYNVVIKYNKDNYVNYPTRSNAVLRVKTGDEIIAGQKITEGSIDVNDLLKYAGIENVRHYIIKEVQKVYRMQGIEISDKYIEVIISQLTNKITITNPGDSGLFVGETISINEFTEVAQNMLVNKKK-PPSAINQVFGLDHAPSKSGSFLSAASFQDTKKILTDAAARSQKDMLIGLKENVILGNLIPAGTGLKDVEEVIAYGEEMYKKQY 1305
>gi|171920104|ref|ZP_02931522.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902465|gb|EDT48754.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] (1305 aa)
Score = 3949, Expect = 0.0e+00, Identities = 800/1281 (62%), Positives = 1004/1281 (78%)
  Q:     8 ITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKN--FNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENA-----IKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGML-----------------FANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           I S+ I +ASPE+I  WS GE+TK ETINYKSLKPE +GLFDE+IFGP KDYEC CGKY+K+K +GKICE+C VEITESIVRRER+GHIELAAP+AHIW TKELP PSKISL+LDI+YKE++QVVYFVNYIVLDEGN  +     FN KEV+DL+S K+S  +R+KLR+TLR I E I+ E + E         +++A T+   L +SN+PFS+++V  FI   TG+RFGIGAEAI ELL+ ++L++E++ I + ++ S N  D KTK+L+RRLE ++W+KDS +KPEWM++  I VTP +TRPII L+GG+FTTSD N+FYRKIIIRNERLK++   +AP I+L+NEKRLLQEAVD+LFDN SRKKP++GKDKRPLKSLS HLKGKQGLFRQNLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLF+P+II ELI+K D+ GN   PI +NIK AE+ IL QDN IWP++ KVIKQRPV+LNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVH+PLS EAVAEAR+I+LASWHILGPKDGKPIITPTQDM+LG YYLT EK     + M+                 F+  DE    Y++K + ++ +IGI T AF  K F K+GIL+TTVGK+I N   P    Y+N+  NL   +  +I+   +    +++   + +  TKKTLS +++ L   Y  + +E+VP TMDKIK +GF+YS  SAT+ISAFD+P Y +K +YF+ETD+ V +++++Y  G LTDDERY KVV AWS   ++V+ DIEKLI   EY  N IVIMA SGARGN SNFTQL+GMRGLMSKSYNYDQK  + VIKDTIE+PIK+SFIEGL+VSEYFNSS+GARKGMTDTAMKT+KSGYMTRKLVD+TQ V++ + DC TK+G I+  I +TK  + IESL +R++ R+ I + ++    K++  + ++IT  +AN I ++GI +VEVRS LHC    G+CQKCFG DL+TNKL+E  TAIGVIAAQSIGEPGTQLTMRTFHTGGV+  TNI QGFER+KQLFD I P++ EK++IS+++G V  I+   +     VV   N    +NY    ++ LRV+ GD++  G KITEGSIDV +LLK AGIE VR+YIIKEVQKVYR+QGIEI+DKYIEVII QLTNK+ I + G+S  F+G+ I IN F +  + ++++  K P +A+N +FGLD APSK+GSFL+AASFQDTKKILTDA  + Q D L GLKENVI GNLIP GTG K  E++I  G +MY+ +Y
  S:     6 IKSLTISIASPEQILNWSKGEITKPETINYKSLKPEPNGLFDESIFGPSKDYECYCGKYRKVKHKGKICERCHVEITESIVRRERMGHIELAAPVAHIWFTKELPSPSKISLLLDITYKEVDQVVYFVNYIVLDEGNNVYDGKSIFNKKEVLDLTSPKNSIRSRNKLRRTLRNIQERIEDELNHEREALIQDFDYRLAVTYDQMLKDSNIPFSVKDVMAFIEKHTGVRFGIGAEAIRELLEKLNLEEEHEKIKQAIQNSPNAYDQKTKRLLRRLECVRWIKDSGSKPEWMVMTRIPVTPSETRPIISLDGGRFTTSDTNNFYRKIIIRNERLKQMQATDAPEILLDNEKRLLQEAVDSLFDNNSRKKPVVGKDKRPLKSLSNHLKGKQGLFRQNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFRPYIISELIRKRDELGNEIQPICANIKLAEQKILAQDNEIWPVVEKVIKQRPVILNRAPTLHRLGIQAFEPKMVDGKAIRLHPLVTTAFNADFDGDQMAVHIPLSKEAVAEARSILLASWHILGPKDGKPIITPTQDMILGIYYLTKEKFPQVIEEMMAKDPTQARVEFINHFHIFSTQDEAIRAYKLKTIRINDVIGITTKAFNNKTFSKEGILVTTVGKIIFNQAFPVNFPYINDVKNLYGENQFEIIGMHESILDYLKAYNLKEPLTKKTLSTVIDYL---YKVSEIEVVPQTMDKIKALGFKYSMISATSISAFDIPSYDQKYEYFKETDELVSKLREFYLDGKLTDDERYTKVVQAWSQTKDKVTHDIEKLINSNEYKDNPIVIMAKSGARGNTSNFTQLAGMRGLMSKSYNYDQKNNNGVIKDTIEIPIKHSFIEGLSVSEYFNSSFGARKGMTDTAMKTAKSGYMTRKLVDSTQAVVIKDHDCGTKEGIIVREIRNTKDNTSIESLKDRIVGRYSI-NTIYDTKNKLIIESDKLITSEIANIIQNSGIREVEVRSPLHCTSLYGVCQKCFGLDLSTNKLIETGTAIGVIAAQSIGEPGTQLTMRTFHTGGVAGDTNITQGFERIKQLFDCIQPQENEKAVISQVKGTVERIEKDSNTNGYNVVIKYNKDNYVNYPTRSNAVLRVKTGDEIIAGQKITEGSIDVNDLLKYAGIENVRHYIIKEVQKVYRMQGIEISDKYIEVIISQLTNKITITNPGDSGLFVGETISINEFTEVAQNMLVNKKK-PPSAINQVFGLDHAPSKSGSFLSAASFQDTKKILTDAAARSQKDMLIGLKENVILGNLIPAGTGLKDVEEVIAYGEEMYKKQY 1305
>gi|13357746|ref|NP_078020.1| DNA-directed RNA polymerase subunit beta' [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762303|ref|YP_001752270.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|14195188|sp|Q9PQV5|RPOC_UREPA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|11261212|pir||D82923 DNA-directed RNA polymerase beta' chain UU188 [imported] - Ureaplasma urealyticum >gi|6899152|gb|AAF30595.1|AE002118_5 DNA-directed RNA polymerase beta' chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827880|gb|ACA33142.1| DNA-directed RNA polymerase, beta' subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] (1305 aa)
Score = 3947, Expect = 0.0e+00, Identities = 800/1281 (62%), Positives = 1004/1281 (78%)
  Q:     8 ITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKN--FNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENA-----IKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGML-----------------FANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           I S+ I +ASPE+I  WS GE+TK ETINYKSLKPE +GLFDE+IFGP KDYEC CGKY+K+K +GKICE+C VEITESIVRRER+GHIELAAP+AHIW TKELP PSKISL+LDI+YKE++QVVYFVNYIVLDEGN  +     FN KEV+DL+S K+S  +R+KLR+TLR I E I+ E + E         +++A T+   L +SN+PFS+++V  FI   TG+RFGIGAEAI ELL+ ++L++E++ I + ++ S N  D KTK+L+RRLE ++W+KDS +KPEWM++  I VTP +TRPII L+GG+FTTSD N+FYRKIIIRNERLK++   +AP I+L+NEKRLLQEAVD+LFDN SRKKP++GKDKRPLKSLS HLKGKQGLFRQNLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLF+P+II ELI+K D+ GN   PI +NIK AE+ IL QDN IWP++ KVIKQRPV+LNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVH+PLS EAVAEAR+I+LASWHILGPKDGKPIITPTQDM+LG YYLT EK     + M+                 F+  DE    Y++K + ++ +IGI T AF  K F K+GIL+TTVGK+I N   P    Y+N+  NL   +  +I+   +    +++   + +  TKKTLS +++ L   Y  + +E+VP TMDKIK +GF+YS  SAT+ISAFD+P Y +K +YF+ETD+ V +++++Y  G LTDDERY KVV AWS   ++V+ DIEKLI   EY  N IVIMA SGARGN SNFTQL+GMRGLMSKSYNYDQK  + VIKDTIE+PIK+SFIEGL+VSEYFNSS+GARKGMTDTAMKT+KSGYMTRKLVD+TQ V++ + DC TK+G I+  I +TK  + IESL +R++ R+ I + ++    K++  + ++IT  +AN I ++GI +VEVRS LHC    G+CQKCFG DL+TNKL+E  TAIGVIAAQSIGEPGTQLTMRTFHTGGV+  TNI QGFER+KQLFD I P++ EK++IS+++G V  I+   +     VV   N    +NY    ++ LRV+ GD++  G KITEGSIDV +LLK AGIE VR+YIIKEVQKVYR+QGIEI+DKYIEVII QLTNK+ I + G+S  F+G+ I IN F +  + ++++  K P +A+N +FGLD APSK+GSFL+AASFQDTKKILTDA  + Q D L GLKENVI GNLIP GTG K  E++I  G +MY+ +Y
  S:     6 IKSLTISIASPEQILNWSKGEITKPETINYKSLKPEPNGLFDESIFGPSKDYECYCGKYRKVKHKGKICERCHVEITESIVRRERMGHIELAAPVAHIWFTKELPSPSKISLLLDITYKEVDQVVYFVNYIVLDEGNNVYDGKSIFNKKEVLDLTSPKNSIRSRNKLRRTLRNIQERIEDELNHEREALIQDFDYRLAVTYDQMLKDSNIPFSVKDVMAFIEKHTGVRFGIGAEAIRELLEKLNLEEEHEKIKQAIQNSPNAYDQKTKRLLRRLECVRWIKDSGSKPEWMVMTRIPVTPSETRPIISLDGGRFTTSDTNNFYRKIIIRNERLKQMQATDAPEILLDNEKRLLQEAVDSLFDNNSRKKPVVGKDKRPLKSLSNHLKGKQGLFRQNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFRPYIISELIRKRDELGNEIQPICANIKLAEQKILAQDNEIWPVVEKVIKQRPVILNRAPTLHRLGIQAFEPKMVDGKAIRLHPLVTTAFNADFDGDQMAVHIPLSKEAVAEARSILLASWHILGPKDGKPIITPTQDMILGIYYLTKEKFPQVIEEMMAKDPTQARVEFINNFHIFSTQDEAIRAYKLKTIRINDVIGITTKAFNNKTFSKEGILVTTVGKIIFNQAFPVNFPYINDVKNLYGENQFEIIGMHESILDYLKAYNLKEPLTKKTLSTVIDYL---YKVSEIEVVPQTMDKIKALGFKYSMISATSISAFDIPSYDQKYEYFKETDELVSKLREFYLDGKLTDDERYTKVVQAWSQTKDKVTHDIEKLINSNEYKDNPIVIMAKSGARGNTSNFTQLAGMRGLMSKSYNYDQKNNNGVIKDTIEIPIKHSFIEGLSVSEYFNSSFGARKGMTDTAMKTAKSGYMTRKLVDSTQAVVIKDHDCGTKEGIIVREIRNTKDNTSIESLKDRIVGRYSI-NTIYDTKNKLIIESDKLITSEIANIIQNSGIREVEVRSPLHCASLYGVCQKCFGLDLSTNKLIETGTAIGVIAAQSIGEPGTQLTMRTFHTGGVAGDTNITQGFERIKQLFDCIQPQENEKAVISQVKGTVERIEKDSNTNGYNVVIKYNKDNYVNYPTRSNAVLRVKTGDEIIAGQKITEGSIDVNDLLKYAGIENVRHYIIKEVQKVYRMQGIEISDKYIEVIISQLTNKITITNPGDSGLFVGETISINEFTEVAQNMLVNKKK-PPSAINQVFGLDHAPSKSGSFLSAASFQDTKKILTDAAARSQKDMLIGLKENVILGNLIPAGTGLKDVEEVIAYGEEMYKKQY 1305
>gi|1350852|sp|P47582|RPOC_MYCGE DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') (1292 aa)
Score = 3914, Expect = 0.0e+00, Identities = 777/1287 (60%), Positives = 1004/1287 (78%)
  Q:     2 NSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPK--NFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTS--DIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQN-NAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEE-LSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           N     I +I++ +AS + I  WS GEVTK+ETINYKSLKPE  GLFDEAIFGPVKDYECACGK+KKIK+RG  C++CGV +TESIVRRER+GHI L +P+AHIWM+KELP PSKISLVL+ISYKE+EQV+YFVNYIVLD G  K  K   F FKEV+DL+  K S  TR K+R+ +  I+ ++    S E+  K KI   FY++L  S++PFS+ + FN+I  +TG R GIGAEAILELL  IDL+ E+  + + LRK++  S  D K KK++R+LE I W ++S   P+ MIL  + V PPD RPIIQL+G KFTTSDIN+FYR++IIRN+RL+R++++   PSI++NNEKRLLQE+VDALFDN+SR KP L KDKR LKSL++ LKGKQGLFR NLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLFKPFIIH LI K D+ GN   PI ++I+ AE +I NQD+ IW I+  VIK RPVLLNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVHVPLS  AV EAR ++LAS HILG KDG+PI+TPTQDMVLGNYYLT E+    G+G++F+ V E +  Y+ +KVH+H+I+GI T AFP K+F   G LITTVGK+I NDVL   + Y+N+ +  E    +  IV+ G+D R  I K ++  AF+KK +S++++     Y     + +P T+D IK +GF+YST S+TT+S FD+P+YT K+ YF+  D++V + K++Y KGLLTDDERYK+VV  W++V  +VS +I+ LI++ +Y  NSIV+MA+SGARGNISNFTQL GMRGLMSKS+NY++  +SK+IKDTIEVPIK+SF EGLT++EYFNSSYGARKGMTDTAMKT+KSGYMTRKLVDAT ++I+N++DC T+KG ++E I +TK+ S+IESL +R++NR+ I  +V P+++K +  A  +IT  +A +I    I +V VRSV++C+ ENGICQ CFG DL+T KLVE  TA+GVIAAQSIGEPGTQLTMRTFHTGGVS+  N+AQGFERLKQ+F+++ PK +EK++ISE++G V SI       N   V IK++ +   Y +PF +++RV  GD+V PGSKITEGS+D+K+LL++AGI+ VR Y+I E+QKVYR+QGI+IADKY+E+IIRQLTN +Q+ D+GNS+ F+GQ++  +   + N+ L+L+  K+P  A+N +FG+DEA SK+ SFL+AASFQDTKKILTDA VK Q+D L GLKENVI G  IP GTG  ++E++   G+K    EY
  S:    11 NKLYKNIKAIKLSIASNDTILNWSEGEVTKAETINYKSLKPEPGGLFDEAIFGPVKDYECACGKFKKIKYRGVRCDRCGVWVTESIVRRERMGHIALVSPVAHIWMSKELPSPSKISLVLNISYKEVEQVLYFVNYIVLDTGKIKDDKIMPFKFKEVLDLTG-KGSLSTRQKMRRVIGYIFRNLIKSKSSEDYRKGKI---FYESLKNSSLPFSLNDAFNYIKKYTGFRVGIGAEAILELLNKIDLNLEFSRLNDALRKAKKDSVEDAKVKKILRQLETISWFRNSKLHPKNMILHTVPVIPPDIRPIIQLDGAKFTTSDINNFYRRVIIRNDRLRRILEDGTVPSIVVNNEKRLLQESVDALFDNSSRHKPSLSKDKRSLKSLTDRLKGKQGLFRHNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFKPFIIHGLINKFDENGNEIRPIAASIRQAEDMIKNQDDLIWGIVYDVIKDRPVLLNRAPTLHRLGIQAFEPRIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPLSENAVNEARAVLLASKHILGLKDGRPIVTPTQDMVLGNYYLTTERKGQLGEGIIFSTVYEARAAYESQKVHLHAIVGISTKAFPNKKFACQGTLITTVGKIIFNDVLGNNVPYINDGEFDENACPEKFIVKQGEDVRQSILKHQIIPAFSKKVISKLID---LLYLLLEFKDLPKTLDNIKALGFKYSTFSSTTVSVFDIPKYTNKQNYFDSADQQVLKYKQFYNKGLLTDDERYKRVVKLWNNVKEKVSDEIQNLIKQEQYRDNSIVVMADSGARGNISNFTQLFGMRGLMSKSFNYERNNQSKIIKDTIEVPIKHSFFEGLTINEYFNSSYGARKGMTDTAMKTAKSGYMTRKLVDATHELIINHDDCGTRKGIVVEAIVETKTKSLIESLFDRIVNRYSITPIVDPETQKTIVEANSLITTQLAKQICATSIKEVLVRSVIYCERENGICQYCFGIDLSTGKLVELGTAVGVIAAQSIGEPGTQLTMRTFHTGGVSTENNLAQGFERLKQIFEVVTPKDFEKAVISEVKGTVKSITTV---QNAQEVVIKSNVDERIYTIPFSAQIRVHVGDQVSPGSKITEGSVDIKQLLRIAGIQRVRQYMIVEIQKVYRIQGIDIADKYVEIIIRQLTNLLQVTDAGNSNLFVGQLVHSHYLNELNKSLLLA-GKMPVIAINQVFGIDEAASKSNSFLSAASFQDTKKILTDAAVKNQVDYLLGLKENVIIGGKIPAGTGFLTDEELTFLGSKTVAEEY 1292
>gi|108885105|ref|NP_073010.2| DNA-directed RNA polymerase subunit beta' [Mycoplasma genitalium G37] >gi|84626139|gb|AAC71565.2| DNA-directed RNA polymerase, beta' subunit [Mycoplasma genitalium G37] >gi|166078745|gb|ABY79363.1| DNA-directed RNA polymerase, beta' subunit [synthetic Mycoplasma genitalium JCVI-1.0] (1292 aa)
Score = 3907, Expect = 0.0e+00, Identities = 776/1287 (60%), Positives = 1003/1287 (77%)
  Q:     2 NSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPK--NFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTS--DIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQN-NAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEE-LSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           N     I +I++ +AS + I  WS GEVTK+ETINYKSLKPE  GLFDEAIFGPVKDYECACGK+KKIK+RG  C++CGV +TESIVRRER+GHI L +P+AHIWM+KELP PSKISLVL+ISYKE+EQV+YFVNYIVLD G  K  K   F FKEV+DL+  K S  TR K+R+ +  I+ ++    S E+  K KI   FY++L  S++PFS+ + FN+I  +TG R GIGAEAILELL  IDL+ E+  + + LRK++  S  D K KK++R+LE I W ++S   P+ MIL  + V PPD RPIIQL+G KFTTSDIN+FYR++IIRN+RL+R++++   PSI++NNEKRLLQE+VDALFDN+SR KP L KDKR LKSL++ LKGKQGLFR NLLGKRVDYSGRSVIV+GPELKMY+VGIP  MILKLFKPFIIH LI K D+ GN   PI ++I+ AE +I NQD+ IW I+  VIK RPVLLNRAPTLHRLGIQAFEP +V+GKAIRLHPLVTTAFNADFDGDQMAVHVPLS  AV EAR ++LAS HILG KDG+PI+TPTQDMVLGNYYLT E+    G+G++F+ V E +  Y+ +KVH+H+I+GI T AFP K+F   G LITTVGK+I NDVL   + Y+N+ +  E    +  IV+ G+D R  I K ++  AF+KK +S++++     Y     + +P T+D IK +GF+YST S+TT+S FD+P+YT K+ YF+  D++V + K++Y KGLLTDDERYK+VV  W++V  +VS +I+ LI++ +Y  NSIV+MA+SGAR NISNFTQL GMRGLMSKS+NY++  +SK+IKDTIEVPIK+SF EGLT++EYFNSSYGARKGMTDTAMKT+KSGYMTRKLVDAT ++I+N++DC T+KG ++E I +TK+ S+IESL +R++NR+ I  +V P+++K +  A  +IT  +A +I    I +V VRSV++C+ ENGICQ CFG DL+T KLVE  TA+GVIAAQSIGEPGTQLTMRTFHTGGVS+  N+AQGFERLKQ+F+++ PK +EK++ISE++G V SI       N   V IK++ +   Y +PF +++RV  GD+V PGSKITEGS+D+K+LL++AGI+ VR Y+I E+QKVYR+QGI+IADKY+E+IIRQLTN +Q+ D+GNS+ F+GQ++  +   + N+ L+L+  K+P  A+N +FG+DEA SK+ SFL+AASFQDTKKILTDA VK Q+D L GLKENVI G  IP GTG  ++E++   G+K    EY
  S:    11 NKLYKNIKAIKLSIASNDTILNWSEGEVTKAETINYKSLKPEPGGLFDEAIFGPVKDYECACGKFKKIKYRGVRCDRCGVWVTESIVRRERMGHIALVSPVAHIWMSKELPSPSKISLVLNISYKEVEQVLYFVNYIVLDTGKIKDDKIMPFKFKEVLDLTG-KGSLSTRQKMRRVIGYIFRNLIKSKSSEDYRKGKI---FYESLKNSSLPFSLNDAFNYIKKYTGFRVGIGAEAILELLNKIDLNLEFSRLNDALRKAKKDSVEDAKVKKILRQLETISWFRNSKLHPKNMILHTVPVIPPDIRPIIQLDGAKFTTSDINNFYRRVIIRNDRLRRILEDGTVPSIVVNNEKRLLQESVDALFDNSSRHKPSLSKDKRSLKSLTDRLKGKQGLFRHNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFKPFIIHGLINKFDENGNEIRPIAASIRQAEDMIKNQDDLIWGIVYDVIKDRPVLLNRAPTLHRLGIQAFEPRIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPLSENAVNEARAVLLASKHILGLKDGRPIVTPTQDMVLGNYYLTTERKGQLGEGIIFSTVYEARAAYESQKVHLHAIVGISTKAFPNKKFACQGTLITTVGKIIFNDVLGNNVPYINDGEFDENACPEKFIVKQGEDVRQSILKHQIIPAFSKKVISKLID---LLYLLLEFKDLPKTLDNIKALGFKYSTFSSTTVSVFDIPKYTNKQNYFDSADQQVLKYKQFYNKGLLTDDERYKRVVKLWNNVKEKVSDEIQNLIKQEQYRDNSIVVMADSGARCNISNFTQLFGMRGLMSKSFNYERNNQSKIIKDTIEVPIKHSFFEGLTINEYFNSSYGARKGMTDTAMKTAKSGYMTRKLVDATHELIINHDDCGTRKGIVVEAIVETKTKSLIESLFDRIVNRYSITPIVDPETQKTIVEANSLITTQLAKQICATSIKEVLVRSVIYCERENGICQYCFGIDLSTGKLVELGTAVGVIAAQSIGEPGTQLTMRTFHTGGVSTENNLAQGFERLKQIFEVVTPKDFEKAVISEVKGTVKSITTV---QNAQEVVIKSNVDERIYTIPFSAQIRVHVGDQVSPGSKITEGSVDIKQLLRIAGIQRVRQYMIVEIQKVYRIQGIDIADKYVEIIIRQLTNLLQVTDAGNSNLFVGQLVHSHYLNELNKSLLLA-GKMPVIAINQVFGIDEAASKSNSFLSAASFQDTKKILTDAAVKNQVDYLLGLKENVIIGGKIPAGTGFLTDEELTFLGSKTVAEEY 1292
>gi|110003981|emb|CAK98321.1| dna-directed rna polymerase beta prime chain protein [Spiroplasma citri] (1250 aa)
Score = 3203, Expect = 0.0e+00, Identities = 668/1287 (51%), Positives = 914/1287 (71%)
  Q:     2 NSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGI---LITTVGKVILNDVLPEEMSYLNNP--DNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           N K++R+  I+IGLA+P+ IR WS GEV K ETINYK+LKPE+DGLFDE IFGP K++ECACGKYKK K +GKICE+CGVEITE+IVRRER+GHIEL  P+ HIWM K    PS+I+L+LD+  KE+E+VVYFV+YIVLD G+ K  K    K V+DL + K+S +TR +L KTLREI ++++      + I ++   T  + L  +++PFS++E   FI+  T  RFGIGAEA+  LLKN+++D E + I + L+  +  + +   KL++RLE +  LK S ++PEWMIL+ + V PPD RPIIQL+GG+FTTS+IN  YR+IIIRNERLK+V    APS+I+NNEKR+LQEAVDAL DN  + +P+ GKDKRPLKSL+  LKGKQG FRQNLLGKRVDYSGRSVI IGP+LKMYQ G+P  M + LFKPF+I +L+         KD + +NIK AEKLILNQD+ +W ++ +VIK RPVLLNRAPTLHRLGIQAFEP LV+GKAIRLHPLVTTAFNADFDGDQMAVHVP++ EAVAEAR+++L S +ILGPKDGKPI+TPTQDMVLGNYYLT E+    G+G +F +++E    Y+   V +H+++ IP + F  K+F  + +   +ITT GK+I N +  EE  YLN P  +NL  L    +++   +   ++   KV   F KK LS   NI+ R +           +D +K++GF+YS KS  T+SA DV  Y +K + F+  D+KV+E+  Y++ G+LT  E+  +++S WS V + +  ++E +++  E   N I +MA+SGARGN+SNFTQL GMRGLM+               D IE+PIK+SF EGLTVSE+F S++GARKGM D A+KT+ SGY+TR+LVD +Q++I+  +DC  ++G ++  I + K  ++I  L +RL+ R+ + D+     + +L  A  ++++    +IVD  I +V +RSVL C+ E G+CQ+C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+ G +I QG  R+K+L D+  PK    ++ISEI+GK+S I+   D   I  + +K+  +   YK  +++ LR++ GDKV  G K+TEGSI +KELL+VA IE V NYI+KEVQ+VYRLQGIEI+DKYIE+II+Q+ NKV+I D+G+++   G+I+ +  +R E    + S  K P TA ++IFG+ +AP ++ SFL++ASFQDT ++L  A +KG++D L GLKEN++ G+LIP GTG K+ +DII  G      EY
  S:     5 NEKNNRM--IKIGLANPDDIRSWSFGEVKKPETINYKTLKPERDGLFDEKIFGPTKNFECACGKYKKSKNKGKICERCGVEITEAIVRRERMGHIELEEPVTHIWMLK--AAPSRIALILDMKTKELEEVVYFVSYIVLDAGDAKSLKQ---KMVLDLGNAKTSAQTRQRLTKTLREILDTLE-----PDTIAYEAGETMIEDLKNTSLPFSMDECAQFINRHTNARFGIGAEAVEVLLKNLNIDDEIEKIKQDLK--DKKTQLDQNKLMKRLEVLDSLKKSGSRPEWMILRAVPVIPPDIRPIIQLDGGRFTTSEINDLYRRIIIRNERLKKVKAMGAPSVIVNNEKRMLQEAVDALLDNERKARPVTGKDKRPLKSLTSILKGKQGRFRQNLLGKRVDYSGRSVIAIGPDLKMYQCGLPRDMAITLFKPFVISKLV---------KDGLAANIKVAEKLILNQDDKVWEVLEEVIKSRPVLLNRAPTLHRLGIQAFEPKLVKGKAIRLHPLVTTAFNADFDGDQMAVHVPITEEAVAEARSLMLGSRNILGPKDGKPIVTPTQDMVLGNYYLTYEEKGQLGEGTIFKDLNEAVIAYETGAVALHALVAIPVAGFVNKKFNSEQMKDYIITTPGKIIFNQIFKEEFPYLNEPNIENLTALPARSLIKDNVNLVEYLATWKVNPPFKKKDLS---NIIDRYFKQYGANKTAEMLDNMKNLGFKYSGKSGVTVSAGDVKVYDKKHEEFKAADQKVKEINDYFKMGMLTSREKQHRIISVWSKVKDNIQTELEHVLR--EDPKNPIFMMADSGARGNVSNFTQLVGMRGLMNNPKG-----------DIIELPIKSSFREGLTVSEFFISTHGARKGMADVALKTADSGYLTRRLVDVSQEIIITMKDCNARRGFVVSDIIEQKHANIIVPLFDRLVGRYNLKDIKLKNGEVIL--ANTLLSEEDTRKIVDNDIKEVIIRSVLTCEAEKGVCQRCYGKNLATGMEVEIGEAVGTIAAQSIGEPGTQLTMRTFHTGGVAGGADITQGLPRIKELLDVTTPKG-SIAVISEIDGKISDIR---DEGGIHTIYVKSDSDERKYKTQYNAVLRIKIGDKVVRGQKLTEGSIKIKELLEVAKIEDVHNYILKEVQRVYRLQGIEISDKYIEIIIKQMLNKVKIIDAGDTELLPGEIVTVKRYRNETINAVRSMKK-PPTAKHVIFGIKKAPLESESFLSSASFQDTTRVLVKAIIKGKVDCLEGLKENIMLGHLIPAGTGLKNPKDIITAGIAAKAEEY 1250
>gi|167757657|ref|ZP_02429784.1| hypothetical protein CLORAM_03207 [Clostridium ramosum DSM 1402] >gi|167702654|gb|EDS17233.1| hypothetical protein CLORAM_03207 [Clostridium ramosum DSM 1402] (1222 aa)
Score = 3098, Expect = 0.0e+00, Identities = 637/1267 (50%), Positives = 873/1267 (68%)
  Q:     3 SKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNIL--HRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + +++ ++IQIGLASPEKIREWS GEV K ETINY+S KPEKDGLF E IFGP KD+EC+CGKYKK++++G +C++CGVE+T+S VRRER+GHIELA PIAHIW  K +P  S++ L+LD+S K++E+++YFV+Y+V+D+  G  P    +K+V+          +    RK   +   + + +                                            IGAEAI  LL+ +DLD E+  + ++L++++     K  KL++RLEAI+  + S N+PEWMIL+ + V PPD RP++QL+GG+F TSD+N  YR++I RN RLK++++   PSII+ NEKR+LQEAVDAL DN  R KP+ G   R LKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP+LKMYQ GIP  M L LFKPF+I+ L++         D + +NIK+AE+LI   D+ IWPI+ +VI+Q PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVT AFNADFDGDQMAVHVPL  EA+ EAR ++L S +ILGPKDGKPI+TP+QDMVLGNYYLT+E     G+G +FA+ +E+   Y  K V +H+ + I  SA   + F K   D  LIT+VGK++ ND+   +  ++N+P  +NL    D   V  G D +  I  +K+ K   KK+L +I++ +  H   SD SL      +DK+KD GF YST + TT+S +D+     K + FE+ D+K+E++KK+Y KG LT+ ERY+ V+  W+ V ++V + +    +  +   N I IM++SGARG++SNFTQL GMRGLMS               +TIE+PIK+SF EGLT SE+F S++GARKG TDTA+KT+ SGY+TR+LVD  Q+VI++ EDC T +G ++  + +    SVI  L++RL+ R+   D+ HP++K+++   GE+IT+A+A+EIV+AGI  VE+RSVL C  + G+C+KC+G +L T  +VE   A+G++AAQSIGEPGTQLTMRTFH GGV+ G +I QG  R+++LF+   PK   KSIISEIEG+V++I    DN   + V I N  E+ +Y  P+ +++RV  GD V  G+KIT+GSID KELL VA +E V NYIIKEVQKVYR+QGIEI+DK+IE+I++Q+  K+++ + G +    G  I++N F + N K +L D K PA A  ++ G+ +A  +T SFL+AASFQ+T KILTDA +KG+ D L GLKENV+ G L+P GTG
  S:     2 ANTNKFSAIQIGLASPEKIREWSYGEVKKPETINYRSQKPEKDGLFCEKIFGPSKDWECSCGKYKKVRYKGVVCDRCGVEVTKSAVRRERMGHIELATPIAHIWYLKGIP--SRMGLILDMSPKQLEEIIYFVSYVVIDK--GSTP--LEYKQVL----------SERDYRKCFEQFGHTFEAQ--------------------------------------------IGAEAIQTLLQQVDLDAEFAKVTKELKEAQGQ---KRTKLLKRLEAIEAFRTSTNEPEWMILEALPVIPPDLRPMLQLDGGRFATSDLNDLYRRVITRNNRLKKLLELGTPSIIVQNEKRMLQEAVDALIDNGRRSKPITGAGGRALKSLSHTLKGKQGRFRQNLLGKRVDYSGRSVIAVGPDLKMYQCGIPREMALNLFKPFVINGLVR---------DQLATNIKAAERLIDKMDDRIWPIVEEVIQQHPVLLNRAPTLHRLGIQAFEPKLVEGRAIRLHPLVTPAFNADFDGDQMAVHVPLGEEAIQEARQLMLGSNNILGPKDGKPIVTPSQDMVLGNYYLTLEDEGGLGEGTVFADRNEVDHAYFAKTVELHTRVAIKASALKNETFTKAQNDCYLITSVGKILFNDIFDGKFPFINDPSSENLIATPDKYFVPMGTDIKEHIRNQKIIKPLNKKSLGKIIDEVFKHSAMSDTSL-----MLDKLKDQGFYYSTIAGTTVSVYDIQVPEAKYEIFEKADEKLEQIKKFYNKGKLTESERYQNVIKLWTDVKDEVQEVVRLEFEADD--RNPIFIMSDSGARGSLSNFTQLVGMRGLMSNPKG-----------ETIELPIKSSFREGLTASEFFISTHGARKGSTDTALKTADSGYLTRRLVDVAQEVIISEEDCGTDRGFVVTELYNNDDKSVIVPLHDRLVGRYSQKDIFHPETKELIIAGGELITEALADEIVNAGITAVEIRSVLGCNAKGGVCRKCYGRNLATGDVVELGEAVGIMAAQSIGEPGTQLTMRTFHDGGVAGGADITQGLPRIQELFEARNPKA--KSIISEIEGEVTNII---DNAGRMEVVITNDLETRSYLAPYGAKIRVNVGDHVNIGAKITKGSIDPKELLSVADVEAVENYIIKEVQKVYRIQGIEISDKHIEIIVKQMLRKMKVVEGGETGCLPGTNINVNAFTELN-KQVLKDGKHPAVARPVLLGITKASLETESFLSAASFQETTKILTDASIKGKKDHLLGLKENVLIGKLLPAGTG 1179
>gi|42561523|ref|NP_975974.1| DNA-directed RNA polymerase beta' chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81618790|sp|Q6MRX5|RPOC_MYCMS DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|42493022|emb|CAE77616.1| DNA-directed RNA polymerase beta' chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1255 aa)
Score = 3066, Expect = 0.0e+00, Identities = 656/1283 (51%), Positives = 890/1283 (69%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIK--FRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK-----DGILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESI-NYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  +I+I LA+P+ IR WS+GEV K ETINYK+LK EKDGLFDE IFGP K+YEC CG+YKK     +GK CEKCGVE+TESIVRRER+GHIEL  P+ HIWM K    P +I+ +LD+  KE+E+VVYFV++IVL++GN    K+F  KEV+DL S + +K TR KL+ T+ ++ + I+      N    K A    + L  + +PFSI+E  + IS +TG +FGIGA A+  LL+ +DL KE + I  +L  S+ T + +TK L++RLE    LK S  +PEWM+++ I V PPD RPIIQL+GG+FTTS+IN  YR+IIIRNERLK+V +  APSII+NNEKR+LQEAVDALFDN  + KP+  K+KRPLKSL+  LKGKQG FRQNLLGKRVDYS RSVI IGP+LKMYQ G+P  M + LFKPF+I  L    D E         N+K AEK++L  D  +W  + +VIK RPVLLNRAPTLHRLGIQAFEP LV+GKAIRLHPLVTTAFNADFDGDQMAVHVP++ EAVAE+R ++L S  ILGPKDGK I+TP QD++LGNYYLT E+ N  GQGM+F+++DE    Y   ++H++S+IGI  SA P+++F       +  L+TTVGK+  N +  +   ++N+ +  N +E     I  + +D    IE  +V +   KK LS I+    R +           +DK+KD+GF +STKS TTISA DV  +T K   F+E D+KVE++  +Y  G+LT+ E+ ++++  WS V +++  ++  +++K   + N I +M +SGARGNISNFTQL GMRGLM+ +             D  E+PIK+SF EGLTVSEYF S++GARKGM D A+KT+ SGY+TR+LVD +Q+++V NEDC+  KG  +  I DTK  +VI  L +RL+ RF  F+ ++   K ++A A  +I K +A +I+ +GI  V +RSVL C  + G+CQKC+G +L T  +V     +GVIAAQSIGEPGTQLTMR FHTGGV+   +I QG  R+K+L D+  PK    +IISE++G VS I+   D   + V+ I    E +  YK  F+S LRVE+G  V  G K+TEG+ID+ +LL+  GI+ V+NYI+KEVQKVYRLQGIEI+DKYIE+II+Q+ NKV+I D G+SD   G++I I  +++  +  I+   + P +    IFG+ +AP ++ S+L++ASFQDT ++LT A +KG+ D L GLKEN++ GNLIP GTG    +++ +   + +  EY
  S:     5 NRKKAIKIELANPDTIRSWSHGEVLKPETINYKTLKAEKDGLFDERIFGPTKNYECVCGRYKKANPMNKGKKCEKCGVELTESIVRRERMGHIELEEPVTHIWMLK--VAPYRIAAILDLKAKELEEVVYFVSHIVLEQGN---QKHFVEKEVLDLGSSRITK-TREKLQLTILDVIDLIN----DPNHRDTKKANRLLEELKNTAVPFSIDEATSLISKYTGAKFGIGARAVEYLLEKVDLTKEIEAIKIQLENSKKTPNERTK-LLKRLETFDSLKRSKQRPEWMVMRVIPVIPPDIRPIIQLDGGRFTTSEINDLYRRIIIRNERLKKVKEMGAPSIIVNNEKRMLQEAVDALFDNERKPKPVQRKNKRPLKSLTSVLKGKQGRFRQNLLGKRVDYSARSVIAIGPDLKMYQAGLPREMAITLFKPFVIQWL---QDHE------YAENVKIAEKMLLQNDPKVWEALEQVIKDRPVLLNRAPTLHRLGIQAFEPKLVKGKAIRLHPLVTTAFNADFDGDQMAVHVPITKEAVAESRALMLGSSAILGPKDGKAIVTPGQDIILGNYYLTTEEKNAKGQGMIFSSLDEAFMAYDSGQIHLNSLIGIALSALPEQKFSDKNQRLNSYLLTTVGKLYFNQIFDDNFPWINSNNIWNAKEAVKEFIYYFSQDINNVIENIQVQQPIKKKELSLII---ERYFETHGARKTAEMLDKMKDLGFSFSTKSGTTISAGDVVAFTHKYDEFKEADQKVEQITDFYNMGMLTNSEKKRRIIEVWSDVKDKIQDELATVLRKD--VKNPIFVMVDSGARGNISNFTQLVGMRGLMNDTKG-----------DIKEIPIKSSFREGLTVSEYFVSTHGARKGMADIALKTADSGYLTRRLVDVSQEIVVVNEDCEPSKGFEVSAIIDTKHDNVIVPLKDRLVGRF-TFEDIYDDDKNLVAFANTLIDKNIAEKIIMSGISSVVIRSVLTCDNKRGVCQKCYGLNLATASVVNIGEPVGVIAAQSIGEPGTQLTMRNFHTGGVAGNVDITQGLPRIKELLDVTTPKG-AVAIISEVDGVVSEIE---DYNGVFVINIVTENEEVKKYKTEFNSVLRVEQGSSVVAGQKLTEGAIDLHQLLEFGGIQDVQNYILKEVQKVYRLQGIEISDKYIEIIIKQMLNKVKITDGGDSDLLPGEVITIQNYKEVVQDCIVKSIRPPLSKAQ-IFGIKKAPLESSSWLSSASFQDTARVLTRAIIKGKEDKLEGLKENIMLGNLIPAGTGLTGTQEVEQLAEQYHNNEY 1255
>gi|83319423|ref|YP_424066.1| DNA-directed RNA polymerase beta' subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|109893838|sp|Q2ST47|RPOC_MYCCT DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|83283309|gb|ABC01241.1| DNA-directed RNA polymerase beta' subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1255 aa)
Score = 3064, Expect = 0.0e+00, Identities = 654/1283 (50%), Positives = 892/1283 (69%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIK--FRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK-----DGILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESI-NYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  +I+I LA+P+ IR WS+GEV K ETINYK+LK EKDGLFDE IFGP K+YEC CG+YKK     +GK CEKCGVE+TESIVRRER+GHIEL  P+ HIWM K    P +I+ +LD+  KE+E+VVYFV++IVL++GN     +F  KEV+DL S + +K TR KL+ ++ ++ + I+     +     K A    + L  +++PFSI+E  + IS +T  +FGIGA A+  LL+ +DL KE + I  +L  S+ T + +TK L++RLE    LK S  +PEWM+++ I V PPD RPIIQL+GG+FTTS+IN  YR+IIIRNERLK+V +  APSII+NNEKR+LQEAVDALFDN  + KP+ GK+KRPLKSL+  LKGKQG FRQNLLGKRVDYS RSVI IGP+LKMYQ G+P  M + LFKPF+I  L    D E         N+K AEK++L  D  +W  + +VIK RPVLLNRAPTLHRLGIQAFEP LV+GKAIRLHPLVTTAFNADFDGDQMAVHVP++ EAVAE+R ++L S  ILGPKDGK I+TP QD++LGNYYLT E+ N  GQGM+F+++DE    Y   ++H++S+IGI  SA P+++F       +  L+TTVGK+  N +  +   ++N+ +  N +E     I ++ +D    IE  +V +   KK LS I+    R +           +DK+KD+GF +STKS TTISA DV  +T K   F+E D+KVE++  +Y  G+LT+ E+ ++++  WS V +++  ++  +++K   + N I +M +SGARGN+SNFTQL GMRGLM+ +             D  E+PIK+SF EGLTVSEYF S++GARKGM D A+KT+ SGY+TR+LVD +Q+++V NEDC+  KG  +  I DTK  +VI  L +RL+ RF  F+ ++   K ++A A  +I K +A +I+ +GI  V +RSVL C  + G+CQKC+G +L T  +V     +GVIAAQSIGEPGTQLTMR FHTGGV+   +I QG  R+K+L D+  PK    +IISE++G VS I+   D   + V+ I    E +  YK  F+S LRVE+G  V  G K+TEG+ID+ +LL+  GI+ V+NYI+KEVQKVYRLQGIEI+DKYIE+II+Q+ NKV+I DSG+SD   G+II I  +++  +  I+   + P +    IFG+ +AP ++ S+L++ASFQDT ++LT A +KG+ D L GLKEN++ GNLIP GTG    +++ +   + +  EY
  S:     5 NRKKAIKIELANPDTIRSWSHGEVLKPETINYKTLKAEKDGLFDERIFGPTKNYECVCGRYKKANPMNKGKKCEKCGVELTESIVRRERMGHIELEEPVTHIWMLK--VAPYRIAAILDLKAKELEEVVYFVSHIVLEQGN---QSHFLEKEVLDLGSSRITK-TREKLQLSILDVIDQINDPEHRDT----KKANRLLEELKNTSIPFSIDEATSLISKYTNAKFGIGARAVEYLLEKVDLTKEIEAIKIQLENSKKTPNERTK-LLKRLETFDSLKRSKQRPEWMVMRVIPVIPPDIRPIIQLDGGRFTTSEINDLYRRIIIRNERLKKVKEMGAPSIIVNNEKRMLQEAVDALFDNERKPKPVQGKNKRPLKSLTSVLKGKQGRFRQNLLGKRVDYSARSVIAIGPDLKMYQAGLPREMAITLFKPFVIQWL---QDHE------YAENVKIAEKMLLQNDPKVWEALEQVIKDRPVLLNRAPTLHRLGIQAFEPKLVKGKAIRLHPLVTTAFNADFDGDQMAVHVPITKEAVAESRALMLGSSAILGPKDGKAIVTPGQDIILGNYYLTTEEKNAKGQGMIFSSLDEAFMAYNSGQIHLNSLIGIALSALPEEKFSDKNQRLNSYLLTTVGKLYFNQIFDDNFPWINSNNIWNAKEAVKEFIYDFSQDIDKVIENVQVQQPIKKKELSLII---ERYFETHGARKTAEMLDKMKDLGFSFSTKSGTTISAGDVVAFTHKYDEFKEADQKVEQITDFYNMGMLTNSEKKRRIIDVWSEVKDKIQNELATVLRKD--VKNPIFVMVDSGARGNVSNFTQLVGMRGLMNDTKG-----------DIKEIPIKSSFREGLTVSEYFVSTHGARKGMADIALKTADSGYLTRRLVDVSQEIVVVNEDCEPTKGFEVSAIIDTKHDNVIVPLKDRLVGRF-TFEDIYDDDKNLVASANTLIDKNIAEKIIMSGISSVIIRSVLTCDNKRGVCQKCYGLNLATASVVNIGEPVGVIAAQSIGEPGTQLTMRNFHTGGVAGNVDITQGLPRIKELLDVTTPKG-AVAIISEVDGVVSEIE---DYNGVFVINIVTENEEVKKYKTEFNSVLRVEQGSSVMAGQKLTEGAIDLHQLLEFGGIQDVQNYILKEVQKVYRLQGIEISDKYIEIIIKQMLNKVKITDSGDSDLLPGEIITIQNYKEVVQDCIVKSIRPPLSKAQ-IFGIKKAPLESSSWLSSASFQDTARVLTRAIIKGKEDKLEGLKENIMLGNLIPAGTGLTGTQEVEQLAEQYHNNEY 1255
>gi|188159049|ref|ZP_02998490.1| DNA-directed RNA polymerase beta' subunit [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1255 aa)
Score = 3062, Expect = 0.0e+00, Identities = 655/1283 (51%), Positives = 891/1283 (69%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIK--FRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK-----DGILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESI-NYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  +I+I LA+P+ IR WS+GEV K ETINYK+LK EKDGLFDE IFGP K+YEC CG+YKK     +GK CEKCGVE+TESIVRRER+GHIEL  P+ HIWM K    P +I+ +LD+  KE+E+VVYFV++IVL++GN    K+F  KEV+DL S + +K TR KL+ T+ ++ + I+      N    K A    + L  + +PFSI+E  + IS +TG +FGIGA A+  LL+ +DL KE + I  +L  S+ T + +TK L++RLE    LK SN +PEWM+++ I V PPD RPIIQL+GG+FTTS+IN  YR+IIIRNERLK+V +  APSII+NNEKR+LQEAVDALFDN  + KP+ GK+KRPLKSL+  LKGKQG FRQNLLGKRVDYS RSVI IGP+LKMYQ G+P  M + LFKPF+I  L    D E         N+K AEK++L  D  +W  + +VIK RPVLLNRAPTLHRLGIQAFEP LV+GKAIRLHPLVTTAFNADFDGDQMAVHVP++ EAVAE+R ++L S  ILGPKDGK I+TP QD++LGNYYLT E+    GQGM+F+++DE    Y+  +  ++S+IGI  SA P+++F       +  L+TTVGK+  N +  +   ++N+ +  N +E     I ++ +D    IE  +V +   KK LS I+    R +           +DK+KD+GF +STKS TTISA DV  +T K   F++ D+KVE++  +Y  G+LT+ E+ ++++  WS V +++  ++  +++K   + N I +M +SGARGN+SNFTQL GMRGLM+ +             D  E+PIK+SF EGLTVSEYF S++GARKGM D A+KT+ SGY+TR+LVD +Q+++V NEDC+  KG  +  I DTK  +VI  L +RL+ RF  F+ ++  +K ++  A  +I K +A++I+ AGI  V +RSVL C  + G+CQKC+G +L T  +V     +GVIAAQSIGEPGTQLTMR FHTGGV+   +I QG  R+K+L D+  PK    +IISE++G VS I+   D   + V+ I    E +  YK  F+S LRVE+G  V  G K+TEG+ID+ +LL+  GI+ V+NYI+KEVQKVYRLQGIEI+DKYIE+II+Q+ NKV+I DSG+SD   G++I I   ++  +  I+   + P +    IFG+ +AP ++ S+L++ASFQDT ++LT A +KG+ D L GLKEN++ GNLIP GTG    +++     + +  EY
  S:     5 NRKKAIKIELANPDTIRSWSHGEVLKPETINYKTLKAEKDGLFDERIFGPTKNYECVCGRYKKANPMNKGKKCEKCGVELTESIVRRERMGHIELEEPVTHIWMLK--VAPYRIAAILDLKAKELEEVVYFVSHIVLEQGN---QKHFIEKEVLDLGSSRITK-TREKLQLTILDVIDLIN----DPNHRDTKKANRLLEELKNTAVPFSIDEATSLISKYTGAKFGIGARAVEYLLEKVDLKKEIEAIKVQLENSKKTPNERTK-LLKRLETFDALKRSNQRPEWMVMRVIPVIPPDIRPIIQLDGGRFTTSEINDLYRRIIIRNERLKKVKEMGAPSIIVNNEKRMLQEAVDALFDNERKPKPVQGKNKRPLKSLTSVLKGKQGCFRQNLLGKRVDYSARSVIAIGPDLKMYQAGLPREMAITLFKPFVIQWL---QDHE------YAENVKIAEKMLLQNDPKVWEALEQVIKDRPVLLNRAPTLHRLGIQAFEPKLVKGKAIRLHPLVTTAFNADFDGDQMAVHVPITKEAVAESRALMLGSSAILGPKDGKAIVTPGQDIILGNYYLTTEEKYAKGQGMIFSSLDEAFMAYKSNQADLNSLIGIALSALPEQKFSDKNQRLNSYLLTTVGKLYFNQIFDDNFPWINSNNIWNAKEAVKEFIYDFSQDIDKVIENVQVQQPIKKKELSLII---ERYFETHGARKTAEMLDKMKDLGFSFSTKSGTTISAGDVVAFTHKYDEFKQADQKVEQITDFYNMGMLTNSEKKRRIIEVWSDVKDKIQNELATVLRKD--VKNPIFVMVDSGARGNVSNFTQLVGMRGLMNDTKG-----------DIKEIPIKSSFREGLTVSEYFVSTHGARKGMADIALKTADSGYLTRRLVDVSQEIVVVNEDCEPTKGFEVSAIIDTKHDNVIVPLKDRLVGRF-TFEDIYDDNKNLIVSANTLIDKNIADKIIMAGISSVIIRSVLTCDNKRGVCQKCYGLNLATASVVNIGEPVGVIAAQSIGEPGTQLTMRNFHTGGVAGNVDITQGLPRIKELLDVTTPKG-AVAIISEVDGVVSEIE---DYNGVFVINIVTENEEVKKYKTEFNSVLRVEQGSSVVAGQKLTEGAIDLHQLLEFGGIQDVQNYILKEVQKVYRLQGIEISDKYIEIIIKQMLNKVKITDSGDSDLLPGEVITIQNCKEVVQDCIVKSIRPPLSKAQ-IFGIKKAPLESSSWLSSASFQDTARVLTRAIIKGKEDKLEGLKENIMLGNLIPAGTGLTGTQEVELLAEQYHNNEY 1255
>gi|50365414|ref|YP_053839.1| DNA-directed RNA polymerase beta subunit [Mesoplasma florum L1] >gi|81612870|sp|Q6F0L8|RPOC_MESFL DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|50363970|gb|AAT75955.1| DNA-directed RNA polymerase beta subunit [Mesoplasma florum L1] (1254 aa)
Score = 3061, Expect = 0.0e+00, Identities = 666/1288 (51%), Positives = 884/1288 (68%)
  Q:     1 MNSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIK--FRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVT--IKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           M +K++++  I+I LAS + IR WS+GEVTK ETINYK+LK EKDGLFDE IFGP K+YEC CGK+KK     +GK CEKCGVE+TESIVRRER+GHIELA P+ HIWM K    PS+I+ +LD+  KE+E+VVYFV++IVLD G  K   +F  KEV+DL   KS K TRSKLR  + EI   I+ + +  + +K   A    + L    +PFSI+E    IS +T  +FGIGA AI ELLK IDLDKE +     L      +D    KL++RL+ ++ LK SN KPEWM+L+ + V PPD RPIIQL+GG+FTTS+IN  YR+IIIRNERL +V +  APSII+NNEKR+LQEAVDAL DN  + +P+ GKDKRPLKSL+  LKGKQG FRQNLLGKRVDYSGRSVI IGP+LKMYQ GIP  M L LFKPF+I  L +    E         N+K AEK+IL  D  IW  +  VIK RPVLLNRAPTLHRLGIQAFEP LV+GKAIRLHPLVTTAFNADFDGDQMAVHVP++ EAVAEAR ++L S  ILGPKDGK I+TP QD++LGNYY T E+    G+G +FA + E    +    V ++++IGI   A P ++F ++   G L+TTVGK++ N +      ++N+    + +E  ++ I ++ KD    I +  +     KK LS I+ I   K+           +DK+KD+GF+YSTKS TTISA DV  +  K + F E D+KV E+  +Y +G+LT +E+  +V+  WS V + + K +E ++++     N + +MA+SGARGN+SNFTQL GMRGLM+ +             D  E+PIK+SF EGL+VSEYF S++GARKGM D A+KT+ SGY+TR+LVD +Q+++V NEDCK  KG  +E + DTK  +VI  L +R++ R+   D+   K   ++A    I +K  A+ I+ AGI KV +RSVL C  + G+CQ+C+G +L T  LV+    +GVIAAQSIGEPGTQLTMRTFHTGGV+   +I QG  R+K+L D+   K    +II+E  G VS I  + +  N +VVT  +  ++    YK  +++ LRV +GD+VKPG K+TEGSI++ +LL+VAG   V+NYI+KEVQKVYRLQGIEI+DKYIE+I++Q+ NKV++  SG S    G+I+    F KE     + +  VP  A N I G+ +AP K+ S+L++ASFQDT ++LTDA +KG+ D L GLKEN++ GNLIP GTG    E+++E   + ++ EY
  S:     1 MENKNNKV--IKIELASADTIRSWSHGEVTKPETINYKTLKAEKDGLFDEKIFGPTKNYECFCGKFKKANPMNKGKKCEKCGVELTESIVRRERMGHIELAEPVTHIWMVK--VSPSRIASLLDLKSKELEEVVYFVSHIVLDPGTSK---HFAAKEVLDLGVSKSQK-TRSKLRPAIEEIVTLIN-DPAHRDTLK---AERLLEELNNPTIPFSIDEATALISKYTDAKFGIGASAIEELLKQIDLDKEIEITKNTLDAIGPNAD--NSKLLKRLDILESLKRSNQKPEWMVLRVLPVIPPDIRPIIQLDGGRFTTSEINDLYRRIIIRNERLLKVKEMGAPSIIINNEKRMLQEAVDALLDNERKPRPIQGKDKRPLKSLTSVLKGKQGRFRQNLLGKRVDYSGRSVIAIGPDLKMYQAGIPREMALTLFKPFVIQWLQEHEYAE---------NVKVAEKMILQNDPKIWEALEHVIKDRPVLLNRAPTLHRLGIQAFEPKLVKGKAIRLHPLVTTAFNADFDGDQMAVHVPITKEAVAEARALMLGSNAILGPKDGKAIVTPGQDIILGNYYATFEEKGQLGEGTMFAEITEAINAFDTGIVSLNAVIGIAVDALPAEKFTEEQRKGYLLTTVGKILFNQIFDASFPWINSSSIYDAKEAVNSFIFDFSKDINEAIAEYTIVTPIKKKELSIIIEIYFNKFGARK---TAEMLDKMKDLGFKYSTKSGTTISAGDVVAFKHKYEEFAEADQKVAEITSFYNEGMLTKEEKKHRVIEVWSDVKDDIQKRLELVLKQDT--KNPVFVMADSGARGNVSNFTQLVGMRGLMNDTKG-----------DIKEIPIKSSFREGLSVSEYFVSTHGARKGMADLALKTADSGYLTRRLVDVSQEIVVVNEDCKANKGFEIESVIDTKHNNVIVPLKDRIVGRYSFNDIKDIKGNVIVAKDTLIESKE-ADAIIAAGITKVTIRSVLTCDNQKGVCQRCYGRNLATASLVKIGEPVGVIAAQSIGEPGTQLTMRTFHTGGVAGDADITQGLPRIKELLDVTTQKG-SVAIIAEKAGVVSDI-INKNGINTIVVTEEVNGTQIEKQYKTMYNAVLRVNKGDQVKPGKKLTEGSINLHDLLEVAGTTAVQNYILKEVQKVYRLQGIEISDKYIEIIVKQMLNKVKVIQSGESHLLQGEIVTQQKF-KEVVTQCIREGLVPPVAKNQILGIKKAPLKSESWLSSASFQDTARVLTDAIIKGREDKLEGLKENIMLGNLIPAGTGLTGIEEVMEIAEEYHKNEY 1254
>gi|169351745|ref|ZP_02868683.1| hypothetical protein CLOSPI_02526 [Clostridium spiroforme DSM 1552] >gi|169291967|gb|EDS74100.1| hypothetical protein CLOSPI_02526 [Clostridium spiroforme DSM 1552] (1224 aa)
Score = 2970, Expect = 0.0e+00, Identities = 620/1267 (48%), Positives = 860/1267 (67%)
  Q:     3 SKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNIL--HRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + +++ ++IQIGLAS +KIREWS GEV K ETINY+S KPEKDGLF E IFGP KD+EC+CGKYKK++++G +C++CGVE+T+S VRRER+GHIELA PIAHIW  K +  PS++ L+LD+S K++E+++YFV+Y+V+D+G+        +K+V+          +    RK   +   + + +   E A++  + +   D+  E                                     + KE K+   + R        K  K +  +EA +    S N+PEWMIL+ + V PPD RP++QL+GG+F TSD+N  YR++I RN RLK++++   PSII+ NEKR+LQEAVDAL DN  R KP+ G   R LKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP+LKMYQ GIP  M L LFKPF+I+ L+         +D + +NIK+AE+LI   D+ IWPI+ +VIKQ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVT AFNADFDGDQMAVHVPL  EA+ EAR ++L S +ILGPKDGKPI+TP+QDMVLGNYYLT+E  +  G+G +FA+ +E+   Y  K V +H+ + I  SA     F +   +  LITTVGK+  ND+   +  ++N+P  +NL    D   V  G + +  I+ + + K   KK+L +I++ +  H+  SD SL      +DK+KD GF YST + TT+S +D+     K + F+E D+K+E++KK+Y KG LT+ ERY+ V+  W+ V +QV + + +  +  +   N I IM++SGARG++SNFTQL GMRGLMS               +T+E+PIK+SF EGLT SE+F S++GARKG TDTA+KT+ SGY+TR+LVD  Q+VI++ +DC T +G ++  + +    SVI  L +RL+ RF   D+ HP++KK++   GE+IT+ +A+EIV+AGI +VE+RSVL C  + GIC+KC+G +L T  +VE   A+G++AAQSIGEPGTQLTMRTFH GGV+ G +I QG  R+++LF+   PK   KSIISEIEG V+S+    DN   + V I N  E+ +Y  P+ +++RV+ GD +  G KIT+GSID KELL VA +E V NYIIKEVQKVYR+QGIEI+DK+IE+I++Q+  K+++ + G++    G  ++I+ F + N + +L + K PA A  ++ G+ +A  +T SFL+AASFQ+T KILTDA +KG+ D L GLKENV+ G L+P GTG
  S:     2 ANTNKFSAIQIGLASLQKIREWSYGEVKKPETINYRSQKPEKDGLFCERIFGPSKDWECSCGKYKKVRYKGVVCDRCGVEVTKSAVRRERMGHIELATPIAHIWYLKGI--PSRMGLILDMSPKQLEEIIYFVSYVVIDKGSTP----LEYKQVL----------SERDYRKCFEQFGHTFEAKIGAE-AVQTLLKQVDLDSEFEK------------------------------------VSKELKEAQGQRRS-------KLLKRLEAIEAFR---SSENQPEWMILEALPVIPPDLRPMLQLDGGRFATSDLNDLYRRVITRNNRLKKLLELGTPSIIVQNEKRMLQEAVDALIDNGRRSKPITGAGGRALKSLSHTLKGKQGRFRQNLLGKRVDYSGRSVIAVGPDLKMYQCGIPREMALNLFKPFVINGLV---------RDQLATNIKAAERLIDKMDDRIWPIVEEVIKQHPVLLNRAPTLHRLGIQAFEPKLVEGRAIRLHPLVTPAFNADFDGDQMAVHVPLGEEAIQEARQLMLGSNNILGPKDGKPIVTPSQDMVLGNYYLTLEDKDGKGEGTVFADRNEVDHAYFAKTVGLHTRVAIRASALKNNTFTETQNNSYLITTVGKIFFNDIFDGQFPFINDPSTENLTATPDKYFVPMGTNIKEHIKNQPIIKPLNKKSLGKIIDEVFKHQAMSDTSL-----MLDKLKDQGFYYSTIAGTTVSVYDIQVPQAKYEIFDEADEKLEQIKKFYNKGKLTESERYQNVIKLWTDVKDQVQEVVREEFEADD--RNPIFIMSDSGARGSLSNFTQLVGMRGLMSNPKG-----------ETMELPIKSSFREGLTASEFFISTHGARKGSTDTALKTADSGYLTRRLVDVAQEVIISEDDCGTDRGFVVTELYNNDDKSVIVPLYDRLVGRFSQKDIFHPETKKLIVSGGELITEVLADEIVNAGIKEVEIRSVLGCIAKGGICRKCYGRNLATGNVVELGEAVGIMAAQSIGEPGTQLTMRTFHDGGVAGGADITQGLPRIQELFEARNPKA--KSIISEIEGDVTSLI---DNAGRVEVVITNELETRSYLAPYGAKIRVDVGDHINIGDKITKGSIDPKELLSVADVETVENYIIKEVQKVYRIQGIEISDKHIEIIVKQMLRKMKVIEGGDTGCLPGTNVNISAFTELNRE-VLKEGKHPAVARPVLLGITKASLETESFLSAASFQETTKILTDAAIKGKKDLLKGLKENVLIGKLLPAGTG 1179
>gi|56418634|ref|YP_145952.1| DNA-directed RNA polymerase subunit beta' [Geobacillus kaustophilus HTA426] >gi|81558137|sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|56378476|dbj|BAD74384.1| DNA-directed RNA polymerase beta' subunit [Geobacillus kaustophilus HTA426] (1199 aa)
Score = 2966, Expect = 0.0e+00, Identities = 606/1259 (48%), Positives = 848/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D G+    K         L S+K  +  R K  ++          +ASM                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  ++++RLE ++  + S N P WM+L  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+++          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y    VH+HS I I   +   + F ++    +L+TTVGK+I N++LP    Y+N P  +N+E    D   ++ G + R  I K+++   F KK L +I+  + +++    +      +D++KD+GF+YSTK+  TI   D+    EK++  +E   KV+ + K +++GL+TD+ERY++V+S WS+  +++   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D     V+  L ERL+ R+    V HP++ +V+    E+IT+ +ANEI+ AGI +V +RSV  C   +G+C+KC+G ++ T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   +++ISEI+G V SI  + DN   +VV  +   E+  Y  P+++ L+VEEG +V+ G ++TEGS+D K+LL+V  I  V+ Y+++EVQKVYR+QG+EI+DK+IEV++RQ+  KV++ D+G++D   G ++D++ F   N K  L + K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKK-------QLLSEKEYRAYREKYGQSF---------QASM------------------------------------------GAEAIKKLLQDIDLDKEVAALKEELKTAQGQ---RRARIIKRLEVLEAFRSSGNDPAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERG---------LAHNIKSAKRKIERVHPEVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFKDTDEALLAYHNGYVHLHSRIAIHAGSLKNETFTEEQNNKLLLTTVGKLIFNEILPNSFPYINEPTTENIEGRTPDKYFLDKGVNVREEIRKRELVPPFKKKVLGQIIAEVFKRF---KITETSKMLDRMKDLGFQYSTKAGITIGVADIVVLPEKQEILDEAQAKVDTVLKQFRRGLITDEERYERVISIWSAAKDKIQDRLMKSLDK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGILARALTD--GTEVVVKLEERLVGRYAHKTVRHPETGEVIVRKDEMITEDIANEIMKAGITEVWIRSVFACNTRHGVCKKCYGRNMATGMDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVQELFEARNPKG--QAVISEIDGTVISINKTRDNQYEVVV--QGEVETRTYVAPYNARLKVEEGQRVERGQELTEGSVDPKQLLRVRDITSVQEYLLREVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDVLPGTLLDVHQFTDVNAK-ALREGKRPATARQVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1176
>gi|138893778|ref|YP_001124231.1| DNA-directed RNA polymerase subunit beta' [Geobacillus thermodenitrificans NG80-2] >gi|134265291|gb|ABO65486.1| RNA polymerase beta subunit [Geobacillus thermodenitrificans NG80-2] (1217 aa)
Score = 2960, Expect = 0.0e+00, Identities = 605/1264 (47%), Positives = 851/1264 (67%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++   ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D G+    K         L S+K  +  R K  ++          +ASM                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  ++++RLE ++  + S N P WM+L  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+++          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y    VH+HS I I   +   + F     + +L+TTVGK+I N++LP+   Y+N P  +N+E    D   ++ G D R  I K+++   F KK L +I+  + +++    +      +D++KD+GF+YSTK+  TI   D+    EK++  +E   KV+ + K +++GL+TD+ERY++V+S WS+  +++   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D     V+  L ERL+ R+    V HP++ +V+    E+IT+ +ANEI+ AGI +V +RSV  C   +G+C+KC+G ++ T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   +++ISEI+G V +I  + DN   +VV  ++  E+ +Y  P+++ L+VEEG  V+ G ++TEGS+D K+LL+V  I  V+ Y+++EVQKVYR+QG+EI+DK+IEV++RQ+  KV++ D+G++D   G ++D++ F   N + I  + K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    23 NKFEYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKK-------QLLSEKEYRAYREKYGQSF---------QASM------------------------------------------GAEAIKKLLQDIDLDKEVATLKEELKTAQGQ---RRARIIKRLEVLESFRSSGNDPAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERG---------LAHNIKSAKRKIERVHPEVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFKDTDEALLAYHNGYVHLHSRIAIHAGSLKNETFTPEQNNKLLLTTVGKLIFNEILPKSFPYINEPTTENIEGRTPDKYFLDKGVDVREEIRKRELVPPFKKKVLGQIIAEVFKRF---KITETSKMLDRMKDLGFQYSTKAGITIGVSDIVVLPEKQEILDEAQAKVDTVLKQFRRGLITDEERYERVISVWSAAKDKIQDRLMKSLDK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGILARALTD--GTEVVVKLEERLVGRYAHKTVHHPETGEVIVRKDEMITEDIANEIIKAGITEVWIRSVFACNTRHGVCKKCYGRNMATGMDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVQELFEARNPKG--QAVISEIDGTVVAINETRDNQYEIVV--QSEVETRSYVAPYNARLKVEEGQHVERGQELTEGSVDPKQLLRVRDITSVQEYLLREVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDVLPGTLLDVHQFTDVNAQAI-REGKRPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1194
>gi|46906496|ref|YP_012885.1| DNA-directed RNA polymerase subunit beta' [Listeria monocytogenes str. 4b F2365] >gi|153200723|ref|ZP_01942804.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes HPB2262] >gi|73917875|sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|46879760|gb|AAT03062.1| DNA-directed RNA polymerase, beta' subunit [Listeria monocytogenes str. 4b F2365] >gi|133736465|gb|EBA38163.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes HPB2262] (1201 aa)
Score = 2947, Expect = 0.0e+00, Identities = 597/1269 (47%), Positives = 857/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V+  W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIGVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1190
>gi|47091393|ref|ZP_00229190.1| DNA-directed RNA polymerase, beta' subunit [Listeria monocytogenes str. 4b H7858] >gi|47020070|gb|EAL10806.1| DNA-directed RNA polymerase, beta' subunit [Listeria monocytogenes str. 4b H7858] (1192 aa)
Score = 2947, Expect = 0.0e+00, Identities = 597/1269 (47%), Positives = 857/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V+  W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:     1 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIGVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1181
>gi|116871648|ref|YP_848429.1| DNA-directed RNA polymerase subunit beta' [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740526|emb|CAK19646.1| rpoC [Listeria welshimeri serovar 6b str. SLCC5334] (1201 aa)
Score = 2946, Expect = 0.0e+00, Identities = 596/1269 (46%), Positives = 859/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V++ W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IV+AGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N + ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILSDIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMSPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPSKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIAVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVEAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANREAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1190
>gi|16799363|ref|NP_469631.1| DNA-directed RNA polymerase subunit beta' [Listeria innocua Clip11262] >gi|17380561|sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|16412715|emb|CAC95519.1| RNA polymerase (beta' subunit) [Listeria innocua] (1201 aa)
Score = 2945, Expect = 0.0e+00, Identities = 597/1269 (47%), Positives = 856/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    +  +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V+  W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRKQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIGVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGSIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1190
>gi|168264898|ref|ZP_02686863.1| DNA-directed RNA polymerase subunit beta' [Listeria monocytogenes FSL J2-071] (1201 aa)
Score = 2944, Expect = 0.0e+00, Identities = 597/1269 (47%), Positives = 856/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    +  +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V+  W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRKQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIGVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1190
>gi|16802305|ref|NP_463790.1| DNA-directed RNA polymerase subunit beta' [Listeria monocytogenes EGD-e] >gi|153172946|ref|ZP_01928881.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes FSL N3-165] >gi|20139473|sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|16409624|emb|CAD00786.1| RNA polymerase (beta' subunit) [Listeria monocytogenes] >gi|133731253|gb|EBA32951.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes FSL N3-165] (1201 aa)
Score = 2943, Expect = 0.0e+00, Identities = 596/1269 (46%), Positives = 858/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V++ W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N + ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREKAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIAVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANREAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1190
>gi|47096520|ref|ZP_00234111.1| DNA-directed RNA polymerase, beta' subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153186412|ref|ZP_01936730.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes J0161] >gi|153189520|ref|ZP_01937104.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes J2818] >gi|153198251|ref|ZP_01942356.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes 10403S] >gi|47015111|gb|EAL06053.1| DNA-directed RNA polymerase, beta' subunit [Listeria monocytogenes str. 1/2a F6854] >gi|126941180|gb|EBA19073.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes J0161] >gi|127632082|gb|EBA21795.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes 10403S] >gi|127766695|gb|EBA27025.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes J2818] (1201 aa)
Score = 2942, Expect = 0.0e+00, Identities = 596/1269 (46%), Positives = 857/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V++ W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREKAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIAVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1190
>gi|149183752|ref|ZP_01862158.1| DNA-directed RNA polymerase subunit beta' [Bacillus sp. SG-1] >gi|148848538|gb|EDL62782.1| DNA-directed RNA polymerase subunit beta' [Bacillus sp. SG-1] (1189 aa)
Score = 2940, Expect = 0.0e+00, Identities = 602/1259 (47%), Positives = 848/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K    K+++      S KE R+      RE Y  +  +A+M                                          GAEAI ++L++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N P+WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          I  NIKSA++ I      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+G  FA+ +E    YQ   VH+HS I +  S+   K F +     +L+TTVGK++ N++LP+   Y+N P   NLE ++ D   V+   D +   + +++   F K  L  ++  + +++   ++      +D++KD+GF YSTK+  T+   D+    EKE+  +E   KV+ + K +++GL+T+DERY +V+S WS+  + +   +   + +    +N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G  +  I+D     +IE L ERL+ R+    + HP++K+V+A   ++IT+ +A  IVD+GI+ V +RS   C   +G+C+KC+GT+L T + VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEIEG ++SI    D      +T++   E+  Y  P+ + L+    D+V  G ++TEGSID KELLKV  +  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   NEK IL +  VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:     1 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTEPGDTALEK----KQLL------SEKEYRA-----YREKY-GVKFQAAM------------------------------------------GAEAIKKILQDIDLDKEADFLKEELKTAQGQ---RRTRAIKRLEVVESFRNSGNDPDWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------IAHNIKSAKRKIERVQPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAKGEGSTFADANEALIAYQNGYVHLHSRIAVAASSVNNKTFTEKQNKQLLLTTVGKIVFNEILPDSFPYINEPTQSNLETVTPDQYFVDPTTDIKEEFKNRELINPFKKGFLGNVIAEVFKRF---AITETSRMLDRMKDLGFRYSTKAGITVGIADIVVLAEKEEILKEAQSKVDNVLKQFKRGLITEDERYDRVISIWSAAKDTIQGKLMATLDR----SNPIFMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLHVASIKD--GTEIIEPLEERLLGRYSRGVIKHPETKEVIAEENQLITQDLAKTIVDSGIESVYIRSAFTCNTRHGVCEKCYGTNLATGQKVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARHPKG--QAVISEIEGVITSISEGKDRQ--YEITVQGEVETRTYTAPYTARLKFGVNDRVLRGQELTEGSIDPKELLKVRDVNAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGETDVLPGTLLDIHQFTDANEKAIL-EGSVPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1167
>gi|15612690|ref|NP_240993.1| DNA-directed RNA polymerase subunit beta' [Bacillus halodurans C-125] >gi|11134852|sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|4512397|dbj|BAA75264.1| rpoC homologue (identity of 85% to B. subtilis ) [Bacillus halodurans] >gi|10172739|dbj|BAB03846.1| DNA-directed RNA polymerase beta' subunit [Bacillus halodurans C-125] (1206 aa)
Score = 2938, Expect = 0.0e+00, Identities = 604/1269 (47%), Positives = 853/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG--KKSNEDIIEE 1279
           ++IGLASP KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D G+    K    K+++      S KE R+ L K  R                                             SFT     +GAEAI +LL +IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ K          +  NIKSA++ +      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+G +F + +E    YQ   VH+H+ I IP ++  K  F ++    +L+TTVGK+I N++LPE   Y+N P   NLE E     +V    + +   +++ V   F K  L  I+  + +K+    +      +D++KD+GF+YSTK+  T+   D+    EK++   E +KKV+ + K +++GL+T++ERY +V+S WS   + +   +   + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G  +E I++     +IE L +RL+ R     V HP++ + +    E+I + +A +IV+AG+++V +RSV  C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   +++I+EIEG+V++I  +        +T+K   E+  Y +P+ + ++VE G++V PG  +TEGSID KELLKV G+  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G +I+I  F  EN+K++LS  K PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG  +  N DI+ +
  S:    10 MKIGLASPNKIRSWSRGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRSLEEVIYFASYVVTDPGDTPLEK----KQLL------SEKEFRAYLDKYGR---------------------------------------------SFTAQ---MGAEAIRKLLMDIDLDKEVDGLKEELQTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVSKG---------LAHNIKSAKRKVERVQPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAKGEGSVFKDTNEALIAYQNGYVHLHTRIAIPVASLGKTTFKEEQNSQLLLTTVGKLIFNEILPESFPYVNEPTAHNLEVETPSKYMVPTSTNVKELFQERDVVAPFKKGFLGNIIAEVFKKF---KITETSKMLDRMKDLGFKYSTKAGITVGVADIVVLPEKKEILAEAEKKVDRVLKQFRRGLITEEERYDRVISIWSEAKDVIQDKLMGSLDK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLEVEAIKE--GNEIIEGLYDRLVGRVAFKTVRHPETGEPIVKKNELIHEDLAKQIVEAGVEQVTIRSVFTCDTRHGVCKKCYGRNLATGSDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QAVITEIEGEVTNINEADKRE----ITVKGEMETKTYSIPYGARIKVELGEQVVPGQSLTEGSIDPKELLKVQGMTGVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVIDAGDTEVLPGSLIEIQHFNDENKKVLLS-GKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELVGLKENVIIGKLVPAGTGMNRYRNLDIVSD 1186
>gi|172056133|ref|YP_001812593.1| DNA-directed RNA polymerase, beta' subunit [Exiguobacterium sibiricum 255-15] >gi|171988654|gb|ACB59576.1| DNA-directed RNA polymerase, beta' subunit [Exiguobacterium sibiricum 255-15] (1199 aa)
Score = 2938, Expect = 0.0e+00, Identities = 600/1264 (47%), Positives = 835/1264 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +R   ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+I+++G IC++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+++YF +Y+V D G     K         L S+K  +  R K                                                F SSFT     +GAEA+ +LL++++L+KE   + E LR  +     +  + ++RLE +   ++S N PEWM+L+ + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          I  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F+ V+E    YQ   VH H+ + IP        F +   + +L+TTVGK+I N++LP    YLN P  +NL+E + D   +E G D    I+ + + + F K  L  ++  + +++           +D++K++GF++ST++  T+   D+    +K++   E    V+ + K Y++GL+T++ERY++VV +W+   +++   + K + +     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  + V    +    IE+L +RL+ R     VVHP++  VL    E+I + +A  I DAGID VE+R+   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   +++ISEI+G+V     S D   +   TI+   E+  Y +PF S LRV+ G++VK G   TEGSID KELL V G+  V+NY+++EVQKVYR+QG+EI DK++EV++RQ+  +V++ +SG +    G ++DI+TF KE  K  L   K  A+A  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:     5 NRFEYMKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECYCGKYKRIRYKGIICDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEIIYFASYVVTDPGESTLEKK-------QLLSEKEYRAYREK------------------------------------------------FGSSFTAE---MGAEAVRKLLRDVELEKEVAGLREDLRMIQGQ---RRTRAIKRLEVLDAFRNSGNNPEWMVLEVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVSRG---------IAPNIKSAKRKIERVQPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAIGEGKIFSTVNEALIAYQNGYVHFHTRVAIPAGVLKNPTFTEAQNEKLLVTTVGKLIFNEILPTTFPYLNEPSMNNLQEATPDQYFLEKGTDIAAEIKSRPIIEPFKKGFLGNVIAEVFKRFETTE---TSRMLDRMKNLGFKHSTRAGITVGIADIIVLPDKQEILVEAQDNVDRVMKSYRRGLITEEERYERVVKSWNDAKDEIQSRLMKSLNR----LNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------RIIELPIKSSFREGLTVQEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRG--IRVTALREGTEEIENLYDRLVGRTAFEKVVHPETGAVLVSTNELIDEDIARAITDAGIDNVEIRTAFTCNTSHGVCKKCYGRNLATGNDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QAVISEIDGQVIDFTESRDKREL---TIQGLSETRTYTIPFGSRLRVQLGEEVKAGQVFTEGSIDPKELLNVKGVSGVQNYLLQEVQKVYRMQGVEIGDKHVEVMVRQMIRRVRVIESGETSLLPGSLVDISTF-KEACKEALRAGKALASAKPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKSDYLRGLKENVIIGKLVPAGTG 1175
>gi|194017490|ref|ZP_03056101.1| DNA-directed RNA polymerase, beta' subunit [Bacillus pumilus ATCC 7061] >gi|194010762|gb|EDW20333.1| DNA-directed RNA polymerase, beta' subunit [Bacillus pumilus ATCC 7061] (1199 aa)
Score = 2934, Expect = 0.0e+00, Identities = 603/1259 (47%), Positives = 847/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D GN    K    K+++      S KE R+ L                       K   TF                          +  +GAEAI +LL++IDL KE   + E+L+ ++     +  + ++RLE ++  ++S NKP WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  ++     F    +  +LITTVGK+I N++LPE   Y+N P   N+EE + D   +E G+D +  IEK+++   F K  L +I+  + +++    +      +D++K++GF+YSTK+  T+   D+    +K+K  EE   KV+ + K +++GL+T++ERY++V+S WSS  + +   + K + +     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+   DC T +G + + I +     +IE L ERLI RF    +VHP++ +V+    E+I +  A E+V+AGI++V +RS   C   +G+C++C+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++ ISEI+G V+ I    D    +VV  +   E+ +Y  P+++ L+V EGDKV  G  +TEGSID KELLKV  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G++D   G ++D++ F + N+K +L + K PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPGNTPLEK----KQLL------SEKEFRAYL----------------------DKYGNTF--------------------------QAAMGAEAINKLLQDIDLVKEVDALKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKGAIGEGMIFKDTNEALLAYQNGYVHLHTRVAVAANSLKNVTFTDEQRSKLLITTVGKLIFNEILPESFPYMNEPTKSNIEEKTPDRFFLEKGEDVKVAIEKQEINAPFKKGILGKIIAEIFKRF---HITETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQKILEEAQAKVDNVMKQFRRGLITEEERYERVISIWSSSKDVIQGKLMKSLDE----VNPIYMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKSIRE--GNEIIEKLEERLIGRFARKPIVHPETGEVIVGENELIDEDKALEVVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QATISEIDGVVAEINDVRDKQQEIVV--QGDVETRSYTAPYNARLKVVEGDKVTRGQVLTEGSIDPKELLKVTDMTAVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVADAGDTDVLPGTLLDVHQFTEANKK-VLFEGKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1176
>gi|157690892|ref|YP_001485354.1| DNA-directed RNA polymerase subunit beta' [Bacillus pumilus SAFR-032] >gi|157679650|gb|ABV60794.1| DNA-directed RNA polymerase subunit beta prime [Bacillus pumilus SAFR-032] (1199 aa)
Score = 2933, Expect = 0.0e+00, Identities = 602/1259 (47%), Positives = 849/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D GN    K    K+++      S KE R+ L K                                             + ++F+     +GAEAI +LL++IDL KE   + E+L+ ++     +  + ++RLE ++  ++S NKP WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  ++     F    +  +LITTVGK+I N++LPE   Y+N P   N+EE + D   +E G+D +  IEK+++   F K  L +I+  + +++    +      +D++K++GF+YSTK+  T+   D+    +K+K  EE   KV+ + K +++GL+T++ERY++V+S WSS  + +   + K + +     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+   DC T +G + + I +     +IE L ERLI RF    +VHP++ +V+    E+I +  A E+V+AGI++V +RS   C   +G+C++C+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++ ISEI+G V+ I    D    +VV  +   E+ +Y  P+++ L+V EGDKV  G  +TEGSID KELLKV  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G++D   G ++D++ F + N+K +L + K PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPGNTPLEK----KQLL------SEKEFRAYLDK---------------------------------------------YGNTFSA---AMGAEAINKLLQDIDLVKEVDTLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKGAIGEGMVFKDTNEALLAYQNGYVHLHTRVAVAANSLKNVTFTDEQRSKLLITTVGKLIFNEILPESFPYMNEPTKSNIEEKTPDRFFLEKGEDVKATIEKQEINAPFKKGILGKIIAEIFKRF---HITETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQKILEEAQAKVDNVMKQFRRGLITEEERYERVISIWSSSKDVIQGKLMKSLDE----VNPIYMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKSIRE--GNEIIEKLEERLIGRFARKPIVHPETGEVIVGENELIDEDKALEVVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QATISEIDGVVAEINDVRDKQQEIVV--QGDVETRSYTAPYNARLKVVEGDKVTRGQVLTEGSIDPKELLKVTDMTAVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVADAGDTDVLPGTLLDVHQFTEANKK-VLFEGKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1176
>gi|81429386|ref|YP_396387.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus sakei subsp. sakei 23K] >gi|90111023|sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|78611029|emb|CAI56082.1| DNA-directed RNA polymerase, beta prime subunit [Lactobacillus sakei subsp. sakei 23K] (1214 aa)
Score = 2933, Expect = 0.0e+00, Identities = 582/1264 (46%), Positives = 839/1264 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEE-LSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLAS +KIR WS GEV K ETINY++LKPE+DGLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V+D G+    K                     K   T RE  E +D   +  NA                                      +GAEAI ELL+++DL+ E  ++ E L+ ++     K  + +RRL+ +   + S N+P+WM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LK YQ G+P  M L+LFKPF++HEL+K+          + SNIK+A++ I  QD+ +W ++  VIK+RPVLLNRAPTLHRLGIQAFEPILV+GK+IRLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKPI+TP+QD+VLGNYYLT+E+ N  G+GM+F + +E+   YQ   VH+HS IG+  +    + F  D    I++T+VGKV+ N+++P +  YLN P  DNL   + D   ++ G+D   ++    V   F K  LS+I+  + + Y    ++     +D +K +G+  +T +  T+   DVP+  EK++  ++  KKV  + K +++GL+TD+ER+ +V+  W    N    DI++ +      TN I +M++SGARGNISNFTQL+GMRGLM+                 +EVP+ ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  EDC T +G ++  + +     +IE L +RL+ R P+  +V+P + +V+    +++ + +A  +VDAG+++V +RSV  C  ++G+C+KC+G ++   + VE   A+G +AAQSIGEPGTQLTMR FHTGGV+ G +I QG  R++++F+   PK    + I+E+ G+V +++ +P   +   +T++   ++ +Y VP+ S + V EGD +  G KIT GS+D K+L+KV  +    NY++ EVQKVYR+QGIEI DK++EV++RQ+  KV++ D G+++   G ++DI+ F   N   ++S   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G ++P GTG
  S:     5 NKFESMQIGLASSDKIRSWSYGEVKKPETINYRTLKPERDGLFDERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVIDPGDTALEK---------------------KQLMTEREYREKLDEYGNKFNA-------------------------------------KMGAEAIKELLQDVDLEGEVAELKENLKSAQGQ---KRTRAIRRLDILDAFRKSGNRPDWMVMDAIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLMAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPTLKFYQCGLPREMALELFKPFVMHELVKRD---------MASNIKNAKRKIDRQDDDVWDVLEDVIKERPVLLNRAPTLHRLGIQAFEPILVDGKSIRLHPLACEAYNADFDGDQMAIHVPLSDEAQAEARMLMLAAHHILAPKDGKPIVTPSQDVVLGNYYLTLEQKNRLGEGMIFKDTNEVLMAYQTGHVHLHSRIGLSVADMANRPFTDDQRHKIMVTSVGKVMFNEIMPADFPYLNEPTTDNLMNGVPDKYFIDNGEDIHDYLAGAPVILPFKKGFLSDIIAQVFKVY---KVQRTSDLLDDMKTLGYVQATHAGLTVGVADVPQLPEKQEIVDDAHKKVTTISKQFRRGLITDEERHARVIEIW----NDAKDDIQQRLTDSFDPTNPISMMSDSGARGNISNFTQLAGMRGLMAAPNG-----------GMMEVPVTSNFREGLSVMEMFMSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREEDCGTDRGLLIHSLRE--GNEMIEPLYDRLVGRCPMKTIVNPTTGEVMVAKNQLMDEQLAQAVVDAGVEEVTIRSVFTCNTKHGVCKKCYGRNMANGEEVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGGEDITQGLPRIQEIFEARNPKAI--ATITEVTGEVIAVEENPAE-HTREITVQGETDTRSYSVPYTSNIIVSEGDMIHRGEKITGGSVDPKQLIKVRDVLSTENYLLHEVQKVYRMQGIEIGDKHVEVMVRQMLRKVRVMDPGDTEILPGTLMDISEFTDRNHDTLISGG-VPATCRPVLLGITKASLETNSFLSAASFQETTRVLTDASIRGKSDPLLGLKENVIIGKIVPAGTG 1178
>gi|29377681|ref|NP_816835.1| DNA-directed RNA polymerase subunit beta' [Enterococcus faecalis V583] >gi|41017979|sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|29345149|gb|AAO82905.1| DNA-directed RNA polymerase, beta-prime subunit [Enterococcus faecalis V583] (1217 aa)
Score = 2933, Expect = 0.0e+00, Identities = 594/1264 (46%), Positives = 851/1264 (67%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDNLE---ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASPEKIR WS GEV K ETINY++LKPE++GLF E IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V++ G+    K         L +++  +E R +  +  +                                                     +GAEA+ +LL N+DLD E   + E+L+ +   S  K  + +RRL+ ++  + S N+P WM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAPSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M ++LFKPF++ EL+++          I +NIK+A++ I   ++ +W I+ +VI++ PVLLNRAPTLHRLGIQAFEP+LVEG+AIRLHPLV  A+NADFDGDQMAVHVPL+ EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F +++E    +Q   VH+HS IG+ T+    K F    K+ ILITTVGK+I N+++P E  YLN P +     +  D   VE G D    I+++++   F KK L  I+  + +++    +      +D++KD+G+++ST +  T+   D+    EK+   +   K+VE + K +++GL+TDDERY++V+  W+   +++    +KLI+  E   N I +M++SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +E I +     +IE L+ERL+ R+    VVHP++  ++  A ++IT+ +A EIVDAGI+KV +RSV  C  ++G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++I+E+ G+V  I   P       VTIK   ++  Y VP+ + ++V EGD +  G+ +TEGSID K+LL+V  +  V NY+++EVQ+VYR+QG+EI DK+IEV++RQ+  K+++ D G+++   G ++DI  F+  N   +++   VPAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPEKIRSWSYGEVKKPETINYRTLKPEREGLFCERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVIEPGDTTLEKK-------QLLTEREYREKREQYGQAFKA---------------------------------------------------AMGAEAVKQLLDNVDLDGEVAQLKEELKTA---SGQKRTRAIRRLDILEAFRASGNQPSWMVMDVIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPFLKMYQCGLPKEMAIELFKPFVMRELVQRE---------IATNIKNAKRKIERGEDEVWDILEEVIQEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIRLHPLVCEAYNADFDGDQMAVHVPLNEEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEEEGREGEGMIFRDMNEAVLAWQNGYVHLHSRIGVQTTLLGDKPFTDWQKERILITTVGKIIFNEIMPVEFPYLNEPTDYNLTVQTPDKYFVEAGTDIPAHIKEQELVLPFKKKNLGNIIAEVFKRF---HITETSKMLDRMKDLGYKHSTYAGMTVGIADIMVLHEKQAIIDAAHKQVETITKQFRRGLITDDERYERVIGVWNGAKDEIQ---QKLIESME-ARNPIFMMSDSGARGNISNFTQLAGMRGLMAAPNG-----------RIMELPIISNFREGLSVLEMFISTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLEIEAIRE--GNEIIEPLDERLLGRYTRKSVVHPETGAIIIGADQLITEDLAREIVDAGIEKVTIRSVFTCNTKHGVCKHCYGRNLATGSDVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVITEVTGEVIDISEDPATRQ-KEVTIKGKTDTRTYTVPYTARMKVAEGDIIHRGAPLTEGSIDPKQLLQVRDVLSVENYLLREVQRVYRMQGVEIGDKHIEVMVRQMLRKIRVMDPGDTEILPGTLMDIAEFKDRNYDTLVAGG-VPATSRPVLLGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDPLLGLKENVIIGKIIPAGTG 1177
>gi|187605178|ref|ZP_02991379.1| DNA-directed RNA polymerase, beta' subunit [Exiguobacterium sp. AT1b] >gi|187482747|gb|EDU20750.1| DNA-directed RNA polymerase, beta' subunit [Exiguobacterium sp. AT1b] (1199 aa)
Score = 2930, Expect = 0.0e+00, Identities = 606/1271 (47%), Positives = 847/1271 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +R   ++IGLAS EKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+I+++G IC++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K    K+++      S KE R       RE Y S D +A M                                          GAEAI  LL++++L+KE  ++ E+L+  +     +  + ++RLE +     S N P+WMIL+ + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          I SNIK+A++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEPILVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYY+++E+ +  GQG +F+NV+E    YQ   VH+HS + +P        F     + +LITTVGK+I N++LP    YLN P  +NL+E + D   ++ G +    I  + +   F K  L +++  + +K+           +D++KD+GF++STK+  T+   D+    +K++  +E  K+V+++ K +++GL+T+DERY++VV AW    N+   +I+  + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+  EDC T +G  +  + +      IESL +RL+ R     V HP++ +VL    E+IT+ +A  IVDAG++KVE+R+   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI G V     S D   +   T++   E+ +Y +PF + LRV+ GD V+ G   TEGSID KELL V G+  V+NY+++EVQKVYR+QG+EI DK++EV++RQ+  +V++ +SG++    G ++DI+ F KE  K  + D K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG     D+
  S:     5 NRFEYMKIGLASSEKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECYCGKYKRIRYKGVICDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTEPGDTPLEK----KQLL------SEKEFR-----LYREKYGS-DFKADM------------------------------------------GAEAIRTLLQDVNLEKEVGELREELKTVQGQ---RRTRAIKRLEVLDAFFTSGNNPDWMILEVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------IASNIKNAKRKIEKMQPEIWGVLEEVIREHPVLLNRAPTLHRLGIQAFEPILVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYISLEREDAVGQGKVFSNVNEALIAYQNGYVHLHSRVALPARTLNNPTFTDEQNEKLLITTVGKMIFNEILPNTFPYLNEPTMENLQEATPDKYFIDKGANVAEEIASRPIIDPFKKGFLGKVIAEVFQKFETTE---TSRMLDRMKDLGFKHSTKAGVTVGIADIIVLPDKQEILDEAQKQVDQIMKSFRRGLITEDERYERVVRAW----NEAKDEIQSRLMKSLNRLNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------RIIELPIKSSFREGLTVQEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIREEDCGTDRGIRVSALRE--GTEEIESLYDRLVGRTSFETVTHPETGEVLIDKNELITEDIARIIVDAGVEKVEIRTAFTCNTSHGVCKKCYGRNLATGSNVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEVFEARNPKG--QAVISEISGTVIDFTESRDKREL---TVEGFSETRSYTIPFGARLRVQIGDTVEAGEVFTEGSIDPKELLAVRGVSGVQNYLLQEVQKVYRMQGVEIGDKHVEVMVRQMLRRVKVIESGDTPLLPGSLVDISVF-KEACKDAIRDGKHPATAKPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDYLLGLKENVIIGKLVPAGTGMAVYRDV 1182
>gi|52078602|ref|YP_077393.1| DNA-directed RNA polymerase subunit beta' [Bacillus licheniformis ATCC 14580] >gi|52783964|ref|YP_089793.1| DNA-directed RNA polymerase subunit beta' [Bacillus licheniformis ATCC 14580] >gi|81667234|sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|52001813|gb|AAU21755.1| RNA polymerase (beta subunit) [Bacillus licheniformis ATCC 14580] >gi|52346466|gb|AAU39100.1| RpoC [Bacillus licheniformis DSM 13] (1199 aa)
Score = 2930, Expect = 0.0e+00, Identities = 603/1259 (47%), Positives = 849/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D  N    K    K+++      S KE R+ L K   +       +ASM                                          GAEAI +LL++IDLDKE   + E+L+ S+     +  + ++RLE ++  ++S NKP WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + DE    YQ   VH+H+ + +  ++   + F ++    +LITTVGK+I N++LP    Y+N P   N+EE + D   +++G D +  I+ +++   F K  L +I+  + +++    +      +D++K++GF+YSTK+  T+   D+    +K++  EE   KV+ + K +++GL+T++ERY++V+S WS+  + +   + K + +     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+   DC T +G + + I  T+   VIE L ERL+ RF    V HP++ +VL    E+I +  A EIV+AGI++V +RS   C   +G+C++C+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++ ISEI+G V+ I    D    +VV  +   ES +Y  P+++ L+V EG+K+  G  +TEGS+D KELLKV  I  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G+++   G ++DI+ F + N+K++L + K PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MNIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEK----KQLL------SEKEYRAYLDKYGNKF------QASM------------------------------------------GAEAIHKLLQDIDLDKEVDMLKEELKTSQGQ---RRTRAIKRLEVLEAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERPGAVGEGMIFKDTDEALLAYQNGYVHLHTRVAVAVNSLKNETFTEEQRSKLLITTVGKLIFNEILPPSFPYMNEPTKSNIEEKTPDRFFLDYGADVKEAIKNQEINPPFKKGILGKIIAEIFKRF---HITETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQGKVDNVMKQFRRGLITEEERYERVISIWSAAKDTIQGKLMKSLDE----INPIYMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKAI--TEGTEVIERLEERLVGRFARKPVKHPETGEVLVNENELIDEDKAIEIVEAGIEEVWIRSAFTCNTSHGVCKRCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QATISEIDGVVAEINEVRDKQQEIVV--QGEVESRSYTAPYNARLKVTEGEKISRGQVLTEGSVDPKELLKVTDITTVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTEVLPGTLLDIHQFTEANKKVLL-EGKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1176
>gi|89100357|ref|ZP_01173222.1| DNA-directed RNA polymerase beta' subunit [Bacillus sp. NRRL B-14911] >gi|89084978|gb|EAR64114.1| DNA-directed RNA polymerase beta' subunit [Bacillus sp. NRRL B-14911] (1199 aa)
Score = 2926, Expect = 0.0e+00, Identities = 603/1259 (47%), Positives = 844/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D G+    K    K+++      S KE R+      RE Y +   +ASM                                          GAE+I +LL +IDL+KE   + E+L  ++     +  + ++RLE ++  + S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F +  E    YQ   VH+H+ + +       + F ++    +LITTVGK++ N++LP    Y+N P   NLEE +     VE G D +  I+   +   F KK L  I+  + +++    +      +D++KD+GF +STK+  T+   D+    EK++  +E   KV+ + K +++GL+T+DERY +V+S WS+  + +   + K + K    +N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV ++DC T +G  +  ++D     VIE+L+ERLI R+   D+ HP++  V+    ++IT+ +A EIV+AGI+ V +RS   C   +G+C+KC+G +L T + VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISE+EG V  I    D  + +VV  +   ES  Y  P+ + L+V   D+V  G ++TEGSID KEL+KV  +  V+ Y+++EVQKVYR+QG+EI DK+IEV++RQ+  KV++ D+G ++   G ++DI+ F   NEK +L + K+PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDSGDTALEK----KQLL------SEKEYRA-----YREKYGN-KFQASM------------------------------------------GAESIKKLLSDIDLNKEVDALKEELTTAQGQ---RRTRAIKRLEVLEAFRGSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAVGEGMVFNDTSEALLAYQNGYVHLHTRVAVNAGTLNNETFTEEQRKKLLITTVGKLVFNEILPTSFPYINEPTKTNLEEETPARYFVERGTDVKEAIKNMPLVDPFKKKILGNIIAEVFKRF---KITETSKMLDRMKDLGFRHSTKAGITVGVADIVVLKEKQEIIQEAQGKVDNVLKQFRRGLITEDERYDRVISIWSAAKDTIQAKLMKSLDK----SNPIFMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVRDDDCGTDRGLQISALKD--GTEVIEALDERLIGRYARRDIKHPETNAVIVKENDLITEDLAVEIVEAGIETVWIRSAFTCNTRHGVCKKCYGRNLATGQEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISELEGVVVGINEGRDRQHEIVV--QGEVESRTYTAPYTARLKVAVDDRVDRGQELTEGSIDPKELIKVRDVNAVQEYLLREVQKVYRMQGVEIGDKHIEVMVRQMLRKVRVIDAGETEVLPGSLLDIHQFTDANEKALL-NGKMPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1176
>gi|163764748|ref|ZP_02171802.1| GTP cyclohydrolase I [Bacillus selenitireducens MLS10] >gi|160354774|gb|EDP81433.1| GTP cyclohydrolase I [Bacillus selenitireducens MLS10] (1201 aa)
Score = 2924, Expect = 0.0e+00, Identities = 600/1269 (47%), Positives = 853/1269 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG-----------KKSNEDIIEE 1279
           ++IGLAS +KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D G                       ET  + ++ L E                 K  R +YD    S                   +  +GAEAI +LL++IDLDKE   + E+L  ++     +  + ++RLE ++  + S+N P WM+L  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ +      +W ++  +IK+ PVLLNRAPTLHRLGIQAFEPILVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AE+R ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F   +E+ + YQ   VH+H+ I +P ++  K  F    +D  L+T+VGKVI N++LP+   Y+N P   NLEE++     V  G D +   +++++   F K  L +I+  + +K+  +   ++   +DK+K++GF YSTK+  TI   D+    +K+   +E D+KV  + K +++GL+T++ERY KV+  WS+  + + + +   + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  LEV    +   VIESL +RL+ R     + HP++ ++LA   + IT+ +A  I DAG+  V +RSV  C  ++G C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEIEG V+ IK   D   I+   I+   E+ NY   + + ++V+EGD +  G ++TEGSID KELL+V+G++ V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ DSG++D   G +++I+ +   N +++L   + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG            + N DIIE+
  S:    10 MKIGLASSDKIRSWSRGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRSLEEVIYFASYVVTDPG-----------------------ETPLETKQLLSE-----------------KEYRAYYDKYGRS------------------FKATMGAEAIRKLLEDIDLDKEADMLKEELETAQGQ---RRTRAIKRLEVLEAFRHSDNDPSWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGQG---------LAHNIKSAKRKVERVQPEVWDVLEDIIKEHPVLLNRAPTLHRLGIQAFEPILVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSAEAQAESRLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGSIFTGPNEVLSAYQAGYVHLHTRIAMPVTSINKTNFEDAVQDHYLLTSVGKVIFNEILPDSFPYINEPSAVNLEEVTPRKYFVPRGTDIKAEFKERELISPFKKGFLGDIIAEVFKKFKISETSVM---LDKMKELGFYYSTKAGITIGVSDIVVLKDKQDILDEADEKVTRVTKQFRRGLITEEERYDKVIEIWSNAKDVIQEKLLGTLVK----TNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRTDDCGTDRG--LEVKAIKEGTEVIESLYDRLVGRVSFQRIYHPETGELLADRNQDITEDMAKVIEDAGVQNVMIRSVFTCDTKHGACKKCYGRNLATGAEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEVFEARNPKG--QAVISEIEGTVAEIKDQNDKKEIV---IQGPVETRNYPTMYGARMKVKEGDTILAGQELTEGSIDPKELLQVSGVQGVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMMRKVRVIDSGDTDILPGSLVEIHQYSDANREVLLKGGR-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDQLVGLKENVIIGKLVPAGTGMQRYRQLKAVNTEDNSDIIEQ 1196
>gi|56961925|ref|YP_173647.1| DNA-directed RNA polymerase subunit beta' [Bacillus clausii KSM-K16] >gi|81601107|sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|56908159|dbj|BAD62686.1| DNA-directed RNA polymerase beta' subunit [Bacillus clausii KSM-K16] (1206 aa)
Score = 2924, Expect = 0.0e+00, Identities = 595/1259 (47%), Positives = 841/1259 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDG---ILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K    K+++      S KE R                      A   K  RTF  ++                          GAEAI +LL +IDL KE   + E+L  ++     +  + ++RLE ++  ++S N+P WM+L  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ K          +  NIKSA++ +      +W ++ +VI++ PVLLNRAPTLHRLGIQAFEPILVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME  N  G+G +F + +E    YQ   VH+H+ I +P ++  K  F  +    +L+TTVGK++ N+++P+   Y+N P   NLE +  +  +V    + +  ++++ +   F K  L  I++ + +K+    +      +D++KD+GF+YSTK+  T+   D+   +EK++  +E DKKVE + K +++GL+T++ERY +V+S WS   + +   +   +       N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV   DC T +G  LEV    +    IE L +RL+ R     V HP++ +VL   GE++ +  A +IVDAG++ V +RSV  C   +G+C+ C+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   +++I+EI+G V  ++          VT+++  E+ NY +P+ S L+V  GDKV  G  +TEGSID KELLKV G+  V+ Y+++EVQKVYRLQG+EI DK++EV++RQ+  KV++ D+G++    G +++I  F + N+K++LS+ + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPNKIRSWSRGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRSLEEVIYFASYVVTEPGDTPLEK----KQLL------SEKEYR----------------------AYYDKYGRTFTASM--------------------------GAEAIRKLLADIDLQKEVNALKEELETAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVSKG---------LAHNIKSAKRKVERVQPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPILVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMENANARGEGSVFKDSNEALIAYQNGYVHLHTRIAVPVASLNKPTFADEESNMLLLTTVGKLLFNEIMPDSFPYINEPTASNLEVKTPEKYLVPSNTNVKELLKERDLVPPFKKGFLGNIISEVFKKF---KITETSKMLDRMKDLGFKYSTKAGITVGVSDIVVLSEKKEILDEADKKVERIMKQFRRGLITEEERYDRVISIWSDAKDLIQSKLMGTLDA----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVRENDCGTDRG--LEVTAIKEGTETIEGLYDRLVGRVAFKTVRHPETDEVLVRRGELMNEDTAKQIVDAGVESVTIRSVFTCNTHHGVCKACYGRNLATGSDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QAVITEIDGDVVDVRDGDKRE----VTVQSELETKNYSIPYGSRLKVAVGDKVVAGQTLTEGSIDPKELLKVTGMGGVQEYLLREVQKVYRLQGVEIGDKHVEVMVRQMLRKVRVVDAGDTGILPGSLVEIQRFNEANKKVLLSNMR-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1174
>gi|69246465|ref|ZP_00603960.1| DNA-directed RNA polymerase., Acetylornithine deacetylase [Enterococcus faecium DO] >gi|68195268|gb|EAN09721.1| DNA-directed RNA polymerase., Acetylornithine deacetylase [Enterococcus faecium DO] (1224 aa)
Score = 2924, Expect = 0.0e+00, Identities = 593/1271 (46%), Positives = 860/1271 (67%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDNLE---ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++  S+QIGLASPEKIR WS GEV K ETINY++LKPE++GLF E IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+++YF +Y+V++ GN     N   K+++      + +E R K     RE Y   + +A+M                                          GAEAI +LL N+DLD E  ++ E+L+ ++     K  + +RRL+ ++  + S N+P WM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M ++LFKPF++ EL+++          + SNIK+A++ I  Q++ +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV+G+AIRLHPLV  A+NADFDGDQMAVHVPL+ EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + +E    ++   VH+HS IG+  ++  +K F    K+  +ITTVGK+I N+++P E  YLN P +     +  D   VE G D    I+++++   F KK L  I+  + +++    +      +D++KD+G+++ST +  T+   D+    EK++  E   K+VE + K +++GL+TDDERY++V++ W++  + +    +KL++  E   N I +M++SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  EDC T +G  ++ I +     +IESL +RL+ R+   +V HP++ +++    ++I++ +A +IVDAG++ V +RSV  C  ++G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++I+E+ G V  I   P       VTIK   ++  Y VP+ + ++V EGD +  G+ +TEGSID K+LL+V  +  V NY+++EVQ+VYR+QG+EI DK+IEV++RQ+  KV++ D G++D   G ++DI  F+ +N   ++S   VPAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG +   D+
  S:    12 NKFESMQIGLASPEKIRSWSYGEVKKPETINYRTLKPEREGLFCERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEIIYFASYVVIEPGN----TNLEKKQLL------TEREYREK-----REQYGQ-EFQAAM------------------------------------------GAEAIKQLLDNVDLDAEAAELKEELKSAQGQ---KRTRAIRRLDILEAFRASGNQPSWMVMDVIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPFLKMYQCGLPKEMAIELFKPFVMRELVQRE---------LASNIKNAKRKIERQEDEVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVQGRAIRLHPLVCEAYNADFDGDQMAVHVPLNEEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEEEGREGEGMVFRDQNEAVIAWRNGYVHLHSRIGVNPNSLGEKPFTEWQKERTMITTVGKIIFNEIMPPEFPYLNEPTDFNLTVQTPDKYFVEAGTDIPAHIKEQELVLPFKKKNLGNIIAEVFKRF---KVTETSKMLDRMKDLGYKHSTHAGITVGIADISVLNEKQEIIENAHKQVETITKQFRRGLITDDERYERVIAVWNAAKDSIQ---QKLMEGLE-AKNPIFMMSDSGARGNISNFTQLAGMRGLMAAPNG-----------RIMELPIISNFREGLSVLEMFISTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREEDCGTDRGLEIQAIRE--GNEIIESLEDRLVGRYTRKEVRHPETNELIIAGNQLISEDIAKQIVDAGVETVTIRSVFTCNTKHGVCKHCYGRNLATGSDVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVQEIFEARNPKG--QAVITEVTGDVIDISEDPAT-RTKEVTIKGKTDTRTYTVPYTARMKVAEGDMIHRGAPLTEGSIDPKQLLQVRDVLSVENYLLREVQRVYRMQGVEIGDKHIEVMVRQMLRKVRVMDPGDTDILPGTLLDIADFKDQNYNTLVSGG-VPATSRPVLLGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDPLLGLKENVIIGKIIPAGTGMQRYRDM 1191
>gi|154684626|ref|YP_001419787.1| DNA-directed RNA polymerase subunit beta' [Bacillus amyloliquefaciens FZB42] >gi|154350477|gb|ABS72556.1| RpoC [Bacillus amyloliquefaciens FZB42] (1199 aa)
Score = 2923, Expect = 0.0e+00, Identities = 600/1259 (47%), Positives = 845/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D  N    K    K+++      S KE R+ L K   +       +ASM                                          GAEAI +LL++IDL KE   + E+L+ S+     +  + ++RLE ++  ++S NKP WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F N DE    YQ   VH+H+ + +  ++     F ++    +LITTVGK++ N++LPE   Y+N P   N+EE + D   ++ G D +  I ++ +   F K  L +I+  + +++    +      +D++K++GF YSTK+  T+   D+    +K++  EE   KV+ + K +++GL+T++ERY++V+S WSS  + +   + K + +     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+   DC T +G + + +++     +IE L ERLI RF    + HP++  VL    E+I +  A EIV+AGI++V +RS   C   +G+C++C+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++ ISEI+G ++ I    D    +VV  + + E+ +Y  P++S L+V EGD++  G  +TEGSID KELLKV  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G++D   G ++DI+ F + N+K++L  ++ PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEK----KQLL------SEKEYRAYLDKYGNKF------QASM------------------------------------------GAEAINKLLQDIDLVKEVDMLKEELKTSQGQ---RRTRAIKRLEVLEAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFKNTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFPYMNEPTKSNIEEKTPDRFFLDKGADVKAVIAEQPINAPFKKGILGKIIAEIFKRF---HITETSKMLDRMKNLGFRYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVLKQFRRGLITEEERYERVISIWSSAKDVIQGKLMKSLDE----VNPIYMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKPLKE--GTEIIERLEERLIGRFARKQIKHPETGAVLINENELIDEDKALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QATISEIDGTIAEINEVRDKQQEIVV--QGAVETRSYTAPYNSRLKVAEGDQITRGQVLTEGSIDPKELLKVTDLTTVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVLLEGNR-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1176
>gi|152973949|ref|YP_001373466.1| DNA-directed RNA polymerase subunit beta' [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022701|gb|ABS20471.1| DNA-directed RNA polymerase, beta' subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (1204 aa)
Score = 2920, Expect = 0.0e+00, Identities = 601/1259 (47%), Positives = 845/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSA------FPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S NKP WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ I +P S+      F ++Q  K  +L+TTVGK+I N++LP+   Y+N P   NLE E      V+ G + +  I  ++    F KK L  I+  + +++    +      +D++KD+GF+YSTK+  T+   D+    EK++   E   KV+++ K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    E+IT+ +A  I +AG++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G V +I    D   ++V   + + E+  Y +P+ + L+V  G ++  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G++D   G ++DI+ F   N K++L + K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGNTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLESFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAIGEGMVFKDTNEALLAYQNGYVHLHTRIAVPASSVNNNETFTEEQ--KGKLLLTTVGKLIFNEILPKSFPYINEPTKSNLEKETPAKYFVDKGANIKEVIASREEVAPFNKKILGNIIAEVFKRF---KITETSRMLDRMKDLGFKYSTKAGITVGVADILVLGEKDEILHEAQAKVDKVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLDK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLIRENELITEDIARAIENAGVETVHIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVVVTINDVKDRQEVVV---QGAVETRTYAIPYGARLKVTPGQEISHGQELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTDANVKVLL-EGKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1176
>gi|30260294|ref|NP_842671.1| DNA-directed RNA polymerase subunit beta' [Bacillus anthracis str. Ames] >gi|47525359|ref|YP_016708.1| DNA-directed RNA polymerase subunit beta' [Bacillus anthracis str. 'Ames Ancestor'] >gi|30253615|gb|AAP24157.1| DNA-directed RNA polymerase, beta' subunit [Bacillus anthracis str. Ames] >gi|47500507|gb|AAT29183.1| DNA-directed RNA polymerase, beta' subunit [Bacillus anthracis str. 'Ames Ancestor'] (1194 aa)
Score = 2919, Expect = 0.0e+00, Identities = 600/1274 (47%), Positives = 851/1274 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----------KKSNEDIIEEGNKMY 1284
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K+ +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G K+  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG          K + +D+  E +++Y
  S:     1 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNVTFTEEQKNMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---KITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVY 1191
>gi|116334276|ref|YP_795803.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus brevis ATCC 367] >gi|122269042|sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116099623|gb|ABJ64772.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Lactobacillus brevis ATCC 367] (1215 aa)
Score = 2916, Expect = 0.0e+00, Identities = 585/1264 (46%), Positives = 833/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDNLE---ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +P  S++ LVLD+S + +E+++YF +Y+VLD GN    K    K+++      S ++ R KL +     Y S   +A M                                          GAEAI +LL ++DLDKE  ++ E+L+++      K  + VRRL+ ++    S N+PEWM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LK  Q+G+PV M L+LF+PFI+ EL+ +          + SNIK+A++ I  +D+ ++ ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL P  GKP++ P+QDMV+GNYYLTME+ N  G+GM+F ++DE    Y+   VH H+ +G+  ++ P K F    +  I++TTVGK+I N++LP+   YLN P +      + D   +E G+D   +++  ++   F K  LS+I+  ++++Y    +      +D+IKD+G+  STKS  T+   DV +  EK +      K+V  + K +++GL+TD ERY++V+  W+   +++   +     +     N I +M++SGARGNISNFTQL+GMRGLM+               D +E+PI ++F EGLTV E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D     +IE L +R++ R+    V  P++  V+ P  ++I +  A +IVDAG+++V +RS   C  E+G+C+ C+G ++ T   VE   A+G +AAQSIGEPGTQLTMR FHTGGV+   +I QG  R+++LF+   PK   K+ I+E+ G V SI+ +P       +TIK   ++ +Y +P  + +RV EGD +  G  +  GS+D KELL+V  +     YI+ EVQ+VYR+QG+ I+DK++E+++RQ+  KV+I D G++D   G ++DI  FR+ N + ++ D  + ATA  +I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDWECACGKYKRIRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGIP--SRMGLVLDMSPRALEEIIYFASYVVLDPGNTPLEK----KQLL------SERDYRDKLLE-----YGSDAFKAEM------------------------------------------GAEAIKKLLMSVDLDKEVTELKEELKEATGQ---KRTRAVRRLDILEAFVMSGNRPEWMVMDAIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNSRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPSLKFNQMGLPVPMALELFRPFIMKELVARG---------LASNIKNAKRQIDREDDDVFNVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLACEAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAHHILAPASGKPVVAPSQDMVIGNYYLTMEEANREGEGMIFTDLDEATLAYRNGIVHWHTRVGVQVTSMPDKPFTDEQRSKIMVTTVGKLIFNNILPKSFPYLNEPTSTNLNGYVPDKYFLEPGEDIHDYLQNAEIIPPFKKGFLSDIIAAVYQQY---KVTATSELLDRIKDLGYNESTKSGLTVGMVDVTDLKEKPEIIAAAHKQVSTVTKQFRRGLITDHERYERVIGIWNDAKDEIQNALIHSFDQ----QNPIFMMSDSGARGNISNFTQLAGMRGLMAAPSG-----------DIMELPITSNFREGLTVMEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQDVIIREKDCGTDRGLKIRAITD--GNEMIEPLYDRILGRYTQKTVYDPQTGDVIVPKNQMIVEDTAQQIVDAGVEEVTIRSAFTCNTEHGVCEHCYGRNMATGDEVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGNEDITQGLPRVQELFESRNPKG--KAEITEVTGTVESIEENPAE-RTKEITIKGEADTRSYTLPITARMRVSEGDFIHRGGALNYGSVDPKELLRVRDVLSTETYILGEVQRVYRMQGVAISDKHVEIMVRQMLRKVRIMDPGDTDVLPGTLMDIQDFRRANYQTLI-DGGIAATARPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKIIPAGTG 1179
>gi|49183137|ref|YP_026389.1| DNA-directed RNA polymerase subunit beta' [Bacillus anthracis str. Sterne] >gi|65317560|ref|ZP_00390519.1| COG0086: DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Bacillus anthracis str. A2012] >gi|167642035|ref|ZP_02400264.1| DNA-directed RNA polymerase, beta' subunit [Bacillus anthracis str. A0193] >gi|170689709|ref|ZP_02880885.1| DNA-directed RNA polymerase, beta' subunit [Bacillus anthracis str. A0465] >gi|49065847|sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|49177064|gb|AAT52440.1| DNA-directed RNA polymerase, beta' subunit [Bacillus anthracis str. Sterne] >gi|167510001|gb|EDR85418.1| DNA-directed RNA polymerase, beta' subunit [Bacillus anthracis str. A0193] >gi|170666334|gb|EDT17121.1| DNA-directed RNA polymerase, beta' subunit [Bacillus anthracis str. A0465] (1203 aa)
Score = 2916, Expect = 0.0e+00, Identities = 600/1274 (47%), Positives = 851/1274 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----------KKSNEDIIEEGNKMY 1284
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K+ +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G K+  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG          K + +D+  E +++Y
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNVTFTEEQKNMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---KITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVY 1200
>gi|2507344|sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') (1199 aa)
Score = 2911, Expect = 0.0e+00, Identities = 600/1259 (47%), Positives = 843/1259 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D  N    K    K+++      S KE R+ L K   +       +ASM                                          GAEAI +LL++IDL KE   + E+L+ S+     +  + ++RLE ++  ++S NKP WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F N DE    YQ   VH+H+ + +  ++     F ++    +LITTVGK++ N++LPE   Y+N P   N+EE + D   +E G D +  I ++ +   F K  L +I+  + +++    +      +D++K++GF+YSTK+  T+   D+    +K++  EE   KV+ + K +++GL+T++ERY++V+S WS+  + +   + K + +     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+   DC T +G + + +++      IE L ERLI RF    V HP++ +VL    E+I +  A EIV+AGI++V +RS   C   +G+C++C+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++ I+EI+G V  I    D    +VV  + + E+ +Y  P++S L+V EGDK+  G  +T GSID KELLKV  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G++D   G ++DI+ F + N+K++L  ++ PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GT 
  S:    10 MNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEK----KQLL------SEKEYRAYLDKYGNKF------QASM------------------------------------------GAEAIHKLLQDIDLVKEVDMLKEELKTSQGQ---RRTRAIKRLEVLEAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFKNTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFPYMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRF---HITETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITEEERYERVISIWSAAKDVIQGKLMKSLDE----LNPIYMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKPLKE--GTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDEDKALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QATITEIDGTVVEINEVRDKQQEIVV--QGAVETRSYTAPYNSRLKVAEGDKITRGQVLTGGSIDPKELLKVTDLTTVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVLLEGNR-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPGGTA 1176
>gi|16077176|ref|NP_387989.1| DNA-directed RNA polymerase subunit beta' [Bacillus subtilis subsp. subtilis str. 168] >gi|2632375|emb|CAB11884.1| RNA polymerase (beta' subunit) [Bacillus subtilis subsp. subtilis str. 168] (1199 aa)
Score = 2907, Expect = 0.0e+00, Identities = 600/1259 (47%), Positives = 842/1259 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V D  N    K    K+++      S KE R+ L K   +       +ASM                                          GAEAI +LL++IDL KE   + E+L+ S+     +  + ++RLE ++  ++S NKP WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F N DE    YQ   VH+H+ + +  ++     F ++    +LITTVGK++ N++LPE   Y+N P   N+EE + D   +E G D +  I ++ +   F K  L +I+  + +++    +      +D++K++GF+YSTK+  T+   D+    +K++  EE   KV+ + K +++GL+T++ERY++V+S WS+  + +   + K + +     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S+ GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+   DC T +G + + +++      IE L ERLI RF    V HP++ +VL    E+I +  A EIV+AGI++V +RS   C   +G+C++C+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++ I+EI+G V  I    D    +VV  + + E+ +Y  P++S L+V EGDK+  G  +T GSID KELLKV  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G++D   G ++DI+ F + N+K++L  ++ PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GT 
  S:    10 MNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEK----KQLL------SEKEYRAYLDKYGNKF------QASM------------------------------------------GAEAIHKLLQDIDLVKEVDMLKEELKTSQGQ---RRTRAIKRLEVLEAFRNSGNKPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFKNTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFPYMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRF---HITETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITEEERYERVISIWSAAKDVIQGKLMKSLDE----LNPIYMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTPGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKPLKE--GTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDEDKALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QATITEIDGTVVEINEVRDKQQEIVV--QGAVETRSYTAPYNSRLKVAEGDKITRGQVLTGGSIDPKELLKVTDLTTVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVLLEGNR-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPGGTA 1176
>gi|28377826|ref|NP_784718.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus plantarum WCFS1] >gi|41018003|sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|28270659|emb|CAD63565.1| DNA-directed RNA polymerase, beta' subunit [Lactobacillus plantarum WCFS1] (1213 aa)
Score = 2907, Expect = 0.0e+00, Identities = 589/1264 (46%), Positives = 840/1264 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +P  S++ LVLD+S + +E+++YF +Y+V++ GN    K         L S++  +E +++            + EA+M                                          GAEAI  LL N+DL+KE +D+ E L+   + S  K  + VRRL+ I+    S N+P WM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKM Q+G+P  M L+LFKPFI+ EL+K+          + SNIK+A++ I + D+ +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMV+GNYYLT E++   G+GM+F +++E +  YQ   VH+HS +GI  S+ P K F  D    +L+TTVGK I N++LP +  YLN P N   +    D   ++ G+D   F++ +++   F K  L++I+  ++++Y   +  ++   +D++KD+G+  STKS  T+   D+    EK     E  K+V  + K +++GL+TDDERY++V+  W+   +Q+    +KLI+      N I +M++SGARGNISNFTQL+GMRGLM+           K+    +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G  +  I   +   VIE L +R++ R+ +  V  P++   +     +I + +A++IVDAG+ +V +RS   C  ++G+C+ C+G ++ T   VE   A+G +AAQSIGEPGTQLTMR FHTGGV +G +I QG  R++++ +   PK   ++ ISE+ G V  I+ +P       VT+K   ++  Y +P  + + V EGD +  G+ +  GSID K+L++V  +    NY+++EVQKVYR+QG+EI DK++E++IRQ+  KV++ D G++D   G ++DI  F+ EN K +++   +PAT+  +I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGIP--SRMGLVLDMSPRALEEIIYFASYVVIESGNTPLEKK-------QLLSEREYREKKAQYGN---------EFEAAM------------------------------------------GAEAIKRLLNNVDLEKEARDLKETLK---DASGQKRTRAVRRLDIIEAFVTSGNEPAWMVMDAIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPFLKMNQMGLPRQMALELFKPFIMKELVKRE---------LASNIKNAKRKIEHADDDVWGVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLACEAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAHHILAPKDGKPVVTPSQDMVIGNYYLTTEEIGREGEGMIFKDLNEAQKAYQSGYVHLHSRVGIQVSSMPDKPFTDDQKQAVLVTTVGKAIFNNILPGKFPYLNEPTNDNLIAGTPDKYFLKPGEDIHQFLDAQEIIPPFKKGFLADIIAEVYKQYHVTATSLL---LDRMKDLGYNISTKSGLTVGVADITGLKEKPAIIAEAHKQVNTISKQFRRGLITDDERYERVIGVWNDAKDQIQ---QKLIESFN-ADNPIFMMSDSGARGNISNFTQLAGMRGLMAAP-------NGKI----MELPILSNFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQDVIVREKDCGTDRGLRIHAI--MEGNEVIEPLYDRILGRYTMKTVFDPETHDEIVGNNVLIDEDLAHKIVDAGVTEVTIRSAFTCNTKHGVCEHCYGRNMATGDEVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGV-AGDDITQGLPRVQEIVESRNPKG--RAEISEVTGTVELIEENPAE-RTKEVTVKGETDTRTYTLPLTARMAVSEGDFIHRGAALNIGSIDPKQLIQVRDVLSTENYLLREVQKVYRMQGVEIGDKHVEIMIRQMLRKVRVMDPGDTDVLPGTLMDIADFKDENYKTLIAGG-IPATSRPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLIGLKENVIIGKIIPAGTG 1177
>gi|163938111|ref|YP_001642995.1| DNA-directed RNA polymerase subunit beta' [Bacillus weihenstephanensis KBAB4] >gi|163860308|gb|ABY41367.1| DNA-directed RNA polymerase, beta' subunit [Bacillus weihenstephanensis KBAB4] (1203 aa)
Score = 2906, Expect = 0.0e+00, Identities = 595/1259 (47%), Positives = 840/1259 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K    K+++      S KE R                      A + +   TF+  +                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N P WMIL+ + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  S+     F    K  +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ +  +G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G  +  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDK----KQLL------SEKEYR----------------------AYRDRYGSTFHAAM--------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNHPSWMILEVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGKG---------LAHNIKSAKRKIERVHPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEAILAYQNGYVHLHTRVAVAASSVNNVTFTEEQKSKLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAEYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---QITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVRQDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVVENQLITEDIAHIVEKSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVTLGQPISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLK-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1175
>gi|75762689|ref|ZP_00742527.1| DNA-directed RNA polymerase beta' chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489823|gb|EAO53201.1| DNA-directed RNA polymerase beta' chain [Bacillus thuringiensis serovar israelensis ATCC 35646] (1203 aa)
Score = 2906, Expect = 0.0e+00, Identities = 593/1259 (47%), Positives = 840/1259 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  S+     F    K  +L+TTVGK+I N++LPE   Y+N P   NLE+ +  +  VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G  +  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGKG---------LAHNIKSAKRKIERVHPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEAILAYQNGYVHLHTRVAVAASSVNNVTFTEEQKGKLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAEYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---QITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVSENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVTPGQPISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLK-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1175
>gi|71902748|ref|YP_279551.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS6180] >gi|90111034|sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|71801843|gb|AAX71196.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes MGAS6180] (1213 aa)
Score = 2899, Expect = 0.0e+00, Identities = 590/1282 (46%), Positives = 836/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I++  +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDRLDINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|15674322|ref|NP_268496.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes M1 GAS] >gi|71909898|ref|YP_281448.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS5005] >gi|81171142|sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|13621405|gb|AAK33217.1| DNA-dependent RNA polymerase, B' subunit [Streptococcus pyogenes M1 GAS] >gi|71852680|gb|AAZ50703.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes MGAS5005] (1213 aa)
Score = 2898, Expect = 0.0e+00, Identities = 589/1282 (45%), Positives = 836/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I++  +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y +PF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDRLDINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVIPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|139472962|ref|YP_001127677.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes str. Manfredo] >gi|160175699|sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|134271208|emb|CAM29424.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes str. Manfredo] (1213 aa)
Score = 2897, Expect = 0.0e+00, Identities = 590/1282 (46%), Positives = 836/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +  +    I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I+  ++   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRLKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQNPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|94993487|ref|YP_601585.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS10750] >gi|123080152|sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|94546995|gb|ABF37041.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes MGAS10750] (1213 aa)
Score = 2897, Expect = 0.0e+00, Identities = 590/1282 (46%), Positives = 836/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I+  ++   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|19745278|ref|NP_606414.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS8232] >gi|25453264|sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|19747375|gb|AAL96913.1| RNA polymerase beta' subunit [Streptococcus pyogenes MGAS8232] (1213 aa)
Score = 2897, Expect = 0.0e+00, Identities = 590/1282 (46%), Positives = 836/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I+  ++   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLICAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|167461256|ref|ZP_02326345.1| DNA-directed RNA polymerase subunit beta' [Paenibacillus larvae subsp. larvae BRL-230010] (1207 aa)
Score = 2896, Expect = 0.0e+00, Identities = 597/1266 (47%), Positives = 840/1266 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDND--IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++IGLASP+KIR WS GEV K ETINY++LKPEK+GLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T   VRRER+GHIELAAP++HIW  K +P  S++ L LD+S + +E+++YF +Y+V D G+    K    K+++      S KE RS      RE Y                                               + G+GAEA+ +LL++ID+DKE   + E+LR ++     +  + ++RLE ++  ++S NKP+WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ K          +  NIKSA++ +      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEPILVEG+AI LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLG++YLT +  +  G GM+  +V E  +VYQ     +H+ + IP  A  K  F    +D  LITT+GK+I N++ P++  Y+N     NL     +D    E G D R  +E+    KA  K  L  I+    RKY      I+   +DK+K +GF YSTK+  T++  DV    EK++  +E+++KV+ +   Y++GL+TDDERY +V++ WS   + ++  + K + K     NSI +M  S ARGN S  TQL GMRGLM+                 IE+PIK++F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD  QDVIV  EDC T KG ++  I+D K   VIE L +R+  R+    V HP++ +++    E+I   +A+ IV+AG++K+++RSV+ C+   G+C+KC+G +L T + VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++II+EI+G V  I+ + D   I    ++   ES  Y VPF S +RV   D ++ G ++TEGSID KE+L++ GI  V+NYI++EVQ+VYR QG+EI DK++EV+IRQ+  K++I D+G+++   G  +D++ + + N+  +L + + PA A  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G LIP GTG +   +I
  S:    10 MKIGLASPDKIRSWSRGEVKKPETINYRTLKPEKEGLFCEKIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRQKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLALDMSPRSLEEIIYFASYVVTDPGDTPLEK----KQLL------SEKEYRS-----YREKYG-------------------------------------------YAFQAGMGAEAVKKLLQDIDIDKEVDVLKEELRTAQGQ---RRNRAIKRLEVMEAFRNSKNKPDWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLKMYQCGLPKEMALELFKPFVMKELVNKQ---------LAHNIKSAKRKVERVSPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPILVEGRAIMLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAGNILNPKDGKPVVTPSQDMVLGSFYLTTDNKHAKGSGMILRSVHEAFSVYQNGTAELHARVAIPAKALNKISFTDKQQDAYLITTIGKIIFNEIFPKDFPYINQSTTSNLMHGPSDDYFAFEKGSDIRAKMEELPECKAVGKDYLGSIIAECFRKYHTTETSII---LDKVKQLGFTYSTKAGITVAVADVIVPKEKQEILKESEQKVQTITNQYRRGLITDDERYDRVIAIWSKAKDDITDILMKSLDK----YNSINMMVESKARGNKSQITQLGGMRGLMANPAG-----------KIIELPIKSNFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDVIVREEDCGTDKGFVVSKIQDGK--EVIEDLFDRIEGRYAFETVRHPETGEIIVHRNELIDANLASRIVEAGVEKIQIRSVMSCRARYGVCKKCYGRNLATGQHVEIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QAIITEIDGMVKDIREAKDRREI---EVEGEAESRVYSVPFGSRIRVAVNDHIEAGDELTEGSIDPKEMLRIKGIRGVQNYILQEVQRVYRNQGVEINDKHVEVMIRQMLRKIRIVDAGDTNLLPGSFVDMHEYEEANKTALL-EGREPAVAKPILLGITKASLETDSFLSAASFQETTRVLTDAAIKGKVDQLLGLKENVIIGKLIPAGTGMQRYRNI 1183
>gi|94989595|ref|YP_597695.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS10270] >gi|123258069|sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|94543103|gb|ABF33151.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes MGAS10270] (1213 aa)
Score = 2896, Expect = 0.0e+00, Identities = 590/1282 (46%), Positives = 835/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I+   +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLDINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|49479285|ref|YP_034455.1| DNA-directed RNA polymerase subunit beta' [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118475872|ref|YP_893023.1| DNA-directed RNA polymerase subunit beta' [Bacillus thuringiensis str. Al Hakam] >gi|196042332|ref|ZP_03109607.1| DNA-directed RNA polymerase, beta' subunit [Bacillus cereus NVH0597-99] >gi|81614035|sp|Q6HPR5|RPOC_BACHK DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|49330841|gb|AAT61487.1| DNA-directed RNA polymerase, beta' subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118415097|gb|ABK83516.1| DNA-directed RNA polymerase, beta' subunit [Bacillus thuringiensis str. Al Hakam] >gi|196026838|gb|EDX65470.1| DNA-directed RNA polymerase, beta' subunit [Bacillus cereus NVH0597-99] (1203 aa)
Score = 2896, Expect = 0.0e+00, Identities = 600/1274 (47%), Positives = 851/1274 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----------KKSNEDIIEEGNKMY 1284
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K+ +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G K+  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG          K + +D+  E +++Y
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKNMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---KITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVY 1200
>gi|50913478|ref|YP_059450.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS10394] >gi|73917877|sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|50902552|gb|AAT86267.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes MGAS10394] (1213 aa)
Score = 2896, Expect = 0.0e+00, Identities = 590/1282 (46%), Positives = 835/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI  LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I+  ++   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQALLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQNPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|94987716|ref|YP_595817.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS9429] >gi|94991584|ref|YP_599683.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS2096] >gi|123258251|sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|123382353|sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|94541224|gb|ABF31273.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes MGAS9429] >gi|94545092|gb|ABF35139.1| DNA-directed RNA polymerase beta' chain [Streptococcus pyogenes MGAS2096] (1207 aa)
Score = 2895, Expect = 0.0e+00, Identities = 590/1282 (46%), Positives = 835/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I+   +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLDINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|52145115|ref|YP_081714.1| DNA-directed RNA polymerase subunit beta' [Bacillus cereus E33L] >gi|166986258|ref|ZP_02257513.1| DNA-directed RNA polymerase subunit beta' [Bacillus cereus AH187] >gi|81689843|sp|Q63H97|RPOC_BACCZ DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|51978584|gb|AAU20134.1| DNA-directed RNA polymerase, beta' subunit [Bacillus cereus E33L] (1203 aa)
Score = 2895, Expect = 0.0e+00, Identities = 600/1274 (47%), Positives = 850/1274 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----------KKSNEDIIEEGNKMY 1284
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K  +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G K+  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG          K + +D+  E +++Y
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---KITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVY 1200
>gi|30018373|ref|NP_830004.1| DNA-directed RNA polymerase subunit beta' [Bacillus cereus ATCC 14579] >gi|41017963|sp|Q81J47|RPOC_BACCR DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|29893913|gb|AAP07205.1| DNA-directed RNA polymerase beta' chain [Bacillus cereus ATCC 14579] (1203 aa)
Score = 2895, Expect = 0.0e+00, Identities = 599/1274 (47%), Positives = 849/1274 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----------KKSNEDIIEEGNKMY 1284
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K  +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G  +  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG          K + +D+  E +++Y
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---QITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVTPGQPISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVY 1200
>gi|47570396|ref|ZP_00241036.1| DNA-directed RNA polymerase, beta-prime subunit [Bacillus cereus G9241] >gi|47552938|gb|EAL11349.1| DNA-directed RNA polymerase, beta-prime subunit [Bacillus cereus G9241] (1194 aa)
Score = 2895, Expect = 0.0e+00, Identities = 600/1274 (47%), Positives = 850/1274 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----------KKSNEDIIEEGNKMY 1284
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K  +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G K+  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG          K + +D+  E +++Y
  S:     1 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---KITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVY 1191
>gi|168138680|ref|ZP_02581909.1| DNA-directed RNA polymerase subunit beta' [Bacillus cereus B4264] (1199 aa)
Score = 2893, Expect = 0.0e+00, Identities = 595/1259 (47%), Positives = 839/1259 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K  +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G  +  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---QITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVTPGQPISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1175
>gi|116493169|ref|YP_804904.1| DNA-directed RNA polymerase subunit beta' [Pediococcus pentosaceus ATCC 25745] >gi|122265367|sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116103319|gb|ABJ68462.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Pediococcus pentosaceus ATCC 25745] (1212 aa)
Score = 2893, Expect = 0.0e+00, Identities = 588/1274 (46%), Positives = 841/1274 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDNLEELS---DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KDYECACGKYK+I+++G +C++CGVE+T+S VRRER+GHIELAAP+ HIW  K +P  S++ LVLD+S + +E+++YF +Y+V+D G                       ET  + ++ L E                    R + + L+E    F  +               IG EAI  LL+ +DL+KE   + E+L+++   S  K  + VRRL+ I+    S N PEWM+L  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKM Q+G+PV M ++LFKPFI+ EL+ +          + SNIK+A++ I  +D+ ++ ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+H+PLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMV+GNY+LTME+    G+GM+F ++DE++   Q   V +H+ IG+  ++ P+K F    +  ILITTVGK++ ND+LP+   YLN P N   +S   D   +E G+D R  + ++ +   F    LS+++  ++++Y      ++   +D++KD+GF  ST S  T+   D+    EK +      K+V  + K +++GL+TDDERY++V+  W    N    DI++ + +     N I +M++SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I   +   +IE L +R++ R+ +  V +P++ + +    E+I +A+A +I++AG+ +V +RS   C   +G+C+KC+G ++ T   VE   A+G +AAQSIGEPGTQLTMR FHTGGV+   +I QG  R++++ +   PK    + ISE+ G V +I+  P       +TIK   ++  Y +P  + ++V EGD +  GS + EGSID KEL+KV  +    NY++ E+QKVYR+QGIEI+DK++E++IRQ+  KV++ D G++D   G ++DIN F+ +N K +++   +PAT+  +I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG      I  E
  S:     5 NKFESMQIGLASPDKIRMWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDYECACGKYKRIRYKGIVCDRCGVEVTKSKVRRERMGHIELAAPVTHIWYFKGIP--SRMGLVLDMSPRSLEEIIYFASYVVIDAG-----------------------ETPLEKKQLLTE--------------------REYRNKLSEYGDKFVAK---------------IGGEAIQALLETVDLEKEANQLKEELKEA---SGQKRTRAVRRLDIIEAFLKSGNHPEWMVLDAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPSLKMNQMGLPVPMAMELFKPFIMKELVGRG---------LASNIKNAKRKIDRKDDDVYDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLACEAYNADFDGDQMAIHLPLSNEAQAEARLLMLAAHHILAPKDGKPVVTPSQDMVIGNYWLTMERAESVGEGMIFNDLDEVRLALQNGYVSIHTRIGVRANSMPEKPFTDAQRKQILITTVGKMLFNDILPKGFVYLNAPTNENLVSGTPDEYFLESGEDIREQLNQRPLIAPFKSGFLSDVIAEVYKQYKVTETSLL---LDRMKDLGFYRSTLSGLTVGIADITNLPEKPEIIAAAHKQVATVTKQFRRGLITDDERYERVIGIW----NDAKDDIQQRLMETFDPQNPIFMMSDSGARGNISNFTQLAGMRGLMAAPNG-----------KIMELPILSNFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQDVIVREKDCGTDRGLLISAI--AEGNEMIEPLYDRILGRYTMKSVFNPENGETIIGPNEMINEAIAQQIIEAGVQEVTIRSAFTCNTAHGVCEKCYGRNMATGDRVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGNADITQGLPRIQEIVESRNPKG--PAEISEVTGTVEAIEEDPAE-GTKDITIKGETDTRTYTLPITARMKVAEGDYIHRGSALNEGSIDPKELIKVRDVLSTENYLLSEIQKVYRMQGIEISDKHVEIMIRQMLRKVRVMDPGDTDILPGTLMDINDFKNDNYKTLIAGG-IPATSRPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKIIPAGTGMTDYRQIKPE 1188
>gi|42779184|ref|NP_976431.1| DNA-directed RNA polymerase subunit beta' [Bacillus cereus ATCC 10987] >gi|81570006|sp|Q73FA3|RPOC_BACC1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|42735099|gb|AAS39039.1| DNA-directed RNA polymerase, beta' subunit [Bacillus cereus ATCC 10987] (1203 aa)
Score = 2892, Expect = 0.0e+00, Identities = 599/1274 (47%), Positives = 850/1274 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----------KKSNEDIIEEGNKMY 1284
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K  +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G ++  G ++TEGSID KELLKV  I  V+ Y+++EVQKVYR+QG+EI DK++EV++RQ+  KV++ D+G +D   G ++DI+ F   N K++L   K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG          K + +D+  E +++Y
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---KITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVETRTYAIPYGARLKVIPGQQISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ-GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVY 1200
>gi|56808831|ref|ZP_00366544.1| COG0086: DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Streptococcus pyogenes M49 591] (1204 aa)
Score = 2892, Expect = 0.0e+00, Identities = 588/1277 (46%), Positives = 833/1277 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I++  +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     1 MQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDRLDINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1186
>gi|163791690|ref|ZP_02186084.1| DNA-directed RNA polymerase subunit beta' [Carnobacterium sp. AT7] >gi|159873038|gb|EDP67148.1| DNA-directed RNA polymerase subunit beta' [Carnobacterium sp. AT7] (1206 aa)
Score = 2890, Expect = 0.0e+00, Identities = 603/1260 (47%), Positives = 857/1260 (68%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           S+QIGLASP+KIR WS GEV K ETINY++LKPE+DGLF E IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+++YF +Y+V++ G+    K    K+++      + +E R K     RE Y + + +A M                                          GAEA+ +LL ++ LD+E +++ E L+    T+  K  + +RRL+ ++  ++S N P WM++  I + PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M ++LFKPF++ EL+ +          I SNIK+A++ I  QD+ IWPI+ +VI++ PVLLNRAPTLHRLGIQAFEP+LVEGKAIRLHPLV  A+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+GM F++++E    YQ   VH+HS I I  +  P K F    KD ++ITTVGK+I ND++P E  Y+N P   NLE +  D+  VE G +    I+ +++ K F KK L  I+  + +++    +      +D++KD+G++YSTK+  T+   D+    EK++  +   K+VE++ K +++GL+TD+ERY++V+  W    N+    I+  + +     N I +M++SGARGNISNFTQL+GMRGLM+                 +E+P+ ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+   DC + +G +++ I++     VIE L ERL+ R+    V +P+   V+    +IIT+ +A EI+ AGI+++ +RSV  C  ++G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++I+E+ G+V SI  +P       VTIK   ++ +Y+VPF + L+VEEGD +  G  + +GSID KELL+V  +  V NY+++EVQKVYR+QG+EI DK+IEV++RQ+  KV++ D G +D   G +IDI+ +  +N   ++S   +PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     9 SMQIGLASPDKIRSWSYGEVKKPETINYRTLKPERDGLFCERIFGPSKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEIIYFASYVVIEPGSTSLEK----KQLL------TEREYREK-----REQYGN-EFQAEM------------------------------------------GAEAVKQLLNDVKLDQEVEELKEILK---TTTGQKRTRAIRRLDILEAFRNSGNHPSWMVMDVIPIIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPFLKMYQCGLPKQMAIELFKPFVMKELVSRD---------IASNIKNAKRKIDRQDDAIWPILEEVIREHPVLLNRAPTLHRLGIQAFEPVLVEGKAIRLHPLVCEAYNADFDGDQMAVHVPLSDEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEEEGREGEGMQFSSLNEAMLAYQSGYVHLHSRIAIKPTDIPNKPFTEWQKDKLMITTVGKLIFNDIMPNEFPYMNEPTQSNLEVQTPDSYFVEGGINVLEHIQAQELVKPFKKKNLGNIIAEVFKRF---KITETSKMLDRMKDLGYKYSTKAGITVGISDIVVLEEKQEILDNAHKQVEKVTKQFRRGLITDEERYERVIDIW----NKTKDHIQIRLMESLNDLNPIFMMSDSGARGNISNFTQLAGMRGLMAAPNG-----------QIMELPVTSNFREGLSVLEMFISTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIRETDCGSDRGLVIQAIKE--GNEVIEPLEERLLGRYTRKTVFNPEDGTVIIGENQIITEDIAREIIAAGIEEITIRSVFTCNTKHGVCKHCYGRNLATGSEVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARHPKG--QAVITEVTGEVVSIDENP-AARTKEVTIKGDTDTRSYQVPFSARLKVEEGDIIHRGEALDQGSIDPKELLRVRDVLAVENYLLREVQKVYRMQGVEIGDKHIEVMVRQMLRKVRVMDPGETDILPGTLIDIHDYTDKNFDTLVSGG-IPATARPVLLGITKASLETNSFLSAASFQETTRVLTDAAIRGKRDPLLGLKENVIIGKVIPAGTG 1177
>gi|21909612|ref|NP_663880.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes MGAS315] >gi|25453263|sp|Q8K8W2|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|21903793|gb|AAM78683.1| putative DNA-dependent RNA polymerase beta prime subunit [Streptococcus pyogenes MGAS315] (1207 aa)
Score = 2890, Expect = 0.0e+00, Identities = 589/1282 (45%), Positives = 834/1282 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G+D +  I+   +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L  RL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLDINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEVRLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1195
>gi|23097568|ref|NP_691034.1| DNA-directed RNA polymerase subunit beta' [Oceanobacillus iheyensis HTE831] >gi|41018046|sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|22775791|dbj|BAC12069.1| DNA-directed RNA polymerase beta' subunit [Oceanobacillus iheyensis HTE831] (1203 aa)
Score = 2888, Expect = 0.0e+00, Identities = 588/1259 (46%), Positives = 846/1259 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPD--NLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF  YIV D G+    K    K+++      S KE RS                              +YD    +                   +  +GAEAI +LL++IDL+KE   + E+L+ ++     +  + ++RLE ++  ++S N+  WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPFI+ EL+ +          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LV+G+AIRLHPLV TA+NADFDGDQMAVHVPL  EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G  F + +E    YQ    H+H+ + +  S+   K F ++    +L+TTVGK+I N++LP+   Y+N P   NLEE + +N  V+ G   +  I+ +++ K F K  L +I+  + +++    +      +D++KD+GF YSTK+  T+   D+    EK+   +E   KV+++ K +++GL+T++ERY +V++ WS   + +   +   +       N I +M++SGARGN SNFTQL+GMRGLM+     D   K       IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  +E+     VIE L +RLI R    +V HP++ +V+    E+I++  A  IV++GI +V +RS   C  ++G+CQKC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   +++I+EI+G V   K   D   I+V   +   E  +Y VP+++ ++V  GD V+ G ++TEGS+D KELL++ G+E V++Y++KEVQ+VYR+QG+EI DK++EV++RQ+  K+++  SG+++   G +++++ F++ N K+++ + + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    10 MKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFAAYIVTDPGSTPLEK----KQLL------SEKEFRS------------------------------YYDKYGNT------------------FKAQMGAEAIRKLLQDIDLEKEVDALREELKSAQGQ---RRTRAIKRLEVMEAFRNSGNESSWMILDVLPVIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKMYQCGLPREMALELFKPFIMKELVSRG---------LAHNIKSAKRKIERVHPDVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVDGRAIRLHPLVCTAYNADFDGDQMAVHVPLGAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAIGEGSYFKDTNEALIAYQTGYAHLHTRVAVQASSLNNKTFTEEQNNKLLLTTVGKLIFNEILPDSFPYINEPTQLNLEEKTPENYFVDPGTSIKEEIQSRELVKPFKKGFLGDIIAEVFKRF---QITETSKMLDRMKDLGFSYSTKAGMTVGISDIVVLAEKQGILDEAQTKVDKVLKQFRRGLITEEERYDRVIAIWSEAKDVIQDKLMGSLSN----RNPIFMMSDSGARGNASNFTQLAGMRGLMA-----DPAGK------IIEIPIKSSFREGLTVMEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTVSALEE--GSEVIEPLIDRLIGRTSFENVKHPETGEVIVEKNELISEDQAKTIVESGIQEVIIRSAFTCNTKHGVCQKCYGRNLATGSDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QAVITEIDGTVLEFKEVKDKQEIVV---QGEVEQRSYAVPYNARMKVSIGDTVEAGQELTEGSVDPKELLQIKGVEGVQDYLLKEVQRVYRMQGVEIGDKHVEVMVRQMLRKIRVVSSGDTEVLPGSLLELHQFKEANHKVLMEEGE-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 1175
>gi|22536345|ref|NP_687196.1| DNA-directed RNA polymerase subunit beta' [Streptococcus agalactiae 2603V/R] >gi|25010232|ref|NP_734627.1| DNA-directed RNA polymerase subunit beta' [Streptococcus agalactiae NEM316] >gi|76787132|ref|YP_328892.1| DNA-directed RNA polymerase subunit beta' [Streptococcus agalactiae A909] >gi|41018036|sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|41018039|sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|109914410|sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|22533170|gb|AAM99068.1|AE014199_4 DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae 2603V/R] >gi|23094584|emb|CAD45802.1| RNA polymerase beta-subunit [Streptococcus agalactiae NEM316] >gi|76562189|gb|ABA44773.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus agalactiae A909] (1216 aa)
Score = 2885, Expect = 0.0e+00, Identities = 580/1271 (45%), Positives = 832/1271 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G IC++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D               +D   +  S  T  + R+ L+E                                       + + S    M    GAEAI +LLK +DLD E   + E+L+ +     +K    VRRL+ +   K S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          +  N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    YQ   VH+H+ +GI   + P K +    K  I++TTVGK++ ND++PE++ YL  P+N    E+  D   +E G+D +  I+  ++   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VE++ K +++GL+T+++RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D K   V E+L ERLI R+    + HP++ ++L  A  +IT+ +A ++V AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V +I+    +     V +K       Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIICDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVIDP--------------MDTPLEPKSLLTEREYREKLQE---------------------------------------YGYGSFVAKM----GAEAIQDLLKRVDLDAEIAVLKEELKSATGQKRVKA---VRRLDVLDAFKKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------LAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDHDEAVMAYQNGYVHLHTRVGIAVDSMPNKPWTEEQKHKIMVTTVGKILFNDIMPEDLPYLIEPNNANLTEKTPDKYFLEPGQDIQAVIDNLEINIPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEDINKAFRRGLMTEEDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTITAITDGK--EVTETLEERLIGRYTKKSIKHPETGEILVGADTLITEDMAAKVVKAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGEVVAIEED-SSTRTKKVFVKGQTGEGEYVVPFTARMKVEVGDEVARGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI 1186
>gi|41018033|sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') (1209 aa)
Score = 2883, Expect = 0.0e+00, Identities = 579/1264 (45%), Positives = 831/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK    +  ++  S  + +E R KL++     Y S    A M                                          GAEAI +LLK +DLD E  ++ E+L+ +   S  K  K +RRL+ +   + S NKPEWM+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++LI   D+ IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME  +  G+GM+F + DE    Y+   VH+HS +GI   + P K +    +  I+ITTVGK++ ND++P ++ YL  P+N    ++  D   +  G + +  I+   +   F KK L  I+  + +++         + +D++KD+G+ +ST +  T+   D+P    K++  +    +VEE+ K +++GL+TDD+RY+ V + W     Q    +E  + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D K   V E+L ERL+ R+    V HP++ +++A    +IT+ +A+ I +AG+ +V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S  +I QG  R++++F+   PK   +++I+E++G+V+ I+          V +K +     Y VPF + ++V+ GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++    G ++DI  F   N  ++++   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NRFKSMQITLASPNKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK----ETPLEAKSLLTEREYREKLQE-----YGSGSFIAKM------------------------------------------GAEAIQDLLKRVDLDAEIAELKEELKTA---SGQKRVKAIRRLDVLDAFQKSGNKPEWMVLNILPVIPPDLRPMLQLDGGRFATSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSQMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVDRD---------IVQNVKAAKRLIERGDDRIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLACEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEGADREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIAVDSMPNKPWTDEQRHKIMITTVGKILFNDIMPADLPYLQEPNNANLTDKTPDKYFLAPGSNIQEAIKNLDLNIPFKKKNLGNIIAEIFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKQEIIDAAHHRVEEISKAFRRGLMTDDDRYEAVTATWRDAKEQ----LEARLVETQDAKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTITAITDGK--EVTETLEERLVGRYTKKSVRHPETGEIIASPDTLITEDMAHYIAEAGVSEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNADITQGLPRIQEIFEARNPKG--EAVITEVKGQVTDIEEDAAT-RTKKVYVKGATGEGEYTVPFTARMKVQVGDEVHRGAPLTEGSIQPKHLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTGLLPGILMDIADFTDANRDIVIAGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTG 1179
>gi|76798579|ref|ZP_00780809.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77406341|ref|ZP_00783404.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae H36B] >gi|77407935|ref|ZP_00784686.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae COH1] >gi|77410971|ref|ZP_00787327.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae CJB111] >gi|77413383|ref|ZP_00789576.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae 515] >gi|76586065|gb|EAO62593.1| DNA-directed RNA polymerase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77160553|gb|EAO71671.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae 515] >gi|77163026|gb|EAO73981.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae CJB111] >gi|77173482|gb|EAO76600.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae COH1] >gi|77175046|gb|EAO77852.1| DNA-directed RNA polymerase beta' subunit [Streptococcus agalactiae H36B] (1226 aa)
Score = 2883, Expect = 0.0e+00, Identities = 580/1271 (45%), Positives = 832/1271 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G IC++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D               +D   +  S  T  + R+ L+E                                       + + S    M    GAEAI +LLK +DLD E   + E+L+ +     +K    VRRL+ +   K S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          +  N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    YQ   VH+H+ +GI   + P K +    K  I++TTVGK++ ND++PE++ YL  P+N    E+  D   +E G+D +  I+  ++   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VE++ K +++GL+T+++RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D K   V E+L ERLI R+    + HP++ ++L  A  +IT+ +A ++V AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V +I+    +     V +K       Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I
  S:    15 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIICDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVIDP--------------MDTPLEPKSLLTEREYREKLQE---------------------------------------YGYGSFVAKM----GAEAIQDLLKRVDLDAEIAVLKEELKSATGQKRVKA---VRRLDVLDAFKKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------LAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDHDEAVMAYQNGYVHLHTRVGIAVDSMPNKPWTEEQKHKIMVTTVGKILFNDIMPEDLPYLIEPNNANLTEKTPDKYFLEPGQDIQAVIDNLEINIPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEDINKAFRRGLMTEEDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTITAITDGK--EVTETLEERLIGRYTKKSIKHPETGEILVGADTLITEDMAAKVVKAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGEVVAIEED-SSTRTKKVFVKGQTGEGEYVVPFTARMKVEVGDEVARGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI 1196
>gi|169830045|ref|YP_001700203.1| DNA-directed RNA polymerase beta' chain [Lysinibacillus sphaericus C3-41] >gi|168994533|gb|ACA42073.1| DNA-directed RNA polymerase beta' chain [Lysinibacillus sphaericus C3-41] (1218 aa)
Score = 2879, Expect = 0.0e+00, Identities = 600/1273 (47%), Positives = 855/1273 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDG---ILITTVGKVILNDVLPEEMSYLNNPD--NLEELSD-----------------------NDIVEWGK-------DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKG-TILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKM 1283
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+V+D G      N   K+++   S+K  +  R K   T          EASM                                          GAEAI +LL  IDL+ E   + E+L+ ++     +  + ++RLE ++  ++S N PEWMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M ++LFKPF++ EL+++          +  NIKSA++ I   +N +W ++  VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +  G+G +F   +E+   Y    VH+H+ I I   +     F ++     L+TTVGKVI N++LPE   Y+N P   NLE+++                        N + E GK         R   E   V   F KK L  I+  + +++    +      +D++K++GF+YST++  T+   D+    +K +      +KV++++  +++G +T+DERY +V+S+WS+  +++   + K ++K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G TI  ++E T+   +IE+L+ER++ R     +VHP++ +V+     +I + VA  I++AGI++V +RS   C  ++G+C+KC+G +L T + VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +S+ISEI G VS I  +     +  +TI+   E+  Y+ P+++ L+V EGD V+ G  +TEGSID K+LLKV  +  V+ Y++KEVQKVYR+QG+EI DK+IEV++RQ+  KV++ ++G++D   G ++DI+ F + N   ++ D K PAT   +I G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG +    I  E +++
  S:     1 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEEVIYFASYVVIDAG----ATNLESKQLL---SEKEYRAYREKFGNTF---------EASM------------------------------------------GAEAIKKLLGKIDLEDETHSLKEELKSAQGQ---RRTRAIKRLEVVESFRNSGNSPEWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMAIELFKPFVMKELVERG---------LAHNIKSAKRKIERLNNDVWDVLEDVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERESARGEGTIFYGPNEVLIAYDTGHVHLHTRIAIKAGSLNNPTFTEEQNNMFLLTTVGKVIFNEILPESFPYINEPTDFNLEQVTPEKYFVNLTIDEETLKELESDSAYNSLDEKGKIDAQRTAVLRKHFESVPVVNPFRKKFLGNIIAEVFKRF---HITETSKMLDRMKNLGFKYSTRAGITVGVSDIVVLPDKGEILAVAQEKVDKVQAQFRRGFITEDERYDRVISSWSAAKDEIQAKLMKSLEK----TNPIFMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLTIGALMEGTE---LIEALDERIVGRHTKKTIVHPETGEVILNKDGLIDQDVARAIIEAGIEEVTIRSAFTCNTKHGVCKKCYGMNLATGEKVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QSVISEIAGTVSDI--TEIREGLKEITIQGDVETRKYQAPYNARLKVIEGDNVERGQVLTEGSIDPKQLLKVKDVSTVQEYLLKEVQKVYRMQGVEIGDKHIEVMVRQMLRKVRVIEAGDTDLLPGSLLDIHQFAEANADAVM-DGKNPATCRPVILGITKASLETESFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMQRYRQIRIEKDEL 1210
>gi|24380332|ref|NP_722287.1| DNA-directed RNA polymerase subunit beta' [Streptococcus mutans UA159] >gi|24378348|gb|AAN59593.1|AE015021_14 DNA-dependent RNA polymerase, beta' subunit [Streptococcus mutans UA159] (1218 aa)
Score = 2879, Expect = 0.0e+00, Identities = 579/1264 (45%), Positives = 831/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK    +  ++  S  + +E R KL++     Y S    A M                                          GAEAI +LLK +DLD E  ++ E+L+ +   S  K  K +RRL+ +   + S NKPEWM+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++LI   D+ IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME  +  G+GM+F + DE    Y+   VH+HS +GI   + P K +    +  I+ITTVGK++ ND++P ++ YL  P+N    ++  D   +  G + +  I+   +   F KK L  I+  + +++         + +D++KD+G+ +ST +  T+   D+P    K++  +    +VEE+ K +++GL+TDD+RY+ V + W     Q    +E  + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D K   V E+L ERL+ R+    V HP++ +++A    +IT+ +A+ I +AG+ +V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S  +I QG  R++++F+   PK   +++I+E++G+V+ I+          V +K +     Y VPF + ++V+ GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++    G ++DI  F   N  ++++   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:    14 NRFKSMQITLASPNKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK----ETPLEAKSLLTEREYREKLQE-----YGSGSFIAKM------------------------------------------GAEAIQDLLKRVDLDAEIAELKEELKTA---SGQKRVKAIRRLDVLDAFQKSGNKPEWMVLNILPVIPPDLRPMLQLDGGRFATSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSQMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVDRD---------IVQNVKAAKRLIERGDDRIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLACEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEGADREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIAVDSMPNKPWTDEQRHKIMITTVGKILFNDIMPADLPYLQEPNNANLTDKTPDKYFLAPGSNIQEAIKNLDLNIPFKKKNLGNIIAEIFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKQEIIDAAHHRVEEISKAFRRGLMTDDDRYEAVTATWRDAKEQ----LEARLVETQDAKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTITAITDGK--EVTETLEERLVGRYTKKSVRHPETGEIIASPDTLITEDMAHYIAEAGVSEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNADITQGLPRIQEIFEARNPKG--EAVITEVKGQVTDIEEDAAT-RTKKVYVKGATGEGEYTVPFTARMKVQVGDEVHRGAPLTEGSIQPKHLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTGLLPGILMDIADFTDANRDIVIAGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTG 1188
>gi|195977260|ref|YP_002122504.1| DNA-directed RNA polymerase beta' chain RpoC [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195973965|gb|ACG61491.1| DNA-directed RNA polymerase beta' chain RpoC [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (1202 aa)
Score = 2878, Expect = 0.0e+00, Identities = 585/1266 (46%), Positives = 828/1266 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ ++E                                        +FI+        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWMIL  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+   VH+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G++ +  I+   +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  E    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI  F   N+++++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I
  S:     1 MQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKIQEYGHG------------------------------------SFIAK-------MGAEAIQDLLKRVDLATEIAELKEELKTATGQKRIKA---VRRLDVLDAFNKSGNKPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARE---------FAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYVHLHSRVGIAVDSMPSKPWKDSQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQNIQEVIDSLPLNVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGTVIEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKHLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDIADFTDANKEIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI 1177
>gi|116491357|ref|YP_810901.1| DNA-directed RNA polymerase subunit beta' [Oenococcus oeni PSU-1] >gi|122276461|sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116092082|gb|ABJ57236.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Oenococcus oeni PSU-1] (1233 aa)
Score = 2877, Expect = 0.0e+00, Identities = 592/1274 (46%), Positives = 847/1274 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDG----ILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++  S+QIGLASP KIREWS GEV K ETINY++LK E+DGLFDE IFGP+KDYECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ L+LD+S + +E+++YF +Y+V++ GN    K    K++I          T ++ R+  ++ Y +   +A M        A    + LAE                                   +DL+K+ K++  +L+   + +  K  + VRRL+ ++    S NKPEWM++  + V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKM Q+G+P  M ++LFKPFI + LI+   + G       +N++SA  L+   ++ +  ++ +V+K+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPLVTTA+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKPI+ P+QDM +GNYYLT E+  + G+GM+F++ DE+K   Q  +V +H+ IGI  S+F K +   D     I++TTVGKVI N++LP++  Y+N P  +N   + D   ++ G D   + + + +   F    LS+I+  ++ +Y      ++   +D +KD+G++ ST+S  T++  DV E  EK +  +E  +KV ++ K +++GLLTDDERY +V   WS   ++    I+ ++       N I +M++SGARGNISNF QL+GMRGLM+           KV    IE+P+  +F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  Q+VIV  EDC T +G  +  I D     VIE L +R++ R+ +  V+ PK+ +V+A   ++I + VA++I+DAGI  V +RS+  C+ E+G+C KC+G ++ T  +VE   A+G +AAQSIGEPGTQLTMRTFHTGGV+   +I QG  R++++F+   PK   ++ ISE+ GKV+SI+ +P +     VTI+   ++  Y +P  + LRV EGD++     I EG +D KEL+KV+      NY++ EVQKVYR+QG+ IADK++EV++RQ+  KV++ D G +D   G+++DI  FR+ N K ILS  +  AT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG      I +E
  S:     6 NKFESMQIGLASPAKIREWSYGEVKKPETINYRTLKAERDGLFDERIFGPIKDYECACGKYKRIRYKGIVCDRCGVEVTSSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLILDMSPRSLEEIIYFASYVVINPGNTPLEK----KQLI----------TEAEYRQ-YQDQYGTDTFDAKMG-------AEAIKELLAE-----------------------------------VDLEKQAKELKNELK---DATGQKRTRAVRRLDIVEAFIQSGNKPEWMVMDVVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVSGPGNRPLKSLSHLLKGKQGRFRQNLLGKRVDYSGRSVIDVGPFLKMNQMGLPRQMAVELFKPFIYNRLIELGTENGGA-----NNLRSARCLVERHEDVVQDVLEEVVKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLVTTAYNADFDGDQMAIHVPLSDEAQAEARLLMLAASHILAPKDGKPIVAPSQDMTIGNYYLTTEEAGIKGEGMIFSSADEVKMALQNHEVELHTRIGIAASSFDKAKPFTDHQRARIMVTTVGKVIFNEILPDDFPYINEPKSENFNGIDDRFFLDPGTDIVGWFKNESLNGPFKSGFLSDIIAQIYARYQVTRTSVL---LDDMKDLGYDISTRSGLTVAMSDVTELPEKGEVLKEAHEKVAKITKQFRRGLLTDDERYIQVTQTWSDAQDK----IKSMLIASFDSKNPIFMMSDSGARGNISNFVQLAGMRGLMAAP-------NGKV----IELPVTANFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQEVIVREEDCGTDRGLDVSAIMD--GNEVIEPLYDRILGRYAMKPVIDPKTGEVIAKKNQMIDEHVADQIIDAGIQTVTIRSIFTCRTEHGVCVKCYGRNMATGDIVEVGEAVGTVAAQSIGEPGTQLTMRTFHTGGVALSEDITQGLPRVQEIFEARNPKG--RAEISEVTGKVTSIEENPAD-RTKTVTIEGETDTREYVLPISARLRVAEGDEIHRSEAINEGPLDPKELIKVSSTLKTENYMLAEVQKVYRMQGVGIADKHVEVMVRQMLRKVRVMDPGQTDLLPGELLDIADFRRANAKTILS-GQTAATSRPVLLGITKASLETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKVIPAGTGVAEYRHIKDE 1194
>gi|28894989|ref|NP_801339.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pyogenes SSI-1] >gi|28810234|dbj|BAC63172.1| putative DNA-dependent RNA polymerase beta prime subunit [Streptococcus pyogenes SSI-1] (1198 aa)
Score = 2877, Expect = 0.0e+00, Identities = 586/1277 (45%), Positives = 831/1277 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELE 1287
           +QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ L+E                                        +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ K             N+K+A++++   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+    H+HS +GI   + P K +    +  I++TTVGK++ ND++PE++ YL  P+N    E   D   +E G++ +  I+   +   F KK L  I+    +++         + +D++KD+G+ +ST +  T+   D+P    K +  +    +VEE+ K +++GL+TDD+RY  V + W     +  + +EK + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L  RL  R+    V HP++ +VL  A ++IT+ +A +IVDAG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   +PAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I  E   M E+E
  S:     1 MQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKLQEYGHG------------------------------------SFVAK-------MGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKA---VRRLDVLDAFNKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKE---------YAGNVKAAKRMVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIFKDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDLPYLQEPNNANLTEGTPDKYFLEPGQNIQEVIDGLDINVPFKKKNLGNIIAETFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMTDDDRYVAVTTTW----REAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRAITDGK--EVTETLEVRLQGRYTRKSVKHPETGEVLIGADQLITEDMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGNVVEIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-IPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNI--EPQAMNEIE 1186
>gi|126654239|ref|ZP_01726033.1| DNA-directed RNA polymerase subunit beta' [Bacillus sp. B14905] >gi|126589297|gb|EAZ83454.1| DNA-directed RNA polymerase subunit beta' [Bacillus sp. B14905] (1227 aa)
Score = 2874, Expect = 0.0e+00, Identities = 598/1273 (46%), Positives = 855/1273 (67%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDG---ILITTVGKVILNDVLPEEMSYLNNP---------------------DNLEELSD----NDIVEWGK-------DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKG-TILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKM 1283
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+V++ G      N   K+++   S+K  +  R K   T          EA+M                                          GAEAI +LL  IDL+ E   + E+L+ ++     +  + ++RLE ++  ++S N PEWMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M ++LFKPF++ EL+++          +  NIKSA++ I   +N +W ++  VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F   +E+   Y    VH+H+ I I  S+     F ++     L+TTVGKVI N++LPE   Y+N P                     D L+EL      N + E GK         R   E   V   F KK L  I+  + +++    +      +D++K++GF+YST++  T+   D+    +K +      +KV++++  +++G +T+DERY +V+S+WS+  +++   + K ++K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G TI  ++E T+   +IE+L+ER++ R     ++HP++ +V+     +I + VA  I++AGI++V +RS   C  ++G+C+KC+G +L T + VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +S+ISEI G VS I  +     +  +T++   E+  Y+ P+++ L+V EGD V+ G  +TEGSID K+LLKV  +  V+ Y++KEVQKVYR+QG+EI DK+IEV++RQ+  KV++ ++G++D   G ++DI+ F + N   ++ + K PAT   +I G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG +    I  E +++
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEEVIYFASYVVIEAG----ATNLESKQLL---SEKEYRAYREKFGNTF---------EAAM------------------------------------------GAEAIKKLLGKIDLEDETHSLKEELKSAQGQ---RRTRAIKRLEVVESFRNSGNSPEWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMAIELFKPFVMKELVERG---------LAHNIKSAKRKIERLNNDVWDVLEDVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENARGEGTIFYGPNEVLIAYDTGHVHLHTRIAIKASSLNNPTFTEEQNNMFLLTTVGKVIFNEILPESFPYINEPTDFNLEQVTPEKYFAKLTIDEDTLKELESDSAYNSLDEKGKIDAQRTAVLRKHFESVPVVNPFRKKFLGNIIAEVFKRF---HITETSKMLDRMKNLGFKYSTRAGITVGVSDIVVLPDKGEILAVAQEKVDKVQAQFRRGFITEDERYDRVISSWSAAKDEIQAKLMKSLEK----TNPIFMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLTIGALMEGTE---LIEALDERIVGRHTKKTILHPETGEVILNKDGLIDQDVARAIIEAGIEEVTIRSAFTCNTKHGVCKKCYGMNLATGEKVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QSVISEIAGTVSDI--TEIREGLKEITVQGDVETRKYQAPYNARLKVIEGDNVERGQVLTEGSIDPKQLLKVKDVSTVQEYLLKEVQKVYRMQGVEIGDKHIEVMVRQMLRKVRVIEAGDTDLLPGSLLDIHQFAEANADAVM-NGKNPATCRPVILGITKASLETESFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTGMQRYRQIRIEKDEL 1219
>gi|153165292|ref|ZP_01926243.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes FSL N1-017] >gi|133728325|gb|EBA30023.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes FSL N1-017] (1177 aa)
Score = 2871, Expect = 0.0e+00, Identities = 584/1252 (46%), Positives = 841/1252 (67%)
  Q:    28 EVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           +V K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V+  W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:     3 KVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIGVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1166
>gi|171778936|ref|ZP_02919998.1| hypothetical protein STRINF_00859 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282582|gb|EDT48006.1| hypothetical protein STRINF_00859 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (1203 aa)
Score = 2868, Expect = 0.0e+00, Identities = 579/1259 (45%), Positives = 826/1259 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +QI L SP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        D   +  S  T  + R+ ++E  +                                     +F++        +GAEAI +LLK +DL  E  ++ E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +             N+K+A++++   D  IW I+  VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+H+ +GI   + P K +    K  I++TTVGK++ ND++P+++ YL  P+N    E+  D   +  G+D  T I+   +   F KK L  I+  + +++         + +D++KD+G+ +ST +  T+   D+P    K++  +    KVE++ K +++GL+TDD+RY  V + W     +  +++E+ + + +   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL+ R+    V HP++ +V+  A  +IT+ +A EIV AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  AS     + V       E   Y VPF + ++V  GD+V  G+ +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV+I D G++D   G ++DI  F   N+ +++S   +PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     1 MQITLTSPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------DTPLEPKSLLTEREYREKIQEYGQG------------------------------------SFVAK-------MGAEAIQDLLKRVDLKSEIAELKEELKTATGQKRIKA---VRRLDVLDAFYKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------YAGNVKAAKRMVERGDERIWDILEDVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEPGREGEGMVFKDRDEAVMAYRNGYVHLHTRVGITVDSMPNKPWTDEQKHKIMVTTVGKILFNDIMPDDLPYLQEPNNANLTEKTPDKYFLAPGQDIHTVIDSLDINVPFKKKNLGNIIAEIFKRFRTTE---TSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKQEIIDAAHTKVEQINKAFRRGLMTDDDRYVAVTTTW----REAKEELEQRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLVIRAITDGK--EVTETLEERLVGRYTKKSVKHPETGEVIVGADVLITEDMAAEIVKAGVEEVTIRSVFTCNTRHGVCRHCYGVNLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGTVVDIEEDASTRTKKVYVQGKTGMGE---YVVPFTARMKVAVGDEVHRGAPLTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRIMDPGDTDLLPGTLMDIADFTDANKDVVISGG-IPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTG 1170
>gi|42518423|ref|NP_964353.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus johnsonii NCC 533] >gi|81668274|sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|41582708|gb|AAS08319.1| DNA-directed RNA polymerase beta' chain [Lactobacillus johnsonii NCC 533] (1224 aa)
Score = 2864, Expect = 0.0e+00, Identities = 587/1264 (46%), Positives = 824/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KD+ CACGKYK I++RG +C++CGVE+T + VRRER+GHIELAAP++HIW  K +  PS++ LVLDIS + +E+V+YF  YIV+D G+          E   L ++   +E ++K              EA M        A    + L + ++   + E+   + + TG +      AI  L           DI +  + S N                        KP WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P++G   RPLKSLS  LKGKQG  RQNLLGKRVDYSGRSVI + PELK YQ G+P  M L+LFKPF++HEL+K+          + SNIK+A++ I  +D+ IW I+  VIK+RPVLLNRAPTLHRLGIQAFEP+LV GK+IRLHPL   A+NADFDGDQMA+HVPLS EAVAE+R ++LA+ HIL PKDGKPI+TP+QD+VLGNY+LT  +    G+GM+F +  E    Y    +H H+ IG+   + P+K +PK    GI +TT GK++ N + P++  Y+N+P  +NL    D    ++ G+D    ++  K+ +AF K  LS+ +  +   Y D  ++     +D +K++G+   T S  TI   D+P  ++K+    E  KKV+ + K Y++GL+TD+ER+ +V+S W++  + V  +I ++I  P    N I IMA+SGARGNISNFTQL+GMRGLM+                 +E+P+ ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  EDC T +G  +  I  T+   +IE L +RL+ R+    V  P++ +V+ PA  ++ + +A++IVDAG+ +V +RSV  C  ++G+C+KC+G +L T   VE   A+G +AAQSIGEPGTQLTMR FH GGV+   +I QG  R+++LF+   PK   ++ ISE+ G+V+SI+  P   +   +T+K   ++  Y VP+ + + V EGD V  G K+T GSID KEL++V        YI+ E+QK YR+QG+EIADK++EV+ RQ+  KV+I D G +D   G+++DI  F+  N ++I+S   +PATA ++I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDWSCACGKYKGIRYRGIVCDRCGVEVTSAKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLVLDISPRALEEVIYFAAYIVIDAGDTDL-------EDKQLLTEAEYREKKAKFGDRF---------EAKMG-------AEAVKELLEQVDIDKEVHELKEELKTATGQK---RTRAIRRL-----------DILDAFKNSGN------------------------KPSWMVMDCIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPRIIVQNEKRMLQEAVDALIDNGRRGRPVVGPGNRPLKSLSHMLKGKQGRLRQNLLGKRVDYSGRSVIDVSPELKFYQCGVPRPMALELFKPFVMHELVKRG---------LASNIKNAKRKIDREDDDIWDILEDVIKERPVLLNRAPTLHRLGIQAFEPVLVPGKSIRLHPLACEAYNADFDGDQMAIHVPLSDEAVAESRLLMLAAHHILAPKDGKPIVTPSQDIVLGNYWLTQAERGREGEGMIFDSPAEAAIAYANGDIHYHTRIGLAADSMPEKPWPKGYEHGIFVTTYGKLVFNQIFPKDFYYINDPTQENLTHPVDERYFLQPGEDIHEKLDNMKLGQAFKKGFLSDSIAQI---YKDYKVQRTSDFLDDLKELGYTVCTTSGLTIGVEDIPTISDKDDIVAEARKKVDVVSKQYRRGLITDEERHDRVISIWNNCKDIVQNEIAQIIHAPR---NPITIMADSGARGNISNFTQLAGMRGLMAAPNG-----------GMMEIPVTSNFREGLSVLEMFMSTHGARKGMTDTALKTANSGYLTRRLVDVAQDVIIREEDCGTDRGLTVHAI--TEGDEMIEPLFDRLVGRYTSKSVYDPETHEVICPADVLMDEDMAHKIVDAGVTEVTIRSVFTCNTQHGVCKKCYGMNLATGDDVEVGEAVGTVAAQSIGEPGTQLTMRNFHNGGVAGAADITQGLPRVQELFEARNPKG--RATISEVTGEVTSIEEDPAE-HTRQITVKGQTDTRTYDVPYTASVAVAEGDHVVRGDKLTLGSIDPKELIRVRDALTTEKYILSEIQKAYRMQGVEIADKHVEVMARQMLQKVRILDPGETDILPGELMDIGEFKARNREVIISGG-IPATAQSVILGITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGLKENVIIGKIIPAGTG 1179
>gi|118586235|ref|ZP_01543696.1| DNA-dependent RNA polymerase, B' subunit [Oenococcus oeni ATCC BAA-1163] >gi|118433329|gb|EAV40034.1| DNA-dependent RNA polymerase, B' subunit [Oenococcus oeni ATCC BAA-1163] (1233 aa)
Score = 2862, Expect = 0.0e+00, Identities = 589/1274 (46%), Positives = 841/1274 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDG----ILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++  S+QIGLASP KIREWS GEV K ETINY++LK E+DGLFDE IFGP+KDYECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ L+LD+S + +E+++YF +Y+V++ GN    K    K++I          T ++ R+  ++ Y +   +A M        A    + LAE N+    +E+ N +   TG                                       K  + VRRL+ ++    S NKPEWM++  + V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G    PLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKM Q+G+P  M ++LFKPFI + LI+   + G       +N++SA +L+   ++ +  ++ +V+K+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPLVTTA+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKPI+ P+QDM +GNYYLT E+  + G+GM+F++ DE+K   Q  +V +H+ IGI  S+F K +   D     I+ TTVGKVI N++LP++  Y+N P  +N   + D   ++ G D   + + + +   F    LS+I+  ++ +Y      ++   +D +KD+G++ ST+S  T++  DV E  EK +  +E  +KV ++ K +++GLLTDDERY +V   WS   ++    I+ ++       N I +M++SGARGNISNF QL+GMRGLM+           KV    IE+P+  +F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  Q++IV  EDC T +G  +  I D     VIE L +R++ R+ +  V+ PK+ +V+A   ++I + VA++I+DAGI  V +RS+  C+ E+G+C KC+G ++ T  +VE   A+G +AAQSIGEPGTQLTMRTFHTGGV+   +I QG  R++++F+   PK   ++ ISE+ GKV+SI+ +P +     VTI+   ++  Y +P  + LRV EGD++     I EG +D KEL+K++      NY++ EVQKVYR+QG+ IADK++EV++RQ+  KV++ D G +D   G+++DI  FR+ N K ILS  +  AT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG      I +E
  S:     6 NKFESMQIGLASPAKIREWSYGEVKKPETINYRTLKAERDGLFDERIFGPIKDYECACGKYKRIRYKGIVCDRCGVEVTSSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLILDMSPRSLEEIIYFASYVVINPGNTPLEK----KQLI----------TEAEYRQ-YQDQYGTDTFDAKMG-------AEAIKELLAEVNLEKQAKELKNELKDATGQ--------------------------------------KRTRAVRRLDIVEAFLQSGNKPEWMVMDVVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVSGPGNSPLKSLSHLLKGKQGRFRQNLLGKRVDYSGRSVIDVGPFLKMNQMGLPRQMAVELFKPFIYNRLIELGTENGGA-----NNLRSARRLVERHEDVVQDVLEEVVKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLVTTAYNADFDGDQMAIHVPLSDEAQAEARLLMLAASHILAPKDGKPIVAPSQDMTIGNYYLTTEEAGIKGEGMIFSSADEVKMALQNHEVELHTRIGIAASSFDKAKPFTDHQRARIMATTVGKVIFNEILPDDFPYINEPKSENFNGIDDRFFLDPGTDIVEWFKNESLNGPFKSGFLSDIIAQIYARYQVTRTSVL---LDDMKDLGYDISTRSGLTVAMSDVTELPEKGEVLKEAHEKVAKITKQFRRGLLTDDERYIQVTQTWSDAQDK----IKSMLIASFDSKNPIFMMSDSGARGNISNFVQLAGMRGLMAAP-------NGKV----IELPVTANFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQEIIVREEDCGTDRGLDVSAIMD--GNEVIEPLYDRILGRYAMKPVIDPKTGEVIAKKNQMIDEHVADQIIDAGIQTVTIRSIFTCRTEHGVCVKCYGRNMATGDIVEVGEAVGTVAAQSIGEPGTQLTMRTFHTGGVALSEDITQGLPRVQEIFEARNPKG--RAEISEVTGKVTSIEENPAD-RTKTVTIEGETDTREYVLPISARLRVAEGDEIHRSEAINEGPLDPKELIKISSALKTENYMLAEVQKVYRMQGVGIADKHVEVMVRQMLRKVRVMDPGQTDLLPGELLDIADFRRANAKTILS-GQTAATSRPVLLGITKASLETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKVIPAGTGVAEYRHIKDE 1194
>gi|160914578|ref|ZP_02076793.1| hypothetical protein EUBDOL_00586 [Eubacterium dolichum DSM 3991] >gi|158433736|gb|EDP12025.1| hypothetical protein EUBDOL_00586 [Eubacterium dolichum DSM 3991] (1286 aa)
Score = 2853, Expect = 0.0e+00, Identities = 605/1260 (48%), Positives = 850/1260 (67%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEK--------------LNMP-----------GQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSS--GTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELR--VEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           SIQ+GLASPE+I EWS+GEV K ETINY+S KPE+DGLF E IFGP KD+EC CGKYKK++++G +C++CGVEIT+S VRRER+GHIELAAP+AHIW  + +P  S+++L+LD++ K++E+V+YFV++IV D  + K      +K+V+                 + RE  E++ +                                     SFT      GAEA L LL+ +DL+ E+  I   L  ++     K KKL++RL+ ++  + S+NKPEWMI+  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK++++   P+II+ NEKR+LQEAVDAL DN  R KP+ G   R LKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP+LKMYQ G+P  M ++LFKPF+I+E++ +          I SN K+AEKLI  QD+ IW I+  VI   PVL+NRAPTLHRLGIQAF+P LVEG+A+RLHPLV TAFNADFDGDQMAVHVPLS EA AEA  ++L S +ILGPKDGKPI+TP QDMV+GN+YLTME+              ++ P            +G ++ +++E+   Y+  ++H+HS + IP  A  K  F    ++  L+TTVGK+I N++ PE+  +LN  + +N     D   +E GKD +  I    +  AF KK L +I+  + ++YS    E     +D+IKD+GF YST +  T+S  D+     K+++ E   +K EE+K+   KG LT  E  + +   W+ V + +++++   + +     N I +MA SGARGN SNFTQL+GMRGLM+K  +  +  K + +   IEVPI + F EGL VSE+F S++G RKG+TDTA+KT++SGY+TR+LVD  QDVI+  +DC T KG  +E I D K+ ++IESL +RL+ R+   +VV+PK+ +++  + E IT+A+A +I D+GI+ + +RS   CK   GIC+KC+G ++ T K VE   A+G++AAQSIGEPGTQLTMRTFHTGGV+S  G +I QG  R+++LF+   PK    +++++I G++++I+          VT+ N KESI +KV     +R  ++ G  V+ G KITEG +D KELLKVAG+  V+NYI+KEV+KVY+ QGIEI+DK+IEV+IRQ+  KV + +  ++    G  + +    K N + +LS  K PAT   ++ G+ +A  +T SFL+AASFQ+T K+LTDA +KG+ D L GLKENVI G +IP GTG
  S:     8 SIQVGLASPERIHEWSHGEVKKPETINYRSQKPERDGLFCERIFGPSKDWECYCGKYKKVRYKGVVCDRCGVEITKSSVRRERMGHIELAAPVAHIWYLRGIP--SRMALLLDVTPKQLEEVIYFVSWIVTDPKDTKL----EYKQVL-----------------SEREYRENVAIYGP---------------------------------GSFTAK---TGAEAALTLLEEVDLEAEFTKIQAALEGAQGE---KRKKLIKRLDTVEAFRHSDNKPEWMIMTAIPVIPPDLRPMLQLDGGRFATSDLNDLYRRVITRNNRLKKLLELGTPAIIVQNEKRMLQEAVDALIDNGRRSKPITGAGGRALKSLSHSLKGKQGRFRQNLLGKRVDFSGRSVIAVGPDLKMYQCGLPREMAIQLFKPFVINEIVNRE---------IASNPKTAEKLIDRQDSRIWDIVESVIDGYPVLMNRAPTLHRLGIQAFKPKLVEGRAMRLHPLVCTAFNADFDGDQMAVHVPLSEEARAEALVMMLGSNNILGPKDGKPIVTPGQDMVMGNFYLTMEETAEEFHQEADRYMAVDCPKEAASWNRYGDNEGHVYGSINEVLMAYETNQIHLHSRVAIPARALHKTSFSEAQQNKYLLTTVGKIIFNNMFPEDFPFLNEVSNENFSATPDKYFLEMGKDVKEAIRNLPITPAFKKKDLGKIIGEIFKRYST---EKTSEILDEIKDMGFRYSTVAGVTVSLADIEVAPHKDEHVEYGKEKAEELKRLRNKGKLTMQEWERHLNKLWADVKDDIAEELLGSLPR----KNPINMMARSGARGNTSNFTQLAGMRGLMAKP-SQSKSAKGEYVPSIIEVPIYSCFREGLNVSEFFISTHGVRKGLTDTALKTAESGYLTRRLVDVAQDVIIKQDDCGTDKGYWVEAIVDRKTNTIIESLYDRLVGRYSKQEVVNPKTGELIIESDEFITEAIAKKIEDSGIEGMYIRSAFTCKSIYGICKKCYGRNMATGKDVEVGEAVGIMAAQSIGEPGTQLTMRTFHTGGVASADGGDITQGLPRVEELFEARCPKG--VAVLAQISGEITAIEQVETGYE---VTVSNDKESIVHKVTLAQAIRPWMKIGANVEAGDKITEGPVDPKELLKVAGVRQVQNYILKEVKKVYQSQGIEISDKHIEVMIRQMLRKVVVLEGNDTHLNAGVQVSLTEITKINRQALLS-GKTPATFKPVLLGISKASVETDSFLSAASFQETTKVLTDAAIKGKKDYLIGLKENVIIGKMIPAGTG 1216
>gi|170017896|ref|YP_001728815.1| DNA-directed RNA polymerase beta' chain [Leuconostoc citreum KM20] >gi|169804753|gb|ACA83371.1| DNA-directed RNA polymerase beta' chain [Leuconostoc citreum KM20] (1220 aa)
Score = 2848, Expect = 0.0e+00, Identities = 595/1264 (47%), Positives = 828/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPK-KQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KDYECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +P  S++ LVLD+S + +E+++YF +Y+V++ G              D   +K    T  + R+  RE                                         + +SF   + G+GAEAI +LL ++DL  E   +  +L+++     ++    VRRL+ I+    S+NKP+WM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKM Q+G+P  M ++LF+PFI+ EL         T   +  N+KSA++ I   D  +  ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPLVT A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKPI+ P+QDMV+GNYYLT E+    G+GM+F++V+E K  +  K VH H+ IGI TS+FP+ K F    +  I++T+VGK+I N++LP +  Y+N P  DN + +SD   +E G+D   ++    V  AF K  LS+++  ++++Y      ++   +D++KD+G+E ST+S  T+S  DV E TEK    E+  K+V  + K +++GL+TD ERY++V   W+   + +    +KLI   E  TN I +M +SGARGNISNF QL+GMRGLM+                 IE+P+  +F EGLTV E F S++GARKGM+DTA+KT+ SGY+TR+LVD  QDVIV   +    +G  ++ I D    SV+E L +R++ R+ +  V +P++   L    E+I + VA  IV AGI++V +RSV     E+G+    +G +L T + VE   A+G +AAQSIGEPGTQLTMR FHTGGV+ G +I QG  R++++ +   PK   ++ ISE+ G V +I+ +P       VTI+   ++  Y +P  + +R  EGD ++ G  I EG ID KELL V       +Y++ E+QKVYRLQGIE++DK+IEV+IRQ+  KV++ D G +    G ++DI  F++ NE  +  D  VPATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     6 NKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDYECACGKYKRIRYKGIVCDRCGVEVTSSKVRRERMGHIELAAPVTHIWYFKGIP--SRMGLVLDMSPRSLEEIIYFASYVVIEPG--------------DAPVEKKQLMTEREYRELKRE-----------------------------------------YGASF---KAGMGAEAIKDLLASVDLAAEADQLKRELQEATGQKRVRA---VRRLDIIEAFLQSDNKPQWMVMDVIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPFLKMNQMGLPRPMAIELFRPFIMKEL---------TTRKLAGNVKSAKRKIDKADEDVMDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLVTEAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAGHILAPKDGKPIVAPSQDMVIGNYYLTTEEAGREGEGMIFSSVEEAKIAFASKVVHYHTRIGIQTSSFPEAKPFTDEQRSKIMVTSVGKLIFNEILPVDFPYINEPSEDNFKGISDQFFIEPGEDIHDYLADTAVIGAFKKGFLSDVIAEVYKRYKVTETSLL---LDRMKDLGYEKSTESGLTVSMNDVTELTEKPAILEDAHKQVATVTKQFRRGLITDSERYQRVTEIWTKAKDVIQ---DKLIASFE-PTNPIFMMQDSGARGNISNFVQLAGMRGLMAGPGG-----------KIIELPVTANFREGLTVMEMFISTHGARKGMSDTALKTANSGYLTRRLVDVAQDVIVREWNNNADRGVAVKAIMD--GTSVVEPLYDRILGRYAMKSVFNPETGDKLVSRNEMIDEDVAKAIVAAGIEEVTIRSVFTSTTEHGVSVLDYGRNLATGEEVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGGNDITQGLPRVQEIVEARIPKG--RAEISEVTGTVVAIEENPAE-RTKAVTIEGETDTRTYTLPLAARMRFAEGDDIQRGDAINEGPIDPKELLAVTDTLTTESYMLTEIQKVYRLQGIEVSDKHIEVMIRQMLRKVRVMDPGETSLLPGMLMDIADFQRANEPALF-DGLVPATARPVLLGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKIIPAGTG 1179
>gi|90961180|ref|YP_535096.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus salivarius UCC118] >gi|123270012|sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|90820374|gb|ABD99013.1| DNA-directed RNA polymerase beta' chain [Lactobacillus salivarius UCC118] (1221 aa)
Score = 2844, Expect = 0.0e+00, Identities = 598/1274 (46%), Positives = 841/1274 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP-----KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELS-DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYS-DASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++  S+QIGLAS +KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLD+S + +E+++YF +Y+V D G+    K    K+++      +  E R K     RE Y         + A+  +  RT    L + ++     E+   +   TG +      A+  L           DI E    S N  D              W+          ++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP+LK+ Q+GIP  M L+LFKPF++ EL+K+          + SNIK+A++ I  +D  IW +++ VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKPII+P+QDM +GNYY+T+E+    G+GM+F +V+E++T YQ   VH+H+ IG+  S+  K   P     K+ ILITT GK I N++LP +  +LN P  +NL  ++ D   VE G D + FI+ + +   F    LS+I+  ++++Y   A+ E+    +D++KD+G+  STKS  T+   DV    EK +  E+  K V  + K +++GL+TD+ERY +V+S W    N+   DI+  + +    +N I +M++SGARGNISNFTQLSGMRGLM+                T+E+P+ ++F EGL+V E F SS+GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  EDC T +G  L+V   T+   +IE L +R++ R+ + +V  P + +++ PA  ++ ++ A +IVDAG+ KV +RS   C   +G+C++C+G +L T   VE   A+G +AAQSIGEPGTQLTMR FH GGV+ G +I QG  R+++LF+   PK   +++I+E+ G V +++ +P       VT+K   ++  Y +PF S L+V+EGD+V  G  +T GSID KEL+KV  +    NYI++EVQKVYR+QG++I+DK+IE++ RQ+  KV+I D G++D   G ++DI+ F+  N   I+ + ++PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G  IP GTG K   DI  E
  S:     5 NKFDSMQIGLASSDKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDWECACGKYKRIRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDMSPRALEEIIYFASYVVTDAGDTALEK----KQLL------TEGEYREK-----REEYGD-----GFKAAMGAEAIRTL---LRDVDLEKECAELKEELREATGQK---RTRAVRRL-----------DILEAFLNSGNRPD--------------WM----------VMDAIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPKLKLNQMGIPHEMALELFKPFMMRELVKRE---------MASNIKNAKRKIERRDEDIWDVLDDVIKEHPVLLNRAPTLHRLGIQAFEPVLVNGKAMRLHPLACEAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAHHILAPKDGKPIISPSQDMTIGNYYITLEEAGREGEGMVFKDVNEVRTAYQNGYVHLHTRIGLQASSLAKLGTPFTDWQKERILITTAGKAIFNEILPADFPFLNEPTQENLTGMTPDKYFVEPGTDIKEFIKNQPLVGPFKSGFLSDIIAQVYKEYKVTATAEL----LDRMKDLGYYESTKSGLTVGIADVTVLKEKPEIIEQAHKNVATVAKQFRRGLITDEERYNRVISIW----NKAKDDIQAKLVENMDPSNPIQMMSDSGARGNISNFTQLSGMRGLMAAPNG-----------KTMELPVISNFREGLSVLEMFLSSHGARKGMTDTALKTANSGYLTRRLVDVAQDVIIREEDCHTDRG--LDVTAITEGNEMIEPLYDRILGRYTMKEVKDPNTGEIIVPANVLVEESEARKIVDAGVQKVTIRSAFTCNTRHGVCERCYGRNLATGDEVEVGEAVGTVAAQSIGEPGTQLTMRNFHQGGVAGGDDITQGLPRVQELFEARNPKG--RAVITEVTGVVDTVEENPAE-RTKEVTVKGETDTRTYSLPFTSVLKVKEGDQVHRGDALTVGSIDPKELIKVRDVLSTENYILREVQKVYRMQGVDISDKHIEIMTRQMLRKVRIMDPGDTDMLPGTLLDISQFKDRNTSAII-EGRIPATARPVLLGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKTIPAGTGMKKYHDIEPE 1190
>gi|148544704|ref|YP_001272074.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus reuteri F275] >gi|184154056|ref|YP_001842397.1| DNA-directed RNA polymerase beta-prime subunit [Lactobacillus reuteri F275] >gi|166991531|sp|A5VLL3|RPOC_LACRF DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|148531738|gb|ABQ83737.1| DNA-directed RNA polymerase, beta' subunit [Lactobacillus reuteri F275] >gi|183225400|dbj|BAG25917.1| DNA-directed RNA polymerase beta-prime subunit [Lactobacillus reuteri F275] (1211 aa)
Score = 2840, Expect = 0.0e+00, Identities = 581/1271 (45%), Positives = 844/1271 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPD--NLEE-LSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEK GLFDE IFGP KDYECACGKYK+I+++G++C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+VLD G              D   +K    T ++ R                             D  AE    F  E               +GA AI +LL ++DL+KE     E   + +  +  K  + +RRL+ ++    S NKPEWM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LK+ Q+G+PV M L+LFKPFI+HEL+K+          + +N+KSA++ I   D+ ++ ++  VIK+ PVLLNRAPTLHRLGIQAFEPILV GK++RLHPLV +A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL P+DG+PI++P+QDMV+GNYY+T E     G+GM+F + DE +  Y+   V + + +G+  SAFP+K F  D    I++TTVGK++ N ++P++ +Y+N P   N++  + D   +E G+D   ++E   +   F K  LS+++  ++++Y    +      +D+IKD+G+  ST S  T +  D+ +  EK +  ++  K+V  + K +++GL+TDDERY++V+ AW+   ++V     KLI+  + + N I +M++SGARGNISNFTQL+GMRGLM+                 +E+P+K++F EGL+V E F SS+GARKGMTDTA+KT+ SGY+TR+LVD  QDV+V  +DC T +G  LEV   T    +IE L +R++ R+ +  V  PK+ + +     +I + +A +IVDAG+ KV +RS   C  E+G+C++C+G +  T   VE   A+G +AAQSIGEPGTQLT+R FHTGGV+   +I QG  R++++ +   PK   ++ I+E+ G+V SI+ +P       +TIK   ++  Y +P  + ++V EGD +  G+ + EGSID KEL++V  +     Y++ +VQ VYR+QGI++ DK++E++IRQ+  KV++ D G++D   GQ++DI+ FR  N+  +++ + +PATA  +I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG  +  +I
  S:     5 NKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPEKQGLFDERIFGPTKDYECACGKYKRIRYKGRVCDRCGVEVTSAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRSLEEVIYFASYVVLDPG--------------DTPLEKKQLLTEAEYR-----------------------------DKKAEYGDRFKAE---------------MGAAAIQKLLADVDLEKEAA---ELKEELKEATGQKRTRAIRRLDILEAFIKSGNKPEWMVMDVIPVMPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLKLQAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHLLKGKQGRFRQNLLGKRVDYSGRSVIDVGPSLKLNQMGLPVPMALELFKPFIMHELVKRG---------LSANVKSAKRKIDRSDDDVFDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPILVSGKSMRLHPLVCSAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAHHILSPRDGEPIVSPSQDMVIGNYYMTTEDKGREGEGMIFKDTDEAELAYRNDYVSLQTRVGVQVSAFPEKPFTDDQRGKIMVTTVGKLLFNRIMPKDFAYINEPTDANIQNGVDDRFFLEPGQDIHEYLENAPLVPPFKKGFLSDLIAEVYKRY---KVTKTSQFLDRIKDLGYYESTISGLTTAMSDIHDLPEKPEILDKAQKQVTLITKQFRRGLITDDERYERVIGAWNDAKDEVQN---KLIEHMD-IHNPINMMSDSGARGNISNFTQLAGMRGLMASPNG-----------KIMELPVKSNFYEGLSVLEMFISSHGARKGMTDTALKTANSGYLTRRLVDVAQDVVVREKDCGTDRG--LEVTAITNGNEMIEPLYDRIMGRYTMKSVFDPKTGEKIVGKNVLIDEEMAQKIVDAGVKKVTIRSAFTCNTEHGVCERCYGRNAATGDRVEAGEAVGTVAAQSIGEPGTQLTLRNFHTGGVAGNDDITQGLPRIQEIVEARNPKG--RATITEVTGEVVSIEENPAE-RTKDITIKGETDTRTYTLPITARMKVAEGDFIHRGAPLNEGSIDPKELIQVRDVLSTETYLLSQVQGVYRMQGIDLLDKHVEIMIRQMMRKVRVMDPGDTDLLPGQLMDISQFRDANKDTLVAGN-IPATARPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKIIPAGTGMSAYRNI 1185
>gi|41018127|sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') (1207 aa)
Score = 2837, Expect = 0.0e+00, Identities = 579/1264 (45%), Positives = 833/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQK--SSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND---IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSG-SVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S++IG+ASP+KIR WS GEV K ETINY++ KPE++GLFDE IFGP KD+ECACGK K + ++ ++CE CGV++T +  RRER+GHIELAAPI+HIW  K +  PS++ L LD+S + +E+V+YF +Y+V+D      PK        DL  ++  + +E R +L K                                            N   SF      +GAEAI +LL ++D+DKE  ++ E+L+     +  +  K++RRL+ +   + S N   WM+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++ NAP+II+ NEKR+LQEAVD L DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M ++LFKPF++ +L+KK          + +NI++A++ +  QD+ +W ++  V+K+ PVLLNRAPTLHRLGIQAFEP+L++GKAIRLHPL   A+NADFDGDQMA+H+PLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+FA  +E++   +   VH+H+ IGI T +   P  +  KD IL+TTVGKVI N ++PE M YLN P ++   +  D    ++ G+D +  +      + F K  L  I+  + ++Y   +       +D++K++G+  ST +  T+   D+P   +K K  +   K+VE++ K +++GL+TDDERY  V   W      + K   +LI + + LTN IV+M +SGARGNISNF+QL+GMRGLM+           K+    +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G    VI D  +G  ++E L ERL+ R+    V+HP++ +++     +I++ VA +I+DAG+ +V +RSV  CK  +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   ++II+E+ G V SI   P       +T+K   ++ +Y V     L VEEG+ +  G+ + +GSI+ K LL+V     V  Y++ EVQK YR QG+EI DK+IEV++RQ+  KV++ D+G++D   G ++DI+ F   NE  +L+ + +PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMRIGIASPQKIRYWSFGEVKKPETINYRTQKPEREGLFDERIFGPQKDWECACGKLKGVFYKNQVCELCGVQVTTAKSRRERMGHIELAAPISHIWYFKGI--PSRMGLALDMSPRALEEVIYFASYVVID------PKE------TDLEKKQLLTEREYREQLLK--------------------------------------------NGFGSFVAK---MGAEAIQDLLNDVDIDKEVSELKEELK---TVTGQRRVKIIRRLDVLSAFRKSGNALSWMVLNVLPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLMELNAPNIIVQNEKRMLQEAVDTLIDNGRRGRPITGAGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMAQLVKKE---------LAANIRAAKRKVERQDSDVWDVLETVVKEHPVLLNRAPTLHRLGIQAFEPVLIDGKAIRLHPLACEAYNADFDGDQMAIHLPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEKGREGEGMIFATPEEVEIAMRNGYVHLHTRIGIATKSLNKPWTENQKDKILVTTVGKVIFNSIIPEGMPYLNEPTDVNLTTSTDDRFFMDAGQDIKEVLAGIDTVRPFKKGYLGNIIAEVFKRYRTTA---TSEYLDRLKNLGYHQSTLAGLTVGIADIPVVEDKHKIIDAAHKRVEQITKQFRRGLITDDERYNAVTGVWRDAKEALEK---RLIDEQD-LTNPIVMMMDSGARGNISNFSQLAGMRGLMAAP-------NGKI----MELPIISNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGL---VISDIATGKEMVEPLFERLVGRYTRKSVLHPETGEMIIADDTLISEDVARKIIDAGVKEVTIRSVFTCKTPHGVCKHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASSSDITQGLPRVQEIFEARNPKG--EAIITEVTGTVESIVEDPAT-RTREITVKGKTDTRSYTVGMADVLMVEEGEFIHRGAPLIQGSIEPKHLLQVRDALSVETYLLGEVQKTYRSQGVEIGDKHIEVMVRQMLRKVRVMDNGSTDILPGTLMDISDFEALNETALLNGE-MPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKEDHLLGLKENVIIGKIIPAGTG 1178
>gi|73663521|ref|YP_302302.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581607|sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|72496036|dbj|BAE19357.1| DNA-directed RNA polymerase beta' subunit [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (1207 aa)
Score = 2836, Expect = 0.0e+00, Identities = 590/1266 (46%), Positives = 841/1266 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEE-------LSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+V++ G     K                        KTL         EA           R +YD                F   FT     +GAE I ELL+ IDLD E K + ++L   E+ +  +  + ++RLE ++  + S N P WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPFI+ EL+++          I +NIK+A+  I   D+ +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPL TTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+      G ++ + +E+   Y    VH+H+ IG+  ++F    F ++    IL+T+VGKVI N+++P+  +Y+N P   NLE        ++  +I E G   + + +++ + K F K  L  ++  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K+   +E +K VE++ K + +GL+TD ERY  V+  W+   +Q+  ++   ++K    TN I +M++SGARGN SNFTQL+GMRGLM+               + IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +V+    E++T  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +V  IK + E+ +Y     S L+VE G  V+ G  +TEGSI+ K  L V+G+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +    + K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D+L GLKENVI G LIP GTG +   D+
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLLLDMSPRALEEVIYFASYVVVNPGPTGLEK------------------------KTLLS-------EAEF---------REYYD---------------KFPGKFTAK---MGAEGIKELLEEIDLDAELKHLRDEL---ESATGQRLTRAIKRLEVVESFRHSGNNPAWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFIMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLATTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKEAVNTGTIYNDTNEVLKAYANGYVHLHTRIGVHAASFNNPTFTEEQNKKILLTSVGKVIFNEIIPDSFAYINEPTQTNLENKTPEKYFIAPTEIGEEG--LKAYFDEQPLIKPFNKNFLGNVIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVSDIVVLPDKQDILDEHEKLVEKVTKQFNRGLITDFERYNAVIEIWTDAKDQIQNELMGSLEK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------EIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETNEVIVNPDELVTAEIAKKITDAGIEEMYIRSAFTCNTRHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVDDIKLAKDRQQEIV--IKGANETKSYLASGTSRLKVEVGQSVERGEVLTEGSIEPKNYLSVSGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKERKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDNLLGLKENVIIGKLIPAGTGMRRYRDV 1187
>gi|194466961|ref|ZP_03072948.1| DNA-directed RNA polymerase, beta' subunit [Lactobacillus reuteri 100-23] >gi|194453997|gb|EDX42894.1| DNA-directed RNA polymerase, beta' subunit [Lactobacillus reuteri 100-23] (1211 aa)
Score = 2833, Expect = 0.0e+00, Identities = 579/1271 (45%), Positives = 844/1271 (66%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLEE-LSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEK GLFDE IFGP KDYECACGKYK+I+++G++C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+VLD G              D   +K    T ++ R                             D  AE    F  E               +GA AI +LL ++DL+KE     E   + +  +  K  + +RRL+ ++    S NKPEWM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LK+ Q+G+PV M L+LFKPFI+HEL+K+          + +N+K+A++ I   D+ ++ ++  VIK+ PVLLNRAPTLHRLGIQAFEPILV GK++RLHPLV +A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL P+DG+PI++P+QDMV+GNYY+T E     G+GM+F + DE +  Y+   V + + +G+  SAFP+K F    +  I++TTVGK++ N ++P++ +Y+N P   N++  + D   +E G+D   ++E   +   F K  LS+++  ++++Y    +      +D+IKD+G+  ST S  T +  D+ +  EK +  ++  K+V  + K +++GL+TDDERY++V+ AW+   ++V     KLI+  + + N I +M++SGARGNISNFTQL+GMRGLM+                 +E+P+K++F EGL+V E F SS+GARKGMTDTA+KT+ SGY+TR+LVD  QDV+V  +DC T +G  LEV   T    +IE L +R++ R+ +  V  PK+ + +     +I + +A +IVDAG+ KV +RS   C  E+G+C++C+G +  T   VE   A+G +AAQSIGEPGTQLT+R FHTGGV+   +I QG  R++++ +   PK   ++ I+E+ G+V SI+ +P       +TIK   ++  Y +P  + ++V EGD +  G+ + EGSID KEL++V  +     Y++ +VQ VYR+QGI++ DK++E++IRQ+  KV++ D G++D   GQ++DI+ FR  N+  +++ + +PATA  +I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG  +  +I
  S:     5 NKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPEKQGLFDERIFGPTKDYECACGKYKRIRYKGRVCDRCGVEVTSAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRSLEEVIYFASYVVLDPG--------------DTPLEKKQLLTEAEYR-----------------------------DKKAEYGDRFKAE---------------MGAAAIQKLLADVDLEKEAA---ELKEELKEATGQKRTRAIRRLDILEAFIKSGNKPEWMVMDVIPVMPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLKLQAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHLLKGKQGRFRQNLLGKRVDYSGRSVIDVGPSLKLNQMGLPVPMALELFKPFIMHELVKRG---------LSANVKAAKRKIDRSDDDVFDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPILVSGKSMRLHPLVCSAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAHHILSPRDGEPIVSPSQDMVIGNYYMTTEDKGREGEGMIFKDTDEAELAYRNDYVSLQTRVGVQVSAFPEKPFTDEQRGKIMVTTVGKLLFNRIMPKDFAYINEPTDANIQNGVDDRFFLEPGQDIHEYLENAPLVPPFKKGFLSDLIAEVYKRY---KVTKTSQFLDRIKDLGYYESTISGLTTAMSDIHDLPEKPEILDKAQKQVALITKQFRRGLITDDERYERVIGAWNDAKDEVQN---KLIEHMD-IHNPINMMSDSGARGNISNFTQLAGMRGLMASPNG-----------KIMELPVKSNFYEGLSVLEMFISSHGARKGMTDTALKTANSGYLTRRLVDVAQDVVVREKDCGTDRG--LEVTAITNGNEMIEPLYDRIMGRYTMKSVFDPKTGEKIVGKNVLIDEEMAQKIVDAGVKKVTIRSAFTCNTEHGVCERCYGRNAATGDRVEAGEAVGTVAAQSIGEPGTQLTLRNFHTGGVAGNYDITQGLPRIQEIVEARNPKG--RATITEVTGEVVSIEENPAE-RTKDITIKGETDTRTYTLPITARMKVAEGDFIHRGAPLNEGSIDPKELIQVRDVLSTETYLLSQVQGVYRMQGIDLLDKHVEIMIRQMMRKVRVMDPGDTDLLPGQLMDISQFRDANKDTLVAGN-IPATARPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKIIPAGTGMSAYRNI 1185
>gi|15673781|ref|NP_267956.1| DNA-directed RNA polymerase subunit beta' [Lactococcus lactis subsp. lactis Il1403] >gi|12724824|gb|AAK05897.1|AE006409_7 DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) [Lactococcus lactis subsp. lactis Il1403] (1198 aa)
Score = 2833, Expect = 0.0e+00, Identities = 578/1259 (45%), Positives = 830/1259 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQK--SSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND---IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSG-SVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IG+ASP+KIR WS GEV K ETINY++ KPE++GLFDE IFGP KD+ECACGK K + ++ ++CE CGV++T +  RRER+GHIELAAPI+HIW  K +  PS++ L LD+S + +E+V+YF +Y+V+D      PK        DL  ++  + +E R +L K                                            N   SF      +GAEAI +LL ++D+DKE  ++ E+L+     +  +  K++RRL+ +   + S N   WM+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++ NAP+II+ NEKR+LQEAVD L DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M ++LFKPF++ +L+KK          + +NI++A++ +  QD+ +W ++  V+K+ PVLLNRAPTLHRLGIQAFEP+L++GKAIRLHPL   A+NADFDGDQMA+H+PLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+FA  +E++   +   VH+H+ IGI T +   P  +  KD IL+TTVGKVI N ++PE M YLN P ++   +  D    ++ G+D +  +      + F K  L  I+  + ++Y   +       +D++K++G+  ST +  T+   D+P   +K K  +   K+VE++ K +++GL+TDDERY  V   W      + K   +LI + + LTN IV+M +SGARGNISNF+QL+GMRGLM+           K+    +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G    VI D  +G  ++E L ERL+ R+    V+HP++ +++     +I++ VA +I+DAG+ +V +RSV  CK  +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   ++II+E+ G V SI   P       +T+K   ++ +Y V     L VEEG+ +  G+ + +GSI+ K LL+V     V  Y++ EVQK YR QG+EI DK+IEV++RQ+  KV++ D+G++D   G ++DI+ F   NE  +L+ + +PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     1 MRIGIASPQKIRYWSFGEVKKPETINYRTQKPEREGLFDERIFGPQKDWECACGKLKGVFYKNQVCELCGVQVTTAKSRRERMGHIELAAPISHIWYFKGI--PSRMGLALDMSPRALEEVIYFASYVVID------PKE------TDLEKKQLLTEREYREQLLK--------------------------------------------NGFGSFVAK---MGAEAIQDLLNDVDIDKEVSELKEELK---TVTGQRRVKIIRRLDVLSAFRKSGNALSWMVLNVLPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLMELNAPNIIVQNEKRMLQEAVDTLIDNGRRGRPITGAGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMAQLVKKE---------LAANIRAAKRKVERQDSDVWDVLETVVKEHPVLLNRAPTLHRLGIQAFEPVLIDGKAIRLHPLACEAYNADFDGDQMAIHLPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEKGREGEGMIFATPEEVEIAMRNGYVHLHTRIGIATKSLNKPWTENQKDKILVTTVGKVIFNSIIPEGMPYLNEPTDVNLTTSTDDRFFMDAGQDIKEVLAGIDTVRPFKKGYLGNIIAEVFKRYRTTA---TSEYLDRLKNLGYHQSTLAGLTVGIADIPVVEDKHKIIDAAHKRVEQITKQFRRGLITDDERYNAVTGVWRDAKEALEK---RLIDEQD-LTNPIVMMMDSGARGNISNFSQLAGMRGLMAAP-------NGKI----MELPIISNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGL---VISDIATGKEMVEPLFERLVGRYTRKSVLHPETGEMIIADDTLISEDVARKIIDAGVKEVTIRSVFTCKTPHGVCKHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASSSDITQGLPRVQEIFEARNPKG--EAIITEVTGTVESIVEDPAT-RTREITVKGKTDTRSYTVGMADVLMVEEGEFIHRGAPLIQGSIEPKHLLQVRDALSVETYLLGEVQKTYRSQGVEIGDKHIEVMVRQMLRKVRVMDNGSTDILPGTLMDISDFEALNETALLNGE-MPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKEDHLLGLKENVIIGKIIPAGTG 1169
>gi|70727463|ref|YP_254379.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus haemolyticus JCSC1435] >gi|82581606|sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|68448189|dbj|BAE05773.1| DNA-directed RNA polymerase beta' subunit [Staphylococcus haemolyticus JCSC1435] (1206 aa)
Score = 2833, Expect = 0.0e+00, Identities = 584/1266 (46%), Positives = 840/1266 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                               +S+  EA           R +YD                +   F       G + +LE    I+LD+E K + ++L   E+ +  +  + ++RLE ++  ++S N P WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++  VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F + +E+   Y    VH+H+ IG+   +F    F +   + IL T+VGKVI N+++P+  +++N P   NLE  + +    D  + G+   + + E++++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K+   +E +K VE + K + +GL+T+DERY  VV  W+   +Q+  ++ + ++K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S L+VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI++F   N +    + K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+
  S:    10 MKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK-------------------------------KSLLSEAEF---------REYYD---------------KYPGQFVAKMGAEGIKDLLE---EINLDEELKSLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNNPAWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEDVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAMNTGTIFNDTNEVLKAYANGYVHLHTRIGVHAKSFNNPTFTEAQNNKILATSVGKVIFNEIIPDSFAFINEPSQTNLEGKTPDKYFIDSTQLGEGGLKAYFEEQELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQDILDEHEKLVERVSKQFNRGLITEDERYNAVVEIWTDAKDQIQGELMQSLEK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDELITAEIAKKITDAGIEQMYIRSAFTCNTRHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRLKVEVGQSVERGEVLTEGSIEPKNFLAVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHSFTDANRE-AFKERKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDV 1187
>gi|27467225|ref|NP_763862.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus epidermidis ATCC 12228] >gi|57866135|ref|YP_187780.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus epidermidis RP62A] >gi|41018014|sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|73917876|sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|27314768|gb|AAO03904.1|AE016745_3 RNA polymerase beta-prime chain [Staphylococcus epidermidis ATCC 12228] >gi|57636793|gb|AAW53581.1| DNA-directed RNA polymerase, beta' subunit [Staphylococcus epidermidis RP62A] (1207 aa)
Score = 2831, Expect = 0.0e+00, Identities = 588/1266 (46%), Positives = 836/1266 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                + + F       G + +LE    IDLD+E K++ ++L   E+ +  +  + ++RLE ++  ++S N P WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++  VI + PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F + +E+   Y    VH+H+ IG+  ++F    F  +    IL T+VGK+I N+++P+  +Y+N P   NLE  + +    D  + G+   + + +  ++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K+   +E +K VE + K Y +GL+T+DERY  VV  W+   +Q+  ++ + ++K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +V+    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    ++V  K + E+ +Y     S L+VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N        K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   DI
  S:    10 MKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------REYYD---------------KYPNQFVAKMGAEGIKDLLE---EIDLDEELKELRDEL---ESATGQRLTRAIKRLEVVESFRNSGNNPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEDVITEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNDTNEVLKAYANGYVHLHTRIGVHANSFNNPTFTDEQNSKILATSVGKIIFNEIIPDSFAYINEPSQANLERTTPDKYFVDPTQLGEGGLKEYFDNTELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVSDIVVLPDKQDILDEHEKLVERVTKQYNRGLITEDERYNAVVEIWTDAKDQIQGELMQSLEK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEVIIRPDELITPDIAKQITDAGIEQMYIRSAFTCNTRHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVDDIKLAKDRQQEIIV--KGANETRSYLASGTSRLKVEIGQSVERGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRD-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDI 1187
>gi|125975207|ref|YP_001039117.1| DNA-directed RNA polymerase subunit beta' [Clostridium thermocellum ATCC 27405] >gi|125715432|gb|ABN53924.1| DNA-directed RNA polymerase, beta' subunit [Clostridium thermocellum ATCC 27405] (1165 aa)
Score = 2827, Expect = 0.0e+00, Identities = 591/1267 (46%), Positives = 843/1267 (66%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           SI+IGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+++YF  Y+V+D G     K    K+++      S KE R  L K                                             F   F   R G+GAEA+ ELL+ I+LD+   ++ E++++S     ++    ++RLE ++  + S NKPEWMIL  I V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M L+LFKPF++ +L+          D +  NIKSA++++    N +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+A++LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L++ ++L P+DGKP+  PTQDMVLG+YYLT+ K    G+G +F ++DE    Y   ++ +HS I +           K  I+ TT+G++I N+ +P+++ +++  +PD + +L  + +V  GK+     E KK+     K         +H     A L      +DKIK++GF+YSTK A TIS  D+     K KY +ET++K+E++ K Y++GL++D+ERY  V++AW+  +  +++ +   + +     N + +M+ SGARGNI+   QL+GMRGLM+ +              TIE PIK +F EGLTV E+F S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV   DC T+KG  +EV +      VIE L+ER+I R+P+ ++VHP++ +++  AG +IT   A +IV AGI KV +RSVL C  E G+C KC+G +L T +      A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +IISEI+G   ++K S       +V      E+ +Y +P+ S ++V +GD+V+ G ++TEGS++  ++LK+ G+E V+ Y++ EVQKVYR+QG++I DK+IEVI+RQ+  KV+++D G++    G ++D+  F +EN K I ++ K PA A   + G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG    +DI
  S:     9 SIRIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPQKDWECHCGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLLLDMSPRALEKILYFAAYVVIDPGQTPLSK----KQIL------SEKEYRDSLEK---------------------------------------------FGPKF---RAGMGAEAVRELLQEINLDELSAELREEIKQSTGQKRVRA---IKRLEVVEAFRQSQNKPEWMILDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMALELFKPFVMKKLV---------NDGLAHNIKSAKRMVERVRNEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRALKLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARFLMLSANNLLKPQDGKPVAVPTQDMVLGSYYLTILKEGAKGEGRVFTSMDEAVMAYDNGEIELHSKIKVRMKRVVDG-VEKSKIIETTLGRLIFNEAIPQDLGFVDRSDPDKIFDLEVDFLV--GKN-----ELKKIIDKSIK---------VHGTTKTAIL------LDKIKELGFKYSTKGAITISISDMVIPEVKAKYIKETEEKIEKITKQYKRGLISDEERYNSVIAAWTEASENITRALINNLDR----FNPVYMMSQSGARGNINQIKQLAGMRGLMADTSG-----------KTIEFPIKANFREGLTVMEFFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRETDCGTRKG--IEVTDIKDGNEVIEELSERIIGRYPVGNIVHPETGEIIVEAGRMITDQDAEKIVKAGIKKVRIRSVLTCHSEYGVCAKCYGANLATGEECNVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGEDITQGLPRVEELFEARKPKGL--AIISEIKG---TVKISETKKKREIVVTSEDGETRSYLIPYGSRIKVSDGDQVEAGDELTEGSVNPHDILKIKGVEAVQTYLVHEVQKVYRMQGVDINDKHIEVIVRQMLRKVKVEDPGDTSLLPGGLVDVFDFEEENAKAI-AEGKKPAVAKRALLGITKAALATDSFLSAASFQETTRVLTEAAIKGKVDPLVGLKENVIIGKLIPAGTGMSRYKDI 1158
>gi|116628957|ref|YP_814129.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus gasseri ATCC 33323] >gi|122274045|sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116094539|gb|ABJ59691.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Lactobacillus gasseri ATCC 33323] (1223 aa)
Score = 2826, Expect = 0.0e+00, Identities = 584/1264 (46%), Positives = 823/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKI-ARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KD+ CACGKYK I++RG +C++CGVE+T + VRRER+GHIELAAP++HIW  K +  PS++ LVLDIS + +E+V+YF  YIV+D G+             DL  ++   E   + +K            A   N  + K+ A    + L + ++   + ++   + + TG +      AI  L           DI +  + S N                 W+          ++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P++G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI + P+LK YQ G+P  M L+LFKPF++HEL+K+          + SNIK+A++ I  +D+ IW I+  VIK+RPVLLNRAPTLHRLGIQAFEP+LV GK+IRLHPL   A+NADFDGDQMA+HVPLS EAVAE+R ++LA+ HIL PKDGKPI+TP+QD+VLGNY+LT  +    G+GM+F +  E    Y    +H H+ IG+   + P+K +PK    GI +TT GK++ N + P++  Y+N+P  +NL    D    ++ G+D    ++  K+ KAF K  LS+ +  +   Y D  ++     +D +K++G+   T S  TI   D+P  T+K+    E  KKV+ + K Y++GL+TD+ER+ +V+S W++  + V  +I + I  P    N I IMA+SGARGNISNFTQL+GMRGLM+                 +E+P+ ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  EDC T +G  +  I  T+   +IE L +RL+ R+    V  P++ +V+ PA  ++ + +A++IVDAG+ +V +RSV  C  ++G+C+KC+G +L T   VE   A+G +AAQSIGEPGTQLTMR FH GGV+   +I QG  R+++LF+   PK   ++ ISE+ G+++SI+  P   +   +T+K   ++  Y VP+ + + V EGD V  G K+T GSID KEL++V        YI+ E+QK YR+QG+EIADK++EV+ RQ+  KV+I D G +D   G+++DI  F+  N ++I+S   +PATA ++I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDWSCACGKYKGIRYRGIVCDRCGVEVTSAKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLVLDISPRALEEVIYFAAYIVIDAGD------------TDLEDKQLLTEAEYREKK------------AKFGNRFEAKMGAEAVKELLEQVDIDKEVHDLKEELKTATGQK---RTRAIRRL-----------DILDAFKNSGNKP--------------SWM----------VMDCIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPRIIVQNEKRMLQEAVDALIDNGRRGRPVVGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVSPKLKFYQCGVPRPMALELFKPFVMHELVKRG---------LASNIKNAKRKIDREDDDIWDILEDVIKERPVLLNRAPTLHRLGIQAFEPVLVPGKSIRLHPLACEAYNADFDGDQMAIHVPLSDEAVAESRLLMLAAHHILAPKDGKPIVTPSQDIVLGNYWLTQAERGREGEGMIFDSPAEAAIAYANGDIHYHTRIGLAADSMPEKPWPKGYEHGIFVTTYGKLVFNQIFPKDFFYINDPTQENLTHPVDERYFLQPGEDIHEKLDNMKLGKAFKKGFLSDSIAQI---YKDYKVQRTSDFLDDLKELGYTVCTTSGLTIGVEDIPTITDKDDIVAEARKKVDVVSKQYRRGLITDEERHDRVISIWNNCKDIVQNEIAQ-IHAPR---NPITIMADSGARGNISNFTQLAGMRGLMAAPNG-----------GMMEIPVTSNFREGLSVLEMFMSTHGARKGMTDTALKTANSGYLTRRLVDVAQDVIIREEDCGTDRGLTVHAI--TEGDEMIEPLFDRLVGRYTSKSVYDPETHEVICPADVLMDEDMAHKIVDAGVTEVTIRSVFTCNTQHGVCKKCYGMNLATGDDVEVGEAVGTVAAQSIGEPGTQLTMRNFHNGGVAGAADITQGLPRVQELFEARNPKG--RATISEVTGEITSIEEDPAE-HTRQITVKGQTDTRTYDVPYTASVAVAEGDHVVRGDKLTLGSIDPKELIRVRDALTTEKYILSEIQKAYRMQGVEIADKHVEVMARQMLQKVRILDPGETDILPGELMDIGEFKARNREVIISGG-IPATAQSVILGITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGLKENVIIGKIIPAGTG 1178
>gi|116628546|ref|YP_821165.1| DNA-directed RNA polymerase subunit beta' [Streptococcus thermophilus LMD-9] >gi|122266859|sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116101823|gb|ABJ66969.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Streptococcus thermophilus LMD-9] (1212 aa)
Score = 2824, Expect = 0.0e+00, Identities = 586/1271 (46%), Positives = 830/1271 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND----IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK    +  ++  S  + +E R KL++     Y      A M                                          GAEAI +LLK +DL+ E  ++ E+L+ +      K  K VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +             N+K+A++++   D  IW I+  VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F ++DE    Y    VH+HS +GI   + P K + ++    IL+TTVGK++ N ++P E+ YL    N E L+D+      +E G+D +T I+  ++   F KK L  I+  + ++          + +D++KD+G+ YST +  T+   D+P    K++  +    +VEE+ K +++GL+T+D+RY  V + W    + + K + +  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +V+     +IT+ +A  IV+AG+++V +RSV  CK  +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  A+     + V       E   Y VPF + ++VE GD+V  G  +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   VPAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I
  S:     5 NRFKSMQITLASPTKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK----ETPLEPKSLLTEREYREKLQE-----YGHGSFVAKM------------------------------------------GAEAIQDLLKQVDLEAEIAELKEELKTATGQ---KRFKAVRRLDVLDAFYKSGNKPEWMVLNILPVLPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELGAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPRLMAIELFKPFVMREIVARE---------YAGNVKAAKRMVERGDERIWDILEDVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLLLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDEGREGEGMIFKDIDEAVMAYHNGYVHLHSRVGIAVDSMPDKPWKENQLHKILVTTVGKILFNSIIPSEIPYLQETTN-ENLTDSTPDKYFLEPGQDIQTVIDSLEINAPFKKKHLGNIIAEIFKRLRTTE---TSAFLDRLKDLGYYYSTLAGLTVGIADIPVIDNKQEIIDAAHHRVEEINKAFRRGLMTEDDRYVAVTTTWREAKDALEKRLIE-TQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLVIRAITDGK--EVTETLEERLFGRYTKKSVKHPETGEVIVGPDTLITEDMAAAIVNAGVEEVTIRSVFTCKTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGTVIEIEEDAATRTKKVFVQGKTGMGE---YVVPFTARMKVEVGDEVHRGEALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-VPATSRPVLLGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLIGLKENVIIGKIIPAGTGMARYRNI 1186
>gi|55821839|ref|YP_140281.1| DNA-directed RNA polymerase subunit beta' [Streptococcus thermophilus LMG 18311] >gi|55823755|ref|YP_142196.1| DNA-directed RNA polymerase subunit beta' [Streptococcus thermophilus CNRZ1066] >gi|73917878|sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|73917879|sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|55737824|gb|AAV61466.1| DNA-directed RNA polymerase B prime subunit [Streptococcus thermophilus LMG 18311] >gi|55739740|gb|AAV63381.1| DNA-directed RNA polymerase B prime subunit [Streptococcus thermophilus CNRZ1066] (1212 aa)
Score = 2823, Expect = 0.0e+00, Identities = 584/1271 (45%), Positives = 832/1271 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND----IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +P  S++ L LD+S + +E+V+YF  Y+V+D      PK        +   ++ S  T  + R+ L+E  +                                     +F++        +GAEAI +LLK +DL+ E  ++ E+L+ +      K  K VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +             N+K+A++++   D  IW I+  VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F ++DE    Y    VH+HS +GI   + P K + ++    IL+TTVGK++ N ++P E+ YL    N E L+D+      +E G+D +T I+  ++   F KK L  I+  + ++          + +D++KD+G+ YST +  T+   D+P    K++  +    +VEE+ K +++GL+T+D+RY  V + W    + + K + +  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   V E+L ERL  R+    V HP++ +V+     +IT+ +A  IV+AG+++V +RSV  CK  +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G V  I+  A+     + V       E   Y VPF + ++VE GD+V  G  +TEGSI  K LL+V     V  Y++ EVQKVYR QG+EI DK++EV++RQ+  KV++ D G++D   G ++DI+ F   N+ +++S   VPAT+  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     +I
  S:     5 NRFKSMQITLASPTKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGIP--SRMGLTLDMSPRALEEVIYFAAYVVID------PK--------ETPLERKSLLTEREYREKLQEYGQG------------------------------------SFVAK-------MGAEAIQDLLKQVDLEAEIAELKEELKTATGQ---KRFKAVRRLDVLDAFYKSGNKPEWMVLNILPVLPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELGAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPRLMAIELFKPFVMREIVARE---------YAGNVKAAKRMVERGDERIWDILEDVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARLLLLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDEGREGEGMIFKDIDEAVMAYHNGYVHLHSRVGIAVDSMPDKPWKENQLHKILVTTVGKILFNSIIPSEIPYLQETTN-ENLTDSTPDKYFLEPGQDIQTVIDSLEINAPFKKKHLGNIIAEIFKRLRTTE---TSAFLDRLKDLGYYYSTLAGLTVGIADIPVIDNKQEIIDAAHHRVEEINKAFRRGLMTEDDRYVAVTTTWREAKDALEKRLIE-TQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLVIRAITDGK--EVTETLEERLFGRYTKKSVKHPETGEVIVGPDTLITEDMAAAIVNAGVEEVTIRSVFTCKTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKG--EAVITEVKGTVIEIEEDAATRTKKVFVQGKTGMGE---YVVPFTARMKVEVGDEVHRGEALTEGSIQPKRLLEVRDTLSVETYLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANKDIVISGG-VPATSRPVLLGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLIGLKENVIIGKIIPAGTGMARYRNI 1186
>gi|49482773|ref|YP_039997.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749584|sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|49240902|emb|CAG39569.1| DNA-directed RNA polymerase beta' chain protein [Staphylococcus aureus subsp. aureus MRSA252] (1207 aa)
Score = 2821, Expect = 0.0e+00, Identities = 590/1269 (46%), Positives = 840/1269 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +V+    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +      K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+  E
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEVIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDVKYE 1190
>gi|148267003|ref|YP_001245946.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus JH9] >gi|147740072|gb|ABQ48370.1| DNA-directed RNA polymerase, beta' subunit [Staphylococcus aureus subsp. aureus JH9] (1207 aa)
Score = 2820, Expect = 0.0e+00, Identities = 589/1269 (46%), Positives = 840/1269 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +      K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+  E
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKKTIRHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDVKYE 1190
>gi|88194305|ref|YP_499097.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|87201863|gb|ABD29673.1| DNA directed RNA polymerase beta-prime chain, putative [Staphylococcus aureus subsp. aureus NCTC 8325] (1198 aa)
Score = 2820, Expect = 0.0e+00, Identities = 589/1269 (46%), Positives = 840/1269 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +      K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+  E
  S:     1 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDVKYE 1181
>gi|161508783|ref|YP_001574442.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|161784269|sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|160367592|gb|ABX28563.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus USA300_TCH1516] (1207 aa)
Score = 2819, Expect = 0.0e+00, Identities = 589/1269 (46%), Positives = 840/1269 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +      K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+  E
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIHHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDVKYE 1190
>gi|87161137|ref|YP_493231.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus USA300] >gi|87127111|gb|ABD21625.1| DNA-directed RNA polymerase, beta' subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] (1198 aa)
Score = 2819, Expect = 0.0e+00, Identities = 589/1269 (46%), Positives = 840/1269 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +      K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+  E
  S:     1 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIHHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDVKYE 1181
>gi|15923533|ref|NP_371067.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus Mu50] >gi|15926221|ref|NP_373754.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus N315] >gi|21282227|ref|NP_645315.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus MW2] >gi|49485408|ref|YP_042629.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651419|ref|YP_185475.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus COL] >gi|150393050|ref|YP_001315725.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus JH1] >gi|151220717|ref|YP_001331539.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978872|ref|YP_001441131.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus subsp. aureus Mu3] >gi|168728925|ref|ZP_02761202.1| RNA polymerase beta-prime chain [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|41017891|sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|41017892|sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|41017893|sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|56749537|sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|81695151|sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|114152142|sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|13700434|dbj|BAB41732.1| RNA polymerase beta-prime chain [Staphylococcus aureus subsp. aureus N315] >gi|14246311|dbj|BAB56705.1| RNA polymerase beta-prime chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21203663|dbj|BAB94363.1| RNA polymerase beta-prime chain [Staphylococcus aureus subsp. aureus MW2] >gi|49243851|emb|CAG42276.1| DNA-directed RNA polymerase beta' chain protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285605|gb|AAW37699.1| DNA-directed RNA polymerase, beta' subunit [Staphylococcus aureus subsp. aureus COL] >gi|149945502|gb|ABR51438.1| DNA-directed RNA polymerase, beta' subunit [Staphylococcus aureus subsp. aureus JH1] >gi|150373517|dbj|BAF66777.1| DNA-directed RNA polymerase beta' chain protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721007|dbj|BAF77424.1| RNA polymerase beta-prime chain [Staphylococcus aureus subsp. aureus Mu3] (1207 aa)
Score = 2819, Expect = 0.0e+00, Identities = 589/1269 (46%), Positives = 840/1269 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +      K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+  E
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDVKYE 1190
>gi|82750251|ref|YP_415992.1| DNA-directed RNA polymerase subunit beta' [Staphylococcus aureus RF122] >gi|109893854|sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|82655782|emb|CAI80182.1| DNA-directed RNA polymerase beta' subunit [Staphylococcus aureus RF122] (1207 aa)
Score = 2817, Expect = 0.0e+00, Identities = 588/1269 (46%), Positives = 840/1269 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F K+ L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQKVYR+QG+EI DK++EV++RQ+  KV+I ++G++    G ++DI+ F   N +      K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG +   D+  E
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKQFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDANRE-AFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLKENVIIGKLIPAGTGMRRYSDVKYE 1190
>gi|184155998|ref|YP_001844338.1| DNA-directed RNA polymerase beta' subunit [Lactobacillus fermentum IFO 3956] >gi|183227342|dbj|BAG27858.1| DNA-directed RNA polymerase beta' subunit [Lactobacillus fermentum IFO 3956] (1215 aa)
Score = 2814, Expect = 0.0e+00, Identities = 582/1267 (45%), Positives = 830/1267 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEE-LSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           S++IGLASP KIR WS GEVTK ETINY++LKPEKDGLFDE IFGP KD+ECACG+YK+ ++  ++CE+CGVE+T + VRRER+GHIELAAP +HIW  K +  PS++ LVLD+S +E+E+V+YF +Y+VLD G+    K                K+  S+ R   RE+ E      + E       A      LA+ ++     E+   +   TG +      A+  L           DI E   KS                         NKPEWM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP +KM Q+G+PV M ++LFKPFIIHEL K+          + +N+K+A+++I  +D  ++ ++  VIK+ PVLLNRAPTLHRLGIQAFEPILV GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL P+DG+PI+ P+QDMV+GNYY+T E     G+GM+F + +E +  Y+   V + + +G+ TS+F KK F    +  I++T+VGK++ N+++PE+ +Y+N P  DNL+  + D   +E G+D   ++E   +   F K  LS+I+  +++ Y    + +    +D+IKD+G+  ST S  T+   DV +  EK +  E+  K+V  + K +++GL+TD+ERY++V+  W+   ++V     KLI+  + + N I +M++SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGL+V E F SS+GARKGMTDTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G  LEV   T    +IE L +R++ R+ +  V +P++ + +     ++ + +A +I+DAG+ KV +RS   C  E+G+C++C+G +  T   VE   AIG +AAQSIGEPGTQLT+R FHTGGV+   +I QG  R++++ +   PK   K+ ISE+ G+V SI+ +P       VTIK   ++  Y +P  + +RV EGD +  G  I EGSID KE+++V  +     Y++ EVQ VYR+QGI++ DK++E++IRQ+  KV++ D G++D   G+++DI+ FR  N + ++S   +PATA  +I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG  +  +I
  S:     9 SMEIGLASPMKIRSWSYGEVTKPETINYRTLKPEKDGLFDERIFGPTKDFECACGRYKRARYNKRVCERCGVEVTSAKVRRERMGHIELAAPASHIWYFKGI--PSRMGLVLDMSPRELEEVIYFASYVVLDAGDTGLEK----------------KQLLSEPR--YRELKEEYGNRFTAEMG-----AEAIQKLLADVDLAKEATELKAVLKEATGQK---RTRAVRRL-----------DILEAFLKS------------------------GNKPEWMVMDVIPVMPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHLLKGKQGRFRQNLLGKRVDYSGRSVIDVGPSMKMNQMGLPVPMAMELFKPFIIHELTKRN---------LATNVKAAKRMIDKRDEKVFDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPILVSGKAMRLHPLVCAAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAHHILSPRDGEPIVAPSQDMVIGNYYMTTEDKAREGEGMIFKDTNEARMAYRNGYVALQTRVGVLTSSFDKKPFTAEQRQKIMVTSVGKLLFNNIMPEDYTYINEPTADNLQNGVPDKYFLEPGEDIHAYLENAPLVPPFKKGFLSDIIADVYKIY---KVTVTSQLLDRIKDLGYYESTISGLTVGIADVTDLKEKPEIIEKAHKQVALVTKQFRRGLITDNERYERVIGIWNDAKDEVQN---KLIEHMD-IHNPINMMSDSGARGNISNFTQLAGMRGLMASPSG-----------KIMELPILSNFREGLSVLEMFISSHGARKGMTDTALKTANSGYLTRRLVDVAQDVIVREKDCGTDRG--LEVTAITNGNEMIEPLYDRILGRYTMKSVFNPETGEKIVGKNVLLNEEMAQKIIDAGVQKVTIRSAFTCNTEHGVCERCYGRNAATGDQVEAGEAIGTVAAQSIGEPGTQLTLRNFHTGGVAGNDDITQGLPRIQEIVESRNPKG--KATISEVTGQVVSIEENPAE-QTKDVTIKGETDTRTYTLPITARIRVAEGDDIHRGRAINEGSIDPKEMIRVRDVLSTETYLLSEVQNVYRMQGIDLLDKHVEIMIRQMMRKVRVMDPGDTDVLPGELLDISQFRDANYQTLISGG-IPATARPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKIIPAGTGMGAYRNI 1185
>gi|78044548|ref|YP_361126.1| DNA-directed RNA polymerase subunit beta' [Carboxydothermus hydrogenoformans Z-2901] >gi|90111017|sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|77996663|gb|ABB15562.1| DNA-directed RNA polymerase, beta' subunit [Carboxydothermus hydrogenoformans Z-2901] (1152 aa)
Score = 2807, Expect = 0.0e+00, Identities = 589/1267 (46%), Positives = 834/1267 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILI---TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDII 1277
           I+IGLASP++IR WS+GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YFV+YIV+D G     K         L ++   +E R K                   NA K                                   G+GAEAI ELL  IDLD+   ++  ++++S     I+    +RRLE ++  + S N+PEWMIL  I V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK++Q G+P  M L+LFKPF++ +L+          D I  NIKSA++++      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+AI++HPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L+S +IL PKDGKP++ PTQDMV+G+YYLT+EK    G+G  FA+ +E+   Y+   + +H+ I        K ++P  G ++   TT G++I N+V+PEE+ ++N+      L D                        KK L +IV   +RK      E     +D +K +GF Y+TK+  TI   D+    EK++  EE D+ V +++  Y++GL+T+DERY++VV  W++ T +V+K + + ++  ++  N + +MA SGARGNI    QL+GMRGLM+                 I++PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD  QDVIV  EDC T+ G     + D K G+ VIE L +R++ R    DVVHP++ ++L    + IT+ +A +IV A I KV++RSVL C+  +G+C +C+G +L TN +V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++II+EI+G V  ++ +     I V+  +  +  + Y + + + ++V+ GDKV  G ++TEG I+  +L+KV GIE  + Y+++EVQKVYR+QG+EI DK+IEV+IRQ+  KV+I+DSG++D   G ++DI  F  EN K+I    K PATA  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG     +I+
  S:    10 IKIGLASPDQIRAWSHGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERLGHIELAAPVSHIWYFKGIP--SRMGLLLDMSPRSLEKVLYFVSYIVIDPGETPLLKK-------QLLTETEYREAREK-----------------YGNAFKA----------------------------------GMGAEAIKELLAEIDLDELSAELKAEIKESTGQRRIRA---LRRLEVVESFRKSGNRPEWMILDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKEMALELFKPFVMKKLV---------ADGIAHNIKSAKRMVERVKPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLSSHNILNPKDGKPVVVPTQDMVIGSYYLTVEKPGAKGEGKKFAHPEEVIMAYEEGVIELHTKI--------KVRYPIRGEIVELETTPGRIIFNEVIPEELRFINH------LVD------------------------KKALGKIVTESYRKL---GYEKTGYLLDGLKKLGFHYATKAGLTIGIVDITVPKEKQEILEEADRMVADIEVKYRRGLITEDERYQRVVDIWNAATEKVTKKLVETLEASQF--NHVYMMAKSGARGNIQQIRQLAGMRGLMADPSG-----------RIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVCQDVIVREEDCGTEDGI---YVTDVKDGTDVIEKLEDRILGRVAAEDVVHPETGELLVAKNQEITEEIAEKIVSANIKKVKIRSVLTCRTRHGVCTRCYGRNLATNSIVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGEDITQGLPRVEELFEARRPKG--QAIITEIDG-VVEVRDNKGRREIEVINQETGERKV-YPITYQARIKVQTGDKVYAGDELTEGPINPHDLIKVKGIEGAQLYLLQEVQKVYRMQGVEINDKHIEVVIRQMLRKVKIEDSGDTDLLPGSLVDIFEFEDENAKVIAKGGK-PATAKRVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKVDPLLGLKENVIIGKLIPAGTGMARYRNIM 1145
>gi|125624759|ref|YP_001033242.1| DNA-directed RNA polymerase subunit beta' [Lactococcus lactis subsp. cremoris MG1363] >gi|160175421|sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|124493567|emb|CAL98552.1| DNA-directed RNA polymerase, beta' subunit [Lactococcus lactis subsp. cremoris MG1363] (1207 aa)
Score = 2804, Expect = 0.0e+00, Identities = 574/1264 (45%), Positives = 831/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQK--SSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND---IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSG-SVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S++IG+ASP+KIR WS GEV K ETINY++ KPE++GLFDE IFGP KD+ECACGK K + ++ ++CE CGV++T +  RRER+GHIELAAPI+HIW  K +  PS++ L LD+S + +E+V+YF +Y+V+D      PK        DL  ++  + +E R +L K                                            N   SF      +GAEAI +LL ++D+DKE  ++ E+L+     +  +  K++RRL+ +   + S N   WM+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++ NAP+II+ NEKR+LQEAVD L DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M ++LFKPF++ +L+KK          + +NI++A++ +  QD+ +W ++  V+K+ PVLLNRAPTLHRLGIQAFEP+L++GKAIRLHPL   A+NADFDGDQMA+H+PLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+FA  +E++   +   VH+H+ IGI T +   P  +  +D IL+TTVGKVI N ++PE M YLN P ++   +  D    ++ G++ +  +      + F K  L  I+  + ++Y   +       +D++KD+G+  ST +  T+   D+P   +K +  +   K+VE++ K +++GL+TDDERY  V   W        + +EK + + + LTN IV+M +SGARGNISNF+QL+GMRGLM+           K+    +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G    VI D  +G  ++E L ERL+ R+    V+HP++ +++     +I++ +A +I++A + +V +RSV  CK  +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   ++II+E+ G V SI           +T+K   ++ +Y V     L VEEG+ +  G+ + +GSI+ K LL+V     V  Y++ EVQK YR QG+EI DK+IEV+IRQ+  KV+I D+G++D   G ++DI+ F   NE  +L+ + +PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMRIGIASPQKIRYWSFGEVKKPETINYRTQKPEREGLFDERIFGPQKDWECACGKLKGVFYKNQVCELCGVQVTTAKSRRERMGHIELAAPISHIWYFKGI--PSRMGLALDMSPRALEEVIYFASYVVID------PKE------TDLEKKQLLTEREYREQLLK--------------------------------------------NGFGSFVAK---MGAEAIQDLLNDVDIDKEVAELKEELK---TVTGQRRVKIIRRLDVLSAFRKSGNALSWMVLNVLPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLMELNAPNIIVQNEKRMLQEAVDTLIDNGRRGRPITGAGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMAQLVKKE---------LAANIRAAKRKVERQDSDVWDVLETVVKEHPVLLNRAPTLHRLGIQAFEPVLIDGKAIRLHPLACEAYNADFDGDQMAIHLPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEKGREGEGMIFATPEEVEIAMRNGYVHLHTRIGIATKSLNKPWTENQQDKILVTTVGKVIFNSIIPEGMPYLNEPTDVNLTTSTDDRFFMDAGQNIKEVLAGIDTVRPFKKGYLGNIIAEVFKRYRTTA---TSEYLDRLKDLGYHQSTLAGLTVGIADIPVVEDKHEIIDAAHKRVEQITKQFRRGLITDDERYNAVTGVW----RDAKESLEKRLIEEQDLTNPIVMMMDSGARGNISNFSQLAGMRGLMAAP-------NGKI----MELPIISNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGL---VIADIATGKEMVEPLFERLVGRYTRKSVLHPETGEMIIGDDTLISEDIARKIIEADVKEVTIRSVFTCKTPHGVCKHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASSSDITQGLPRVQEIFEARNPKG--EAIITEVTGTVESI-VEDGATRTREITVKGKTDTRSYTVGMADVLMVEEGEFIHRGAPLIQGSIEPKHLLQVRDALSVETYLLGEVQKTYRSQGVEIGDKHIEVMIRQMLRKVRIMDNGSTDVLPGTLMDISDFEALNETALLNGE-MPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKEDHLLGLKENVIIGKIIPAGTG 1178
>gi|116512668|ref|YP_811575.1| DNA-directed RNA polymerase subunit beta' [Lactococcus lactis subsp. cremoris SK11] >gi|123125374|sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116108322|gb|ABJ73462.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Lactococcus lactis subsp. cremoris SK11] (1207 aa)
Score = 2804, Expect = 0.0e+00, Identities = 574/1264 (45%), Positives = 831/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQK--SSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND---IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSG-SVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S++IG+ASP+KIR WS GEV K ETINY++ KPE++GLFDE IFGP KD+ECACGK K + ++ ++CE CGV++T +  RRER+GHIELAAPI+HIW  K +  PS++ L LD+S + +E+V+YF +Y+V+D      PK        DL  ++  + +E R +L K                                            N   SF      +GAEAI +LL ++D+DKE  ++ E+L+     +  +  K++RRL+ +   + S N   WM+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++ NAP+II+ NEKR+LQEAVD L DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M ++LFKPF++ +L+KK          + +NI++A++ +  QD+ +W ++  V+K+ PVLLNRAPTLHRLGIQAFEP+L++GKAIRLHPL   A+NADFDGDQMA+H+PLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+FA  +E++   +   VH+H+ IGI T +   P  +  +D IL+TTVGKVI N ++PE M YLN P ++   +  D    ++ G++ +  +      + F K  L  I+  + ++Y   +       +D++KD+G+  ST +  T+   D+P   +K +  +   K+VE++ K +++GL+TDDERY  V   W        + +EK + + + LTN IV+M +SGARGNISNF+QL+GMRGLM+           K+    +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G    VI D  +G  ++E L ERL+ R+    V+HP++ +++     +I++ +A +I++AG+ +V +RSV  CK  +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   ++II+E+ G V SI           +T+K   ++ +Y V     L VEEG+ +  G+ + +GSI+ K LL+V     V  Y++ EVQK YR QG+EI DK+IEV++RQ+  KV+I D+G+ D   G ++DI+ F   NE  +L+ + +PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMRIGIASPQKIRYWSFGEVKKPETINYRTQKPEREGLFDERIFGPQKDWECACGKLKGVFYKNQVCELCGVQVTTAKSRRERMGHIELAAPISHIWYFKGI--PSRMGLALDMSPRALEEVIYFASYVVID------PKE------TDLEKKQLLTEREYREQLLK--------------------------------------------NGFGSFVAK---MGAEAIQDLLNDVDIDKEVAELKEELK---TVTGQRRVKIIRRLDVLSAFRKSGNALSWMVLNVLPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLMELNAPNIIVQNEKRMLQEAVDTLIDNGRRGRPITGAGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMAQLVKKE---------LAANIRAAKRKVERQDSDVWDVLETVVKEHPVLLNRAPTLHRLGIQAFEPVLIDGKAIRLHPLACEAYNADFDGDQMAIHLPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEKGREGEGMIFATPEEVEIAMRNGYVHLHTRIGIATKSLNKPWTENQQDKILVTTVGKVIFNSIIPEGMPYLNEPTDVNLTTSTDDRFFMDAGQNIKEVLAGIDTVRPFKKGYLGNIIAEVFKRYRTTA---TSEYLDRLKDLGYYQSTLAGLTVGIADIPVVEDKHEIIDAAHKRVEQITKQFRRGLITDDERYNAVTGVW----RDAKESLEKRLIEEQDLTNPIVMMMDSGARGNISNFSQLAGMRGLMAAP-------NGKI----MELPIISNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGL---VIADIATGKEMVEPLFERLVGRYTRKSVLHPETGEMIIGDDTLISEDIARKIIEAGVKEVTIRSVFTCKTPHGVCKHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASSSDITQGLPRVQEIFEARNPKG--EAIITEVTGTVESI-VEDGATRTREITVKGKTDTRSYTVGMADVLMVEEGEFIHRGAPLIQGSIEPKHLLQVRDALSVETYLLGEVQKTYRSQGVEIGDKHIEVMVRQMLRKVRIMDNGSIDVLPGTLMDISDFEALNETALLNGE-MPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKEDHLLGLKENVIIGKIIPAGTG 1178
>gi|83591283|ref|YP_431292.1| DNA-directed RNA polymerase subunit beta' [Moorella thermoacetica ATCC 39073] >gi|109893837|sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|83574197|gb|ABC20749.1| DNA-directed RNA polymerase, subunit beta-prime [Moorella thermoacetica ATCC 39073] (1164 aa)
Score = 2801, Expect = 0.0e+00, Identities = 579/1264 (45%), Positives = 811/1264 (64%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILI-TTVGKVILND--VLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           S    ++IGLASPE+IR WS+GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YFV Y+V+D G+    K         L ++   +E R K     R                                                     +GAEAI ELL+ IDLD+   ++ ++L++S     I+    +RRLE ++  + S N+PEWMI+  I V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKM+Q G+P  M L+LFKPF++  L+ K          +  NIKSA++++    N +W ++ +VI + PVLLNRAPTLHRLGIQAFEP+LVEG+AI++HPLV TA+NADFDGDQMAVHVPLS EA AEAR +++A+ HIL PKDG+P+++PTQDMVLG YYLT       G+G  F++ DE    Y  K + +H++I         K   +DG L+ TT+G++I N    +P+E+ Y                     Y   ++KKK            +  I+ R Y     E   + +D IK +GF YST +  TI   D+    +K++   ET+  VE++ + Y+KGL++++ERY+KV+S W++ T+ ++K +   + K     N + +MANSGARGN+    QL+GMRGLM+                 I++PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD  QDVIV  +DC T  G  +EV E  +   VIE + ERL  R+ + DV HP++ ++L  A  +I    A  IV AGI  V++RSVL CK   G+C+KC+G DL T + VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++II+E  G +++I        I +    +S E  +Y+VP+ S L+V EGD V+ G ++T GS++  +LLKV G+  V+ Y+++EVQ+VYRLQG++I DK+IEV+IRQ+  KV+++D G++D   G ++D   F   N K+     K PATA  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG
  S:     5 SNFERMRIGLASPEQIRAWSSGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRVRYKGIVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLILDMSPRSLEKVLYFVAYVVIDPGDTPLVKK-------QLLTEAEYREYRDKYGNAFRA---------------------------------------------------AMGAEAIKELLQEIDLDQLAAELRQELKESSGQRKIRA---LRRLEVVEAFRSSGNRPEWMIMDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMHQCGLPKEMALELFKPFVMKRLVDKG---------LAHNIKSAKRMVERVKNEVWDVLEEVISEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMMAAHHILNPKDGRPVVSPTQDMVLGAYYLTTVSKGARGEGKAFSSYDEAYMAYLNKVIDMHAMI---------KVRQEDGQLLETTIGRLIFNREIPIPKELGY---------------------YNCEVDKKK------------LTEIIARCYQLLGTEATATLLDGIKKVGFHYSTLAGFTIGIDDIVVPGDKKEIIAETESAVEKIDQQYRKGLISEEERYQKVISLWNNATDTLTKKLMAGMDK----FNPVFMMANSGARGNVQQIRQLAGMRGLMADPSG-----------RIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDVIVREDDCGTTAG--IEVREIQEGNQVIEKMEERLAGRYALEDVRHPETGELLVAANTMIDDDAARAIVQAGIKTVKIRSVLTCKTRYGVCRKCYGRDLATGREVEIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLSRVEELFEARKPKG--QAIIAETTGTITAITEVRGRREIEIT--DDSGEKFSYQVPYGSRLKVAEGDHVEAGDELTGGSVNPHDLLKVKGVRGVQLYLLREVQRVYRLQGVDINDKHIEVMIRQMLRKVKVEDQGDTDLLPGSLVDAFDFEDANRKVQEIGGK-PATARPVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGRVDPLLGLKENVIIGKLIPAGTG 1134
>gi|169190355|ref|ZP_02850327.1| DNA-directed RNA polymerase, beta' subunit [Paenibacillus sp. JDR-2] >gi|169002962|gb|EDS49837.1| DNA-directed RNA polymerase, beta' subunit [Paenibacillus sp. JDR-2] (1208 aa)
Score = 2797, Expect = 0.0e+00, Identities = 580/1259 (46%), Positives = 831/1259 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDND----IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP+KIR WS GEV K ETINY++LKPEK+GLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ L LD+S + +E+++YF +Y+V D G+    K    K+++      S KE RS      RE Y                                             G +  +GAEA+ +LL++ID++KE + + E+LR ++     +  + ++RLE I+  ++S N+PEWMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKM+Q G+P  M L+LFKPF++ EL+ K          +  NIKSA++ +      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEPILVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LAS +IL PKDGKP++TP+QDMVLG+YYLTM+     G G +FA V+E  + YQ   V +H+ + +P     K  F    ++ ++ TTVGKVI N++ PE+  Y+N       L        + E G D    +++  +     K+ L  I+    R Y      I+   +D+IK +GF YST++  T++  DV    EK +  +E+D KV  +   Y++GL+T++ERY +V+  WS   +Q+++ + + + +     NSI++M +S ARGN S   QL GMRGLM+                 IE+PIK++F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD  QDVIV  +DC T KG  +  I+D K   VIE L +R+  R+    + HPK+ +V+    E+I    A+ I++AGI+K+++RSVL C+  +G+C+ C+G +L T K VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++II+E++G V  I+ + D   I    ++   E+  Y + + S +RV EG +++ G ++T+GSID K++L++ GI  V+NYI++EVQ+VYR QG+EI DK++EV+++Q+  K++I D+G++    G  +DI+ +   N + I +  + PA A  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G LIP GTG
  S:    10 MKIGLASPDKIRSWSRGEVKKPETINYRTLKPEKEGLFCEKIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLALDMSPRSLEEIIYFASYVVTDPGDTPLEK----KQLL------SEKEYRS-----YREKYG-------------------------------------------YGFQASMGAEAVKKLLQDIDVEKELETLKEELRTAQGQ---RRNRAIKRLEVIEAFRNSGNEPEWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMFQCGLPKEMALELFKPFVMKELVNKG---------LAHNIKSAKRKVERVSPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPILVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLASGNILNPKDGKPVVTPSQDMVLGSYYLTMDNKEAKGSGSVFATVNEAISAYQRGIVSLHARVFVPARVLKKTIFTEQQQNSLISTTVGKVIFNEIFPEDFPYINEATKANLLQGTPDKYFVYEKGSDLNKIMDELPIAGGVGKEYLGNIIGECFRIYHTTLTSII---LDRIKQLGFTYSTRAGITVAVSDVIVPEEKVEILKESDAKVAVVMNQYRRGLITNEERYDRVIEIWSKSKDQITEILMRSMDR----YNSIMLMVDSKARGNKSQIAQLGGMRGLMANPSG-----------RIIELPIKSNFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDVIVREDDCGTDKGFAVSKIQDGK--EVIEDLYDRIEGRYSFETLRHPKTGEVIVKKSELIDSGKADAIIEAGIEKLQIRSVLSCRARHGVCKVCYGRNLATGKHVEIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQELFEARNPKG--QAIITELDGVVKEIREAKDRREI---EVQGEAETKVYAITYGSRIRVTEGQQLEAGDELTDGSIDPKDMLRIKGIRGVQNYILQEVQRVYRNQGVEINDKHVEVMVKQMLRKIRIVDAGDTTLLPGAFVDIHEYEAANREAIFAGLE-PAVAKPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKVDQLLGLKENVIIGKLIPAGTG 1176
>gi|149003617|ref|ZP_01828482.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP14-BS69] >gi|147758349|gb|EDK65349.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP14-BS69] (1225 aa)
Score = 2797, Expect = 0.0e+00, Identities = 586/1283 (45%), Positives = 834/1283 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G D +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGVADIPVVDDKTEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|15901783|ref|NP_346387.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae TIGR4] >gi|148985539|ref|ZP_01818728.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP3-BS71] >gi|148989959|ref|ZP_01821234.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP6-BS73] >gi|148998489|ref|ZP_01825930.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP11-BS70] >gi|149007434|ref|ZP_01831077.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP18-BS74] >gi|168484259|ref|ZP_02709211.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC1873-00] >gi|168494800|ref|ZP_02718943.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC3059-06] >gi|168576639|ref|ZP_02722505.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae MLV-016] >gi|169833593|ref|YP_001695314.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182684895|ref|YP_001836642.1| DNA-directed RNA polymerase beta' subunit [Streptococcus pneumoniae CGSP14] >gi|41018114|sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|14973466|gb|AAK76027.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae TIGR4] >gi|147755682|gb|EDK62728.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP11-BS70] >gi|147761006|gb|EDK67975.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP18-BS74] >gi|147922259|gb|EDK73380.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP3-BS71] >gi|147924619|gb|EDK75705.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP6-BS73] >gi|168996095|gb|ACA36707.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae Hungary19A-6] >gi|172042512|gb|EDT50558.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC1873-00] >gi|182630229|gb|ACB91177.1| DNA-directed RNA polymerase beta' subunit [Streptococcus pneumoniae CGSP14] >gi|183575320|gb|EDT95848.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC3059-06] >gi|183577668|gb|EDT98196.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae MLV-016] (1225 aa)
Score = 2797, Expect = 0.0e+00, Identities = 586/1283 (45%), Positives = 834/1283 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G D +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|111658848|ref|ZP_01409469.1| hypothetical protein SpneT_02000019 [Streptococcus pneumoniae TIGR4] (1225 aa)
Score = 2797, Expect = 0.0e+00, Identities = 586/1283 (45%), Positives = 835/1283 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G D +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++ + VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGE-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|149012451|ref|ZP_01833482.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP19-BS75] >gi|194398481|ref|YP_002038543.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae G54] >gi|147763507|gb|EDK70443.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP19-BS75] >gi|194358148|gb|ACF56596.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae G54] (1225 aa)
Score = 2796, Expect = 0.0e+00, Identities = 586/1283 (45%), Positives = 834/1283 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G D +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKTEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|168492065|ref|ZP_02716208.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC0288-04] >gi|183573693|gb|EDT94221.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC0288-04] (1225 aa)
Score = 2793, Expect = 0.0e+00, Identities = 586/1283 (45%), Positives = 834/1283 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G D +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMSYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|148993180|ref|ZP_01822746.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP9-BS68] >gi|168489965|ref|ZP_02714164.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae SP195] >gi|147928154|gb|EDK79172.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP9-BS68] >gi|183571623|gb|EDT92151.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae SP195] (1225 aa)
Score = 2793, Expect = 0.0e+00, Identities = 585/1283 (45%), Positives = 834/1283 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   +H+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G D +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYIHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLLYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKTEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|116515724|ref|YP_817181.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae D39] >gi|149021910|ref|ZP_01835897.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP23-BS72] >gi|122277973|sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116076300|gb|ABJ54020.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae D39] >gi|147929948|gb|EDK80936.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae SP23-BS72] (1225 aa)
Score = 2789, Expect = 0.0e+00, Identities = 585/1283 (45%), Positives = 833/1283 (64%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G   +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGAIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|183603347|ref|ZP_02711608.2| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC1087-00] >gi|183569972|gb|EDT90500.1| DNA-directed RNA polymerase, beta' subunit [Streptococcus pneumoniae CDC1087-00] (1216 aa)
Score = 2787, Expect = 0.0e+00, Identities = 584/1278 (45%), Positives = 831/1278 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G D +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     1 MQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGDIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1186
>gi|15903818|ref|NP_359368.1| DNA-directed RNA polymerase subunit beta' [Streptococcus pneumoniae R6] >gi|41018029|sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|15459459|gb|AAL00579.1| DNA-dependent RNA polymerase [Streptococcus pneumoniae R6] (1225 aa)
Score = 2787, Expect = 0.0e+00, Identities = 585/1283 (45%), Positives = 832/1283 (64%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I++RG +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D      PK+   +        KS    R    +     Y S   +   E AI+        D L + ++   I E+   + + TG +     +AI  L           D+ +   KS N  +              W+          IL  + V PPD RP++QL+GG+F +SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y+   VH+HS +GI T +   P  +  +  +L+TTVGK++ ND++PE + YL  P+N    E +     +  G   +  I   ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +LI  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C    G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + +RVE G +V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DIN F   N+ ++++   VPAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG     ++  E + + E EY
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYRGIVCDRCGVEVTRTKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID------PKDTPLE-------HKSIMTEREYRERLREYGYGSFVAKMGAE-AIQ--------DLLKQVDLEKEIAELKEELKTATGQK---RVKAIRRL-----------DVLDAFYKSGNKPE--------------WM----------ILNILPVIPPDLRPMLQLDGGRFASSDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDRDEAVMAYRNGYVHLHSRVGIATDSLNKPWTEEQRHKVLLTTVGKILFNDIMPEGLPYLQEPNNANLTEGVPAKYFLPLGGAIKEAISNLELNPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRMKNLGYHHSTLAGLTVGIADIPVVDDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLIANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLIRSIAEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRRGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGQVTAIEEDASTRTKKVFV---KGETGEGEYVVPFTARMRVEVGGQVARGAALTEGSIQPKRLLAVRDVLSVETYLLGEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDINDFTDANKDVLIAGG-VPATGRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTGMARYRNL--EPHAVNEEEY 1195
>gi|20808667|ref|NP_623838.1| DNA-directed RNA polymerase subunit beta' [Thermoanaerobacter tengcongensis MB4] >gi|41018080|sp|Q8R7U7|RPOC_THETN DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|20517302|gb|AAM25442.1| DNA-directed RNA polymerase beta subunit/160 kD subunit (split gene in archaea and Syn) [Thermoanaerobacter tengcongensis MB4] (1183 aa)
Score = 2785, Expect = 0.0e+00, Identities = 589/1266 (46%), Positives = 839/1266 (66%)
  Q:     4 KSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYL--NNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           K     +I+IGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK++K++G +C++CGVE+T S VRRER+GHIELAAP+AHIW  K +P  S++ L+LD+S + +E+V+YFV+Y+V+D G+    K    K+++      S KE R  L K                                                   G RF  G+GAEAI ELL+ IDL+K  K++  ++++S     ++    +RRLE ++   DS N+PEWMIL+ + V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M L+LFKPF++  L+ K          +  +IKSA++++      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+AI+LHPLV  A+NADFDGDQMAVH+PLS EA AEAR ++LA+ +IL P+DGKP++TPTQDMVLG YYLT ++  +PG+G  F++ +E    YQ+  +H+H+ I +  +     +  K  ++ TTVGK+I N+ +P+++ ++  NNP+    L  ND+V+                   K  L +I++ ++R +          T+DKIK++GF+YSTK+A TIS  D+    EKEK  +E D+ V +++  +++GL++++ERY+KV+  W+  T +V++ +   + K     N I +MA+SGARG+ +   QL+GMRGLM+                 IE+PI+++F EGL V E+F S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  EDC T +G  +E I +     +IE L++R+I R    D+V  +   V+    E+I +  A +I  AGI +V++RS L C+  +G+C+ C+G DL T +LV    A+G+IAAQ+IGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    ++I+EI G V  I  S     I VV  +N+  S  Y +P+ S L+V +G  V+ G ++TEGS++  +LLK+ GI  V++Y+++EVQKVYRLQG+EI DK+IE+IIRQ+  KV+++D G++    G++ID+  F +EN+K I    + PAT    + G+ +A   T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G LIP GTG
  S:     3 KLKNFEAIKIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRVKYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVAHIWYVKGIP--SRMGLLLDMSPRALEKVLYFVSYVVIDPGDTPLTK----KQLL------SEKEYREYLEKY--------------------------------------------------GNRFRAGMGAEAIKELLQEIDLEKLSKELRAEIKESTGQKRVRA---IRRLEVVQAFIDSGNRPEWMILEVLPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKVYQCGLPKEMALELFKPFVMKRLVDKG---------LAQHIKSAKRMVERVRPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIKLHPLVCPAYNADFDGDQMAVHIPLSMEAQAEARFLMLAANNILKPQDGKPVMTPTQDMVLGCYYLTADEDGVPGEGKYFSSPEEALMAYQLGYIHIHAKIKVKMTREINGE-KKSKVIETTVGKIIFNEAIPQDLGFVDRNNPETAFNLEINDLVD-------------------KSKLGKILDRVYRIHGPTK---TAETLDKIKELGFKYSTKAAITISVSDMVIPKEKEKLLKEADEMVAKIEAQFRRGLISEEERYEKVIETWNMTTEKVTEALMATLDK----FNPIFMMAHSGARGSKNQIRQLAGMRGLMADPSG-----------RIIELPIRSNFREGLNVLEFFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREEDCGTDEGIYVEEIRE--GNEIIEKLSDRIIGRIAAEDIVDSEG-NVIVRRNEMINEEEAEKIDKAGITRVKIRSPLTCRSRHGVCRMCYGRDLATGELVNIGEAVGIIAAQAIGEPGTQLTMRTFHTGGV-AGVDITQGLPRVEELFEARKPKGL--AVITEISG-VVRINESKKRREITVVDEENNI-SKTYLIPYGSRLKVRDGQWVQAGDELTEGSVNPHDLLKIKGIYAVQSYLLQEVQKVYRLQGVEINDKHIEIIIRQMMKKVKVEDPGDTSMLPGELIDMFKFEEENKKAIEKGLR-PATGRRALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKVDPLIGLKENVIIGKLIPAGTG 1151
>gi|104773536|ref|YP_618516.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|122984011|sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|103422617|emb|CAI97222.1| DNA-directed RNA polymerase beta' chain [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (1221 aa)
Score = 2780, Expect = 0.0e+00, Identities = 569/1264 (45%), Positives = 825/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQF---PKDGILITTVGKVILNDVLPEEMSYLNNP--DNLEE-LSDNDIVEWGKDYRTFIE---KKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KDY CACGKYK ++++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLD+S K++E+V+YF  YIV+D G+          E   L ++   +E ++K        Y +  V      AI+        D L + ++   +  +   + +  G +      AI  L           DI +  R S N                        KPEWM+++ + V PPD RP++QLEGG+F TSD+N  YR++I RN RLK+++  +AP +I+ NE+R+LQEAVDAL DN  R +P++G   RPLKS+S  LKGKQG FRQNLLGKRVDYSGRSVI + PELK YQ G+P  M L+LF+PF++ EL+++          I SNIK+A++ I  +D+ IW ++  VIK+RPVLLNRAPTLHRL IQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+HVPLS EAVAE+R ++LA+ HIL PKDG PI+TP+QD+VLGNY+LT  ++   G+GM+FA  +E    Y    +H H+IIG+  ++ PKK +    +D + +TT G+++ N + P++  Y+N P  DNL++ ++D   +E G+D +  I    +  V   F K  L + ++ ++++Y    ++     +D +K++G+  ST S  TI   D+PE   K+    E  K+V+++ K +++G L+D ER+  ++  W+   + V ++I +   +     N I +M  SGARGNISNFTQL+GMRGLM+               +  E+P+ ++F EGLTV E F S++GARKGMTDTA+KT++SGY+TR+LVD  QDVI+  +DC T +G   + I D  +G +IESL +RL+ RF    +  P++ +V+   G ++ + +A +IVDAG+ +V++RS+L C   +GIC+KC+G +L T + VE   A+G +AAQSIGEPGTQLT+RTFHTGGV+   +I QG  R+++LF+   PK   +++ISE++G V  I+++    ++  +T+K   ++  Y +P+ ++  V+EGD++  G K+  GSID KEL+KV        YI+ EVQK YR QG+++ADK+ EV+ RQ+  KV++ D G +D   G+++DI  FR  N  +I+S   +PATA   I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDYACACGKYKGVRYKGIVCDRCGVEVTTSHVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDVSPKQLEEVIYFAAYIVIDPGDTGL-------EAKQLLTEAEYREEKAK--------YGNRFVAKMGAEAIR--------DLLKQVDLDKEVTALKAELQTLKGQK---RTRAIRRL-----------DILDAFRNSGN------------------------KPEWMVMETVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKKLLDMHAPGLIVQNEERMLQEAVDALIDNGRRGRPVVGPGNRPLKSISHMLKGKQGRFRQNLLGKRVDYSGRSVIDVSPELKFYQCGVPRPMALELFRPFVMRELVRRG---------IASNIKNAKRKIDREDDDIWDVLEYVIKERPVLLNRAPTLHRLSIQAFEPVLVPGKALRLHPLACEAYNADFDGDQMAIHVPLSDEAVAESRLLMLAAHHILTPKDGTPIVTPSQDIVLGNYWLTQAEIGREGEGMIFATPEEATIAYNNGDIHYHTIIGVSAASMPKKDWGAGHEDSVFVTTYGRLVFNSLFPDDYFYINEPTQDNLKQPMADKYFLEDGQDIQDKIAEIGQDLVATPFKKGFLGDTISEIYKRY---RVQRTSEYLDDLKEMGYSASTISGLTIGMADIPETKTKDALVAEARKQVKQVSKMFRRGKLSDKERHDNIIKIWTDCKDAVQQEIAEFKDQ----KNPISVMQQSGARGNISNFTQLAGMRGLMATPSG-----------ELFEIPVISNFKEGLTVLELFMSTHGARKGMTDTALKTAQSGYLTRRLVDVAQDVIIREDDCGTDRGITAKAIVDKDAG-LIESLYDRLVGRFTNRTIRDPQTGEVICSKGVLMDEQMAQKIVDAGVQEVQIRSILTCNTSHGICRKCYGRNLATAEEVEIGEAVGTVAAQSIGEPGTQLTLRTFHTGGVAGAEDITQGLPRVQELFEARNPKG--RAVISEVDGVVDKIESNAAE-HLQEITVKGKIDTRVYTIPYTAKPAVQEGDEIHRGDKLIPGSIDPKELIKVTDTLTTEEYILAEVQKSYRTQGVDLADKHAEVLTRQMLQKVRVLDPGETDILPGEVMDIAEFRDRNRDVIISGG-IPATAQAYILGITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGLKENVIIGKIIPAGTG 1182
>gi|116513533|ref|YP_812439.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275697|sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116092848|gb|ABJ58001.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (1221 aa)
Score = 2779, Expect = 0.0e+00, Identities = 571/1264 (45%), Positives = 825/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQF---PKDGILITTVGKVILNDVLPEEMSYLNNP--DNLEE-LSDNDIVEWGKDYRTFIE---KKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KDY CACGKYK ++++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLD+S K++E+V+YF  YIV+D G+          E   L ++   +E ++K        Y +  V      AI+        D L + ++   +  +   + +  G +      AI  L           DI +  R S N                        KPEWM+++ + V PPD RP++QLEGG+F TSD+N  YR++I RN RLK+++  +AP +I+ NE+R+LQEAVDAL DN  R +P++G   RPLKS+S  LKGKQG FRQNLLGKRVDYSGRSVI + PELK YQ G+P  M L+LFKPF++ EL+++          I SNIK+A++ I  +D+ IW ++  VIK+RPVLLNRAPTLHRL IQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+HVPLS EAVAE+R ++LA+ HIL PKDG PI+TP+QD+VLGNY+LT  ++   G+GM+FA  +E    Y    +H H+IIG+  ++ PKK +    +D I +TT G+++ N + P++  Y+N P  DNL++ ++D   +E G+D +  I    +  V   F K  L + ++ ++++Y    ++     +D +K++G+  ST S  TI   D+PE   K+    E  K+V+++ K +++G L+D ER+  ++  W+   + V ++I +   +     N I +M  SGARGNISNFTQL+GMRGLM+               +  E+P+ ++F EGLTV E F S++GARKGMTDTA+KT++SGY+TR+LVD  QDVI+  +DC T +G   + I D  +G +IESL +RL+ RF    +  P++ +V+   G ++ + +A +IVDAG+ +V++RS+L C   +GIC+KC+G +L T + VE   A+G +AAQSIGEPGTQLT+RTFHTGGV+   +I QG  R+++LF+   PK   +++ISE++G V  I+++    ++  +T+K   ++  Y +P+ ++  V+EGD++  G K+  GSID KEL+KV        YI+ EVQK YR QG+++ADK+ EV+ RQ+  KV++ D G +D   G+++DI  FR  N  +I+S   +PATA   I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDYACACGKYKGVRYKGIVCDRCGVEVTTSHVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDVSPKQLEEVIYFAAYIVIDPGDTGL-------EAKQLLTEAEYREEKAK--------YGNRFVAKMGAEAIR--------DLLKQVDLDKEVTALKAELQTLKGQK---RTRAIRRL-----------DILDAFRNSGN------------------------KPEWMVMETVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKKLLDMHAPGLIVQNEERMLQEAVDALIDNGRRGRPVVGPGNRPLKSISHMLKGKQGRFRQNLLGKRVDYSGRSVIDVSPELKFYQCGVPRPMALELFKPFVMRELVRRG---------IASNIKNAKRKIDREDDDIWDVLEYVIKERPVLLNRAPTLHRLSIQAFEPVLVPGKALRLHPLACEAYNADFDGDQMAIHVPLSDEAVAESRLLMLAAHHILTPKDGTPIVTPSQDIVLGNYWLTQAEIGREGEGMIFATPEEATIAYNNGDIHYHTIIGVSAASMPKKDWGAGHEDSIFVTTYGRLVFNSLFPDDYFYINEPTQDNLKQPMADKYFLEDGQDIQDKIAEIGQDLVATPFKKGFLGDTISEIYKRY---RVQRTSEYLDDLKEMGYSASTISGLTIGMADIPETKTKDALVAEARKQVKQVSKMFRRGKLSDKERHDNIIKIWTDCKDAVQQEIAEFKDQ----KNPISVMQQSGARGNISNFTQLAGMRGLMATPSG-----------ELFEIPVISNFKEGLTVLELFMSTHGARKGMTDTALKTAQSGYLTRRLVDVAQDVIIREDDCGTDRGITAKAIVDKDAG-LIESLYDRLVGRFTNRTIRDPQTGEVICSKGVLMDEQMAQKIVDAGVQEVQIRSILTCNTSHGICRKCYGRNLATAEEVEIGEAVGTVAAQSIGEPGTQLTLRTFHTGGVAGAEDITQGLPRVQELFEARNPKG--RAVISEVDGVVDKIESNAAE-HLQEITVKGKIDTRVYTIPYTAKPAVQEGDEIHRGDKLIPGSIDPKELIKVTDTLTTEEYILAEVQKSYRTQGVDLADKHAEVLTRQVLQKVRVLDPGETDILPGEVMDIAEFRDRNRDVIISGG-IPATAQAYILGITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGLKENVIIGKIIPAGTG 1182
>gi|167629460|ref|YP_001679959.1| DNA-directed RNA polymerase subunit beta' [Heliobacterium modesticaldum Ice1] >gi|167592200|gb|ABZ83948.1| DNA-directed RNA polymerase, beta' subunit [Heliobacterium modesticaldum Ice1] (1180 aa)
Score = 2775, Expect = 0.0e+00, Identities = 576/1266 (45%), Positives = 832/1266 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSA-------FPK---KQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDK-------VEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++IGLASP+ IR+WS+GEV K ETINY++LKPE+DGLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YFV YIV+++G+    K         L ++   +E R K     R                                                    G+GAEAI ELL  +DL++  +++ ++L++      ++    +RRLE ++  K+S N+PEWMI+  I V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK++Q G+P  M L+LFKPF++ +L+         +D    NIKSA++++    N +W ++  VI + PVLLNRAPTLHRLGIQAFEP+LVEG+A+++HPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L++ +IL PKDG+P+ TPTQDMV+G+YYLT+E+    G+ M+FA+ DE    Y  K VH+ + I +  +A       F K   + F + G L+TTVG++I N V+P ++ Y+N                              +   KK L    NI+ R Y    +    + +D IK +G+ +ST++  T+   DV    EK +   E D  VE++++ Y++GL+T++ERY+KV+  W+  T+ V++ + + + K     N + +MANSGARGNI    QL+GMRGLM+                 I++PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV   DC T +G  +E I D K   VIE L++RL  R+ + ++V P++ + LA   E I +A A E +D  I +       V +RSVL C+   G+C++C+G +L T + VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +II+E +G V  I  +    +I +VT  +  ES +Y +P++S L+VE+G +V+ G+++TEGS++  ++L+V GI+ V+ Y+++EVQ+VYRLQG++I DK+IEV++RQ+  KV++++ G++D   G +IDI  F  EN K I +  + PATA  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG     +I
  S:    10 MRIGLASPDLIRQWSSGEVKKPETINYRTLKPERDGLFCERIFGPTRDWECHCGKYKRVRYKGIVCDRCGVEVTRSKVRRERLGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRSLEKVLYFVAYIVIEQGDTPLMKK-------QLLTETEYREHREKYGNRFRA---------------------------------------------------GMGAEAIKELLVEMDLEQLCRELRQELKEVTGQRKVRA---IRRLEVVEAFKNSGNRPEWMIMDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKEMALELFKPFVMKKLV---------EDGHAHNIKSAKRMVERVKNEVWDVLEDVIAEHPVLLNRAPTLHRLGIQAFEPVLVEGRALQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARNLMLSAHNILNPKDGRPVATPTQDMVIGSYYLTIEREGAKGENMIFASPDEAIAAYDAKSVHLQARIRVRPTARLQEALEFAKSEARSFDEQGRLMTTVGRLIFNSVIPPKVGYVN------------------------------EVVGKKQLG---NIVARCYDKLGISETAAMLDGIKKLGYTFSTRAGITVGITDVEVPEEKRRLIAEADSFVEKVEQQYRRGLITEEERYQKVIDIWNKTTDGVTQALMRTLDK----FNPVYMMANSGARGNIQQIRQLAGMRGLMADPSG-----------RIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREIDCGTHEGIPVEAIVDGK--QVIEKLSDRLTGRYALEEIVDPETGEKLAAYNEEI-QADAAERIDQLIKQGKLAHNAVYIRSVLTCRTRYGVCRRCYGRNLATGRSVEIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKGL--AIIAEQDGIV-RIVDNKGRKDIEIVT--DDGESHHYAIPYNSRLKVEDGQRVQAGTELTEGSVNPHDMLRVKGIQGVQTYLLREVQRVYRLQGVDINDKHIEVMVRQMMRKVKVEEPGDTDLLPGGLIDIADFEAENLKAIEAGLE-PATARPILLGITKASLATDSFLSAASFQETTRVLTEAAIKGKVDPLLGLKENVIIGKLIPAGTGMSRYRNI 1162
>gi|164686521|ref|ZP_02210549.1| hypothetical protein CLOBAR_00088 [Clostridium bartlettii DSM 16795] >gi|164604390|gb|EDQ97855.1| hypothetical protein CLOBAR_00088 [Clostridium bartlettii DSM 16795] (1164 aa)
Score = 2772, Expect = 0.0e+00, Identities = 587/1270 (46%), Positives = 836/1270 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTME-KLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           SI+IGLASPE+IREWS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKY++++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+++YF +Y+V+D G        N K+++      + KE RS         YE              K   TF                            G+GAEA+ +LL  IDL++E K + + L+ S     ++T   +RRLE ++  K S NKPEWMIL+ I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK YQ GIP  M L+LFKPF++ +L+K    EG        NIKSA+ L+      +W ++ +VIK  PVLLNRAPTLHRLGIQAFEP+LVEGKAIRLHPL  TA+NADFDGDQMAVHVPLS EA AEAR ++L+  +IL PKDG PI TP+QDMVLG YYLT+E +    G G +F + +EL   YQ K V +HS + +        +  + GI  +TVG+ I N+ +P+++ ++N  ++   L  N +V+                   KK L +I++   R++ +    I    +D IK +GF+YST    T++  D+     K+   ++ + +VE+ +K +++GL++D+ERY+KV+  W+  T +V+ ++   +++     N+I IMA+SGARG+ +   QL+GMRGLM+ +              T+E+P+K++F EGL+V EYF SS+GARKG+ DTA++T+ SGY+TR+LVD +QDVIV + DC T + T  E+   T     IE L +R++ R+ I  ++HP++ +VL  A  +I +  A  I++AGI++V +R+VL+CK  +G+C KC+G +L T K V    A+G+IAAQSIGEPGTQLTMRTFHTGGV+ G +I QG  R+++LF+   PK    +IISEI G+V  I  +     ++V+  +  +E   Y++P+ S +RV++G  V+ G  +T+GSI+  ++++V GI  V+ YI+KEVQ+VYRLQG++I DK+IEVI+RQ+ +KV+++D G++D   G   D+ TF++ NE+   S    PA A  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG+ D L GLKENVI G LIP GTG K   +I  E
  S:     9 SIKIGLASPERIREWSRGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYRRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPMSHIWYFKGIP--SRMGLLLDMSPRSLEKILYFASYVVIDPGE----TGLNEKQLL------TEKEFRSN--------YE--------------KYGNTF--------------------------EVGMGAEAVKKLLMRIDLEQESKLLRDDLKDSTGQKRVRT---IRRLEVVEAFKKSGNKPEWMILEAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPDLKFYQCGIPRKMALELFKPFVMDKLVK----EG-----YAHNIKSAKSLVEKVKPEVWDVLEEVIKSHPVLLNRAPTLHRLGIQAFEPVLVEGKAIRLHPLACTAYNADFDGDQMAVHVPLSVEAQAEARFLMLSVNNILAPKDGSPITTPSQDMVLGCYYLTIESQGGEKGTGTVFKDFNELMMAYQTKAVELHSTVKMRIVL----EDGRVGITESTVGRFIFNENIPQDLGFVNREEDPFGLEINYLVD-------------------KKALGKIIDKCFRRHGNT---ITAEVLDHIKSLGFKYSTIGGITVAVADMKIPETKKDLIKDAEVQVEKYEKVFRRGLISDEERYEKVIDTWTKTTEKVTDELMNGLER----MNNIYIMAHSGARGSKNQIRQLAGMRGLMANASG-----------KTVEIPVKSNFREGLSVMEYFTSSHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRDFDCGTTETT--EIFAITDGSEAIEDLYDRIVGRYTIDAILHPETGEVLVEADTMIQEDDAEAIINAGIERVNIRTVLNCKTHHGVCSKCYGRNLATGKEVHIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGG-DITQGLPRVEELFEARKPKGL--AIISEITGRV-EIDETGKRKEVIVIPKEGEREV--YQIPYGSRIRVKQGQLVEAGDPLTQGSINPHDIVRVKGIGGVQEYIVKEVQRVYRLQGVDINDKHIEVIVRQMLSKVKVEDPGDTDLLPGGYEDVLTFQECNEE-AESKGLRPAIAKRVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKEDHLIGLKENVILGKLIPAGTGMKKYRNIAVE 1157
>gi|89893210|ref|YP_516697.1| DNA-directed RNA polymerase subunit beta' [Desulfitobacterium hafniense Y51] >gi|89332658|dbj|BAE82253.1| hypothetical protein [Desulfitobacterium hafniense Y51] (1161 aa)
Score = 2770, Expect = 0.0e+00, Identities = 579/1259 (45%), Positives = 825/1259 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSG-SVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVS--SIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP  IREWS+GEV K ETINY++LKPE++GLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YFV+YIV D G              D S  K    T ++ R+  R+ Y S   +ASM                                          GAEAI  LL+ +DLDK   ++  +L++      I+    +RRLE ++  K+S N+PEWMI+  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP L+++Q G+P  M L+LFKPF++ +L+K    EG+       NIKSA++++    + +W ++ +VI + PVLLNRAPTLHRLGIQAFEP+LVEG+A+++HPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L++ +IL PKDG+P+ +PTQDMVLG+YYLTME+    G+G +F N DE    Y  K+ ++ ++I        K + P   +L TT+G++I N V+P E+ Y+N                              +   KK L+   NI+ + Y     +     +D IK +GF+YST++  T+   D+    EK +   + D  V + ++ +++GL+TD+ERY+KV+  W+  T+ V+K +   + K     N + +MA SGARGNI    QL+GMRGLM+                TIE+PIK +F EGLTV EYF SS+GARKG+ DTA++T+ SGY+TR+LVD +QDVIV +EDC T +G +   ++D K G  VIE L ERL+ RF + D+ HP++ ++LA A   IT+  A++I +   DKV +RSVL CK   G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++IISE +G V+   +K   +     V  I +++E + Y +P+ S L+V EG +++ G ++TEGSI+  ++LKV GI  V+ Y++ EVQ+VYRLQG++I DK+IEV++RQ+  KV+++++G++    G +ID+  F +EN K+I +  + PA A  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG
  S:    16 MRIGLASPTMIREWSHGEVRKPETINYRTLKPEREGLFCEKIFGPTRDWECHCGKYKRVRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLLLDMSPRSLEKVLYFVSYIVTDAG--------------DTSLMKKQLLTETEYRE-YRDKYGS-RFKASM------------------------------------------GAEAIKMLLEEMDLDKLNDELRVELKEVSGQRKIRA---IRRLEVVEAFKESGNRPEWMIMDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLRLHQCGLPKEMALELFKPFVMKKLVK----EGHAH-----NIKSAKRMVERVRSEVWDVLEEVITEHPVLLNRAPTLHRLGIQAFEPVLVEGRALQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLSAHNILNPKDGRPVASPTQDMVLGSYYLTMERPGALGEGKIFKNRDEAVLAYDTKQANLQAMI--------KVRQPNGELLETTIGRLIFNSVIPPEVGYIN------------------------------EVAGKKALN---NIVAKCYRLGGYKATAQLLDGIKSLGFKYSTRAGMTVGLADITVPEEKRQILADADGMVNKTEQQFRRGLITDEERYEKVIDIWTKATDTVTKALMHSLDK----FNPVYMMATSGARGNIQQLRQLAGMRGLMADPSG-----------RTIELPIKANFREGLTVLEYFISSHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRDEDCGTTQGIM---VDDVKDGPEVIEKLEERLVGRFLLEDLKHPETGEILATADNEITEEQAHDIAEV-YDKVTIRSVLTCKTRYGVCRKCYGRNLATGHHVEMGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKG--QAIISENDGVVAIREVKGRRE-----VDVISDTEERMTYTIPYGSRLKVREGHRIEAGDELTEGSINPHDMLKVKGIRGVQVYLLGEVQRVYRLQGVDINDKHIEVMVRQMLRKVKVEEAGDTTLLPGGLIDVFDFEEENTKVIAAGGE-PAVARPVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKVDPLLGLKENVIIGKLIPAGTG 1136
>gi|109647476|ref|ZP_01371379.1| DNA-directed RNA polymerase, beta' subunit [Desulfitobacterium hafniense DCB-2] >gi|109640566|gb|EAT50121.1| DNA-directed RNA polymerase, beta' subunit [Desulfitobacterium hafniense DCB-2] (1155 aa)
Score = 2766, Expect = 0.0e+00, Identities = 579/1259 (45%), Positives = 824/1259 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSG-SVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVS--SIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP  IREWS+GEV K ETINY++LKPE++GLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YFV+YIV D G              D S  K    T ++ R+  R+ Y S   +ASM                                          GAEAI  LL+ +DLDK   ++  +L++      I+    +RRLE ++  K+S N+PEWMI+  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP L+++Q G+P  M L+LFKPF++ +L+K    EG+       NIKSA++++    + +W ++ +VI + PVLLNRAPTLHRLGIQAFEP+LVEG+A+++HPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L++ +IL PKDG+P+ +PTQDMVLG+YYLTME+    G+G +F N DE    Y  K+ ++ ++I        K + P   +L TT+G++I N V+P E+ Y+N                              +   KK L+   NI+ + Y     +     +D IK +GF+YST++  T+   D+    EK +   + D  V + ++ +++GL+TD+ERY+KV+  W+  T+ V+K +   + K     N + +MA SGARGNI    QL+GMRGLM+                TIE+PIK +F EGLTV EYF SS+GARKG+ DTA++T+ SGY+TR+LVD +QDVIV +EDC T +G +   ++D K G  VIE L ERL+ RF + D+ HP++ ++LA A   IT+  A++I  A  D V +RSVL CK   G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++IISE +G V+   +K   +     V  I +++E + Y +P+ S L+V EG +++ G ++TEGSI+  ++LKV GI  V+ Y++ EVQ+VYRLQG++I DK+IEV++RQ+  KV+++++G++    G +ID+  F +EN K+I +  + PA A  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG
  S:    10 MRIGLASPTMIREWSHGEVRKPETINYRTLKPEREGLFCEKIFGPTRDWECHCGKYKRVRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLLLDMSPRSLEKVLYFVSYIVTDAG--------------DTSLMKKQLLTETEYRE-YRDKYGS-RFKASM------------------------------------------GAEAIKMLLEEMDLDKLNDELRVELKEVSGQRKIRA---IRRLEVVEAFKESGNRPEWMIMDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLRLHQCGLPKEMALELFKPFVMKKLVK----EGHAH-----NIKSAKRMVERVRSEVWDVLEEVITEHPVLLNRAPTLHRLGIQAFEPVLVEGRALQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLSAHNILNPKDGRPVASPTQDMVLGSYYLTMERPGALGEGKIFKNRDEAVLAYDTKQANLQAMI--------KVRQPNGELLETTIGRLIFNSVIPPEVGYIN------------------------------EVAGKKALN---NIVAKCYRLGGYKATAQLLDGIKSLGFKYSTRAGMTVGLADITVPEEKRQILADADGMVNKTEQQFRRGLITDEERYEKVIEIWTKATDTVTKALMHSLDK----FNPVYMMATSGARGNIQQLRQLAGMRGLMADPSG-----------RTIELPIKANFREGLTVLEYFISSHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRDEDCGTTQGIM---VDDVKDGPEVIEKLEERLVGRFLLEDLKHPETGEILATADNEITEEQAHDIA-AVYDNVTIRSVLTCKTRYGVCRKCYGRNLATGHHVEMGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKG--QAIISENDGVVAIREVKGRRE-----VDVISDTEERMTYTIPYGSRLKVREGHRIEAGDELTEGSINPHDMLKVKGIRGVQVYLLGEVQRVYRLQGVDINDKHIEVMVRQMLRKVKVEEAGDTTLLPGGLIDVFDFEEENTKVIAAGGE-PAVARPVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKVDPLLGLKENVIIGKLIPAGTG 1130
>gi|167036794|ref|YP_001664372.1| DNA-directed RNA polymerase subunit beta' [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855628|gb|ABY94036.1| DNA-directed RNA polymerase, beta' subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] (1184 aa)
Score = 2765, Expect = 0.0e+00, Identities = 593/1276 (46%), Positives = 843/1276 (66%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG--KKSNEDIIEEGNKMYE 1285
           +I+IGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP+AHIW  K +P  S++ L+LD+S + +E+V+YFV+Y+V+D G+    K    K+++      S KE R  L K                                                   G RF  G+GAEAI ELL+ IDL+K  K++  ++R+S     ++    +RRLE ++   DS N+PEWMIL  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M L+LFKPF++ +L+    DEG     +  +IKSA++++      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P+DGKP++TPTQDMVLG YYLT ++  +PG+G  F++ +E    YQ+  +H+H+ I +  +        K  I+ TTVGK+I N+ +P+++ Y++  NP+   +L  ND+V+                   K  L +I++ ++R +          T+DKIK++GF YSTK+A T+S  D+    EKEK  +E D+ V +++  +++GL++++ERY+ V+  W+  T +V++ +   + K     N I +MA+SGARG+ +   QL+GMRGLM+                 IE+PI+++F EGL V E+F S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  +DC   +G  +E I +     +IE L +R+I R    DV+  +   ++    E+I +  A +I  AGI KV +RS+L CK  +G+C+ C+G DL T +LV    A+G+IAAQ+IGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    ++ISEI G V  I  S     + +VT + +  S  Y +P+ S L+V +G  ++ G ++TEGS++  +LLK+ GI  V+ Y+++EVQKVYRLQG+EI DK+IEVIIRQ+  KV+++D G++    G++ID+  F  EN+K I    + PAT    + G+ +A   T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G LIP GTG  +  N  ++++ N   E
  S:     9 AIKIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVAHIWYVKGIP--SRMGLLLDMSPRALEKVLYFVSYVVIDPGDTPLTK----KQLL------SEKEYRDYLDKY--------------------------------------------------GNRFRAGMGAEAIKELLQEIDLEKLSKELRAEIRESTGQKRVRA---IRRLEVVQAFIDSGNRPEWMILDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKVYQCGLPKEMALELFKPFVMKKLV----DEG-----LAQHIKSAKRMVEKVKPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSMEAQAEARFLMLAANNILKPQDGKPVMTPTQDMVLGCYYLTADEEGVPGEGKYFSSPEEAIMAYQLGYIHIHAKIKVKMTK-EIDGVKKSKIIETTVGKIIFNEAIPQDLGYVDRTNPETAFDLEINDLVD-------------------KSKLGKILDRVYRLHGPTK---TAETLDKIKELGFRYSTKAAITVSVSDMVIPKEKEKLLKEADEMVSKIESQFRRGLISEEERYESVIRTWNMTTEKVTEALMASLDK----FNPIFMMAHSGARGSKNQIRQLAGMRGLMADPSG-----------RIIELPIRSNFREGLNVLEFFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREDDCGADEGIYVEEIRE--GNEIIEKLADRIIGRVAAEDVIDNEG-NIIVRRNELINEEEAEKIEKAGITKVRIRSLLTCKSRHGVCRMCYGRDLATGELVNIGEAVGIIAAQAIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AVISEISG-VVRINESKKRREV-IVTDEENNISKTYLIPYGSRLKVHDGQVIQAGDELTEGSVNPHDLLKIKGIFAVQTYLLQEVQKVYRLQGVEINDKHIEVIIRQMMRKVKVEDPGDTSMLPGELIDMFKFEDENKKAIEKGLR-PATGRRALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKVDPLLGLKENVIIGKLIPAGTGLSRYRNISVVKKVNDQQE 1169
>gi|161506867|ref|YP_001576821.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus helveticus DPC 4571] >gi|172048362|sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|160347856|gb|ABX26530.1| DNA-directed RNA polymerase, beta prime subunit [Lactobacillus helveticus DPC 4571] (1217 aa)
Score = 2764, Expect = 0.0e+00, Identities = 574/1264 (45%), Positives = 825/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLR---KTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEE-LSDNDIVEWGKDYRTFIEK---KKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KD+ CACGKYK +++RG +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLDIS K +E+V+YF  YIV+D G+          E  +   QK+    R + +   + +RE+ + +D++  +++  K                          + + TG +      AI  L           DI +  + S N  +              W+          ++  + V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP+II+ NEKR+LQEAVDAL DN  R +P++G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI + P+LK YQ G+P  M L+LFKPF++HEL+K+          I SNIK+A++ I ++D+ IW ++  VIK+RPVLLNRAPTLHRL IQAFEP+LV GK+IRLHPL   A+NADFDGDQMA+HVPLS EAVAE+R ++LA+ HIL PKDGKPI+TP+QD+VLGNY+LT  +    G+GM+F++  E    Y+   +H H+IIG+   A PKK +P+    GI ITT GK++ N + P++  Y+N P  +NL   L     +  G+D    I++     +   F    LS+ +  +++ Y    ++     +D +K +G+  ST S  TI   DVPE  +K++   +  K+V+ + K +++GL+T+ ER+ +V+S W++  +++  +I + I  P    N I IMA+SGARGNISNFTQL+GMRGLM+                  E+P+ ++F EGL+V E F S++GARKGMTDTA+KT++SGY+TR+LVD  QDVI+ ++DC T +G  +  I   +   +IE L +RL+ RF    V  PK+ + +     ++ + +A++I DAG+  V++RS+L C   +G+C+KC+G +L T + VE   A+G +AAQSIGEPGTQLT+RTFH GGV+   +I QG  R+++LF+   PK   ++ ISE++G + SI+ +P + +   +T+K   ++ +Y VP+ + + V EGD V  G K+T GS+D KEL++V        YI+ EVQK YR+QG++IADK++EV+ RQ+  KV++ D G +D   G+++DI  FR  N+++I+S   +PATA ++I G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDWSCACGKYKGVRYRGIVCDRCGVEVTSSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDISPKLLEEVIYFAAYIVIDPGDTDLEPKQLLTEA-EYREQKAKYGNRFEAKMGAEAIRELLKKVDLDKEVKDLKKE-------------------------LQTATGQK---RTRAIRRL-----------DILDTFKNSGNKPE--------------WM----------VMDAVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPNIIVQNEKRMLQEAVDALIDNGRRGRPVVGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVSPKLKFYQCGVPRPMALELFKPFVMHELVKRG---------IASNIKNAKRKIDSEDDDIWDVLEDVIKERPVLLNRAPTLHRLSIQAFEPVLVPGKSIRLHPLACEAYNADFDGDQMAIHVPLSDEAVAESRLLMLAAHHILAPKDGKPIVTPSQDIVLGNYWLTQAERGREGEGMIFSSPAEATVAYENGDIHYHTIIGMSADAMPKKPWPQGHEHGIFITTYGKLVFNQLFPDDYFYINEPTEENLNNPLDAKYFLGEGQDIHDKIDEVGDDLIATPFKSSFLSDSIATIYKYY---KVQRTSEYLDDLKKLGYTSSTTSGITIGMNDVPEIKDKDEKVAKARKQVDIVSKQFRRGLITEQERHDRVISIWNACKDEIQNEIAQ-IHSPR---NPISIMADSGARGNISNFTQLAGMRGLMATPNG-----------GLFEIPVTSNFKEGLSVLELFMSTHGARKGMTDTALKTAQSGYLTRRLVDVAQDVIIRDDDCGTDRGITVSAI--MEGDEMIEPLFDRLVGRFTAETVKDPKTGEAIVGRDVMMDENMAHKICDAGVTHVKIRSILTCDTPHGVCRKCYGMNLATGEEVEVGEAVGTVAAQSIGEPGTQLTLRTFHNGGVAGAEDITQGLPRVQELFEARNPKG--RATISEVDGVIDSIQENPAD-HTREITVKGKIDTRSYSVPYTASVAVSEGDYVHRGDKLTLGSVDPKELIQVTDTLTTEKYILAEVQKAYRMQGVDIADKHVEVLTRQMLQKVRVLDPGETDILPGEVMDIGQFRDRNKEVIISGG-IPATAQSVILGITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGLKENVIIGKIIPAGTG 1181
>gi|167013712|ref|ZP_02276245.1| DNA-directed RNA polymerase subunit beta' [Listeria monocytogenes FSL J1-194] (1147 aa)
Score = 2764, Expect = 0.0e+00, Identities = 564/1224 (46%), Positives = 817/1224 (66%)
  Q:    56 VKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           +KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V+  W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:     1 MKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIGVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1136
>gi|168178825|ref|ZP_02613489.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum NCTC 2916] >gi|182670098|gb|EDT82074.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum NCTC 2916] (1178 aa)
Score = 2763, Expect = 0.0e+00, Identities = 583/1260 (46%), Positives = 830/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET   L+K L   +E  ESID                                      SF      +GAEA+  LL  IDL++   ++ E+L+ S     I+   ++RRLE ++  + S N+P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         ++ +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K  + G+G +F+  +E+   YQ K V +H+ I +        +   +GI+ TT GK+I N+ +P+++ Y++   P+N  +L  + +V                   +KKTL  I+N  + K+      I+   +DKIK  G+ YST  A TIS  D+     K +  + T+K+VE+++K Y++G ++++ERY+KV+  W+  T  V+  +   +       N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T++G   EV E  +   VIE L ERL  R+P  D++HP + +++      + + +A ++ DAGI KV++RSV  CK ++G+C +C+G ++ T++ +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  ++ +     I+VVT  +  E ++Y +PF S ++V+ GD +  G +ITEGSI+  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I+DSG+++   G +ID+  F + N + IL     PA     + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKET-PLLKKQLLNEKEYRESIDKYGD---------------------------------DSFVA---AMGAEAVKTLLDEIDLEQSSIELKEELKTSTGQKKIR---IIRRLEVVESFRKSGNRPDWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QNGLAHNIKSAKRMVERVQPQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAHNILKPSDGKPVSVPTQDMVLGSYYLTMDKDGVKGEGKVFSCPEEVLMAYQCKAVDIHAKIKVRLKKVIDGE-TIEGIIETTPGKIIFNESIPQDLGYIDRTIPENKLKLEVDFLV-------------------SKKTLGGIINRCYMKHGATKTSIM---LDKIKAKGYHYSTIGAITISTSDMVVPEAKRELLQNTEKQVEKIQKMYRRGFISEEERYEKVIDLWTKTTEDVANALMASLDS----FNPIYMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRQEDCGTEEG--YEVSEIKEGNEVIEPLVERLSGRYPSEDIIHPTTGEIIVKRNTYMNEDIAKKVSDAGIKKVKIRSVFTCKSKHGVCARCYGMNMATSQKIHIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVSGTV-KMEETKKKRTIIVVT--DDGEEVSYDIPFGSRIKVKNGDIISAGDEITEGSINPHDILRIKGVDGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEDSGDTELLPGTMIDVFDFEEANRE-ILEKGGEPAVGRIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|188584829|ref|YP_001916374.1| DNA-directed RNA polymerase, beta' subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349516|gb|ACB83786.1| DNA-directed RNA polymerase, beta' subunit [Natranaerobius thermophilus JW/NM-WN-LF] (1218 aa)
Score = 2762, Expect = 0.0e+00, Identities = 579/1260 (45%), Positives = 830/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQF-------PKDG-ILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +++IGLASPE+IR WS GEV K ETINY++LKPEK+GLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+L++S + +E+V+YF +Y+V+D G                       ET    ++ L E                    R +YD           E  F     F  M   +GAEAI ELLK +DL+   K++   L+ ++    ++T   VRRLE  +  + S NKPEWMIL  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R + + G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M L+LFKPF++  L++K          +  NIKSA++++      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+L+EG+AI++HPLV  A+NADFDGDQMAVH+PLS EA AEAR ++LAS +IL PKDG P+ TPTQDMVLG+YYLT+E  +       F++  E    ++ K + +   I +    + KK F       P D  +LITTVGK+I N++ PE+  Y+N       L++ D ++ G+     +++++  +A  K +L ++V   +RKY         S +DK+K++G+ Y+TK+  TI   DV    +K +   + + KV+E++K + +GL+T  ERY +V+  W++  + V+  +   +     + N I +MA SGARGNIS  TQL+GMRGLM+                 I++PIK +F EGLTV EYFNS++GARKG+ DTA+KT+ SGY+TR+LVD +QDVIV  EDC    G  +EV   T    +IE + +R++ RF   D +  +   ++    E+IT+  A +I +A +D+V +RSVL CK +NG+C KC+G DL T  +     A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    ++ISEI+G++ ++K   +   ++V   K  ++S  Y +P+ + L+V++GD++  G +ITEGSI+  +LLK+ G+  V+ YI++EVQKVYR+QG++I+DK+IE+IIRQ+  KV+I+++G+++   G  +D   F K NE+ I  +   PA A +L+ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G L+P GTG
  S:     9 ALKIGLASPEQIRSWSKGEVKKPETINYRTLKPEKEGLFCEKIFGPQKDWECHCGKYKRVRYKGIVCDRCGVEVTQSKVRRERMGHIELAAPVSHIWYFKGIP--SRLGLLLNMSPRALEKVLYFASYVVIDPG-----------------------ETSLAKKQLLTETE-----------------YREYYDKF---------ESQFKKGKGFKAM---MGAEAIKELLKELDLEALTKELRNDLKTAKGQKKVRT---VRRLEVAESFRKSGNKPEWMILDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLNLGAPDIIVRNEKRMLQEAVDALIDNGRRGRAVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMALELFKPFVMKRLVEKE---------LSHNIKSAKRMVEKVRPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIEGRAIQIHPLVCPAYNADFDGDQMAVHLPLSAEAQAEARILMLASQNILNPKDGSPVATPTQDMVLGSYYLTLENTSDFKNDAYFSSPAEAVMAFRQKDIDMQEPIAVDVRNYEKKDFSLPENNKPSDSNLLITTVGKIIFNEIFPEDFPYVNGEK--PGLNEYDWLKSGERIEDKLKQREPREAIQKGSLGDLVGHCYRKYGSTK---TASILDKMKEVGYSYATKAGVTIGITDVAVPEKKHEIISDAEGKVDEVEKQHHRGLITPQERYTRVIDIWNNAKDSVTGAVMDNLD----IFNPIYMMATSGARGNISQITQLAGMRGLMADPTG-----------RIIDLPIKTNFREGLTVLEYFNSTHGARKGLADTALKTADSGYLTRRLVDVSQDVIVREEDCGETDG--VEVGAITNGNEIIEGIGDRVVGRFAAAD-IRDRQGNMIVNRNELITEDAAEQIQEAKLDQVPIRSVLTCKTKNGVCVKCYGRDLATGAVANVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIEELFEARKPKGL--AVISEIDGRI-TVKTEHNKRKVIVTPEKGEQKS--YNIPYGARLKVKDGDEINAGDEITEGSINPHDLLKIKGVRGVQLYILQEVQKVYRMQGVDISDKHIEIIIRQMLKKVRIEEAGDTELLPGSYVDFFDFEKVNER-IKEEGGEPAKAKSLLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKVDPLIGLKENVIIGKLVPAGTG 1180
>gi|18311394|ref|NP_563328.1| DNA-directed RNA polymerase subunit beta' [Clostridium perfringens str. 13] >gi|110799903|ref|YP_697101.1| DNA-directed RNA polymerase subunit beta' [Clostridium perfringens ATCC 13124] >gi|110802145|ref|YP_699670.1| DNA-directed RNA polymerase subunit beta' [Clostridium perfringens SM101] >gi|168208048|ref|ZP_02634053.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens E str. JGS1987] >gi|168211997|ref|ZP_02637622.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens B str. ATCC 3626] >gi|168215382|ref|ZP_02641007.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens CPE str. F4969] >gi|168218308|ref|ZP_02643933.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens NCTC 8239] >gi|182627155|ref|ZP_02954868.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens D str. JGS1721] >gi|123344486|sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|124053361|sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|15186725|dbj|BAB62885.1| RNA polymerase beta' subunit [Clostridium perfringens] >gi|18146078|dbj|BAB82118.1| RNA polymerase beta' subunit [Clostridium perfringens str. 13] >gi|110674550|gb|ABG83537.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens ATCC 13124] >gi|110682646|gb|ABG86016.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens SM101] >gi|170660663|gb|EDT13346.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens E str. JGS1987] >gi|170710075|gb|EDT22257.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens B str. ATCC 3626] >gi|170713244|gb|EDT25426.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens CPE str. F4969] >gi|177907458|gb|EDT70130.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens D str. JGS1721] >gi|182379681|gb|EDT77160.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens NCTC 8239] (1178 aa)
Score = 2762, Expect = 0.0e+00, Identities = 578/1260 (45%), Positives = 831/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPE+IREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+ HIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +YIV+D                        KET S L+K L                +  K  R   D   E +          F++       G+GAEAI  LL  IDL++   ++ E+L++S     ++   ++RRLE ++  K S NKPEWM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         +D +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +I+ P DG+P+  PTQDMVLG+YYLTM+K    G+G  FA+ DE+   YQ+K+V +H+ I +  +     +  K GI+ TT G +I N+ +P+++ ++N  +N EE+ + +I     D+             TKK+L +I++  + K+      I+   +D IK  G+ YS+  A T++A D+    +K +  +E D+ V++++K Y++GL+++DERY++V+  W+  T +V+  +   + K     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV   DC T+ G     +E+ K GS V+E L ERL  R+   DV HP++ ++LA     +   +A +I D GI KV++RSV  C  + G+C KC+G ++ T+  +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  I+ +     + VVT  +S E  +Y +PF S L+V++G  +  G +ITEGS++  +++ + G++  R Y++ EVQKVYRLQG++I DK++EV++RQ+T K+++ + G+++   G +ID+  FR ENE+ + S     A    ++ G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEQIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPIKDWECHCGKYKRVRYKGIVCDRCGVEVTKSKVRRERMAHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYIVID-----------------------PKET-SLLKKQL----------------LNEKEYREACDKYGEES----------FVA-------GMGAEAIKTLLSEIDLERTAAELKEELKQSTGQKKVR---IIRRLEVVESFKSSGNKPEWMVVDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------EDGVAHNIKSAKRMVERVMPQVWDVLEEVIADHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAGNIMKPSDGRPVCVPTQDMVLGSYYLTMDKDGAKGEGKYFASFDEVIMAYQLKEVDIHAKINVKVTKEIDGEL-KSGIIKTTPGFIIFNECIPQDLGFVNR-ENPEEMFNLEI-----DF-----------LITKKSLGKIIDKCYLKHGPTKTSIM---LDNIKATGYHYSSIGAVTVAASDMIVPQKKYELLKEADETVDKIEKMYRRGLISEDERYERVIEKWTETTEEVADTLMNSLDK----FNPIFMMADSGARGSKSQIKQLAGMRGLMASPSG-----------KIIELPIRASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREHDCGTQNGI---YVEEIKEGSEVVEQLAERLTGRYTAEDVFHPETGELLAAKDTYMDPILAEKIADTGIQKVKIRSVFTCDSKVGVCTKCYGMNMATSYKINIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVAGTV-RIEETKKKRTVYVVT--DSGEEYSYDIPFGSRLKVKDGIAIGAGDEITEGSVNPHDIMSIKGVDGAREYLLSEVQKVYRLQGVDINDKHLEVVVRQMTRKIKVTEQGDTNLLPGVMIDMFDFRAENER-VESFGGEKAQGDIVLLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLVGLKENVIIGKLIPAGTG 1152
>gi|168181857|ref|ZP_02616521.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum Bf] >gi|182674760|gb|EDT86721.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum Bf] (1178 aa)
Score = 2762, Expect = 0.0e+00, Identities = 586/1260 (46%), Positives = 831/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET   L+K L   +E  ESID                                      SF      +GAEA+  LL  IDL++   ++ E+L+ S     I+   ++RRLE ++  + S N+P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         ++ +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K  + G+G +F+  +E+   YQ K+V +H+ I +        +   +GI+ TT GK+I N+ +P+++ Y++   P+N  +L  + +V                   +KKTL  I+N  + K+      I+   +DKIK  G+ YST  A TIS  D+     K +  E T+K+VE+++K Y++G ++++ERY+KV+  W+  T  V+  +   +       N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T++G   EV E  +   VIE L ERL  R+P  D++HP + +V+      + + +A ++ DAGI KV++RSV  CK ++G+C +C+G ++ T++ +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  ++ +     I+VVT  +  E ++Y +PF S ++V+ GD +  G +ITEGSI+  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I+DSG+++   G +ID+  F + N K IL     PA     + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKET-PLLKKQLLNEKEYRESIDKYGE---------------------------------GSFVA---AMGAEAVKTLLDEIDLEQTSIELKEELKTSTGQKKIR---IIRRLEVVESFRKSGNRPDWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QNGLAHNIKSAKRMVERVQPQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAHNILKPSDGKPVSVPTQDMVLGSYYLTMDKDGVKGEGKVFSCPEEVLMAYQCKEVDIHAKIKVRLKRVVDGE-TIEGIIETTPGKIIFNESIPQDLGYIDRTIPENKLKLEVDFLV-------------------SKKTLGGIINRCYMKHGATKTSIM---LDKIKAKGYHYSTIGAITISTSDMVVPEAKRELLENTEKQVEKIQKMYRRGFISEEERYEKVIDLWTKTTEDVANALMGSLDS----FNPIYMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRQEDCGTEEG--YEVSEIKEGNEVIEPLVERLSGRYPSEDIIHPTTGEVIVKRNTYMNEDIAKKVSDAGIKKVKIRSVFTCKSKHGVCARCYGMNMATSQKIHIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVSGTV-KMEETKKKRTIIVVT--DDGEEVSYDIPFGSRIKVKNGDIISAGDEITEGSINPHDILRIKGVDGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEDSGDTELLPGTMIDVFDFEEAN-KEILEKGGEPAVGRIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|158319536|ref|YP_001512043.1| DNA-directed RNA polymerase subunit beta' [Alkaliphilus oremlandii OhILAs] >gi|158139735|gb|ABW18047.1| DNA-directed RNA polymerase, beta' subunit [Alkaliphilus oremlandii OhILAs] (1179 aa)
Score = 2760, Expect = 0.0e+00, Identities = 575/1267 (45%), Positives = 836/1267 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           SI+I LASPEKIR+WS GEV K ETINY++LKPEK+GLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF  YIV+D G     +    K+V+                 T +E  E+I+   S                                  SF   + G+GAE++ +LL+NIDL++ YKD+  KL++S     I+T   +RRLE +   K S NKPEWMIL  I V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R KP+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK YQ G+P  M L+LFKPF++ +L+         +D    NIKSA++++      +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP+LVEGKAI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA  +IL PKDG+PI TPTQDM+LG+YYLT+E+  + G+GM+F + DE+   Y  K VH+H+ + +     P+    K  ++ +TVG+ I N+ +P+ + +++   +   L  + + +                   KK L ++++   RK+ +    I+   +D IK  GF YST+ A TI+  D+    EK +     ++KV++ +K +++GL++D+ERY+KV+  WS  T +V++ +   +       N++ IMA+SGARG+ +   QL GMRGLM+ +              T+E+PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVI+   DC +++G+ ++ ++D     VIE L +R++ R+ + +V+HP++ +V+    E+I + +A EI   GI+ V++RS L C+  +G+C  C+G +L T + V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +IISE+ G V  ++         V+      ES  Y +P+ S ++V +G+ V+ G +IT+GS++  ++L++  +  V+NYIIKEVQ+VYRLQG++I DK+IEVI+RQ+ NKV+I+++G+++   G +  I  + +EN + I +  + PA    ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG+ D L GLKENVI G LIP GTG K  ++I
  S:     9 SIKIALASPEKIRQWSKGEVKKPETINYRTLKPEKEGLFCEKIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLLLDMSPRSLEKVLYFAAYIVIDPGETGLTE----KQVL-----------------TEKEYSEAIEKYGS---------------------------------GSF---KAGMGAESVKKLLENIDLEELYKDLRSKLKESTGQKRIRT---IRRLEVVDAFKHSGNKPEWMILDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGKPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKFYQCGLPKKMALELFKPFVMKKLV---------EDNHAHNIKSAKRMVEKVKPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAPNNILAPKDGQPITTPTQDMILGSYYLTIEQEGVQGEGMIFKDHDEMLMAYANKAVHLHARVKVRRKLHPED---KGRLVESTVGRFIFNEEIPQNLGFVDRKKDPYALEVDFLCD-------------------KKALGKVIDKCFRKHGNTITAIM---LDYIKKTGFRYSTQGAITIAVGDMEVPKEKGELISLAEEKVDKYEKAFRRGLISDEERYEKVIETWSETTEKVTEALMATLGS----MNNMFIMAHSGARGSKNQIRQLGGMRGLMANATG-----------KTVEIPIKANFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREIDCGSQEGSNIKALKD--GNEVIEELYDRIVGRYTLEEVIHPETGEVMIGKNEMILEDMAEEICALGIESVKIRSALKCQTRHGVCAHCYGRNLATGEAVKVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIISELSGTVKVVETKKKRE---VIVTDEHGESNTYTIPYGSRMKVRDGEFVELGDEITDGSVNPHDILRIKDVAGVQNYIIKEVQRVYRLQGVDINDKHIEVIVRQMLNKVKIEEAGDTNLLPGSLETIFKYEEENARTIAAGGE-PADGKPVLLGITKASLATESFLSAASFQETTRVLTEAAIKGKEDHLIGLKENVIIGKLIPAGTGLKRYKNI 1155
>gi|170759278|ref|YP_001788828.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169406267|gb|ACA54678.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum A3 str. Loch Maree] (1178 aa)
Score = 2759, Expect = 0.0e+00, Identities = 585/1260 (46%), Positives = 829/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET   L+K L   +E  ESID                                      SF      +GAEA+  LL  IDL++   ++ E+L+ S     I+   ++RRLE ++  + S N+P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         ++ +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K  + G+G +F+  +E+   YQ K V +H+ I +        +   +GI+ TT GK+I N+ +P+++ Y++   P+N  +L  + +V                   +KKTL  I+   + K+      I+   +DKIK  G+ YST  A TIS  D+     K +  E T+K+VE+++K Y++G ++++ERY+KV+  W+  T  V+  +   +       N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T++G   EV E  +   VIE L ERL  R+P  D++HP + +V+      + + +A ++ DAGI KV++RSV  CK ++G+C +C+G ++ T++ +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  ++ +     I+VVT  +  E ++Y +PF S ++V+ GD +  G +ITEGSI+  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I+DSG+++   G +ID+  F + N K IL     PA     + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKET-PLLKKQLLNEKEYRESIDKYGD---------------------------------DSFVA---AMGAEAVKTLLDEIDLEQSSIELKEELKTSTGQKKIR---IIRRLEVVESFRKSGNRPDWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QNGLAHNIKSAKRMVERVQPQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAHNILKPSDGKPVSVPTQDMVLGSYYLTMDKDGVKGEGKVFSCPEEVLMAYQCKAVDIHAKIKVRLKRVVDGE-TIEGIIETTPGKIIFNESIPQDLGYIDRTIPENKLKLEVDFLV-------------------SKKTLGGIITRCYMKHGATKTSIM---LDKIKAKGYHYSTIGAITISTSDMVVPEAKRELLENTEKQVEKIQKMYRRGFISEEERYEKVIDLWTKTTEDVANALMGSLDS----FNPIYMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRQEDCGTEEG--YEVSEIKEGNEVIEPLVERLSGRYPSEDIIHPTTGEVIVKRNTYMNEDIAKKVSDAGIKKVKIRSVFTCKSKHGVCARCYGMNMATSQKIHIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVSGTV-KMEETKKKRTIIVVT--DDGEEVSYDIPFGSRIKVKNGDIIAAGDEITEGSINPHDILRIKGVDGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEDSGDTELLPGTMIDVFDFEEAN-KEILEKGGEPAVGRIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|167403399|ref|ZP_02308229.1| DNA-directed RNA polymerase subunit beta' [Listeria monocytogenes FSL J2-003] (1147 aa)
Score = 2759, Expect = 0.0e+00, Identities = 563/1224 (45%), Positives = 818/1224 (66%)
  Q:    56 VKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           +KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V++ W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N + ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:     1 MKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREKAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIAVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANREAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1136
>gi|153177993|ref|ZP_01931685.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes F6900] >gi|133733898|gb|EBA35596.1| DNA-directed RNA polymerase, beta subunit [Listeria monocytogenes F6900] (1147 aa)
Score = 2759, Expect = 0.0e+00, Identities = 563/1224 (45%), Positives = 817/1224 (66%)
  Q:    56 VKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG----KKSNEDIIEE 1279
           +KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+G +F +++E +  YQ   VH+HS I +   + P ++F    ++ +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V++ W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQKVYR+QG+EI DK++EV++RQ+  K+++ D+G+++   G ++DI+TF + N   ILS  + PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG    +K   ++I+E
  S:     1 MKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREKAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIAVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAILSGSQ-PATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVILGKLVPAGTGIGRYRKLKSEVIKE 1136
>gi|58336624|ref|YP_193209.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus acidophilus NCFM] >gi|75433041|sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|58253941|gb|AAV42178.1| RNA-polymerase DNA-directed beta subunit [Lactobacillus acidophilus NCFM] (1217 aa)
Score = 2758, Expect = 0.0e+00, Identities = 573/1264 (45%), Positives = 823/1264 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLR---KTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK---DGILITTVGKVILNDVLPEEMSYLNNP--DNLEE-LSDNDIVEWGKDYRTFIEKKK---VYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QIGLASP KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KD+ CACGKYK +++RG +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLDIS + +E+V+YF  YIV+D G+          E  +   QK+    R + +   + +RE+ + +D++  ++N  K                          + + TG +      AI  L           DI +  + S N  +              W+          ++  + V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP+II+ NEKR+LQEAVDAL DN  R +P++G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI + P+LK YQ G+P  M L+LFKPF++HEL+K+          I SNIK+A++ I  +D+ IW ++  VIK+RPVLLNRAPTLHRL IQAFEP+LV GK+IRLHPL   A+NADFDGDQMA+HVPLS EAVAE+R ++LA+ HIL PKDGKPI+TP+QD+VLGNY+LT  +    G+GM+F++  E    Y+   +H H+IIG+   A PKK +PK    GI ITT GK++ N + P++  Y+N P   NL + L     +  G+D  + I +     +   F    LS+ +  +++ Y    ++     +D +K++G+  ST S  TI   DVPE  +K++   +  K+V+ + K +++GL+T+ ER+ +V+S W++  +++  +I + I  P    N I IMA+SGARGNISNFTQL+GMRGLM+                  E+P+ ++F EGL+V E F S++GARKGMTDTA+KT++SGY+TR+LVD  QDVI+ ++DC T +G  +  I   +   +IE L +RL+ RF    V  P++ + +     ++ + +A++I DAG+  V++RS+L C   +G+C+KC+G +L T + VE   A+G +AAQSIGEPGTQLT+RTFH GGV+   +I QG  R+++LF+   PK   ++ ISE++G + SI+ +P   +   +T+K   ++ +Y VP+ + + V EGD V  G K+T GS+D KEL++V        YI+ EVQK YR+QG++IADK++EV+ RQ+  KV++ D G +D   G+++DI  FR  N+++I+S   +PATA ++I  + +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     5 NKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDWSCACGKYKGVRYRGIVCDRCGVEVTSSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDISPRLLEEVIYFAAYIVIDPGDTDLEPKQLLTEA-EYREQKAKYGNRFEAKMGAEAIRELLKKVDLDKEVKNLKKE-------------------------LQTATGQK---RTRAIRRL-----------DILDAFKNSGNKPE--------------WM----------VMDAVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPNIIVQNEKRMLQEAVDALIDNGRRGRPVVGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVSPKLKFYQCGVPRPMALELFKPFVMHELVKRG---------IASNIKNAKRKIDREDDDIWDVLEDVIKERPVLLNRAPTLHRLSIQAFEPVLVPGKSIRLHPLACEAYNADFDGDQMAIHVPLSDEAVAESRLLMLAAHHILAPKDGKPIVTPSQDVVLGNYWLTQAERGREGEGMIFSSPAEATVAYENGDIHYHTIIGMSADAMPKKPWPKGHEHGIFITTYGKLVFNQLFPDDYFYVNEPTEKNLNDPLDAKYFLNEGEDINSKINEVADDLIASPFKSSFLSDSIATIYKYY---KVQRTSEYLDDLKELGYTSSTTSGITIGMNDVPEIGDKDEKVAKARKQVDVVSKQFRRGLITEQERHDRVISIWNACKDEIQNEIAQ-IHSPR---NPISIMADSGARGNISNFTQLAGMRGLMATPNG-----------GLFEIPVTSNFKEGLSVLELFMSTHGARKGMTDTALKTAQSGYLTRRLVDVAQDVIIRDDDCGTDRGITVSAI--MEGDEMIEPLFDRLVGRFTAETVKDPETGEAIVGRDVMMDENMAHKICDAGVTHVKIRSILTCDTPHGVCRKCYGMNLATGEEVEVGEAVGTVAAQSIGEPGTQLTLRTFHNGGVAGAEDITQGLPRVQELFEARNPKG--RATISEVDGVIDSIQENPAE-HTREITVKGKIDTRSYSVPYTASVAVSEGDYVHRGDKLTLGSVDPKELIQVTDTLTTEKYILAEVQKAYRMQGVDIADKHVEVLTRQMLQKVRVLDPGETDILPGEVMDIGQFRDRNKEVIISGG-IPATAQSIILSITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGLKENVIIGKIIPAGTG 1181
>gi|169344016|ref|ZP_02865006.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens C str. JGS1495] >gi|169297840|gb|EDS79936.1| DNA-directed RNA polymerase, beta' subunit [Clostridium perfringens C str. JGS1495] (1178 aa)
Score = 2756, Expect = 0.0e+00, Identities = 577/1260 (45%), Positives = 831/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPE+IREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+ HIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +YIV+D                        KET S L+K L                +  K  R   D   E +          F++       G+GAEAI  LL  IDL++   ++ E+L++S     ++   ++RRLE ++  K S NKPEWM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         +D +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +I+ P DG+P+  PTQDMVLG+YYLTM+K    G+G  FA+ DE+   YQ+K+V +H+ I +  +     +  K GI+ TT G +I N+ +P+++ ++N  +N EE+ + +I     D+             TKK+L +I++  + K+      I+   +D IK  G+ YS+  A T++A D+    +K +  +E D+ V++++K Y++GL+++DERY++V+  W+  T +V+  +   + K     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV   DC T+ G     +E+ K GS V+E L ERL  R+   DV HP++ ++LA     +   +A +I + GI KV++RSV  C  + G+C KC+G ++ T+  +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  I+ +     + VVT  +S E  +Y +PF S L+V++G  +  G +ITEGS++  +++ + G++  R Y++ EVQKVYRLQG++I DK++EV++RQ+T K+++ + G+++   G +ID+  FR ENE+ + S     A    ++ G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEQIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPIKDWECHCGKYKRVRYKGIVCDRCGVEVTKSKVRRERMAHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYIVID-----------------------PKET-SLLKKQL----------------LNEKEYREACDKYGEES----------FVA-------GMGAEAIKTLLSEIDLERTAAELKEELKQSTGQKKVR---IIRRLEVVESFKSSGNKPEWMVVDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------EDGVAHNIKSAKRMVERVMPQVWDVLEEVIADHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAGNIMKPSDGRPVCVPTQDMVLGSYYLTMDKDGAKGEGKYFASFDEVIMAYQLKEVDIHAKINVKVTKEIDGEL-KSGIIKTTPGFIIFNECIPQDLGFVNR-ENPEEMFNLEI-----DF-----------LITKKSLGKIIDKCYLKHGPTKTSIM---LDNIKATGYHYSSIGAVTVAASDMIVPQKKYELLKEADETVDKIEKMYRRGLISEDERYERVIEKWTETTEEVADTLMNSLDK----FNPIFMMADSGARGSKSQIKQLAGMRGLMASPSG-----------KIIELPIRASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREHDCGTQNGI---YVEEIKEGSEVVEQLAERLTGRYTAEDVFHPETGELLAAKDTYMDPILAEKIANTGIQKVKIRSVFTCDSKVGVCTKCYGMNMATSYKINIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVTGTV-RIEETKKKRTVYVVT--DSGEEYSYDIPFGSRLKVKDGIAIGAGDEITEGSVNPHDIMSIKGVDGAREYLLSEVQKVYRLQGVDINDKHLEVVVRQMTRKIKVTEQGDTNLLPGVMIDMFDFRAENER-VESFGGEKAQGDIVLLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLVGLKENVIIGKLIPAGTG 1152
>gi|15896391|ref|NP_349740.1| DNA-directed RNA polymerase subunit beta' [Clostridium acetobutylicum ATCC 824] >gi|20139601|sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|15026208|gb|AAK81080.1|AE007809_6 DNA-dependent RNA polymerase beta' subunit [Clostridium acetobutylicum ATCC 824] (1182 aa)
Score = 2755, Expect = 0.0e+00, Identities = 580/1271 (45%), Positives = 826/1271 (64%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQK-SSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++  ++QIGLASPEKIREWS GEV K ETINY++LKPEKDGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD            KE   L  Q  + KE R    K   E +E+                                               G+GAE+I +LL+ IDL++  +++ E L+ S     ++   ++RRLE ++  + S NKPEWMI+  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LKMYQ G+P  M L+LFKPF++ +L++              NIKSA++++    N +W ++ +VI   PV+LNRAPTLHRLGIQAF+PILVEG+AI+LHPL  TA+NADFDGDQMAVHVPLS EA AE+R ++LA+ +IL P DGKP+  PTQDMVLG+YYLT++K  + G+G  F NVDE    YQ+ ++ +H+ I +        +    GI+ TT+GK+I N+ +P+++ +++       ++ N+++             ++     KK L  I++  +RK+      I+   +DKIK  G+ YST SA T+S  D+     K +   E +  VE+++K Y++G ++DDERY++V+S W+  T +V+  +   + +     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV NEDC   +G   EV E  +   VIESL+ERLI R+   D++ P SK+VL    E I +  A  I   G+ KV++RSV  C  + G+C KC+G D+ T + +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    +I+SE+ G   +++        +V     S E ++Y +PF S L+V+ G+ +  G +ITEGS++  +++++ G+  V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T KV+++DSG+++   G +IDI  FR EN+K +  +   PA A   + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ D L GLKENV  G LIP GTG    ++I
  S:     4 NKFDALQIGLASPEKIREWSRGEVKKPETINYRTLKPEKDGLFCERIFGPIKDWECHCGKYKRVRYKGIVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYLVLDP-----------KETPLLKKQLLNEKEYREAADKYGEESFEA-----------------------------------------------GMGAESIKKLLQEIDLNQLSEELKENLKTSTGQKKVR---IIRRLEVVESFRKSTNKPEWMIMDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPDLKMYQCGLPKEMALELFKPFVMKKLVETG---------AAHNIKSAKRMVERVQNQVWDVLEEVISDHPVMLNRAPTLHRLGIQAFQPILVEGRAIKLHPLACTAYNADFDGDQMAVHVPLSVEAQAESRFLMLAAHNILKPSDGKPVCVPTQDMVLGSYYLTIDKDGVKGEGKAFTNVDEALMAYQLGEIDIHAKIKVRLEKEIDGKM-VSGIIETTIGKLIFNESIPQDLGFID-----RSIAGNELL------------LEINFLVGKKNLGGIIDKCYRKHGPTKTSIM---LDKIKAKGYHYSTISAITVSTSDMTVPPNKGELMSEAETAVEKIEKMYRRGFISDDERYERVISTWTKTTEKVADALMDNLDR----FNPIFMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRNEDCGATEG--FEVSEIKEGNEVIESLSERLIGRYTSEDIIDPTSKEVLVKQNEYIDEDKAIRIEKVGVKKVKIRSVFTCNCKYGVCAKCYGMDMATAEKISMGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AIVSEVSG---TVRIEETKKKRIVFIATESGEEVSYDIPFGSSLKVKNGETIGAGDEITEGSVNPHDIIRIKGVNAVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKVKVEDSGDTELLPGTMIDIFDFRDENKK-VEENGGRPAQARVSLLGITKAALATDSFLSAASFQETTRVLTDAAIKGKSDPLVGLKENVTIGKLIPAGTGMNRYKNI 1158
>gi|116618913|ref|YP_819284.1| DNA-directed RNA polymerase subunit beta' [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122066000|sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116097760|gb|ABJ62911.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (1220 aa)
Score = 2754, Expect = 0.0e+00, Identities = 583/1264 (46%), Positives = 821/1264 (64%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFP-KKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDI--EKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++  S+QI LASP+KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KDYECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLD+S + +E+++YF +Y+V++ G              D   +K    T  + R+  +E           E AIK        + LA  ++    +E+   +   TG +      A+  L           DI E   +S+                        NKPEWM+++ I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKM Q+G+PV M ++LF+PFI+ EL         T   +  N+KSA++ I   D  +  ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPLVT A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKPI+ P+QDMV+GNYYLT E+    G+GM+F++VDE +  +  K VH H+ +GI TS+FP +K F    +  I+IT+VGK+  N++LP +  Y+N P  DN + + D+  ++ G++   ++    +   F K  LS+I+  ++++Y      ++   +D++KD+G++ ST+S  T+S  DV E  EK    E+   +V  + K +++GL+TD ERY++V   W+      +KDI  +KLI+  E  TN I +M +SGARGNISNF QL+GMRGLM+                 IE+P+  +F EGLTV E F S++GARKGM+DTA+KT+ SGY+TR+LVD  QDVIV   D  + +G  ++ I D    SV+E L +R++ R+ +  V  P++ + +    E+I + VA +IV+AGI +V +RSV     E+G+    +G +L + + VE   A+G +AAQSIGEPGTQLTMR FHTGGV+ G +I QG  R++++ +   PK   ++ ISE+ G ++ I+ +P +     VTI+   ++  Y +P  + +R  EGD++K G  I EG ID KELL V       +Y++ E+QKVYRLQGIE++DK+IEV+IRQ+  K+++ D G +D   G ++DI  F++ NE  +  +  VPATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:     6 NKFESMQIALASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDYECACGKYKRIRYKGIVCDRCGVEVTSSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDMSPRSLEEIIYFASYVVIEPG--------------DAPVEKKQMMTEREYRQLKKEYGAGFKAGMGAE-AIK--------ELLANVDLATEADELKRELQEATGQK---RVRAVRRL-----------DIIEAFLQSD------------------------NKPEWMVMEVIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPFLKMNQMGLPVPMAIELFRPFIMKEL---------TTRKLAGNVKSAKRKIDKADGDVMDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLVTEAYNADFDGDQMAIHVPLSDEAQAEARLLMLAAGHILAPKDGKPIVAPSQDMVIGNYYLTTEEAGREGEGMIFSSVDEARIAFASKVVHYHTRVGIQTSSFPSEKPFTDEQRSKIMITSVGKLFFNEILPSDFPYINEPSEDNFKRVDDSFFIDAGENIHDYLADTSIVNPFKKGFLSDIIAEVYKRYKVTETSLL---LDRMKDLGYDKSTESGLTVSMTDVLELEEKPAILEDAHSQVATVTKQFRRGLITDSERYQRVTEIWTK-----AKDIIQDKLIESFE-PTNPIFMMQDSGARGNISNFVQLAGMRGLMAGPGG-----------KIIELPVTANFREGLTVMEMFISTHGARKGMSDTALKTANSGYLTRRLVDVAQDVIVREFDNDSDRGVAVQAIMD--GTSVVEPLYDRILGRYAMKSVFDPETDEKIVSRNEMIDEDVAKKIVNAGIKEVTIRSVFTSTTEHGVSVLDYGRNLASGEEVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGGNDITQGLPRVQEIVEARIPKG--RAEISEVTGTITVIEENPAD-RTKSVTIEGETDTRTYTLPLTTRMRFGEGDEIKRGEAINEGPIDPKELLAVTDTLTTESYMLTEIQKVYRLQGIEVSDKHIEVMIRQMLRKIRVMDPGQTDLLPGTLMDIADFKRANEPALF-EGLVPATARPVLLGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLVGLKENVIIGKIIPAGTG 1179
>gi|170756482|ref|YP_001783128.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum B1 str. Okra] >gi|169121694|gb|ACA45530.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum B1 str. Okra] (1178 aa)
Score = 2754, Expect = 0.0e+00, Identities = 583/1260 (46%), Positives = 829/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET   L+K L   +E  ESID                                      SF      +GAEA+  LL  IDL++   ++ E+L+ S     I+   ++RRLE ++  + S N+P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         ++ +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K  + G+G +F+  +E+   YQ K V +H+ I +        +   + I+ TT GK+I N+ +P+++ Y++   P+N  +L  + +V                   +KKTL  I+N  + K+      I+   +DKIK  G+ YST  A TIS  D+     K +  + T+K+VE+++K Y++G ++++ERY+KV+  W+  T  V+  +   +       N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T++G   EV E  +   VIE L ERL  R+P  D++HP + +V+      + + +A ++ DAGI KV++RSV  CK ++G+C +C+G ++ T++ +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  ++ +     I+VVT  +  E ++Y +PF S ++V+ GD +  G +ITEGSI+  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I+DSG+++   G +ID+  F + N + IL     PA     + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKET-PLLKKQLLNEKEYRESIDKYGD---------------------------------DSFVA---AMGAEAVKTLLDEIDLEQSSIELKEELKTSTGQKKIR---IIRRLEVVESFRKSGNRPDWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QNGLAHNIKSAKRMVERVQPQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAHNILKPSDGKPVSVPTQDMVLGSYYLTMDKDGVKGEGKVFSCPEEVLMAYQCKAVDIHAKIKVRLKKVIDGE-TIERIIETTPGKIIFNESIPQDLGYIDRTVPENKLKLEVDFLV-------------------SKKTLGGIINRCYMKHGATKTSIM---LDKIKAKGYHYSTIGAITISTSDMVVPEAKRELLQNTEKQVEKIQKMYRRGFISEEERYEKVIDLWTKTTEDVANALMGSLDS----FNPIYMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRQEDCGTEEG--YEVSEIKEGNEVIEPLVERLSGRYPSEDIIHPTTGEVIVKRNTYMNEDIAKKVSDAGIKKVKIRSVFTCKSKHGVCARCYGMNMATSQKIHIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVSGTV-KMEETKKKRTIIVVT--DDGEEVSYDIPFGSRIKVKNGDIISAGDEITEGSINPHDILRIKGVDGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEDSGDTELLPGTMIDVFDFEEANRE-ILEKGGEPAVGRIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|153939938|ref|YP_001392841.1| DNA-directed RNA polymerase subunit beta' [Clostridium botulinum F str. Langeland] >gi|152935834|gb|ABS41332.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum F str. Langeland] (1178 aa)
Score = 2753, Expect = 0.0e+00, Identities = 583/1260 (46%), Positives = 830/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET   L+K L   +E  ESID                                      SF      +GAEA+  LL  IDL++   ++ E+L+ S     I+   ++RRLE ++  + S N+P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         ++ +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K  + G+G +F+  +E+   YQ K V +H+ I +        +   +GI+ TT GK+I N+ +P+++ Y++   P+N  +L  + +V                   +KKTL  I+   + K+      I+   +DKIK  G+ YST  A TIS  D+     K +  E T+K+VE+++K Y++G ++++ERY+KV+  W+  T  V+  + + +       N I +MA+SGARG+ S   QL+GMRGLM+                 +E+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T++G   EV E  +   VIE L ERL  R+P  D++HP + +V+      + + +A ++ DAGI KV++RSV  CK ++G+C +C+G ++ T++ +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  ++ +     I+VVT  +  E ++Y +PF S ++V+ GD +  G +ITEGSI+  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I+DSG+++   G +ID+  F + N + IL     PA     + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKET-PLLKKQLLNEKEYRESIDKYGD---------------------------------DSFVA---AMGAEAVKTLLDEIDLEQSSIELKEELKTSTGQKKIR---IIRRLEVVESFRKSGNRPDWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QNGLAHNIKSAKRMVERVQPQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAHNILKPSDGKPVSVPTQDMVLGSYYLTMDKDGVKGEGKVFSCPEEVLMAYQCKAVDIHAKIKVRLKKVIDGE-TIEGIIETTPGKIIFNESIPQDLGYIDRTIPENKLKLEVDFLV-------------------SKKTLGGIITKCYMKHGATKTSIM---LDKIKAKGYHYSTIGAITISTSDMVVPESKRELLENTEKQVEKIQKMYRRGFISEEERYEKVIDLWTKTTEDVANALMESLDS----FNPIYMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KILELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRQEDCGTEEG--YEVSEIKEGNEVIEPLVERLSGRYPSEDIIHPTTGEVIVKRNTYMDEDIAQKVSDAGIKKVKIRSVFTCKSKHGVCARCYGMNMGTSQKIHIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVSGTV-KMEETKKKRTIIVVT--DDGEEVSYDIPFGSRIKVKNGDIISAGDEITEGSINPHDILRIKGVDGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEDSGDTELLPGTMIDVFDFEEANRE-ILEKGGEPAVGRIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|187776569|ref|ZP_02993042.1| hypothetical protein CLOSPO_00083 [Clostridium sporogenes ATCC 15579] >gi|187775228|gb|EDU39030.1| hypothetical protein CLOSPO_00083 [Clostridium sporogenes ATCC 15579] (1178 aa)
Score = 2751, Expect = 0.0e+00, Identities = 583/1260 (46%), Positives = 830/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET   L+K L   +E  ESID                                      SF      +GAEA+  LL  IDL++   ++ E+L+ S     I+   ++RRLE ++  + S N+P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         ++ +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K  + G+G +F+  +E+   YQ K V +H+ I +        +   +GI+ TT GK+I N+ +P+++ Y++   P+N  +L  + +V                   +KKTL  I+   + K+      I+   +DKIK  G+ YST  A TIS  D+     K +  E T+K+VE+++K Y++G ++++ERY+KV+  W+  T  V+  + + +       N I +MA+SGARG+ S   QL+GMRGLM+                 +E+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T++G   EV E  +   VIE L ERL  R+P  D++HP + +V+      + + +A ++ DAGI KV++RSV  CK ++G+C +C+G ++ T++ +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  ++ +     I+VVT  +  E ++Y +PF S ++V+ GD +  G +ITEGSI+  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I+DSG+++   G +ID+  F + N + IL     PA     + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKET-PLLKKQLLNEKEYRESIDKYGD---------------------------------DSFVA---AMGAEAVKTLLDEIDLEQSSIELKEELKTSTGQKKIR---IIRRLEVVESFRKSGNRPDWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QNGLAHNIKSAKRMVERVQPQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAHNILKPSDGKPVSVPTQDMVLGSYYLTMDKDGVKGEGKVFSCPEEVLMAYQCKAVDIHAKIKVRLKKVIDGE-TIEGIIETTPGKIIFNESIPQDLGYIDRTIPENKLKLEVDFLV-------------------SKKTLGGIITKCYMKHGATKTSIM---LDKIKAKGYHYSTIGAITISTSDMVVPESKRELLENTEKQVEKIQKMYRRGFISEEERYEKVIDLWTKTTEDVANALMESLDS----FNPIYMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KILELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRQEDCGTEEG--YEVSEIKEGNEVIEPLVERLSGRYPSEDIIHPTTGEVIVKRNTYMNEDIAKKVSDAGIKKVKIRSVFTCKSKHGVCARCYGMNMGTSQKIHIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVSGTV-KMEETKKKRTIIVVT--DDGEEVSYDIPFGSRIKVKNGDIISAGDEITEGSINPHDILRIKGVDGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEDSGDTELLPGTMIDVFDFEEANRE-ILEKGGEPAVGRIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|148381428|ref|YP_001255969.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum A str. ATCC 3502] >gi|153933989|ref|YP_001385803.1| DNA-directed RNA polymerase subunit beta' [Clostridium botulinum A str. ATCC 19397] >gi|153936207|ref|YP_001389210.1| DNA-directed RNA polymerase subunit beta' [Clostridium botulinum A str. Hall] >gi|148290912|emb|CAL85048.1| DNA-directed RNA polymerase beta' chain [Clostridium botulinum A str. ATCC 3502] >gi|152930033|gb|ABS35533.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum A str. ATCC 19397] >gi|152932121|gb|ABS37620.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum A str. Hall] (1178 aa)
Score = 2750, Expect = 0.0e+00, Identities = 583/1260 (46%), Positives = 830/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET   L+K L   +E  ESID                                      SF      +GAEA+  LL  IDL++   ++ E+L+ S     I+   ++RRLE ++  + S N+P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         ++ +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K  + G+G +F+  +E+   YQ K V +H+ I +        +   +GI+ TT GK+I N+ +P+++ Y++   P+N  +L  + +V                   +KKTL  I+N  + K+      I+   +DKIK  G+ YST  A TIS  D+     K +  + T+K+VE+++K Y++G ++++ERY+KV+  W+  T  V+  +   +       N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PIK SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T++G   EV E  +   VIE L ERL  R+P  D+++P + +V+      + + +A ++ DAGI KV++RSV  CK ++G+C +C+G ++ T++ +    A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SE+ G V  ++ +     I+VVT  +  E ++Y +PF S ++V+ GD +  G +ITEGSI+  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I+DSG+++   G +ID+  F + N + IL     PA     + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKET-PLLKKQLLNEKEYRESIDKYGD---------------------------------DSFVA---AMGAEAVKTLLDEIDLEQSSIELKEELKTSTGQKKIR---IIRRLEVVESFRKSGNRPDWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QNGLAHNIKSAKRMVERVQPQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAHNILKPSDGKPVSVPTQDMVLGSYYLTMDKDGVKGEGKVFSCPEEVLMAYQCKAVDIHAKIKVRLKKVIDGE-TIEGIIETTPGKIIFNESIPQDLGYIDRTVPENKLKLEVDFLV-------------------SKKTLGGIINRCYMKHGATKTSIM---LDKIKAKGYHYSTIGAITISTSDMVVPEAKRELLQNTEKQVEKIQKMYRRGFISEEERYEKVIDLWTKTTEDVANALMASLDS----FNPIYMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIKASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVRQEDCGTEEG--YEVSEIKEGNEVIEPLVERLSGRYPSEDIINPTTGEVIVKRNTYMNEDIAKKVSDAGIKKVKIRSVFTCKSKHGVCARCYGMNMATSQKIHIGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEVSGTV-KMEETKKKRTIIVVT--DDGEEVSYDIPFGSRIKVKNGDIISAGDEITEGSINPHDILRIKGVDGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEDSGDTELLPGTMIDVFDFEEANRE-ILEKGGEPAVGRIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|146295986|ref|YP_001179757.1| DNA-directed RNA polymerase subunit beta' [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409562|gb|ABP66566.1| DNA-directed RNA polymerase, beta' subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (1168 aa)
Score = 2745, Expect = 0.0e+00, Identities = 607/1270 (47%), Positives = 850/1270 (66%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD-----GILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSK-ESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           +I+I LASPEKIREWS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYKK+K++G +C+KCGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD++ + +E+V+YF  Y+V+D G+     N   K+++      S KE R                       +K K    F                          R G+GAEAI ELLK IDLDK  +++ ++L   E  +  K  K+++RLE ++  + S N+PEWMIL  I V PP+ RP++QL+GG+F TSD+N  YR++I RN RLK++++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M L+LFKPF++ +L++K          I +NIK+A+K +  Q + +W I+ +VIK  PVLLNRAPTLHRLGIQAFEP+LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L++ ++L P DGKPI+ PTQDMVLG YYLT+EK    G+G +F++ DE    Y+ K V +H+ I +      ++   KD     GI+ TT GK+ILN V+P+++ +++    +NL +   + +V+                   KK L +I++   + Y           +D+IK++GF +ST+ A TIS  D+     K+K   E ++KVE ++K Y+ GL++D+ERY++V+S W+   ++++   E+LIQ  +   N I +MA+SGARG+ +  +QL+GMRGLM+                TIE+PIK++F EGL V E+F S++GARKG+ DTA++T+ SGY+TR+LVD  QD+IV  EDC T+KG  +EV E      VIE+L ER+I R+   D+++ K+ +V+    E+IT+ +A +IVDAG   V VRSVL CK   G+C KC+G DL T + V    A+G+IAAQ+IGEPGTQLTMRTFHTGG+ +G +I QG  R+++LF+   PK    +IISEIEG V SIK          +T++N   E   Y+VP+ + L+V +GD VK G ++TEGSI+  +LL++ G   V++Y++ EVQKVY++QG++I DK+IE+IIRQ+  KV+I+D G+++   G I++I  F +EN++ I ++ K PA    ++ G+ +A   T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G LIP GTG     +II E
  S:    13 AIKISLASPEKIREWSRGEVKKPETINYRTLKPEKDGLFCEKIFGPTKDWECHCGKYKKVKYKGVVCDKCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGVP--SRMGLILDMTPRNLEKVLYFAAYVVIDPGD---VPNLEKKQIL------SEKEYRE----------------------LKEKYGDRF--------------------------RAGMGAEAIKELLKEIDLDKLSQELRQEL---ETATGQKKLKIIKRLEVVEAFRKSGNRPEWMILDVIPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLMELGAPDIIIRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMALELFKPFVMKKLVEKG---------ICNNIKNAKKAVERQRSEVWDILEEVIKDHPVLLNRAPTLHRLGIQAFEPVLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARFLMLSANNLLKPADGKPIVVPTQDMVLGIYYLTLEKKGDKGEGKIFSSEDEALLAYEHKVVGLHARIKV------RRTIEKDGEVVSGIVETTPGKIILNQVIPQDLGFVDRSKKENLLKYEIDTLVD-------------------KKMLGKIIDRCIKVYGTTR---TAEILDEIKELGFRFSTRGAITISVSDMVIPEVKQKLIAEAEQKVENIEKLYRHGLISDEERYEQVISIWNETKDKLT---EELIQNLDEF-NPIFMMASSGARGSKNQISQLAGMRGLMANPSG-----------KTIEMPIKSNFREGLNVIEFFISTHGARKGLADTALRTADSGYLTRRLVDVAQDIIVREEDCGTEKG--IEVSEIRDGTEVIETLEERIIGRYAAKDIINEKTGEVIVKRNELITEEIAKKIVDAGEKSVYVRSVLECKTRYGVCTKCYGLDLGTGQPVNVGEAVGIIAAQAIGEPGTQLTMRTFHTGGI-AGQDITQGLPRVEELFEARKPKG--VAIISEIEGYV-SIKEDKKR----TITVRNDNGEERTYEVPYGARLKVNDGDYVKAGDELTEGSINPHDLLRIKGPRGVQSYLLAEVQKVYKMQGVDINDKHIEIIIRQMMKKVKIEDPGDTELLPGDIVEIYRFEEENDRAI-AEGKRPALGRRVLLGITKAALSTESFLSAASFQETTRVLTDAAIKGKVDPLIGLKENVIIGKLIPAGTGMAKYRNIIVE 1165
>gi|145956379|ref|ZP_01805375.1| hypothetical protein CdifQ_04000075 [Clostridium difficile QCD-32g58] >gi|168696863|ref|ZP_02729140.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile QCD-37x79] >gi|168726733|ref|ZP_02759010.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile QCD-76w55] >gi|168730437|ref|ZP_02762714.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile QCD-97b34] >gi|196160583|ref|ZP_03121144.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile CIP 107932] (1161 aa)
Score = 2734, Expect = 0.0e+00, Identities = 576/1270 (45%), Positives = 834/1270 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLN-MPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDK--VPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           SI+I LASPEKIR+WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKY++++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+++YF +Y+V+D G        N K+++      + KE R+ L K                                             +  +FT    G+GAEA+  LL+NIDL+++ KD+  +L+ S     ++T   +RRLE ++  K S NKPEWMIL  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK YQ G+P  M L+LFKPF++ +L+K    EG        NIKSA+ ++      +W ++  VIK  PVLLNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L+  +IL PKDG PI TP+QDMVLG YYLT+E  +   G GM+F + +EL   Y  K VH+H+++ +  +     +  +  ++ +TVG+ I N+ +P+++ +++  +N   L  + + +                   KK+L +I++   RK+ +         +D IK +GF+YST    T++  D+    EK+ +  E + KV++ +K Y++GL++D+ERY+KV+  W+  T++V+  +   + +     N+I IMA+SGARG+ +   QL+GMRGLM+ +              T+E+P+K++F EGL+V EYF SS+GARKG+ DTA++T++SGY+TR+LVD +QDVIV   DC T+  T +  I++     VIE + +R++ R+ I  +++P++ +VL  A  +I +  A  IV  GI+K+ +R+VL+CK  +G+C KC+G +L T K V    A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    ++I+E+ G+V   +         V  I    E+  Y +P+ S L+V++G  ++ G  +T+G I+  ++++V G++ V+ YI+KEVQ+VYRLQG+++ DK+IEVI+RQ+ +KV+++D G++D   G   D+ TF + N+  I   DK   PA A  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG+ D L GLKENVI G LIP GTG K   +I  E
  S:     9 SIKIALASPEKIRQWSRGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYRRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPMSHIWYFKGIP--SRMGLLLDMSPRSLEKILYFASYVVVDPGE----TGLNEKQLL------TEKEYRTALEK---------------------------------------------YGYTFT---VGMGAEAVKTLLQNIDLEQQSKDLRAELKDSTGQKKVRT---IRRLEVVEAFKKSGNKPEWMILDAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKFYQCGLPKKMALELFKPFVMDKLVK----EG-----YAHNIKSAKSIVEKVKPEVWDVLEDVIKSHPVLLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLSVNNILAPKDGSPITTPSQDMVLGCYYLTIEAQDGAKGTGMVFKDFNELLLAYYNKSVHLHALVKLKVTL----EDGRSSLVESTVGRFIFNENIPQDLGFVDRKENPFALEVDFLAD-------------------KKSLGKIIDKCFRKHGNTE---TAELLDYIKALGFKYSTLGGITVAVDDMSVPEEKKVFIAEAEAKVDKYEKAYRRGLISDEERYEKVIETWTETTDKVTDALMGGLDR----LNNIYIMAHSGARGSKNQIRQLAGMRGLMANASG-----------KTVEIPVKSNFREGLSVLEYFTSSHGARKGLADTAIRTAESGYLTRRLVDVSQDVIVREIDCGTEDTTEIYAIKE--GNEVIEEIYDRIVGRYTIDPILNPETGEVLVEADSMIQEDEAETIVALGIEKIRIRTVLNCKTNHGVCSKCYGRNLATGKEVNIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AVITEVSGRVEIDETGKRKE---VNVIPEEGETQTYVIPYGSRLKVKQGQMLEAGDPLTQGFINPHDIVRVNGVKGVQEYIVKEVQRVYRLQGVDVNDKHIEVIVRQMLSKVKVEDPGDTDLLPGGYEDVLTFNECNKDAI---DKGLRPAVAKRVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKEDHLIGLKENVILGKLIPAGTGMKKYRNIAVE 1157
>gi|182418862|ref|ZP_02950120.1| DNA-directed RNA polymerase, beta' subunit [Clostridium butyricum 5521] >gi|182377287|gb|EDT74854.1| DNA-directed RNA polymerase, beta' subunit [Clostridium butyricum 5521] (1178 aa)
Score = 2732, Expect = 0.0e+00, Identities = 573/1267 (45%), Positives = 823/1267 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPK-DG-----ILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +IQIGLASP++IR WS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +YIV D                        KET    ++ L E                 K  R   D   E +          F++S       +GAEAI ELL  IDL+   K++ E+L++S     ++   ++RRLE ++  + S N PEWM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M ++LFKPF++ +L+         +D I  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+PILVEG+AI+LHPL  TA+NADFDGDQMAVH+PLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM+K    G+GM F++ DE    Y+ K + VH+ I +       + F + DG     ++ TTVGK+I N+ +P+ + +++  N D +  L  + +V                   TKK+L +I++  + ++      I+   +D IK +G+ YS+  A T++  D+    EK +  +E D+ +E+++K Y++G ++DDERY++V+  WS  T +V+  +   + K     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL V EYF+S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T  G  L V E  +   V+E L ERLI R+   D+++P++ +++    E +   +A  IV AGI KV+++SV  C  + G+C  C+G ++ T K ++   A+G+IAAQSIGEPGTQLTMRTFHTGGV++G +I QG  R+++LF+   PK    +I+SE+ G   ++K         VV +    E  +Y +PF S L+V +GD ++ G +ITEGS++  +++ + GI+  R Y++ EVQKVYRLQG++I DK++EV++RQ+T K+++ DSG++D   G +ID+  FR+EN + +       A     + G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG     D+
  S:     9 AIQIGLASPDQIRAWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRVRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYIVTD-----------------------PKETPLLKKQLLNE-----------------KEYREACDKYGEDS----------FVAS-------MGAEAIQELLAEIDLESGSKELKEELKQSTGQKKVR---IIRRLEVVESFRKSGNNPEWMVINVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMAIELFKPFVMKKLV---------QDGIAHNIKSAKRMVERVQPQVWDVLEEVIADHPVLLNRAPTLHRLGIQAFQPILVEGRAIKLHPLACTAYNADFDGDQMAVHLPLSVEAQAEARFLMLAATNILKPSDGKPVCVPTQDMVLGSYYLTMDKDGAKGEGMTFSSKDEAIMAYESKAIAVHAKINV-------RMFREIDGVVRHKVIKTTVGKLIFNESVPQNLGFVDRKNEDEMFNLEIDFLV-------------------TKKSLGKIIDNCYLEHGPVKTSIM---LDNIKALGYHYSSIGAVTVATSDIKVPPEKFELLKEADETIEKIEKMYKRGFISDDERYERVIEKWSKTTEEVADALMDSMDK----FNPIFMMADSGARGSKSQIKQLAGMRGLMASPSG-----------KIIELPIRASFKEGLDVLEYFSSTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREEDCGTDDG--LYVSEIKEGNEVVEELKERLIGRYTAEDIINPENGEIIVAKNEYMDPYIAERIVAAGIRKVKIKSVFTCNCKVGVCSHCYGMNMATAKKIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVATGADITQGLPRVEELFEARKPKGL--AIVSEVTG---TVKMEETKKKRTVVIMTADGEERSYDIPFGSRLKVTDGDNIEAGDEITEGSVNPHDIMSIKGIDGARRYLLSEVQKVYRLQGVDINDKHLEVVVRQMTRKIKVTDSGDTDLLPGTMIDMFDFREENAR-VREFGGEEAKGEETLLGITKAALATDSFLSAASFQETTRVLTEAAIKGKVDPLVGLKENVIIGKLIPAGTGMMRYRDL 1160
>gi|196165504|ref|ZP_03126035.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile QCD-23m63] (1161 aa)
Score = 2731, Expect = 0.0e+00, Identities = 575/1270 (45%), Positives = 834/1270 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLN-MPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDK--VPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           SI+I LASPEKIR+WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKY++++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+++YF +Y+V+D G        N K+++      + KE R+ L K                                             +  +FT    G+GAEA+  LL+NIDL+++ KD+  +L+ S     ++T   +RRLE ++  K S NKPEWMIL  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK YQ G+P  M L+LFKPF++ +L+K    EG        NIKSA+ ++      +W ++  VIK  PVLLNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L+  +IL PKDG PI TP+QDMVLG YYLT+E  +   G GM+F + +EL   Y  K VH+H+++ +  +     +  +  ++ +TVG+ I N+ +P+++ +++  +N   L  + + +                   KK+L +I++   RK+ +         +D IK +GF+YST    T++  D+    EK+ +  E + KV++ +K Y++GL++D+ERY+KV+  W+  T++V+  +   + +     N+I IMA+SGARG+ +   QL+GMRGLM+ +              T+E+P+K++F EGL+V EYF SS+GARKG+ DTA++T++SGY+TR+LVD +QDVIV   DC T+  T +  I++     VIE + +R++ R+ I  +++P++ +V+  A  +I +  A  IV  GI+K+ +R+VL+CK  +G+C KC+G +L T K V    A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    ++I+E+ G+V   +         V  I    E+  Y +P+ S L+V++G  ++ G  +T+G I+  ++++V G++ V+ YI+KEVQ+VYRLQG+++ DK+IEVI+RQ+ +KV+++D G++D   G   D+ TF + N+  I   DK   PA A  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG+ D L GLKENVI G LIP GTG K   +I  E
  S:     9 SIKIALASPEKIRQWSRGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYRRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPMSHIWYFKGIP--SRMGLLLDMSPRSLEKILYFASYVVVDPGE----TGLNEKQLL------TEKEYRTALEK---------------------------------------------YGYTFT---VGMGAEAVKTLLQNIDLEQQSKDLRAELKDSTGQKKVRT---IRRLEVVEAFKKSGNKPEWMILDAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKFYQCGLPKKMALELFKPFVMDKLVK----EG-----YAHNIKSAKSIVEKVKPEVWDVLEDVIKSHPVLLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLSVNNILAPKDGSPITTPSQDMVLGCYYLTIEAQDGAKGTGMVFKDFNELLLAYYNKSVHLHALVKLKVTL----EDGRSSLVESTVGRFIFNEKIPQDLGFVDRKENPFALEVDFLAD-------------------KKSLGKIIDKCFRKHGNTE---TAELLDYIKSLGFKYSTLGGITVAVDDMSVPEEKKVFIAEAEAKVDKYEKAYRRGLISDEERYEKVIETWTETTDKVTDALMGGLDR----LNNIYIMAHSGARGSKNQIRQLAGMRGLMANASG-----------KTVEIPVKSNFREGLSVLEYFTSSHGARKGLADTAIRTAESGYLTRRLVDVSQDVIVREVDCGTEDTTEIYAIKE--GNEVIEEIYDRIVGRYTIDPILNPETGEVIVEADSMIQEDEAETIVALGIEKIRIRTVLNCKTNHGVCSKCYGRNLATGKEVNIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AVITEVSGRVEIDETGKRKE---VNVIPEEGETQTYVIPYGSRLKVKQGQMLEAGDPLTQGFINPHDIVRVNGVKGVQEYIVKEVQRVYRLQGVDVNDKHIEVIVRQMLSKVKVEDPGDTDLLPGGYEDVLTFNECNKDAI---DKGLRPAVAKRVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKEDHLIGLKENVILGKLIPAGTGMKKYRNIAVE 1157
>gi|126697634|ref|YP_001086531.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile 630] >gi|168715545|ref|ZP_02747822.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile QCD-63q42] >gi|196127772|ref|ZP_03119521.1| DNA-directed RNA polymerase subunit beta' [Clostridium difficile ATCC 43255] >gi|115249071|emb|CAJ66882.1| DNA-directed RNA polymerase beta' chain [Clostridium difficile 630] (1161 aa)
Score = 2730, Expect = 0.0e+00, Identities = 575/1270 (45%), Positives = 834/1270 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLN-MPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDK--VPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           SI+I LASPEKIR+WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKY++++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+++YF +Y+V+D G        N K+++      + KE R+ L K                                             +  +FT    G+GAEA+  LL+NIDL+++ KD+  +L+ S     ++T   +RRLE ++  K S NKPEWMIL  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK YQ G+P  M L+LFKPF++ +L+K    EG        NIKSA+ ++      +W ++  VIK  PVLLNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L+  +IL PKDG PI TP+QDMVLG YYLT+E  +   G GM+F + +EL   Y  K VH+H+++ +  +     +  +  ++ +TVG+ I N+ +P+++ +++  +N   L  + + +                   KK+L +I++   RK+ +         +D IK +GF+YST    T++  D+    EK+ +  E + KV++ +K Y++GL++D+ERY+KV+  W+  T++V+  +   + +     N+I IMA+SGARG+ +   QL+GMRGLM+ +              T+E+P+K++F EGL+V EYF SS+GARKG+ DTA++T++SGY+TR+LVD +QDVIV   DC T+  T +  I++     VIE + +R++ R+ I  +++P++ +V+  A  +I +  A  IV  GI+K+ +R+VL+CK  +G+C KC+G +L T K V    A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    ++I+E+ G+V   +         V  I    E+  Y +P+ S L+V++G  ++ G  +T+G I+  ++++V G++ V+ YI+KEVQ+VYRLQG+++ DK+IEVI+RQ+ +KV+++D G++D   G   D+ TF + N+  I   DK   PA A  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG+ D L GLKENVI G LIP GTG K   +I  E
  S:     9 SIKIALASPEKIRQWSRGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYRRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPMSHIWYFKGIP--SRMGLLLDMSPRSLEKILYFASYVVVDPGE----TGLNEKQLL------TEKEYRTALEK---------------------------------------------YGYTFT---VGMGAEAVKTLLQNIDLEQQSKDLRAELKDSTGQKKVRT---IRRLEVVEAFKKSGNKPEWMILDAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKFYQCGLPKKMALELFKPFVMDKLVK----EG-----YAHNIKSAKSIVEKVKPEVWDVLEDVIKSHPVLLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLSVNNILAPKDGSPITTPSQDMVLGCYYLTIEAQDGAKGTGMVFKDFNELLLAYYNKSVHLHALVKLKVTL----EDGRSSLVESTVGRFIFNENIPQDLGFVDRKENPFALEVDFLAD-------------------KKSLGKIIDKCFRKHGNTE---TAELLDYIKALGFKYSTLGGITVAVDDMSVPEEKKVFIAEAEAKVDKYEKAYRRGLISDEERYEKVIETWTETTDKVTDALMGGLDR----LNNIYIMAHSGARGSKNQIRQLAGMRGLMANASG-----------KTVEIPVKSNFREGLSVLEYFTSSHGARKGLADTAIRTAESGYLTRRLVDVSQDVIVREIDCGTEDTTEIYAIKE--GNEVIEEIYDRIVGRYTIDPILNPETGEVIVEADSMIQEDEAETIVALGIEKIRIRTVLNCKTNHGVCSKCYGRNLATGKEVNIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AVITEVSGRVEIDETGKRKE---VNVIPEEGETQTYVIPYGSRLKVKQGQMLEAGDPLTQGFINPHDIVRVNGVKGVQEYIVKEVQRVYRLQGVDVNDKHIEVIVRQMLSKVKVEDPGDTDLLPGGYEDVLTFNECNKDAI---DKGLRPAVAKRVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKEDHLIGLKENVILGKLIPAGTGMKKYRNIAVE 1157
>gi|134298086|ref|YP_001111582.1| DNA-directed RNA polymerase subunit beta' [Desulfotomaculum reducens MI-1] >gi|134050786|gb|ABO48757.1| DNA-directed RNA polymerase, beta' subunit [Desulfotomaculum reducens MI-1] (1185 aa)
Score = 2725, Expect = 0.0e+00, Identities = 571/1276 (44%), Positives = 830/1276 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPA-----GEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG--KKSNEDIIEEGNKMYE 1285
           SI+IGLASP+KIR+WS+GEV K ETINY++LKPE+DGLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YFV+YIV++ G+    K         L ++   +E R K     +                                                    G+GAEAI  LL  I+L++  +++ ++L++      I+    +RRLE ++  K S N+PEWMI+  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKM+Q G+P  M L+LFKPF++ +L+          D    NIKSA++++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEP+LVEG+AI++HP+V TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP+ +PTQDMVLG+YYLTM++    G+G++F +  E    Y  K+V + + I +      + Q        TTVG++I N+V+PEE+ Y+N                              K   KKTLS+IV   +R+  +A        +D IK++G++YST++  TI   D+     K++   + +++V +++  +++GL+T+DERY+KV+  W+  T++V+K +   + K     N++ +MA SGARGNI    QL+GMRGLM+                 I++PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD  QDVIV  +DC T +G  +  I D   G  IE L+ERL  R P+  VVHP++ +VL         +++T+  A  I DAGI+KV++RSV+ CK   G+C+ C+G +L T   ++   A+G+IAAQSIGEPGTQLTMRTFHTGGV+ G +I QG  R+++LF+   PK   ++I++E +G ++ I+       I +   K++ E   Y VPF + ++V+EG +++ G ++TEGS++  +LLK+ G   V+ Y+++EVQ+VYRLQG+EI DK+IEV+IRQ+  KV+I+++G+++   G +IDI  F +EN K +    + PA A  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G L+P GTG  +  N +++EEG    E
  S:     9 SIRIGLASPDKIRQWSSGEVKKPETINYRTLKPERDGLFCERIFGPTRDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERLGHIELAAPVSHIWYFKGIP--SRMGLLLDMSPRALEKVLYFVSYIVIEPGDTPLLKK-------QLLTETEYREYRDKFGNNFKA---------------------------------------------------GMGAEAIKVLLVEINLEELARELRQELKEVSGQRKIRA---IRRLEVVEAFKKSGNRPEWMIMDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPRLKMHQCGLPKEMALELFKPFVMKKLVN---------DGHAHNIKSAKRMVERVRPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPVLVEGRAIKIHPMVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAANNILNPKDGKPVASPTQDMVLGSYYLTMDRDGDLGEGLIFKDEQEAMLAYDNKQVSLQAKITVRRKNGERLQ--------TTVGRIIFNEVIPEELGYIN------------------------------KVCDKKTLSKIVADCYRRLGNAH---TAELLDGIKELGYKYSTRAGITIGVPDITIPEAKKEILAKAEEQVNKIETQFRRGLITEDERYRKVIGIWNDATDKVTKALMATLDK----FNNVYMMATSGARGNIQQIRQLAGMRGLMADPSG-----------RIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDVIVREDDCGTTEGIEVREIRDGTEG--IEKLHERLEGRVPMEVVVHPETGEVLISQEQVDNHQVMTEEQAQAIEDAGIEKVKIRSVITCKTRYGVCKHCYGKNLATGGNIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVA-GDDITQGLPRVEELFEARRPKG--QAIVAEEDGSIA-IREVKGRREIEIT--KDNGEKNVYAVPFGARIKVKEGQRIEAGDELTEGSVNPHDLLKIKGPAGVQVYLLQEVQRVYRLQGVEINDKHIEVMIRQMLRKVKIEEAGDTELLPGGLIDIFEFEEENRKAVEQGGE-PAVAKPVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKMDPLLGLKENVIIGKLVPAGTGMSRYRNIEVLEEGQPFLE 1154
>gi|153952854|ref|YP_001393619.1| DNA-directed RNA polymerase subunit beta' [Clostridium kluyveri DSM 555] >gi|146345735|gb|EDK32271.1| RpoC [Clostridium kluyveri DSM 555] (1174 aa)
Score = 2725, Expect = 0.0e+00, Identities = 567/1260 (45%), Positives = 825/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLAS EKIREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+I+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD                        KET+   ++ L E                 K  R   D   E N          F++S       +GAE++ +LL+ IDL++    + E L+   N++  K  +++RRLE ++  + S N+PEWM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+++          +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPL  TA+NADFDGDQMAVHVPLS EA +EAR ++LA+ +IL P DGKP++ PTQDMVLG+YYLT+E+    G+G  F+  DE+   YQ+K++ +++ I +  +     ++   GI+  T GK+I N+ +P+++ +++   P N  +L  + +V                    KK L +I+N  + K+      I+   +DKIK  G+ YST S  T+S  D+     K++   E+D  V++++K Y++G +++DERY++V+  W+  T  V+ ++   + K     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T +G   +V E  +   VIESL+ERL  R+   D++ P + +++ P    +   +A+ I  +GI KV++RSV  CK  +G+C KC+G ++ T + ++   ++G+IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    +I+SE+ G   ++K         V  I ++ E + Y +PF S ++V  GD +  G ++TEGS++  ++L++ G++ V+NY++ EVQKVYRLQG++I DK++EV+IRQ+T K++I++SG+++   G +IDI  F +EN ++  S        V L+ G+ +A   T SFL+AASFQ+T ++LTDA +KG+ID L GLKENVI G LIP GTG
  S:     9 ALQIGLASTEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPQKDWECHCGKYKRIRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRALEKVLYFASYVVLD-----------------------PKETQLLKKQLLTE-----------------KEYREAVDKYGEQN----------FVAS-------MGAESVKKLLEEIDLEQLSLVLKEDLK---NSTGQKKIRIIRRLEVVESFRKSGNRPEWMVIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLVERG---------LAHNIKSAKRMVERVQAQVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLSCTAYNADFDGDQMAVHVPLSVEAQSEARFLMLAAHNILKPSDGKPVVVPTQDMVLGSYYLTVEREGAKGEGRYFSFPDEVIMAYQLKQIDINAKIKVKMTKIIDGKY-ISGIIDATAGKIIFNECVPQDLGFIDRSKPGNEFKLEIDFLV-------------------AKKNLGKIINKCYMKHGATKTSIM---LDKIKARGYHYSTISGITVSTSDMEVPEAKKRLLSESDAAVDKIEKMYRRGFISEDERYQRVIERWTKTTEDVADELMNNLDK----FNPIFMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIRASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREEDCGTYEG--YDVSEIKEGNEVIESLSERLTGRYSAEDIIDPNNHQIIVPKNSYMDSKLADRIEASGIKKVKIRSVFTCKSRHGVCSKCYGMNMATAQKIDIGESVGIIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AIVSEVSG---TVKMEETKKKRSVSVITDNGEEVTYDIPFGSRIKVSNGDLISAGDEVTEGSVNPHDILRIKGVQGVKNYLLSEVQKVYRLQGVDINDKHLEVVIRQMTRKIKIEESGDTELLPGTMIDIFDFEEENARVEASGGSAAQGRVALL-GITKAALATESFLSAASFQETTRVLTDAAIKGKIDPLLGLKENVIIGKLIPAGTG 1152
>gi|89211784|ref|ZP_01190126.1| RNA polymerase Rpb1, domain 4 [Halothermothrix orenii H 168] >gi|89158615|gb|EAR78321.1| RNA polymerase Rpb1, domain 4 [Halothermothrix orenii H 168] (1158 aa)
Score = 2717, Expect = 0.0e+00, Identities = 579/1267 (45%), Positives = 817/1267 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILI-TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           S++I +ASPE+IR+WS GEV K ETINY++LKPEKDGLF E IFGP KDYEC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP  HIW  K +P  S++ L+LD+S + +E+V+YFV+YIV+D G     +         L S+   +E R K                                                +  SF     G+GAEA+ ELLK ID+  E K + ++++++   S  + K+ +RRLE +  L  S  KPEW++L+ I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKM+Q G+P  M L+LFKPF++  L+ K          +  NIK+A++++   D+ +W ++ +VI+  PVLLNRAPTLHRLGIQAFEP+LVEGKAI+LHPLV TA+NADFDGDQMAVHVPLS EA  E+R ++L++ +IL P DG PI  PTQDMV+G YYLT  K    G+G LFA+ +E    Y   KV + + + +            DG L+ T+ G+VI N+ LPE+M ++N   +  EL D                              IV  LH K+ +   +I    +DKIK++G++++T+S  TI+  D      KEK   E +++V  ++++Y++G +T++ERY+KVV  W+   + V+  +   + +     N+I +MA SGARGN S  +QL+GMRGLM+                 +++PI++SF EGL V E+F S++GARKG+ DTA++T+ SGY+TR+LVD +QDVI+  +DC T+ G  +E I   K    IE+L ER I R    D+V P + KV+    E+IT+    EI  AGI++V++RSVL C+ ++G+C+KC+G +L T KLV+   AIG+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++II+E  G+V  ++    N   +V+   + K+   Y+VP+ S++ V++G  VK G K+TEG +D   +LK+ G++ V++Y+++EVQKVYR QG+EI DK+IEVIIRQ+  KV+I D G++DF  G ++D   F + N K++  + K PAT    + G+ +A   T SFL+AASFQ+T ++LT+A ++G++D L GLKENVI G LIP GTG K   DI
  S:     9 SMKISVASPEQIRDWSRGEVKKPETINYRTLKPEKDGLFCEKIFGPTKDYECHCGKYKRVRYKGVVCDRCGVEVTHSKVRRERMGHIELAAPCTHIWFFKGIP--SRLGLILDMSPRALEKVIYFVSYIVIDAGESPLSEK-------QLLSETEYREARQK------------------------------------------------YGDSFEA---GMGAEAVKELLKKIDVGAEVKRLKKEVKEA---SGQRRKRAIRRLEVLDGLNKSGIKPEWLVLEVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIIRNEKRMLQEAVDALIDNGRRGRPVTGAGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMHQCGLPKKMALELFKPFVMKGLVDKG---------LAHNIKNAKRMVERVDDEVWGVLEEVIEDHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCTAYNADFDGDQMAVHVPLSAEAQIESRVLMLSTSNILAPSDGSPITVPTQDMVIGIYYLTTIKDGEKGEGKLFASPEEAIKAYDTGKVSLQARVKVRL----------DGKLVETSPGRVIFNEALPEKMEFINYQVDKSELGD------------------------------IVADLHEKFGN---DITARALDKIKELGYDFATRSGITIAVSDASISPAKEKILNEAEEEVRNIEQHYRRGAITENERYQKVVDIWNKAKDAVTDALLDHLGE----DNNIYMMAISGARGNTSQISQLAGMRGLMADPSG-----------RILDIPIRSSFREGLNVMEFFISTHGARKGLADTAIRTADSGYLTRRLVDVSQDVIIREDDCGTENGIYVEAI-GGKGDDAIETLAERCIGRLAAEDIVDPSNDKVIVKRDELITRDKMKEINAAGIERVKIRSVLTCETKHGVCRKCYGRNLATGKLVDIGEAIGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEGRTPKG--QAIITEKTGRVKILEKR--NSRRIVIEDDDGKKK-TYQVPYGSKVIVKDGQMVKAGDKLTEGPLDPSTVLKIKGVDEVQDYLLQEVQKVYRSQGVEINDKHIEVIIRQMMRKVRIIDPGDTDFLPGSLVDRLEFNEINHKMV-DEGKQPATCKPELLGITKASLATDSFLSAASFQETTRVLTEASLEGKVDPLLGLKENVIIGQLIPAGTGMKYYRDI 1138
>gi|118444505|ref|YP_877191.1| DNA-directed RNA polymerase subunit beta' [Clostridium novyi NT] >gi|118134961|gb|ABK62005.1| DNA-directed RNA polymerase, beta' subunit [Clostridium novyi NT] (1185 aa)
Score = 2712, Expect = 0.0e+00, Identities = 572/1260 (45%), Positives = 816/1260 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++QIGLASPE+IREWS GEV K ETINY++LKPEKDGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +Y+VLD       K         L S+K  +E+  K  +      E+ D E                                            +GAEA+ +LL  IDL++  K++ E L+ S     ++T   +RRLE ++  + S N+PEWMI+  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L++              NIKS++K++      +W ++ +VI + PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDM+LG+YYLT++K  + G+G +F+N DE+   YQ   +++H+ I +  +   K      GI+ TT GK+I ND +P+++ +++  NP+N  +L  + +V                   TKK L +I++  + KY         + +DKIK  G+ YST  A TIS  D+     K +   +TD  VE+++K Y++G +++DERY++V+  W+  T  V+  +   + +     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC +  G   EV E  +   VIE+L ERL  R+ I D+V P++ +V+ PA   +   +A ++   G+ KV +RSV  CK ++G+C KC+G ++ T   +    ++G++AAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +II+E+ G   ++K        +V  I +     +Y +PF S ++V  G +++ G +ITEGS++  ++L + G + V+NY++ EVQKVYRLQG++I DK++EV++RQ+T KV+I++SG+++   G ++D+  F + NEK I       AT    + G+ +A   T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG
  S:    16 ALQIGLASPEQIREWSRGEVKKPETINYRTLKPEKDGLFCERIFGPIKDWECHCGKYKRVRYKGIVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRSLEKVLYFASYVVLDPKETPLLKK-------QLLSEKEYRESVDKYGE------EAFDAE--------------------------------------------MGAEAVKKLLAEIDLEQLSKELKEALKTSTGQKKVRT---IRRLEVVESFRKSTNRPEWMIIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLVESG---------AAHNIKSSKKMVERVMPQVWDVLEEVISEHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAANNILKPSDGKPVCVPTQDMILGSYYLTLDKDGVKGEGKIFSNPDEVMMAYQTGAINIHAKIKVRMTK-EKDGKIISGIIETTPGKLIFNDSIPQDLGFVDRSNPENEFKLEIDFLV-------------------TKKNLGKIIDKCYTKYGATE---TSTMLDKIKARGYHYSTIGAITISVSDMTVPESKNRLLSDTDLAVEKIEKMYRRGFISEDERYERVIEKWTQTTEDVANALMDNLDR----FNPIFMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIRASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREEDCGSTHG--YEVSEIKEGNEVIETLTERLTGRYSIEDIVDPQTGEVIVPADTYMNADLAEKVEKHGVKKVNIRSVFTCKSKHGVCAKCYGMNMATANKINIGESVGIVAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIITEVAG---TVKLEETKKKRIVHVIDDEGVDKSYDIPFGSRIKVSNGSRIEAGDEITEGSVNPHDILAIKGPKEVKNYLLSEVQKVYRLQGVDINDKHLEVVVRQMTRKVKIKESGDTELLPGTLVDVFDFEEVNEK-IRQQGGEEATGDIALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKSDPLLGLKENVIIGKLIPAGTG 1159
>gi|167769916|ref|ZP_02441969.1| hypothetical protein ANACOL_01257 [Anaerotruncus colihominis DSM 17241] >gi|167667907|gb|EDS12037.1| hypothetical protein ANACOL_01257 [Anaerotruncus colihominis DSM 17241] (1206 aa)
Score = 2711, Expect = 0.0e+00, Identities = 569/1267 (44%), Positives = 813/1267 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQD-NTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYL--NNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSD-----DKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           SI+IGLASP+ +REWS GEV K ETINY++LKPE++GLF E IFGP KD+EC CG+YK+I+++GK+CE+CGVE+T S VRRER+GHIELAAP++HIW  K     S++ L+L++S + +E+V+YF +YIV+D      P   N K+   LS     KE R      L+E YE                                              R G+GAEA+ ELL  +DLDK  +++   L   E  +  K  KL++RLE ++  + S+N+PEWMIL  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLK++++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++  L+            + +NIK+A K++       +W  +  VIK  PVLLNRAPTLHRLGIQAFEP+LVEG+A++LHPLV TA+NADFDGDQMAVHVPLS EA +EAR ++LA+ ++L P DGKP+  PTQDMVLG+YYLTM +   PG G +F + +E    YQ   V +H+ I +  +    +Q   +    I+ TTVG++I ND +P+++ Y+  N+P+++ +L    +V                    KK L +I++   R Y  A        +D+IK  GF+YST+ A T++ +D     EK ++    DK+V+ +K+ Y +G +++D RY++VVS W+  T +V   ++K + +     N I +MA+SGARG++    QL+GMRGL++ +               IE+PIK ++ EGL + EYFNSS GARKG+ DTA++T+ SGY+TR+LVD +QDVIV   DC T +G ++  I D  SG VIE   ER+I R+   DV+ P + +V+    +++T+A A  I  AG  ++++R+ L+C+ + G+C KC+G +L   + V    A+G+IAAQSIGEPGTQLTMRTFHTGG++S  +I QG  R+++LF+   PK    ++IS ++G VS  K         VV   +  E    +V + S LRV EGD V+ G  ITEG+++  E+L V+G   V++Y+IKEVQ+ YR QG++I DK+IEVI+RQ+  KV+I D G++    G  +D +   + N ++   +      + PA+ + ++ G+ +A   T SF++AASFQ+T ++LT+A +KG++D L GLKENVI G L+P GTG  S + +
  S:    19 SIKIGLASPDLVREWSWGEVKKPETINYRTLKPEREGLFCEKIFGPTKDWECYCGRYKRIRYKGKVCERCGVEVTRSKVRRERMGHIELAAPVSHIWYFKG--TSSRMGLLLNMSPRLLEKVLYFASYIVID------PGVTNLKKYTLLSE----KEYRD-----LKEAYED-------------------------------------------DFRAGMGAEAVKELLAELDLDKLSEELKTDL---ETAAGQKRVKLLKRLEVVEAFRQSHNRPEWMILDVVPVIPPDIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPSNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKRLVDLK---------VATNIKNARKMVERASVKDVWDALEVVIKDHPVLLNRAPTLHRLGIQAFEPVLVEGRALKLHPLVCTAYNADFDGDQMAVHVPLSAEAQSEARFLMLAANNLLKPSDGKPVTVPTQDMVLGSYYLTMLREEEPGAGKVFRDFNEATMAYQAGAVGLHAPIKVRVT----RQVGDERVSHIIDTTVGRIIFNDPIPQDLGYVDRNDPEHVFDLEIGFLVR-------------------KKELGKIIDRCIRTYGTAK---TAEVLDRIKAQGFKYSTRGAITVAVYDAVIPPEKAEFIAAADKQVDAIKRQYDRGFISEDVRYERVVSTWNDCTAKVKDALQKTLDE----RNPIYMMADSGARGSMDQIRQLAGMRGLIANTSG-----------RAIEIPIKANYREGLNILEYFNSSRGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCGTHEGIVVCDIVD--SGRVIEDFVERMIGRYAADDVIDPNTGEVIVSRDQMMTEADAQRIKAAGFTELKIRTPLNCESKIGVCAKCYGANLANGQPVGVGEAVGIIAAQSIGEPGTQLTMRTFHTGGIASAADITQGLPRVEELFEARKPKN--SAVISHLDGIVSFEKDQKGGD--FVVVTADDGERFERQVVYGSTLRVSEGDVVRKGDMITEGAVEPNEILMVSGHLAVQDYLIKEVQRTYRTQGVDINDKHIEVIVRQMMRKVKIDDGGDTGLITGANVDKSELLRVNAEIERKNAEDGGTRRPASGLPVLLGITKASLATESFMSAASFQETTRVLTEAAIKGKVDKLQGLKENVIIGKLVPAGTGTVSYDSL 1177
>gi|160935067|ref|ZP_02082453.1| hypothetical protein CLOLEP_03943 [Clostridium leptum DSM 753] >gi|156866520|gb|EDO59892.1| hypothetical protein CLOLEP_03943 [Clostridium leptum DSM 753] (1183 aa)
Score = 2708, Expect = 0.0e+00, Identities = 577/1267 (45%), Positives = 822/1267 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGI-PTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKL---ILSD--DKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           SI+IGLASP+KIREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+I+++GKIC++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ L+LDIS + +E+V+YF  YIV D G  +           +L+ Q+   E   K  + +RE YE  D EA                                          G+GAEAI +LL+ IDLD    ++ E+L  +      K  +L++RLE ++  + S N+PEWMIL  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G + RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++  L++            VSNIK+A K +      +W  +  VIK  PVLLNRAPTLHRLGIQAFEP+LVEG+A++LHPL  TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ ++L P DG+P+  PTQDMVLG+YYLT++K    G+G +F + DE    Y  K + +H+ I +  T    ++   K  ++ TTVG++I N  +P+++ +++  +P++L +L  + +V                    KK L +I++   + +  A    V   +D IK  G++YST+S  T++  D     EK++   E DK+V+ +   +++GL+++ ER   V+  W   TN V+  ++  + +     N I +MA+SGARG++S   QL+GMRGL++ +         KV    IE+PI+ ++ EGL + EYF SS GARKG+ DTA++T+ SGY+TR+LVD +QDVI+  +DC    G  LEV +      VIES++ERLI R+   D V  ++ +VL    +++T   A+ IV+AG+ K+++RS+L+CK ++G+C+KC+G++L     V    A+G+IAAQSIGEPGTQLTMRTFHTGGV+S  +I QG  R+++LF+   PK    +IISEI GKV   +   +     VV  + + E  +Y +PF S + VEEGD ++ G  ITEGS++  ++L + G + V+NY+I+EVQ+VYR+QG++I DK+IEVI+RQ+  KV++ D G++      +++ + F   NE++   I +   D   AT    + G+ +A   T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G L+P GTG     D+
  S:     8 SIKIGLASPDKIREWSYGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRIRYKGKICDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDISPRMLEKVLYFAMYIVTDPGAAR-----------ELTKQQFLNE---KEYRDMREKYED-DFEA------------------------------------------GMGAEAIKKLLEEIDLDALSNELKEELATATGQ---KRVRLLKRLEVVESFRLSGNRPEWMILDVVPVIPPDIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPNNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKRLVETG---------AVSNIKAARKAVERAKPEVWDALEVVIKGHPVLLNRAPTLHRLGIQAFEPVLVEGRALKLHPLSCTAYNADFDGDQMAVHVPLSAEAQAEARFLMLAAGNLLKPSDGRPVTVPTQDMVLGSYYLTLDKDGEKGEGKVFRDFDEALMAYDAKAISLHAKIKVRRTLELGEETISK--LIETTVGRIIFNQPIPQDLGFVDRSDPEHLFDLEIDFLV-------------------GKKQLGKIIDRCIKVHGTAKTSEV---LDNIKAQGYKYSTQSGITVAVCDATIPPEKKEILAEADKQVDRVGAQFRRGLISNAERSAAVLKIWDKATNDVTAKLQSGLDR----YNPIYMMADSGARGSMSQIRQLAGMRGLIANT-------SGKV----IEIPIRANYREGLNILEYFISSRGARKGLADTALRTADSGYLTRRLVDVSQDVIIREDDCGAATG--LEVFDIRDGKEVIESMHERLIGRYLCEDFVDAETGRVLVSKDKMMTDEDADIIVNAGVKKIQIRSILNCKAKHGVCKKCYGSNLANGMPVTVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVASAEDITQGLPRVEELFEGRKPKHL--AIISEIGGKVRFEEIKKNRH--AVVFNQETGEEKSYLIPFGSRVHVEEGDVIEAGDMITEGSVNPHDILAIKGTDAVQNYLIQEVQRVYRMQGVDINDKHIEVIVRQMMKKVRVDDEGDTLLMPNSLVEKSEFDTANEEIRARIAAGELDLREATCTPTLLGITKASLATDSFLSAASFQETTRVLTDAAIKGKVDPLLGLKENVIIGKLVPAGTGMHRYNDV 1166
>gi|187933483|ref|YP_001884467.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum B str. Eklund 17B] >gi|187721636|gb|ACD22857.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum B str. Eklund 17B] (1177 aa)
Score = 2696, Expect = 0.0e+00, Identities = 572/1260 (45%), Positives = 814/1260 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +IQIGLASPE+IREWS GEV K ETINY++LKPEKDGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L++D+S + +E+V+YF +YI                 VID       KET    ++ L E                 K  R   D   E +          F++       G+GAEAI +LL  IDL    K++ E L++S      K  +++RRLE ++    S N P+WMI+  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         +D I  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPL  TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM++    G+GM F+N DE    Y+ K + +H+ I +           K GI+ TTVGK+I N+ +P+++ ++N  D  E+ +                  ++    TKK+L ++++  +  +      I+   +D IK +G+ YS+  A T++A D+     K     E D+ +++++K Y++G +++DERY++V+  W+  T +V+  +   + K     N I +MA+SGARG+ S   QL+GMRGLM+                 +E+PI+ SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD  QDVIV  EDC T  G     + + K GS VIE L ERLI R+   DVV P S +++    E +   +A+++V AGI KV++RS   C  + G+C KC+G ++ T K ++   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    +I+SEI G V  I+ +     + V+     + S  Y +PF S L+V +GD ++ G +ITEGS++  +++ + G++  R Y++ EVQKVYRLQG++I DK++EV+++Q+T KV+I +SG+++   G +IDI  F++ N+K +       A     + G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG
  S:     9 AIQIGLASPEQIREWSRGEVKKPETINYRTLKPEKDGLFCERIFGPMKDWECHCGKYKRVRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLLMDMSPRALEKVLYFASYI-----------------VID------PKETPLLKKQLLNE-----------------KEYREAIDKYGEDS----------FVA-------GMGAEAIQDLLGQIDLIAGSKELKEDLKQSTGQ---KRVRIIRRLEVVESFAKSGNNPKWMIINVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QDGIAHNIKSAKRMVERVLPQVWDVLEEVITDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLACTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAGNILKPSDGKPVCVPTQDMVLGSYYLTMDRTGAKGEGMTFSNKDEAVMAYESKYIDIHAQINVRVYKEIDGVL-KSGIIKTTVGKLIFNESIPQDLGFVNREDEKEKFN-----------------LEIDFLVTKKSLGKVIDQSYMLHGPTKTSIM---LDNIKALGYHYSSIGAVTVAASDMIVPPVKYDLLHEADETIDKIEKMYKRGFISEDERYERVIEKWTKTTEEVADALMDSLDK----FNPIYMMADSGARGSKSQIKQLAGMRGLMASPSG-----------KILELPIRASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVCQDVIVREEDCGTDNGI---YVSEIKEGSEVIEELRERLIGRYTAEDVVDPNSGEIIVARNEYMNPIIADKVVSAGIKKVKIRSAFTCNCKIGVCAKCYGMNMATAKKIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AIVSEIHGNV-RIEETKKKRAVFVMGADGDERS--YDIPFGSRLKVSDGDYIEAGDEITEGSVNPHDIMNIKGVDGARRYLLSEVQKVYRLQGVDINDKHLEVVVKQMTRKVKILESGDTELLPGIMIDIFDFQEANDK-VREFGGEEAKGEQSLLGITKAALATDSFLSAASFQETTRVLTEAAIKGKVDPLIGLKENVIIGKLIPAGTG 1152
>gi|51894219|ref|YP_076910.1| DNA-directed RNA polymerase subunit beta' [Symbiobacterium thermophilum IAM 14863] >gi|81610340|sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|51857908|dbj|BAD42066.1| RNA polymerase beta' subunit [Symbiobacterium thermophilum IAM 14863] (1179 aa)
Score = 2695, Expect = 0.0e+00, Identities = 559/1260 (44%), Positives = 815/1260 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASM-ENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---------------KDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           SIQIGLASPE+IR+WS GEV K ETINY++L+PE+DGLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +  PS++ L+LDIS + +E+V+YF  YIV D G+    +         L ++   +E R K     +         A M   A+K  + +   D +A        EE+ + + + +G R                          K+R +            RRLE ++  + S N+PEWMIL+ I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP LK++Q G+P  M L+LFKPF++ +L+          D    NIKSA++++      +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP+LVEG+AI++HPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDG+P+ITP++DM+LG+YYLT+ K +   + M F++  E    YQ   V +H  + I     PK   P                   + TT+G++I N+VL  ++ Y+N                              +   KK + +I+++ +RK             DKIKD+GF ++T+S  TI+  D+    +K++   + +K+V+++++ Y++GL+T+DERY++V++ WS    +V+  + K ++      N + +M  SGARGNIS  TQL+GMRGLM+     D   K       +E+P+K +F EGLTV EYF S++G RKG+ DT+++T+ SGY+TR+LVD  QDVIV  +DC T  G I    E  + G+VIE +   ++ R  + D+VHP++ +++  A E+I + +A +I+ AGI +V +RSVL C+   G+C+ C+G +L T +LV+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++II+E++G+V SI        I + +     ES+ Y +P+ + ++V  G  V+ G ++TEGS++  +LL+V G+  V+ Y+++EVQKVY LQG++I DK+IE+++RQ+  KV+++D G++D   G  +DI  F  ENE++I+ +  VPA A  ++ G+ +A   T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G LIP GTG
  S:     9 SIQIGLASPERIRQWSRGEVKKPETINYRTLRPERDGLFCERIFGPTRDWECHCGKYKRVRYKGIVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLILDISPRALEKVLYFAAYIVTDPGDTPLMEK-------QLLTENEYREYREKYGDAFK---------AGMGAEAVKVLLEKLDLDKMA--------EELRHEVRTVSGQR--------------------------KIRAT------------RRLEVVEAFRKSGNRPEWMILEVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPHLKLHQCGLPKEMALELFKPFVMKKLV---------NDGHAHNIKSAKRMVERMRPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPVLVEGRAIQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAHNILNPKDGQPVITPSKDMLLGSYYLTLPKPDSEPK-MRFSHPHEALLAYQNGLVELHDWVEIRFPEPPKDLEPYSEEWWEHPDNWNTVSGKRIKTTIGRMIFNEVLHPKLRYIN------------------------------ETIEKKWMGKIIDMAYRKLGTVK---TAEQTDKIKDLGFRFATQSGATIAISDIKVPGDKDEILRQAEKEVDQVERNYRRGLITNDERYQRVIAIWSEAKEKVTSTLVKTMED----FNPVNMMMKSGARGNISQITQLAGMRGLMA-----DPSGK------IVELPVKANFREGLTVLEYFLSTHGTRKGLADTSLRTADSGYLTRRLVDVAQDVIVREDDCGTTAG-ITWTEEVDQFGNVIEPITPHIVGRVALNDIVHPETGEIIVYANEMIDEDLAEQILAAGIKEVTIRSVLTCRTRYGVCRACYGRNLATGRLVDVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKG--QAIIAELDGEV-SITEQKGRREITITS--EDGESVTYSIPYGARVKVRSGQFVEAGDELTEGSVNPHDLLRVKGLRGVQRYLLREVQKVYNLQGVDINDKHIEIMVRQMLRKVKVEDPGDTDLLPGGFVDIFDFEDENERVIM-EGGVPAVARPMLLGITKASLATDSFLSAASFQETTRVLTDAAIKGKRDPLLGLKENVIIGKLIPAGTG 1154
>gi|147676648|ref|YP_001210863.1| DNA-directed RNA polymerase subunit beta' [Pelotomaculum thermopropionicum SI] >gi|146272745|dbj|BAF58494.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Pelotomaculum thermopropionicum SI] (1170 aa)
Score = 2692, Expect = 0.0e+00, Identities = 575/1266 (45%), Positives = 823/1266 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEG--KVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           I+IGLASP++IR WS+GEV K ETINY++LKPE+DGLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YFV+YIV D G+                           ++K L    E  D      NA K  +                                  GAEAI +LL+ I+L++  +++ ++L++      I+    +RRLE ++  + S N+PEWMIL+ I V  P+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPEL ++Q G+P  M L+LFKPF++  L+          D    NIKSA++++      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+AI++HP+V TA+NADFDGDQMAVHVPLS EA AEAR ++L+S +IL PKDG+P+  PTQDMVLG YYLT+EK  +PG+G  F + +E    Y    V +H+ +        K + P  G + TTVG++I N+V+P E+ Y N                              +   KK LS+IV+  +RK            +D IK +GF ++T++  TI   D+     K++  +E +++VE++++ Y++GL+T++ERY+KV+  W+  T +V+  + + + K     N + +MANSGARGNI    QL+GMRGLM+                 I++PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD  QDVIV   DC T +G  +EV E      VIE L +R+I R  + DV HP++ ++LA AGE IT++ A +IV AGI KV++RSVL C+   G+C KC+G +L T + V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++II+E +G  +V  +K   +    + VT ++  +S+ Y+VP+ + L+V +GD+V  G ++TEGS++  +LLK+ G++ V+ Y+++EVQ+VYRLQG++I DK+IEV+IRQ+  KV++ + G++D   G +IDI  F  EN + I +    PATA  ++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G L+P GTG     +I
  S:    10 IRIGLASPDQIRAWSSGEVKKPETINYRTLKPERDGLFCERIFGPTRDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERLGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEKVLYFVSYIVTDPGDTGL------------------------IKKQLLTETEYRDCRERYGNAFKASM----------------------------------GAEAIKKLLEEINLEELARELRQELKEVTGQRKIRA---IRRLEVVEAFRKSGNRPEWMILEVIPVISPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELHLHQCGLPKEMALELFKPFVMKRLV---------NDGYAHNIKSAKRMVERVRPEVWEVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIQIHPMVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLSSNNILNPKDGRPVAIPTQDMVLGIYYLTVEKQGVPGEGKAFKDPEEAVMAYYNNAVSLHAAV--------KVRMPGMGRIETTVGRIIFNEVIPRELGYYN------------------------------QVIDKKVLSKIVDDCYRKL---GFSATSKLLDGIKKLGFTFATRAGVTIGIQDITIPARKKEILKEAEQQVEKVEQQYRRGLITEEERYRKVIGIWNDATKEVTDALIETLDK----FNPVYMMANSGARGNIQQIRQLAGMRGLMADPSG-----------RIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDVIVREVDCGTGQG--IEVTEIKDGNEVIEKLEDRIIGRVALEDVKHPETGEILAFAGEEITESEAAKIVAAGIKKVKIRSVLTCRTRYGVCIKCYGRNLATGRQVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARRPKG--QAIIAEADGTVEVREVKGRRE----IEVTAEDGTKSV-YQVPYGARLKVRDGDRVYAGDELTEGSVNPHDLLKIKGVQGVQIYLLQEVQRVYRLQGVDINDKHIEVMIRQMLRKVKVDEPGDTDLLPGGLIDIFEFEDENRR-IKNLGGEPATAKPVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKLDLLLGLKENVIIGKLVPAGTGMSRYRNI 1138
>gi|167768222|ref|ZP_02440275.1| hypothetical protein CLOSS21_02778 [Clostridium sp. SS2/1] >gi|167709746|gb|EDS20325.1| hypothetical protein CLOSS21_02778 [Clostridium sp. SS2/1] (1199 aa)
Score = 2687, Expect = 0.0e+00, Identities = 572/1273 (44%), Positives = 835/1273 (65%)
  Q:     4 KSSRIT--SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDC-----KTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +S++I+  +I+IGLASPEKIREWS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYKK++++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LDIS + +E+V+YF  YIVLD G+     +  +K+V+                K  RE YE              K   TF                          R G+GAEA+ ELL+ IDL+ E K + ++ + +      K  ++V+RLE ++   +S+NKPEWMIL  + V PPD RP++QL+GG+F TSD+N  YR+II RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK+YQ G+P  M ++LFKPF++ EL+++          +  NIKSA+K++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAIRLHPLV TA+NADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT+EK    G+G  F + +E    Y+ K + +HS I +  +   K   P   I+  T+G+++ N+++ +++ +++   P+N         + +  D+   + KK++     K+ L   +NI H     A +      +D IK IG+++ST+ A T+S  D+    EK +   +  K+VE + + Y++GL+T++ERYK VV  W    + ++   +KLI   + L N+I +MA+SGARG+     QL+GMRGLM+ +              TIE+PIK++F EGL V EYF S++GARKG++DTA++T+ SGY+TR+LVD +QD+I+  +DC     +   G  +E   D +   VIESL ER+  R+   ++V+ ++ +V+  A  +IT   A  + DAG   V++R++L CK   G C KC+G+++ T + V+   A+G+IAAQSIGEPGTQLTMRTFH GGV +G +I QG  R+++LF+   PK    +II+E  G+V  +K +     + ++T + + +   Y +P+ S L+V+EG  ++ G ++TEGSI+  +LL++ GI  V++Y+I+EVQ+VYRLQG++I DK++EVI+RQ+  KV+I+D G++ +  G ++D+    K N+++     +  A A  ++ G+ +A   T SFL+AASFQ+T K+LTDA +KG++D L GLKENVI G LIP GTG +   D+
  S:     9 QSNKISFDAIKIGLASPEKIREWSRGEVKKPETINYRTLKPEKDGLFCEKIFGPTKDWECHCGKYKKVRYKGVVCDRCGVEVTKASVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDISPRTLEKVLYFACYIVLDAGD----TDLAYKQVLT--------------EKEYREAYE--------------KYGDTF--------------------------RVGMGAEAVKELLQAIDLEAEAKSLQDEFKTATGQ---KRARIVKRLEVVEAFLNSDNKPEWMILDAVPVIPPDIRPMVQLDGGRFATSDLNDLYRRIINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPDLKIYQCGLPKEMAIELFKPFVMKELVERK---------LAHNIKSAKKMVEKLQPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVCTAYNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTLEKDGDKGEGKYFKSENEAYLAYENKVITLHSKIKVRRTGVDKDGNPISQIVDCTLGRILFNEIILQDLGFVDRSKPEN--------ALAYEIDFH--VGKKQL-----KQILDRCINI-HGATKTAEV------LDDIKAIGYKFSTRGALTVSISDMTVPPEKPQILGDAQKQVEFITEQYKRGLMTEEERYKAVVKTWFDADDVLT---DKLISGLDRL-NNIFMMADSGARGSNQQIKQLAGMRGLMADTSG-----------RTIELPIKSNFREGLDVLEYFISAHGARKGLSDTALRTADSGYLTRRLVDVSQDLIIREQDCCEGTGEEIPGMYVEAFMDGQ--EVIESLEERITGRYAAEELVNKETGEVIVKANHMITPKRAKAVCDAGYTSVKIRTMLTCKSGVGACAKCYGSNMATGQAVQVGEAVGIIAAQSIGEPGTQLTMRTFHAGGV-AGDDITQGLPRVEELFEARKPKGL--AIIAEFGGEV-QLKDTKKKREV-IITNRETGDVKTYLIPYGSRLKVQEGQILEAGDELTEGSINPHDLLRIKGIRAVQDYMIREVQRVYRLQGVDINDKHVEVIVRQMLKKVRIEDGGDTGYLPGAMVDVLELEKRNKEMEEQGLQT-AIADQIMLGITKASLATDSFLSAASFQETTKVLTDAAIKGKVDPLVGLKENVILGKLIPAGTGMRRYRDV 1173
>gi|167039513|ref|YP_001662498.1| DNA-directed RNA polymerase subunit beta' [Thermoanaerobacter sp. X514] >gi|166853753|gb|ABY92162.1| DNA-directed RNA polymerase, beta' subunit [Thermoanaerobacter sp. X514] (1157 aa)
Score = 2685, Expect = 0.0e+00, Identities = 575/1241 (46%), Positives = 821/1241 (66%)
  Q:    29 VTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           + K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T S VRRER+GHIELAAP+AHIW  K +P  S++ L+LD+S + +E+V+YFV+Y+V+D G+    K    K+++      S KE R  L K   +                                                 R G+GAEAI ELL+ IDL+K  K++  ++R+S     ++    +RRLE ++   DS N+PEWMIL  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M L+LFKPF++ +L+    DEG     +  +IKSA++++      +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+AI+LHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P+DGKP++TPTQDMVLG YYLT ++  + G+G  F++ +E  T YQ+  +H+H+ I +  +        K  I+ TTVGK+I N+ +P+++ Y++  NP+   +L  ND+V+                   K  L +I++ ++R +          T+DKIK++GF YSTK+A T+S  D+    EKEK  +E D+ V +++  +++GL++++ERY+ ++  W+  T +V++ +   + K     N I +MA+SGARG+ +   QL+GMRGLM+                 IE+PI+++F EGL V E+F S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  EDC T +G  +E I +     +IE L +R+I R    DVV  +  K++    E+I +  A +I  AGI KV++RS+L CK  +G+C+ C+G DL T +LV    A+G+IAAQ+IGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    ++ISEI G V  I  S     ++V   +NS  S  Y +P+ S L+V +G  ++ G ++TEGS++  +LLK+ GI  V+ Y+++EVQKVYRLQG+EI DK+IEVIIRQ+  KV+++D G++    G++ID+  F +EN+K +    K PAT    + G+ +A   T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G LIP GTG
  S:     1 MKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVAHIWYVKGIP--SRMGLLLDMSPRALEKVLYFVSYVVIDPGDTPLTK----KQLL------SEKEYREYLDKYGNK------------------------------------------------FRAGMGAEAIKELLQEIDLEKLSKELKAEIRESTGQKRVRA---IRRLEVVQAFIDSGNRPEWMILDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKVYQCGLPKEMALELFKPFVMKKLV----DEG-----LAQHIKSAKRMVEKIKPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHVPLSMEAQAEARFLMLAANNILKPQDGKPVMTPTQDMVLGCYYLTADEEGVQGEGKYFSSPEEAITAYQLGYIHIHAKIKVKMTK-EIDGVKKSKIIETTVGKIIFNEAIPQDLGYVDRTNPETAFDLEINDLVD-------------------KSKLGKILDRVYRLHGPTK---TAETLDKIKELGFRYSTKAAITVSVSDMVIPKEKEKLLKEADEMVSKIESQFRRGLISEEERYESIIRTWNMTTEKVTEALMTSLDK----FNPIFMMAHSGARGSKNQIRQLAGMRGLMADPSG-----------RIIELPIRSNFREGLNVLEFFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREEDCGTDEGIYVEEIRE--GNEIIERLADRIIGRVAAEDVVDNEG-KIIVRRNELINEEEAEKIEKAGITKVKIRSLLTCKSRHGVCRMCYGRDLATGELVNIGEAVGIIAAQAIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AVISEISG-VVRINESKKRREVIVTDEENSI-SKTYLIPYGSRLKVHDGQVIQAGDELTEGSVNPHDLLKIKGIFAVQTYLLQEVQKVYRLQGVEINDKHIEVIIRQMMRKVKVEDPGDTSMLPGELIDMFKFEEENKKAVEKGLK-PATGRRALLGITKAALATDSFLSAASFQETTRVLTDAAIKGKVDPLLGLKENVIIGKLIPAGTG 1124
>gi|167748164|ref|ZP_02420291.1| hypothetical protein ANACAC_02908 [Anaerostipes caccae DSM 14662] >gi|167652156|gb|EDR96285.1| hypothetical protein ANACAC_02908 [Anaerostipes caccae DSM 14662] (1191 aa)
Score = 2680, Expect = 0.0e+00, Identities = 573/1267 (45%), Positives = 826/1267 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKK-----GTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +I+IGLASPEKIREWS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LDIS + +E+V+YF  YIVLD G      +  +K+V+      + KE R    K                                             + SSF   R G+GAE+I ELL+ IDL  E K + ++ + +      K  ++V+RLE ++   +S N PEWMIL  + V PPD RP++QL+GG+F TSD+N  YR+II RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+++          +  NIKSA+K++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TA+NADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT+EK    G+G  F + +E    Y+ K + +H+ I +  +   K       ++  T+G+++ N+++ +++ +++  NP+N  +L          +    + KK++     K+ L + +NI H     A +      +D IK +G++YST+ A T+S  D+    EK++       + E +   +++GL+T++ERYK VV  W    + ++   +KLI   +   N+I +MA+SGARG+     QL+GMRGLM+ +              TIE+PIK++F EGL V EYF S++GARKG++DTA++T+ SGY+TR+LVD +QD+I+   DC         G  +E   D +   VIESL +R+  R+   ++ HP++ +VL  +  +IT   A  ++DAG+ KV++R++L C+ + G C KC+G+++ T + V+   A+G+IAAQSIGEPGTQLTMRTFH GGV +G +I QG  R+++LF+   PK    +IISE  GKV  IK +     + V+T K + +   Y +P+ S L+V EG +V+ G ++TEGS++  ++LK+ GI  V++Y+I+EVQ+VYRLQG++I DK++EVI+RQ+  KV+I++ G+SD+  G +ID+  F K N +L   + +  A A  +I G+ +A   T SFL+AASFQ+T K+LTDA +KG++D L GLKENVI G LIP GTG K   ++
  S:    17 AIKIGLASPEKIREWSRGEVKKPETINYRTLKPEKDGLFCEKIFGPSKDWECHCGKYKKIRYKGVVCDRCGVEVTKANVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDISPRSLEKVLYFACYIVLDAGE----TDLAYKQVL------TEKEYRDAYDK---------------------------------------------YGSSF---RVGMGAESIKELLEAIDLPAEAKSLKDEFKTATGQ---KRARIVKRLEVVEAFLNSENNPEWMILDVVPVIPPDIRPMVQLDGGRFATSDLNDLYRRIINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELVERK---------LSHNIKSAKKMVEKLQPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTLEKEGDKGEGKYFKSENEAFLAYENKAITLHARINVRRTKIDKDGNKISKVVQCTLGRILFNEIIMQDLGFVDRSNPENALDL----------EIDFHVGKKQL-----KQILDKCINI-HGATKTAEV------LDDIKALGYKYSTRGALTVSISDMTVPEEKKEILAGAQDQAEFINNQFKRGLMTEEERYKAVVKTWFDADDVLT---DKLITGLDKY-NNIFMMADSGARGSNQQIKQLAGMRGLMADTSG-----------RTIELPIKSNFREGLDVLEYFISAHGARKGLSDTALRTADSGYLTRRLVDVSQDLIIREADCGLDADGQIPGMYVEAFMDGQ--EVIESLQDRITGRYAAEEIKHPETGEVLVKSNHMITPRRAKTVIDAGLTKVKIRTMLTCQSQVGCCAKCYGSNMATGQAVQVGEAVGIIAAQSIGEPGTQLTMRTFHAGGV-AGDDITQGLPRIEELFEARKPKGL--AIISEFAGKV-QIKDTKKKREV-VITNKETGDMKAYLIPYGSRLKVMEGQEVEAGDELTEGSVNPHDILKIKGIRAVQDYMIREVQRVYRLQGVDINDKHVEVIVRQMLKKVRIEEGGDSDYLPGAMIDVLEFEKTNRELEERNLET-AKAEQIILGITKASLATDSFLSAASFQETTKVLTDAAIKGKVDPLVGLKENVILGKLIPAGTGMKRYRNV 1173
>gi|150392167|ref|YP_001322216.1| DNA-directed RNA polymerase subunit beta' [Alkaliphilus metalliredigens QYMF] >gi|149952029|gb|ABR50557.1| DNA-directed RNA polymerase, beta' subunit [Alkaliphilus metalliredigens QYMF] (1171 aa)
Score = 2678, Expect = 0.0e+00, Identities = 572/1278 (44%), Positives = 826/1278 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKN--FNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILI-TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATT--ISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI---IEEGNKMYELE 1287
           SI+I LASPEKIR+WS GEV K ETINY++LKPEK+GLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF  YIV++ G     +      KE  D   +   K       + ++ + ESID++A M   ++HK        L ES     I  V                                 ++ E  RKS+N                         P WMIL  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R KP+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK YQ G+P  M L+LFKPF++ +L+++             NIKSA++++      +W ++ +VI Q PVLLNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TA+NADFDGDQMAVHVPLS EA AE+R ++L+  +IL PKDG+PI TPTQDMVLG YYLT++   + G+G +F + +EL   Y+ K V +H+ + +      K      G L+ +TVG+ I N+ +P+++ +++   +L  L  + +                    TK  L +++    RK+ +    I+   +D IK++GF+YST+ A T  +S  DVPE   K +   + +++V++ +K +++GL++D+ERY+KV+  W+  T +V+  +   + +     N+I IMA+SGARG+ +   QL GMRGLM+ +  +           T+E+PIK++F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVI+   DC T+ G + +  +D     VIE L  R++ R  I D++HP++KKV+ P G+II +  A  I +AGI+KV +RS L C+ ++G+C  C+G +L T + V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    +IISEI GKV  I  S     + V     ++E + Y +P+ S ++V++G  ++PG +ITEGS++  ++L++ G+E V+ YIIKEVQ+VYRLQG++I DK+IEVI RQ+ ++++++++G+++   G + ++  F   N+K I  +   PAT    + G+ +A   T SFL+AASFQ+T ++LT+A +KG+ D L GLKENVI G LIP GTG K  ++I    E   K+ E+E
  S:     9 SIKIALASPEKIRQWSKGEVKKPETINYRTLKPEKEGLFCEKIFGPTRDWECHCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRSLEKVLYFAAYIVINPGETPLTEKQILTEKEYADAIEKYGPKFKAGMGAEAVKGLLESIDLDA-MNIELRHK--------LKESTGQKRIRTVRRL------------------------------EVVEAFRKSKNN------------------------PAWMILDVVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGKPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKFYQCGLPKQMALELFKPFVMKKLVQEN---------YAHNIKSAKRMVEKVKPEVWGVLEEVISQHPVLLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVHVPLSVEAQAESRFLMLSINNILAPKDGEPITTPTQDMVLGCYYLTIQDEGVLGEGTIFKDFEELLLAYETKAVSLHAKVKVRM----KLSAEDSGKLVESTVGRFIFNEKIPQDLGFVDRSKDLYALEVDFLC-------------------TKGALGKVIGKCFRKHGNTITSIM---LDYIKELGFKYSTRGAITVAVSDMDVPE--AKAELISQAEQRVDKYEKAFRRGLISDEERYEKVIETWTETTEKVTDALMAGLDR----FNNIFIMADSGARGSKNQIRQLGGMRGLMANASGH-----------TVEIPIKSNFREGLTVLEYFTSTHGARKGLADTALRTADSGYLTRRLVDVSQDVIIRELDCGTETGIVAKAFKD--GNEVIEELYFRIVGRHSIDDIIHPETKKVIVPKGDIIFEDAAETITEAGIEKVAIRSALACRSKHGVCGTCYGRNLATGEPVKVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AIISEISGKV-DISESKRKREVTVT--DENQEVVTYTIPYGSRVKVKQGQILEPGDEITEGSVNPHDILRIKGVEGVQTYIIKEVQRVYRLQGVDINDKHIEVISRQMLSRIKVEEAGDTELLPGSLENVFAFELANQKAI-EEGGEPATGNIALLGITKASLATDSFLSAASFQETTRVLTEAAIKGKEDHLIGLKENVIIGKLIPAGTGMKRYKNIAISTETDEKLDEIE 1168
>gi|166030467|ref|ZP_02233296.1| hypothetical protein DORFOR_00128 [Dorea formicigenerans ATCC 27755] >gi|166029719|gb|EDR48476.1| hypothetical protein DORFOR_00128 [Dorea formicigenerans ATCC 27755] (1224 aa)
Score = 2674, Expect = 0.0e+00, Identities = 563/1267 (44%), Positives = 835/1267 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKK----GTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGID-------KVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +I+IGLASPEKI EWS GEVTK ETINY++LKPE+DGLF E IFGP KD+EC CGKYKKI+++G +C++CGVE+T++ VRRER+GHI LAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +YIVLD+G      +  +K+V+   S++  +E R    K                                                   G R G+GAE+ILELL+ IDL+KEY+D+ E L+ +      K  ++V+RLE ++  ++S NKPEWMI+ N+ V PPD RP++QL+GG+F TSD+N  YR+II RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGK G FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+         ++    NIK+A+K++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TAFNADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT E+    G+G +F +V+E    Y+ + + +HS I +  +          GI+ +T+G+ I N+++P+++ +++      E  +N ++    +    + KK++     K+ L +++N      + A+ E+    +D +K IG++YST++A T+S  D+    +K +  ++    V+ + K +++GL+T++ERYK+VV  W +  +++++ +   + K     N+I +MA+SGARG+     QL+GMRGLM+ +  +           TIE+PI ++F EGL V EYF S++GARKGM+DTA++T+ SGY+TR+LVD +Q++I++  DC  K     G  ++   D K    IESL ER+  R+  +D+V  K   VL     ++T   A  I   G++       ++++R++L C+  +G+C KC+G ++ T + V+   A+G+IAAQSIGEPGTQLTMRTFH GGV+ G +I QG  R+++LF+   PK    +II+EI G  +++  +     I +VT   + ES  Y +P+ S ++V +G +++ G ++TEGSI+  ++L++ GI  V++Y+I+EVQ+VYRLQG+EI DK+IEVI+RQ+  K++I++SG+++F  G  +D   F   NE ++ ++ K PA    +I G+ +A   T SFL+AASFQ+T K+LT+A +KG+ID L GLKENVI G  IP GTG +   DI
  S:    17 AIKIGLASPEKILEWSKGEVTKPETINYRTLKPERDGLFCERIFGPSKDWECHCGKYKKIRYKGVVCDRCGVEVTKASVRRERMGHIALAAPVSHIWYFKGIP--SRMGLILDLSPRTLEKVLYFASYIVLDKGE----TDLQYKQVL---SEQEYQEARESWGK---------------------------------------------------GFRVGMGAESILELLQAIDLEKEYEDLTEGLKGATGQ---KRARIVKRLEVVEAFRESGNKPEWMIMTNVPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKSGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELV---------QNGTAHNIKNAKKMVERLQPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTQERPGAAGEGKIFKSVNEAILAYENQAITLHSKIKVRVTKTMPGGEEITGIVESTLGRFIFNEIIPQDLGFVD-----REKEENKLL---LEIDFHVGKKQL-----KQILEKVINT---HGATATAEV----LDAVKAIGYKYSTRAAMTVSISDMTVPPQKPQMIQQAQDTVDRITKNFKRGLITEEERYKEVVETWKATDDKLTEALLSGLDK----YNNIFMMADSGARGSDKQIKQLAGMRGLMADTTGH-----------TIELPITSNFREGLDVLEYFMSAHGARKGMSDTALRTADSGYLTRRLVDVSQELIIHEVDCAKKDAPIPGIFVKAFMDGKEE--IESLQERITGRYLCYDIVD-KDGNVLVKKNHMVTPKRAELICKKGVNENGEPLTQIKIRTILTCRSHSGVCAKCYGANMATGEPVQVGEAVGIIAAQSIGEPGTQLTMRTFHNGGVAGG-DITQGLPRVEELFEARKPKGL--AIITEIAG-TANLNDTKKKREI-IVTNHETGESKAYLIPYGSRIKVADGAELEAGDELTEGSINPHDILRIKGIRAVQDYMIQEVQRVYRLQGVEINDKHIEVIVRQMLKKIRIEESGDTEFLPGTNVDRLEFEDVNE-VLEAEGKEPAIGEPIIMGITKASLATNSFLSAASFQETTKVLTEAAIKGKIDPLVGLKENVIIGKHIPAGTGMRKYRDI 1178
>gi|169830428|ref|YP_001716410.1| DNA-directed RNA polymerase, beta' subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169637272|gb|ACA58778.1| DNA-directed RNA polymerase, beta' subunit [Candidatus Desulforudis audaxviator MP104C] (1154 aa)
Score = 2671, Expect = 0.0e+00, Identities = 554/1259 (44%), Positives = 806/1259 (64%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILI-TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEG--KVSSIKASPDNPNILVVTIKNSK-ESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           I+IGLAS + I  WS+GEV K ETINY++LKPE+DGLF E IFGP +D+EC CGKYK+++++G +C++CGVE+T S VRRER+GHI+LAAP++HIW  K +  PS++ L+LD+S + +E+V+YFV+YIV + G+        FK+   L +++  +E R K            D +A+M                                          GAEAIL+LL  IDL++   ++ +++R       I+    +RRLE ++  + S N P WMI++ + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP LK++Q G+P  M L+LFKPF++  L+          D    NIKSA++ +      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+AI++HPLV TA+NADFDGDQMAVHVPLS EA AEAR ++L++++IL PKDG+P+  PTQDMVLG YYLT+E+    G+G  F +V+E    Y+   + +H+++ +            DG L+ TTVG++I N+ +P E+SY+N                              K   KK LS IV+   R Y     +     +D IK +GF+Y+T+   TI   D+     K++   E +  VE ++  Y++GL+T DE+Y++ +  W+  T  V++++   + +     N + +MA SGARGNI    QL+G+RGLM+                 I++PIK +F EGL+V EYF S++GARKG+ DTA++T+ SGY+TR+LVD  QDVIV   DC T +   +EV +      +IE L +R++ R     +VHP++  V+  A E I +  A +IV AGI KV +RSV  CK  +G+C+KC+G +L T ++V+   AIG+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   ++I++EI+G  +V  +K   +      + I+    E + Y +PF + L+V+ GD+V+ G +++EGS++  +LLK+ G   V+ Y+++EVQ+VYR+QG++I DK+IEV+IRQ+  KV+I + G+++F  G ++DI    +EN + + +    PAT+ +++ G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG
  S:    10 IRIGLASADHITTWSHGEVKKPETINYRTLKPERDGLFCERIFGPTRDWECYCGKYKRVRYKGIVCDRCGVEVTRSKVRRERLGHIKLAAPVSHIWYFKGI--PSRMGLLLDMSPRALEKVLYFVSYIVTNPGDTPL-----FKK--QLLTEQEYREFRDKY---------GTDFQAAM------------------------------------------GAEAILQLLDEIDLNELAAELRQEIRDVTGQRRIRA---IRRLEVVESFRKSQNSPSWMIMQVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLKLHQCGLPKEMALELFKPFVMKRLV---------GDGHAHNIKSAKRKVERVRPEVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIQIHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLSTYNILNPKDGRPVTIPTQDMVLGIYYLTIERPGARGEGKAFRDVNEAILAYESGVIELHALVKVNMG---------DGRLLETTVGRLIFNEAMPPEISYIN------------------------------KLVDKKELSLIVD---RCYRRLGYKRTAELLDGIKQLGFKYATQGGLTIGMNDIVIPERKKEILGEAESHVEMIEDQYRRGLITFDEKYRQTIETWNRATELVTQELLNTLDR----FNPVYMMATSGARGNIQQIRQLAGLRGLMADPSG-----------RIIDLPIKANFREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDVIVREIDCGTDE--YVEVGDVRDGTEIIEMLQDRIVGRTAARAIVHPETGAVIVDADEEILEEAAEKIVAAGIKKVAIRSVFTCKTRHGVCKKCYGRNLATGRVVDIGEAIGIIAAQSIGEPGTQLTMRTFHTGGV-AGEDITQGLPRVEELFEARRPKG--QAIVAEIDGLVEVREVKGRRE------IEIRGENGERVQYAIPFGARLKVQNGDRVEAGDELSEGSVNPHDLLKIKGPAAVQQYLLREVQRVYRMQGVDINDKHIEVVIRQMLRKVKIDEPGDTEFLPGSLVDILDLEEENRR-VEAAGGSPATSKSVLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKVDPLLGLKENVIIGKLIPAGTG 1131
>gi|160937580|ref|ZP_02084941.1| hypothetical protein CLOBOL_02471 [Clostridium bolteae ATCC BAA-613] >gi|158439649|gb|EDP17399.1| hypothetical protein CLOBOL_02471 [Clostridium bolteae ATCC BAA-613] (1237 aa)
Score = 2659, Expect = 0.0e+00, Identities = 565/1262 (44%), Positives = 814/1262 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNED-CKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIIT----KAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKK 1271
           +I+IGLASP+KI EWS+GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G IC++CGVE+T++ VRRER+GHI+LAAP++HIW  K +P  S++ L+LDIS + +E+V+YF +YIVLD G+     +  +K+V+      S KE R ++ K                                                   G R G+GAEAI ELL+ I+L+K+  D+   L  S      K  ++++RLE ++    S N+PEWMI+  I V PPD RP++QL+GG+F TSD+N  YR+II RN RL R+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+          +    NIK+A+K++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TAFNADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT E+    G+GM+F +V+E    Y+ ++  +HS + +  S        K G + +T+G+ I N+++P+++ +++   P+N          E   +    + KK++     K+ L +++N+ H     A       T+D IK IG++YST++A T+S  D+     K K  EE    V+ + K Y++GL+T++ERYK+V+  W +  +Q++ D+   + K     N+I +MA+SGARG+     QL+GMRGLM+ +  +           TIE+PIK++F EGL V EYF S++GARKG++DTA++T+ SGY+TR+LVD +QD+I+   D C+ +    +E+        VIE L ER+  R+    +  P + +V+  A  + T     AV   +   G   V++R+VL CK   G+C KC+G ++ T + V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV+ G +I QG  R+++LF+   PK    +II+E  G V  IK +     I  VT   +  +  Y +P+ S ++V +G  ++ G ++TEGSI+  ++LK+ G+  V++Y+++EVQ+VYRLQG+EI DK+IE+I+ Q+  K++I++SG+SD   G  +D+  + + NE LI +D K PA    ++ G+ +A   T SFL+AASFQ+T K+LT+A + G++D L GLKENVI G  IP GTG K
  S:    17 AIKIGLASPDKILEWSHGEVKKPETINYRTLKPEKDGLFCERIFGPSKDWECHCGKYKKIRYKGVICDRCGVEVTKASVRRERMGHIKLAAPVSHIWYFKGIP--SRMGLILDISPRTLEKVLYFASYIVLDPGS----TSLQYKQVL------SEKEYREEVEK----------------------------------------------YGGTGGFRVGMGAEAIQELLRAINLEKDSADLRRALADSTGQ---KRARIIKRLEVVEAFLTSGNRPEWMIMDVIPVIPPDIRPMVQLDGGRFATSDLNDLYRRIINRNNRLARLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELV---------SNGTAHNIKNAKKMVERLQPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTQERPGAKGEGMVFKSVNEAILAYENQEATLHSRVKVRVSKTMSDGTVKTGTIDSTIGRFIFNEIIPQDLGFVDRSIPEN----------ELKLEVDFHVAKKQL-----KQILEKVINV-HGATQTA------VTLDDIKAIGYKYSTRAAMTVSISDMTVPESKPKLIEEAQATVDRIAKNYRRGLITEEERYKEVIETWKTTDDQLTHDLLTGLDK----YNNIYMMADSGARGSDKQIKQLAGMRGLMADTTGH-----------TIELPIKSNFREGLDVLEYFISAHGARKGLSDTALRTADSGYLTRRLVDVSQDLIIREVDCCEGRDIPFMEIKAFMDGNEVIEDLEERITGRYIAETITDPDTGEVVVKANHMCTPKRAAAVMKVLNKTGRKSVKIRTVLSCKSHIGVCAKCYGANMATGQPVQVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGG-DITQGLPRVEELFEARKPKGL--AIITEF-GGVVQIKDTKKKREI-TVTDNETGNAKTYLIPYGSRIKVLDGQVLEAGDELTEGSINPHDILKIKGVRAVQDYMLQEVQRVYRLQGVEINDKHIEMIVHQMLKKIKIEESGDSDVLPGVSMDVLDYNEMNEALI-ADGKKPAEGRQVMLGITKASLATDSFLSAASFQETTKVLTEAAINGKVDHLIGLKENVIIGKPIPAGTGMK 1172
>gi|114567848|ref|YP_755002.1| DNA-directed RNA polymerase subunit beta' [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338783|gb|ABI69631.1| DNA-directed RNA polymerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (1181 aa)
Score = 2658, Expect = 0.0e+00, Identities = 563/1268 (44%), Positives = 807/1268 (63%)
  Q:     2 NSKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQG--MLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKK-----------QFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESI-NYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           N  S     I+I LASPE+IR WS+GEV K ETINY++L+PEK+GLF E IFGPVKD+EC CGKYK+++ +G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +P  S++ L+LD+S K +E+V+YFV+YIVLD G+    K         L +++  +E R +  +  +                                                    GIGAEA+  LL  ++LDK   D+ E++     T+  +  + ++RLE ++  + S N P WMIL  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKM+Q G+P  M L+LFKPF++ +L+ K          I SNIKSA+K++      +W I++ VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+A++LHPLV TA+NADFDGDQMAVHVPLS EA  EAR ++LAS +IL PKDGKP++TPTQDMV+G YYLT        +     F++ DE +  +++ ++ +H  I +  S  P+K           Q   + I+ T+VG++I ND +P  + +                     Y   I+KKK            + NI++  Y           +D +K +G+E+ST++  T+   D      K    +E D++VE +++ Y+ GL+TD+ER+ +VV  W    NQ + D+ ++++      N + +MA SGARGN     QL+GMRGLM+     D   K       I++PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  +DC++ +G  +  I   +   +IE L++R+I R  +  V+HP + ++L    ++I   +  EI  AGI+KV++RSVL CK  +G+C+KC+G +L T   VE   A+G++AAQSIGEPGTQLTMRTFHTGGV +G +I +G  R+++LF++  PK   ++++ E+ GKV   +   +     V  +  + E +  Y V + S L+ EEG +V+ G  +TEG ++  ++LK  G++ V+ Y+++EVQKVYR QG++I+DK+IE++IRQ+  KV+I+D G++    G  +DI++F  EN + I +   +PAT   ++ G+ +A   T SFL+AASFQ+T K+LT+A +KG+ID L GLKENVI G LIP GTG
  S:     9 NDLSENFDRIRISLASPEQIRSWSSGEVKKPETINYRTLRPEKEGLFCEKIFGPVKDWECHCGKYKRVRHKGIVCDRCGVEVTTSKVRRERMGHIELAAPVCHIWYLKGIP--SRMGLLLDMSPKVLEKVIYFVSYIVLDPGDTPLLKK-------QLLNEREYRENRDRYGEAFKA---------------------------------------------------GIGAEAVKSLLYEVELDKMSSDLKEEI---ATTTGQRKSRAIKRLEVVESFRLSGNDPMWMILDVLPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALVDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMHQCGLPKEMALELFKPFVMKKLVDKA---------IASNIKSAKKMVERGREEVWDILDDVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRALQLHPLVCTAYNADFDGDQMAVHVPLSAEAQTEARLLMLASNNILNPKDGKPVVTPTQDMVIGLYYLTFISAEAFSKENPRAFSSTDEARMAFELGQIDLHEKIRVKMSV-PQKTGREILKSHEAQTFLEEIVDTSVGRIIFNDAIPTSLGF---------------------YNEIIDKKK------------LGNIVYECYRLEGNARTADMLDSLKSLGYEFSTRAGITVGVTDFETPLAKYDILQEADQEVEAIERDYEVGLITDEERHAQVVEIW----NQATDDVTEVLKNSLSEDNPVYMMATSGARGNFQQIRQLAGMRGLMA-----DPSGK------IIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREDDCESVEGIWVGRI--MEGSQLIEPLHQRIIGRVSVDTVIHPDTGEILVEENQMIDDDIGYEIERAGIEKVKIRSVLTCKTRHGVCKKCYGRNLATGYNVEIGEAVGILAAQSIGEPGTQLTMRTFHTGGV-AGDDITRGLPRVEELFEVRKPKG--QAVVVEVNGKV---RFGENKGRREVEVLGENGEVLGTYPVHYGSRLKFEEGTEVEIGDALTEGPLNPHDILKTKGLQEVQRYLLQEVQKVYRSQGVDISDKHIEIMIRQMLKKVKIEDPGDTSLLPGAFVDISSFEDENNREIRAGG-LPATCSPMLLGITKASLNTDSFLSAASFQETTKVLTEAAIKGKIDHLIGLKENVIIGKLIPAGTG 1160
>gi|188590157|ref|YP_001919666.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188500438|gb|ACD53574.1| DNA-directed RNA polymerase, beta' subunit [Clostridium botulinum E3 str. Alaska E43] (1177 aa)
Score = 2657, Expect = 0.0e+00, Identities = 560/1260 (44%), Positives = 806/1260 (63%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTL---REIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +IQIGLASPE+IREWS GEV K ETINY++LKPEKDGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +  PS++ L++D+S + +E+V+YF +YIV+D                        KET   L+K L   +E  E++D                  D+        +I+E+   I    G +                      ++ E L++S      K  +++RRLE ++    S N P+WMI+  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L+         +D +  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPL  TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLTM++    G+GM F+N DE    Y+ K + +H+ I +           K GI+ TTVGK+I N+ +P+++ ++N  D  E+ +                  ++    TKK+L ++++  +  +      I+   +D IK +G+ YS+  A T++A D+     K     E D+ +++++K Y++G +++DERY++V+  W+  T +V+  +   + K     N I +MA+SGARG+ S   QL+GMRGLM+                 +E+PI+ SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD  QDVIV  EDC T  G     + + K GS VIE L ERLI R+   D+V+P S  ++    E +   +A+++V AGI KV++RS   C  + G+C KC+G ++ T K ++   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    +I+SEI G V  I+ +     + V+      E  +Y +PF S L+V +GD ++ G +ITEGS++  +++ + G++  R Y++ EVQKVYRLQG++I DK++EV+++Q+T KV++ +SG+++   G +IDI  F+  N K +       A     + G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG
  S:     9 AIQIGLASPEQIREWSRGEVKKPETINYRTLKPEKDGLFCERIFGPMKDWECHCGKYKRVRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLMDMSPRALEKVLYFASYIVID-----------------------PKET-PLLKKQLLNEKEYREAVDKYGD--------------DSFVAGMGAEAIQELLGEIDLVAGAK----------------------ELKEDLKQSTGQ---KRVRIIRRLEVVESFAKSGNDPKWMIINVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLV---------QDGVAHNIKSAKRMVERVLPQVWDVLEEVITDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLACTAYNADFDGDQMAVHVPLSVEAQAEARFLMLAAGNILKPSDGKPVCVPTQDMVLGSYYLTMDRTGAKGEGMTFSNKDEAVMAYESKYIDIHAQINVRVYKEIDGVL-KSGIIKTTVGKLIFNESIPQDLGFVNREDEKEKFN-----------------LEIDFLVTKKSLGKVIDQSYMLHGPTKTSIM---LDNIKALGYHYSSIGAVTVAASDMIVPPVKYDLLHEADETIDKIEKMYKRGFISEDERYERVIEKWTKTTEEVADALMDSLDK----FNPIYMMADSGARGSKSQIKQLAGMRGLMASPSG-----------KILELPIRASFREGLDVLEYFISTHGARKGNADTALKTADSGYLTRRLVDVCQDVIVREEDCGTDDGI---YVSEIKEGSEVIEELKERLIGRYTAEDIVNPNSGDIIVAKNEYMDPVIADKVVSAGIKKVKIRSAFTCDCKVGVCAKCYGMNMATAKKIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AIVSEIHGNV-RIEETKKKRAVFVMGADG--EECSYDIPFGSRLKVSDGDYIEAGDEITEGSVNPHDIMNIKGVDGARRYLLSEVQKVYRLQGVDINDKHLEVVVKQMTRKVKVLESGDTELLPGTMIDIFDFQGANAK-VREFGGEEAKGEQSLLGITKAALATDSFLSAASFQETTRVLTEAAIKGKVDPLIGLKENVIIGKLIPAGTG 1152
>gi|160946993|ref|ZP_02094196.1| hypothetical protein PEPMIC_00955 [Peptostreptococcus micros ATCC 33270] >gi|158447377|gb|EDP24372.1| hypothetical protein PEPMIC_00955 [Peptostreptococcus micros ATCC 33270] (1206 aa)
Score = 2657, Expect = 0.0e+00, Identities = 578/1267 (45%), Positives = 823/1267 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNI--LVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGPVKD+EC CGKYK+IK++G +CEKCGVEIT+S VRRER+GHIEL AP++HIW  K +P  S++ L+LD+S + +E+++YF NY+                 V+D      +K+T   +++ L E                            E+   F  E   NF       R G+GAEAI ELL+NIDLD+   ++ + L  +     I+   L RRLE  +  + S N+PEWMI+  + V PPD RP++QLEGG+F TSD+N  YR++I RN RLK++I+ +AP II+ NEKR+LQEAVD L DN    K + G   R LKSLS+ LKGK G FRQNLLGKRVDYSGRSVIV+GP+LK +Q G+P  M L+LFKPFI+ +L+         +D IV NIKSA+K +   ++ +W I++KVIK  PVLLNRAPTLHRLGIQAFEP+LVEGKAI+LHPLV TA+NADFDGDQMAVH+PLS EA AEAR ++L++ +IL PKDGKPI TPTQDMVLG+YYLT   +        F + DE+   Y    V +H  + I    +  ++  +  I+ +TVG+ I N+ +P+++ +++   +   L  + +V+                   KK L +IV+   RK+ +         +D IK  G++YST  A +IS  DV    EK +  +E +KK+   ++ ++ GL+++ ERY+ V+S W+  T    +DI K++ + +  TNSI IMA+SGARGNI+   QL+GMRGLMS +               +E+PIK +F EGL+V E+F S++G+RKG++DTA++T+ SGY+TR+LVD +QDVIV  +DC T +  +    +D    +++E L +R++ R    DV++P + ++L    E+IT+++A ++   GI +++VRSVL CK ++G+C KC+G +L T   V    A+G+IAAQSIGEPGTQLTMRTFH+GGV +G  I QG  R+++LF+   PK    + I+EI+G V  +    DN     +VVT  +  E I Y +P+ + ++V++G+K+K G  +TEGSI+  ++L + G   V+ YI KEVQKVYR QG++I D++IE+II+Q+ +KV+I  SG+++F  G ++        N ++ L +DK+PAT  N++ G+ +A   T SFL+AASFQ+T ++LTDA +KG++D L GLKENVI G LIP GTG K  + I
  S:     8 AMKIGLASPDKIRSWSRGEVKKPETINYRTLKPEKDGLFCEKIFGPVKDWECNCGKYKRIKYKGNVCEKCGVEITKSKVRRERMGHIELVAPVSHIWYFKGIP--SRMGLILDMSPRALEKILYFANYV-----------------VLD------AKDTDLYVKQLLTE------------------------GEYGEACEKFGAE---NF-------RVGMGAEAIKELLENIDLDELSDELKKGLVDATGQKKIR---LSRRLEVCEAFRKSGNRPEWMIIDVVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKKLIEIHAPEIIMRNEKRMLQEAVDTLIDNGRHGKAVTGAGNRELKSLSDMLKGKTGRFRQNLLGKRVDYSGRSVIVVGPDLKFHQCGLPKKMALELFKPFIMKQLV---------EDGIVHNIKSAKKYVERLNSNVWDILDKVIKDHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCTAYNADFDGDQMAVHLPLSTEAQAEARLLMLSTNNILAPKDGKPITTPTQDMVLGSYYLTSGTVEEQAVRS-FMDYDEMFKAYSTNNVKIHDTVNI---LYRDEETGESQIVKSTVGRFIFNEHIPQDLGFVDRSKDKFSLEIDRLVD-------------------KKMLGKIVDKCFRKHGNIK---TAEVLDYIKSTGYKYSTVGAISISMNDVIVPEEKWEILKEAEKKIAVYEELFRDGLVSEQERYEYVISVWTKAT----EDITKILVEKQDPTNSISIMADSGARGNINQIRQLAGMRGLMSSATG-----------RIVEIPIKANFREGLSVQEFFISTHGSRKGLSDTALRTADSGYLTRRLVDVSQDVIVREDDCCTDEYVLARDFKD--GNAIVEKLADRIVGRHSFEDVLNPTTGEILIHKNEMITESLAEKVEKLGITEIKVRSVLGCKSKHGVCAKCYGRNLATGNPVNIGEAVGIIAAQSIGEPGTQLTMRTFHSGGV-AGVGITQGLPRVEELFEARKPKGL--AYITEIDGTVKLV----DNKKRYDIVVTADDGDERI-YAIPYGARIKVKDGEKIKAGDMLTEGSINPHDILAIKGPTGVQEYITKEVQKVYRNQGVDIDDRHIEIIIKQMLSKVKIDTSGDTNFLEGSLVPFREVEAVNRQM-LDEDKIPATFDNVLLGITKASLATESFLSAASFQETTRVLTDASIKGKVDGLIGLKENVILGKLIPAGTGMKVYKSI 1153
>gi|169335207|ref|ZP_02862400.1| hypothetical protein ANASTE_01615 [Anaerofustis stercorihominis DSM 17244] >gi|169257945|gb|EDS71911.1| hypothetical protein ANASTE_01615 [Anaerofustis stercorihominis DSM 17244] (1235 aa)
Score = 2653, Expect = 0.0e+00, Identities = 580/1262 (45%), Positives = 821/1262 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHS-IIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYL--NNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKK 1271
           SIQIGLAS EKI +WS GEV K ETINY++ KPEKDGLF E IFGP KDYEC CGKYK+I+++G IC++CGVE+T+S VRRER+GHI LAAP+ HIW  K +P  S+I L+L++S KE+E+++YF  Y+V D      P N    E   L+  +          K  R+IY S                                         FT     IGAEAI +LL  +DL+KE +++ + +  +  T+  K  K +++L+ ++  ++SNN P+ M+L+ + V PP+ RP++ L+GG++ TSD+N  YR++I RN RLKR+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPL+SLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M ++LFKPFI+ EL+K+             NIKSA++++  Q   +W +++ VIK  PVLLNRAPTLHRLGIQAFEPILVEG+AI+LHPLV TAFNADFDGDQMAVHVPLS EA AEAR ++LA+++IL P+DG P+++PTQDM+LG+YYLT+ K N  G+G  FA++ EL+  Y  K+V +H+ +          K+  K  I+ +TVG+ + N ++P+++ ++    P ++ +L  + +V+ G      +  + VYK FT+   ++   +L                D IK +GF YSTK+A T+S  D+     K +  EE D KV+++ K Y++G++T+ ER ++V+  W+  TN V+  +   +       N I +MA+SGARG+ +   QL+GMRGLM+               D IE+PI+++F EGL V E+F SS+GARKG+ DTA++T+ SGY+TR+LVD +QD IV  +DC T +G  +  I+      VIE L ER+  R+   DVV+P + +V+    E+IT   A EIVDAGI+KV +R+V +CK + G+C KC+G DLT+ K V    A+G IAAQSIGEPGTQLTMRTFHTGGV+S  +I QG  R+++LF+   PK   ++IIS+I+G +   +   D  + ++V    + E  +Y +P+ S ++V +GDKV+ G +ITEGSI  ++LL++ G++ V+ YI+ EVQKVYR QG+ I+DK++E+IIRQ+  K ++ D+G +D   G  +D   F   NEK      +  AT    + G+ +A   T SFL+AASFQ+T K+LTDA ++G++D L GLKEN+I G LIP GTG K
  S:    25 SIQIGLASKEKILDWSYGEVKKPETINYRTSKPEKDGLFCEKIFGPTKDYECYCGKYKQIRYKGVICDRCGVELTKSKVRRERMGHIALAAPVTHIWYFKGIP--SRIGLLLEMSPKELERIIYFAAYVVTD------PGNTPLDEKTVLTENEY---------KEYRQIYGS----------------------------------------EFTAK---IGAEAIQDLLGQVDLEKESQELKQII--ATETTRQKKTKAIKKLKIVEDFRNSNNNPQDMVLEVVPVIPPELRPMVMLDGGRYATSDLNDLYRRVINRNNRLKRLLELNAPDIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLRSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMAIELFKPFIMRELVKRKHS---------LNIKSAKRMVERQSPEVWDVLDDVIKDHPVLLNRAPTLHRLGIQAFEPILVEGRAIKLHPLVCTAFNADFDGDQMAVHVPLSVEAQAEARFLMLAAYNILKPQDGSPVVSPTQDMILGSYYLTIVKENQKGEGKAFASIPELEMAYYNKEVELHAKVKVRVKKVIDGKEHVK--IVESTVGRFLFNQIIPQDLGFVVRETPADMFKLEIDKVVDKG------VLSEIVYKCFTRHGAAKTSMVL----------------DDIKKMGFTYSTKAAVTVSISDMEVPDVKPQLLEEADVKVDKVLKKYKRGMITEAERKREVIDIWNDTTNLVTNALLDHLDP----FNPINMMADSGARGSRNQIRQLAGMRGLMASPNG-----------DIIELPIRSNFREGLDVLEFFISSHGARKGLADTALRTADSGYLTRRLVDVSQDQIVKEDDCGTDQGYDVTAIK--VGNDVIEELEERINGRYAFDDVVNPSTGEVIVSRNELITPDKAKEIVDAGIEKVSIRAVFNCKSKVGVCAKCYGVDLTSMKTVSVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASAEDITQGLPRIEELFEARRPKG--QAIISDIDGVIEVTEE--DGHSKVIVMNNENGEVFDYDIPYGSRIKVRQGDKVEAGDEITEGSIYPEDLLRIKGVDGVQKYILTEVQKVYRYQGVHISDKHVEIIIRQMLRKYEVTDAGETDLLPGTSVDYFEFENANEKAKEEGKEE-ATGNRKLLGITKASLSTSSFLSAASFQETTKVLTDAAIQGKVDPLLGLKENIILGKLIPAGTGIK 1172
>gi|150015037|ref|YP_001307291.1| DNA-directed RNA polymerase subunit beta' [Clostridium beijerinckii NCIMB 8052] >gi|149901502|gb|ABR32335.1| DNA-directed RNA polymerase, beta' subunit [Clostridium beijerinckii NCIMB 8052] (1178 aa)
Score = 2653, Expect = 0.0e+00, Identities = 565/1260 (44%), Positives = 807/1260 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +IQIGLASPE+IR+WS GEV K ETINY++LKPE+DGLF E IFGP+KD+EC CGKYK+++++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +  PS++                    ++LD       K   F   I +  +++    +  L +  +E  E++D                                      SF     G+GAEAI +LL  IDL    K++ E+L++S   S  K  +++RRLE ++  + S N P+WM++  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M ++LFKPF++ +L+         +D I  NIKSA++++      +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPL  TA+NADFDGDQMAVH+PLS EA AEAR ++LA+ +IL P DGKP+  PTQDM+LG+YYLTM+K    G GM F++ DE    Y++K++ +H+ I +        +  K  I+ TTVGK+I N+ +P+ +  +N  +  EE S N  V++                 TKK+L +I++  + K+      I+   +D IK +G+ YS+  A T+++ D+     K    +E D+ +E+++K Y++G ++D+ERY++V+  W+  T  V+  +   + K     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL V EYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC T +G  +  I++     VIE L ERLI R+   D+V P++  VL P  E +    A++IV AGI KV++RSV  CK + G+C +C+G ++ T K ++   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +I+SEI G  + I+ +     ++V+     + S  Y +PF S LRV E D V+ G +ITEGS++  +++ + GI+  R Y++ EVQKVYRLQG++I DK++EV++RQ+T K++I DSG++D   G +ID+  F +EN + +       A     + G+ +A   T SFL+AASFQ+T ++LT+A +KG++D L GLKENVI G LIP GTG
  S:     9 AIQIGLASPEQIRQWSRGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECHCGKYKRVRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHIWYFKGI--PSRMG-------------------LILDMSPRALEKVLYFASYIVIDPKETPLLKKQLLNE--KEYREAVDKYGD---------------------------------ESFVA---GMGAEAIQDLLNEIDLVTSSKELKEELKQS---SGQKKVRIIRRLEVVESFRKSGNDPQWMVINVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMAIELFKPFVMKKLV---------QDGIAHNIKSAKRMVERVLPQVWDVLEEVIADHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLACTAYNADFDGDQMAVHLPLSVEAQAEARFLMLAATNILKPSDGKPVCVPTQDMILGSYYLTMDKNGAKGDGMTFSSKDEAIMAYEVKEIDIHAQINVRMFREVDGEL-KSKIIKTTVGKIIFNESIPQNLGLVNREN--EEESFNLEVDF---------------LATKKSLGKIIDQCYMKHGPVKTSIM---LDNIKALGYHYSSIGAVTVASSDIIVPKVKYDLLKEADETIEKIEKMYKRGFISDEERYERVIEKWTQTTEDVANALMDSLDK----FNPIYMMADSGARGSKSQIKQLAGMRGLMASPSG-----------KIIELPIRASFKEGLDVIEYFLSTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREEDCGTDEGIFVSEIKE--GNEVIEELRERLIGRYTAEDIVDPETGDVLHPKNEYMDPYAADKIVSAGIKKVKIRSVFTCKCKVGVCARCYGMNMATAKKIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGADITQGLPRVEELFEARKPKGL--AIVSEIAG-TARIEETKKKRTVIVMGADGEERS--YDIPFGSRLRVNESDYVEAGDEITEGSVNPHDIMSIKGIDGARRYLLSEVQKVYRLQGVDINDKHLEVVVRQMTRKIKIVDSGDTDLLPGTMIDMFDFYEENAR-VREFGGEEAKGEQTLLGITKAALATDSFLSAASFQETTRVLTEAAIKGKVDPLVGLKENVIIGKLIPAGTG 1152
>gi|153812150|ref|ZP_01964818.1| hypothetical protein RUMOBE_02547 [Ruminococcus obeum ATCC 29174] >gi|149831805|gb|EDM86891.1| hypothetical protein RUMOBE_02547 [Ruminococcus obeum ATCC 29174] (1244 aa)
Score = 2643, Expect = 0.0e+00, Identities = 566/1267 (44%), Positives = 828/1267 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNN--PDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKK----GTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDK-------VEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +I+IGLASPEKIREWS GEVTK ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF NYIVLD  +        +K+V+     + ++E                                                  +NF       R G+GAE+I+ELLK IDL+K+  ++  +L    + +  K  ++++RLE ++  ++S N+PEWMI+  I V PPD RP++QL+GG+F TSD+N  YR+II RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGK G FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+               NIK+A+K++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TAFNADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT E+   PG+G  F +V+E    Y+ K + + S I +  +          GI+ +T+G+ + N++LP+++ +++   P N E L + D +         + KK++     KK L +++N  H     A +      +D IK  G++YST++A T+S  D+    +K +  +     V+++ K Y++GL+T++ERYK+VV  W    ++++K +   + K     N+I +MA+SGARG+     QL+GMRGLM+ +  +           TIE+PIK++F EGL V EYF S++GARKGM+DTA++T+ SGY+TR++VD +Q++IV   DC   +    G  ++   D K    IE+L ER+  RF   + +  K  +VL  A  +IT   A  I+  G+ K       V++R++L CK + G+C KC+G ++ T + V+   A+G+IAAQSIGEPGTQLTMRTFH+GGV+ G +I QG  R+++LF+   PK    +II+EI G V+ I  +     I+V   +N  +S  Y +P+ S +++ +G  ++ G ++TEGS++  ++L++ G+  V++Y+I+EVQ+VYRLQG+EI+DK+IEV++RQ+  K++I+D+G+++F  G ++D+  F + NE L   + K PA    ++ G+ +A   T SFL+AASFQ+T K+LT+A +KG++D L GLKENVI G LIP GTG K   DI
  S:    30 AIKIGLASPEKIREWSRGEVTKPETINYRTLKPEKDGLFCERIFGPSKDWECHCGKYKKIRYKGVVCDRCGVEVTKASVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDLSPRTLEKVLYFANYIVLDPAD----SGLQYKQVLTEKEYQDAREAYG-----------------------------------------------YNF-------RVGMGAESIMELLKAIDLEKDAAELKAEL---VDATGQKRARIIKRLEVVESFRESGNRPEWMIMTAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKSGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELVANGTSH---------NIKNAKKMVEKLQPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNADFDGDQMAVHLPLSQEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTQERPGNPGEGKFFKSVNEAILAYENKVITLQSRIKVRITKTMPDGTEMTGIVESTLGRFLFNEILPQDLGFVDRSIPGN-ELLLEVDFL---------VGKKQL-----KKILEKVINT-HGATKTAEV------LDSIKATGYKYSTRAAMTVSISDMTVPPQKPEMIQNAQNIVDKITKNYKRGLITEEERYKEVVETWKKTDDELTKALLDGLDK----YNNIFMMADSGARGSDKQIKQLAGMRGLMADTTGH-----------TIELPIKSNFREGLEVLEYFMSAHGARKGMSDTALRTADSGYLTRRMVDVSQELIVRETDCCENRPEISGMYVKGFMDGKEE--IENLQERITGRFAC-ETITNKDGEVLVKANHMITPRRAARIMSEGVSKTGGPIEEVKIRTILTCKCKVGVCAKCYGANMATGEAVQVGEAVGIIAAQSIGEPGTQLTMRTFHSGGVAGG-DITQGLPRVEELFEARKPKGL--AIITEIPG-VAVINDTKKKREIIVTNPENG-DSKTYLIPYGSRIKIADGQVLEAGDELTEGSVNPHDILRIKGVRAVQDYMIREVQRVYRLQGVEISDKHIEVLVRQMLKKIRIEDNGDTEFLPGTLVDVLEFEEVNENL-EKEGKKPAEGKQVMLGITKASLATDSFLSAASFQETTKVLTEAAIKGKVDHLVGLKENVIIGKLIPAGTGLKRYRDI 1191
>gi|169824814|ref|YP_001692425.1| DNA-directed RNA polymerase beta' subunit [Finegoldia magna ATCC 29328] >gi|167831619|dbj|BAG08535.1| DNA-directed RNA polymerase beta' subunit [Finegoldia magna ATCC 29328] (1220 aa)
Score = 2643, Expect = 0.0e+00, Identities = 566/1260 (44%), Positives = 815/1260 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +++IGLASP+KIR+WS GEV K ETINY++LKPEK+GLF E IFGP KDYEC CGKYK+I+++G +CEKCGVE+T+S VRRER+GHIELA P++HIW  K +  PS++                    ++LD       K   F   + +   K+             ++YE            K  +    Y+   +       EE  +F       R  +GAEAI ELL+ IDL +EYK++ E     E ++  K  +++RRLE ++   +S N P WMI+  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++   +P II+ NEKR+LQEAVDAL DN  R KP+ G   RPLKSLS+ LKGK G FRQNLLGKRVDYSGRSVIVIGP LK YQ G+P  M L+LFKPF+I EL+K+          I  N+K+A+KL+  +++ +W ++  +I   PVLLNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TA+NADFDGDQMAVH+PLSPEA AEAR ++L++ +IL PKDGKPI TP+QDMVLG++Y+T  K    G+G++F ++DE+   Y M  V + +I+ +  ++       K  I+ +TVG+ I N+ +P+++  +N  ++   L  +  V+                   KK LS+I+++  R+Y +         +D IK +G++YST  A TIS  D+     K+   E+ +++++ ++  Y +G +T++ERYKKV+  W     Q  KD+ + +       N++ IMA SGARG+ +   QL GMRGLMS +             +TIE+PI ++F EGL+V E+F S++G+RKG++DTA++T+ SGY+TR+LVD +QDVI+  +DC T +  + + I+D      +E L  R+I R+   D++   + +++    ++I +A+A  I   GI +V+VRSVL CK ++G+C KC+G +L T K V    A+G+IAAQSIGEPGTQLTMRTFH+GG+ +G  I  G  R+++LF+   PK    + I+EIEG V   +    N   ++VT ++ +E + Y++P+ + +RV EGD V+ G  +TEGSI+ +++L+V G E VR+YII+EVQKVYRLQG++I DK+IE+IIRQ+ +K+++++SG+S F  G ++D   F+  NE+LI  + K PAT  + + G+ +A   T SFL+AASFQ+T ++LT+  +KG++D L GLKENVI G LIP GTG
  S:    27 AMKIGLASPDKIRQWSWGEVKKPETINYRTLKPEKEGLFCEKIFGPTKDYECNCGKYKRIRYKGIVCEKCGVEVTKSKVRRERMGHIELATPVSHIWYFKGI--PSRMG-------------------LLLDMSPRALEKVLYFASFVVIDPGKT-------------DLYE------------KQLLTEQEYEEYCDK-----YEEDVDF-------RAKMGAEAIKELLQKIDLQEEYKNLTETF---EGSTGQKKVRILRRLEVVEAFIESKNDPSWMIMDVIPVIPPDIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDIGSPEIIVRNEKRMLQEAVDALIDNGRRGKPVTGPGNRPLKSLSDMLKGKSGRFRQNLLGKRVDYSGRSVIVIGPNLKFYQCGLPKKMALELFKPFVIRELVKRE---------ISHNVKNAKKLVERENDKVWDVLEDIIVDHPVLLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVHLPLSPEAQAEARLLMLSTNNILAPKDGKPITTPSQDMVLGSFYMTTRKEGQKGEGLIFKDIDEMMLAYAMHYVTLQTIVKVRRNSVNNDGTSK--IVESTVGRFIFNEGIPQDLGMVNRNEDPYSLEVDLQVD-------------------KKMLSKIIDLTFRRYGNIR---TAELLDYIKSMGYKYSTIGALTISMGDITIPDSKKGIIEQAEQRIDMVQDIYLQGDITNEERYKKVIEIWE----QCIKDVTRALMTNLPADNNLNIMAVSGARGSENQIRQLGGMRGLMSDTAG-----------NTIEIPITSNFREGLSVQEFFISTHGSRKGLSDTALRTADSGYLTRRLVDVSQDVIITEDDCGTDEYIVAKEIKD--GNRQVEDLKSRIIGRYAFEDILDLDTGEIIVHKNDMINEAIAERIESKGIKEVKVRSVLGCKMKHGVCAKCYGRNLATGKPVNIGEAVGIIAAQSIGEPGTQLTMRTFHSGGI-AGVGITSGLPRVEELFEARKPKGL--AYITEIEGTVKIQENKKRND--VIVTSEDGEEQV-YQIPYGAHIRVNEGDHVEKGEPLTEGSINPQDILRVNGAEGVRDYIIREVQKVYRLQGVDIDDKHIEIIIRQMMSKIKVEESGDSGFLSGSVVDARDFKMTNEQLI-KEGKTPATGTHSLMGITKASLATESFLSAASFQETTRVLTETSIKGKVDHLIGLKENVIIGKLIPAGTG 1168
>gi|167758506|ref|ZP_02430633.1| hypothetical protein CLOSCI_00846 [Clostridium scindens ATCC 35704] >gi|167663702|gb|EDS07832.1| hypothetical protein CLOSCI_00846 [Clostridium scindens ATCC 35704] (1210 aa)
Score = 2640, Expect = 0.0e+00, Identities = 563/1267 (44%), Positives = 832/1267 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTI--LEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGID-------KVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +I+IGLASPEKI EWS GEVTK ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G +C++CGVE+T++ VRRER+GHI LAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +YIVLD+G      +  +K+V+   S++  +E R                                                  + SSF   R G+GAE+I ELL++IDLDKEY ++ E L+ +      K  ++V+RLE ++  ++S NKPEWMI+  I V PPD RP++QL+GG+F TSD+N  YR+II RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGK G FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+         ++    NIK+A+K++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TA+NADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT E+    G+G  F +V+E    Y+ + + +HS I +  S          G + +T+G+ I N+++P+++ +++      E+ +N ++    +    + KK++     K+ L +++N      S A+ E+    +D +K IG++YST++A T+S  D+    +K +  ++    V+++ K +++GL+T++ERYK+VV  W +  + +++ +   + K     N+I +MA+SGARG+     QL+GMRGLM+ +              TIE+PIK++F EGL V EYF S++GARKG++DTA++T+ SGY+TR+LVD +Q++I++  DC  K   I  + V         IESL ER+  R+   ++V  K   VL  A  ++T   A  I+  G+D       K+++R++L C+  +G+C KC+G ++ T + V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +II+E  G  ++I  +     I +VT   + ES  Y +P+ S ++V++G +++ G ++TEGS++  ++LK+ G+  V++Y+I+EVQ+VYRLQG+EI DK+IEVI+RQ+  KV+I+++G+++F  G  +D   F   N +L   + K PA    ++ G+ +A   T SFL+AASFQ+T K+LT+A +KG++D L GLKENVI G  IP GTG +   DI
  S:    17 AIKIGLASPEKILEWSRGEVTKPETINYRTLKPEKDGLFCEKIFGPSKDWECHCGKYKKIRYKGVVCDRCGVEVTKASVRRERMGHIALAAPVSHIWYFKGIP--SRMGLILDLSPRTLEKVLYFASYIVLDKGK----TDLQYKQVL---SEQEYQEAREA------------------------------------------------WGSSF---RVGMGAESIKELLESIDLDKEYTELQEGLKGATGQ---KRARIVKRLEVVEAFRESGNKPEWMIMTAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKSGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELV---------QNGTAHNIKNAKKMVERLQPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTQERPGAKGEGKAFKSVNEAILAYENEAITLHSRIKVRVSKVMPDGEEVSGTIESTLGRFIFNEIIPQDLGFVD-----REVEENKLL---LEVDFHVGKKQL-----KQILEKVINT---HGSTATAEV----LDAVKAIGYKYSTRAAMTVSISDMTVPPQKPEMIQQAQDTVDKITKNFKRGLITEEERYKEVVETWKATDDALTEALLSGLDK----YNNIFMMADSGARGSDKQIKQLAGMRGLMADTTG-----------RTIELPIKSNFREGLDVLEYFMSAHGARKGLSDTALRTADSGYLTRRLVDVSQELIIHEVDCVEKGAEIPGMYVKAFMDGNEEIESLQERITGRYLCENIVD-KDGNVLVKANHMVTPKRAELIMKKGVDEKGQPLTKIKIRTILTCRSHSGVCAKCYGANMATGEPVQVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKGL--AIITEFAG-TANINDTKKKREI-IVTNHETGESKAYLIPYGSRIKVQDGAELEAGDELTEGSVNPHDILKIKGLRAVQDYMIQEVQRVYRLQGVEINDKHIEVIVRQMLKKVRIEEAGDTEFLPGTNVDRLIFEDVNNEL-EKEGKEPAAGEQIMLGITKASLATNSFLSAASFQETTKVLTEAAIKGKVDPLIGLKENVIIGKHIPAGTGMRKYRDI 1178
>gi|160881804|ref|YP_001560772.1| DNA-directed RNA polymerase subunit beta' [Clostridium phytofermentans ISDg] >gi|160430470|gb|ABX44033.1| DNA-directed RNA polymerase, beta' subunit [Clostridium phytofermentans ISDg] (1255 aa)
Score = 2635, Expect = 0.0e+00, Identities = 565/1279 (44%), Positives = 829/1279 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTI--LEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGI-----DKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKMYELEY 1288
           +I+IGLASPEKIREWS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G +C++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +YIVLD+G      +  +K+V++               K  RE Y+              K    F                          R G+GAEAI+ELL+ IDL+KE KD+   L++S      K  ++++RLE ++  ++S NKPEWMI+  + V PPD RP++QL+GG+F TSD+N  YR+II RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+ K             NIKSA+K++      +W I+ +VI++ PV+LNRAPTLHRLGIQAFEP+LVEGKAI+LHPLV TAFNADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT++K    G+G  F +V+E    Y+   + +H++I +  +    +   +   + +TVG+ I N+++ +++ +++   P+N   L          D+ T   KK++     KK L + +N   R  +  +      T+D IK +G++YST++A T+S  D+     K+   E  +K+VE++ K +++GL+T++ERYK V+  W    ++++K++   + K     N+I +MA+SGARG+     QL+GMRGLM+ +              TIE+PIK +F EGL V EYF S++GARKG++DTA++T+ SGY+TR+LVD +QD+I+   DC      I  +E+        VIE L +R+I R+   + ++  + +++     IIT   A  IV +         +++R+VL CK   G+C KC+G ++ T + V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +II+E  G V+          I+  T  ++ ES  Y +P+ S ++V +   ++ G ++TEGS++  ++LK+ G+  V++Y+I+EVQ+VYRLQG+EI DK+IEVI+RQ+  KV+++++G+++F  G ++DI  +   NE L  +     A    ++ G+ +A   T SFL+AASFQ+T K+LT+A +KG+ID L GLKENVI G LIP GTG K   ++  + ++  E+ +
  S:    17 AIKIGLASPEKIREWSRGEVRKPETINYRTLKPEKDGLFCEKIFGPNKDWECHCGKYKKIRYKGVVCDRCGVEVTKASVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDLSPRTLEKVLYFASYIVLDKGT----TDLQYKQVLN--------------EKEFREAYD--------------KYGDRF--------------------------RVGMGAEAIMELLEAIDLEKESKDLKRGLKESTGQ---KRARIIKRLEVVEAFRESGNKPEWMIMTVVPVIPPDLRPMVQLDGGRFATSDMNDLYRRIINRNNRLKRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELVAKG---------TAHNIKSAKKMVERLQPEVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCTAFNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTLQKPGDIGEGKYFKSVNEAILAYENGVISLHAMIKVRRTGLNAEGVEESRTIESTVGRFIFNEIISQDLGFVDRSKPENFLALE--------IDFHT--GKKQL-----KKILEKCINT--RGATQTA-----ETLDAIKSLGYKYSTRAAMTVSISDMTVPEAKKDIIERAEKQVEDIAKNHRRGLMTEEERYKAVIETWKEADDEITKELLSGLDK----YNNIFMMADSGARGSDKQIKQLAGMRGLMADTSG-----------KTIELPIKANFREGLDVLEYFISAHGARKGLSDTALRTADSGYLTRRLVDVSQDLIIREVDCGEGTDEIPGMEIKAFMDGKEVIEGLEDRIIGRYAC-ETIYDDNGELIVKKNHIITPKRAARIVASKAFEDPNATIKIRTVLSCKSHIGVCAKCYGANMATGEAVQVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKGL--AIIAEFGGTVTIKDTKKKREVIVTRTSNDTLESKAYLIPYGSRIKVMDEQVIEAGDELTEGSVNPHDILKIKGVRAVQDYMIQEVQRVYRLQGVEINDKHIEVIVRQMLKKVRVENNGDAEFLPGTMVDILEYNDVNESLA-AKGLEQAEGKQVMLGITKASLATNSFLSAASFQETTKVLTEAAIKGKIDPLIGLKENVIIGKLIPAGTGMKHYRNVKLDTDQNQEITF 1190
>gi|1495656|emb|CAA61513.1| DNA-directed RNA polymerase [Listeria innocua] (1053 aa)
Score = 2631, Expect = 0.0e+00, Identities = 534/1135 (47%), Positives = 758/1135 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S++  +  R K  K                                                   G   G+GAEAI ++L +IDL+KE  D+ E+L+ ++     +  + +RRLE ++  ++S N P WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+ +          +  NIKSA++ I      IW ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G +F +++E +  YQ   VH+HS I +   + P ++F    +  +LITTVGK+I N +LP+   Y+N P   NLE E      V+   D R  I  +++   F KK L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+    VE++ K +++GL+TDDERY++V+  W++  +++     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTVSEYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++K+V+A   ++IT+A+A +IVDAGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++II+E+ G+V SI+   D      +TI+ + +  +Y +P+ + LRVEEG  V+ G  +TEGS+D K L++V  +  V+ Y++ EVQK
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEREYRVYREKYGK---------------------------------------------------GFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQ---RRTRAIRRLEVMEAFRNSGNNPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRG---------LAHNIKSAKRKIERMAPEIWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFKDINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRKQLLITTVGKLIFNTILPKSFPYINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITDDERYERVIGVWNAAKDEIQG---KLILSLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVSEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEAIATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAIITEVGGEVVSIEEGRDRQQ--EITIQGTDDRRSYNIPYTARLRVEEGSIVERGEALTEGSVDPKALIRVRDVLSVQEYLLAEVQK 1053
>gi|118727009|ref|ZP_01575621.1| DNA-directed RNA polymerase, beta' subunit [Clostridium cellulolyticum H10] >gi|118663574|gb|EAV70223.1| DNA-directed RNA polymerase, beta' subunit [Clostridium cellulolyticum H10] (1131 aa)
Score = 2625, Expect = 0.0e+00, Identities = 556/1237 (44%), Positives = 805/1237 (65%)
  Q:    40 LKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPD--NLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFD--VPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKA----VANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +KPE+DGLF E IFGP KD+EC CGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP++HIW  K +P  S++ L+LD+S + +E+++YF +Y+V+D G     K    K+V+                 T +E  +S+D           K    F                          R  +GAEA+ ELL  IDL+   K++  +L +S     I+    V+RLE ++  + S N+PEWMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++ +L+          D +  NIKSA++++    N +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP+LVEG+A++LHPLV +A+NADFDGDQMAVHVPLS EA +EAR ++L++ ++L PKDGKPI  PTQDMVLG+YYLT+EK + PG G +F ++DE+   Y+   + +H+ I +           K  I+  T G++I N+ +P+++ +++  D  NL +L  N +V                    KK L +I++   R +      ++   +DKIK +GF+YST+ A TIS  D  +PE   K++Y +ET+  ++ + K Y++GL++D+ERY  V+SAW+     ++K +   + +     N + +M+ SGARGNI+   QL+GMRGLM+ +              TIE+PIK++F EGL V E+F S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV   DC T KG  +  I+D   G  IE L+ERL+ R+   D+   ++ ++LA   E + +     V   +  +GI KV++RSVL C  E G+C KC+G +L T   V    A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +IISEI G    +K S       V+      ES +Y++P+ S ++V +GD V+ G ++TEGS++  ++LK+ GI+ V++Y+++EVQ+VYR+QG++I DK+IEVI+RQ+  KV+I+D+G++    G ++DI  F KEN+K + +    PAT+   + G+ +A   T SFL+AASFQ+T ++LT+A +KG+ID L GLKENVI G LIP GTG    +DI
  S:     1 MKPERDGLFCERIFGPQKDWECHCGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDMSPRSLEKILYFASYVVIDPGQTPLSK----KQVL-----------------TEKEYRDSVD-----------KFGLNF--------------------------RAAMGAEAVKELLVEIDLESLSKELRTELTESTGQKRIRA---VKRLEVVEAFRLSGNRPEWMILDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPDLKIFQCGLPKEMALELFKPFVMKKLV---------NDGLAHNIKSAKRMVERVRNEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRALKLHPLVCSAYNADFDGDQMAVHVPLSAEAQSEARFLMLSANNLLAPKDGKPITVPTQDMVLGSYYLTIEKSDEPGDGRVFCDIDEVLMAYEEGALGLHAQIKVRVEK-EIDGVKKRKIISCTPGRLIFNEAIPQDLGFVDRSDESNLFDLEINFLV-------------------GKKELGKIIDKCIRVHGTTKTAVI---LDKIKALGFKYSTRGAITISVSDMVIPEI--KKQYLQETENTIDNIVKQYKRGLISDEERYNSVISAWTETGESITKALIDNLDR----FNPVYMMSQSGARGNINQIKQLAGMRGLMADTSG-----------KTIEIPIKSNFREGLNVLEFFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRELDCGTDKGIEVHDIKD--GGETIEPLSERLVGRYLTDDLYDSETNELLASKDEAMDEKKASLVTKSLAKSGIKKVKIRSVLTCHSEVGVCAKCYGANLATGDAVNIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKGL--AIISEIAG---GVKLSDSKKKREVIITSEDGESKSYQIPYGSRIKVYDGDVVEAGDELTEGSVNPHDILKIKGIKGVQSYLLQEVQRVYRMQGVDINDKHIEVIVRQMMRKVKIEDAGDTSMLPGGLVDIFEFEKENQKAVEA-GLAPATSERTLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKIDPLVGLKENVIIGKLIPAGTGMSRYKDI 1124
>gi|154499822|ref|ZP_02037860.1| hypothetical protein BACCAP_03479 [Bacteroides capillosus ATCC 29799] >gi|150271420|gb|EDM98677.1| hypothetical protein BACCAP_03479 [Bacteroides capillosus ATCC 29799] (1249 aa)
Score = 2619, Expect = 0.0e+00, Identities = 577/1260 (45%), Positives = 822/1260 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKS-ENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSII---------GIPTSA-----FPKKQFPKD------------------------GILI----------------TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIK-NSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFR---KENEKLILSDD-------KVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +I+IG+ASPE+IREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYKKI+++GKIC++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ L+LDIS + +E+V+YF +YIV D G     KN    +++      S KE R      +RE YE  D EA                                          G+GAEA+ +LL +IDL++    + E+LR   ++ S  K  ++V+RLE +   + S NKP WMI+  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR+IQ NAP II+ NEKR+LQEAVDAL DN  R + + G + R LKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPE+K+YQ G+P  M ++LF+PF++ +L++         D + +NIKSA+K++      +W  +  VIK+ PV+LNRAPTLHRLGIQAFEP+LVEG+AI+LHPLV TAFNADFDGDQMAVHVPLS EA  EAR ++L++ ++L P+DG P+  PTQDMVLG+YYLT EK      G  + +V  +K       +     +          IPT A      P  + P++                         IL+                TTVG++I N+ +P+++ +++  D  E + D +I         F+  KK         L +I++    KY           +D IK  G+++ST+ A T+S +D+    EK+     T+K++ ++ + Y++G LT+DERY+ VV AW   T  V+  +   + +     N I +MA+SGARG+ +   QL+GMRGLM+ +              TIE+PIK++F EGL+V EYF SS GARKGM DTA++T+ SGY+TR+LVD +Q+VI+  EDC T  G I  V E +++G VIE+  ERL  R+P+ D+  P + +VL     ++T   A  +   GI + ++RSVL C+  +G+C KC+G +L   + V    A+G+IAAQSIGEPGTQLTMRTFHTGGV+ G +I QG  R+++LF+   PK+  +  ++EI G+VS  +A      +L VTI  +  E + Y +P  + +RV++GD VK G  +T+G++  ++++++ G+  V NY+I+EVQK YR QG++I DK+IEVI RQ+  KV+++D+G+SD   G  +DI  F+   K  E  I + +       ++P T   L+ G+ +A   T SFL+AASFQ+T K+LT+A +KG++D L GLKENVI G LIP G+G
  S:     8 AIRIGIASPEQIREWSYGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKKIRYKGKICDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLLLDISPRILEKVLYFASYIVTDPGFSPLAKN----QIL------SEKEYRD-----MREKYED-DFEA------------------------------------------GMGAEAVKKLLDDIDLEQ----LSEQLRAELKDASGQKKARIVKRLEVVDAFRVSGNKPSWMIIDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIQLNAPDIIVRNEKRMLQEAVDALIDNGRRGRAVTGANNRALKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPEMKIYQCGLPKEMAIELFRPFVMKKLVE---------DGLANNIKSAKKMVDKGKAEVWDALEFVIKEHPVMLNRAPTLHRLGIQAFEPVLVEGRAIKLHPLVCTAFNADFDGDQMAVHVPLSAEAQTEARLLMLSANNLLRPQDGGPVTVPTQDMVLGSYYLTYEKYPEHTPGETYDDVAAVKAALAEGALQADDYVWVKNPGKPDDIPTYAGICAETPDGELPREVLHAFGSDIEARLAYDEGELELHVPILVRRSREVNGETKTKLVRTTVGRLIFNEGIPQDLGFVDRNDP-ETMFDPEI--------NFVTGKK--------QLGKIIDKCITKYG---FNYSAGVLDTIKARGYKFSTRGALTVSIYDMTLPEEKKGLIAATEKEIVKIDRQYKRGFLTNDERYRLVVEAWEKTTKDVTDALMACLDR----YNPIWMMADSGARGSSAQIRQLAGMRGLMADTSG-----------RTIEIPIKSNFREGLSVLEYFISSRGARKGMADTALRTADSGYLTRRLVDVSQEVIIREEDCGTHDGII--VSEISENGQVIETFGERLKGRYPVEDICDPVTGEVLIDHHTMMTADHAKLLEAHGIYQAKIRSVLTCEARSGVCSKCYGINLAIGEPVGAGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGG-DITQGLPRVEELFEARRPKKMAQ--LAEISGRVSVEEAK--RATLLNVTITADDGEVVTYAIPNSAGIRVKDGDTVKKGDALTDGALYPQDVIRIRGVHAVYNYLIQEVQKPYRQQGVDINDKHIEVICRQMMRKVRVEDAGDSDLLSGSTVDIIEFKDAYKAVEARIAAGETNDGMELRLP-TCTRLLMGITKASLATESFLSAASFQETTKVLTEAAIKGKVDHLLGLKENVIIGKLIPAGSG 1217
>gi|41018005|sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') (1135 aa)
Score = 2615, Expect = 0.0e+00, Identities = 554/1244 (44%), Positives = 811/1244 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNG 1253
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +YIV+D                        KET   L+K L         E     AI++     F   +   ++   +EE+                          DL++  K++ E L+ S     I   +L+RRLEA++  + S+N+P+WMI+  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L++           +  NIKSA++++    + +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVH+PLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLT++K N  G+G +F++ +E    YQ+  + +H+ I +  S    K+   +   GI+  T GK+I N+ +P+++ +++       +  N++            K +V     K +L +++N  + K+      I+   +DKIK+ G+ YST  A T+S  D+     K++   ETD +V ++ K Y++G +++DERY++V+  W+  T+ V+ ++ K + +     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL VSEYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC +K+G   E+ E  +   +IE L+ERL  R+   D++ P + ++L    E I    A E+  +G+ K+++RSV  CK ++G+C KC+G ++ T + +    ++G+IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    +I+SEI G   +I+         VV I  ++E I+Y +PF S L+V  GD +  G +ITEGS++  ++L++ G   V+NY++ EVQKVYRLQG++I DK++EV++RQ+T K++I++SG+++F  G ++DI  F++EN K    + K  A     + G+ +A   T SFL++ASFQ+T ++LTDA +KG++D L G
  S:     9 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRVRYKGIVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLMLDMSPRSLEKVLYFASYIVID-----------------------PKET-PLLKKQLLN-------EKEYREAIENYGEEGFVAGMGAESVQKLLEEI--------------------------DLNQVSKELKEALKTSTGQKKI---RLIRRLEAVESFRKSSNRPDWMIIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLVQGG---------LSHNIKSAKRMVERVQSEVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHLPLSVEAQAEARFLMLAAHNILKPSDGKPVCVPTQDMVLGSYYLTLDKENAIGEGRIFSSPEEAIMAYQIGDIDIHAHIKVRIS----KEVDGEEVCGIIDCTPGKLIFNESIPQDLGFVD-----RSVPGNEV------------KLEVDFLINKSSLGKLINKCYMKHGPTKTSIM---LDKIKEKGYHYSTIGAITVSTSDMVVPEAKKRLLAETDVEVNKIDKMYRRGFISEDERYERVIEKWTKTTDLVADELMKNLDR----FNPIFMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIRASFREGLDVSEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREEDCGSKEG--FEISEIREGNEIIEPLSERLTGRYSAEDIIDPNTGEILVKKEEYIDGEKAEEVEKSGVKKIKIRSVFTCKSKHGVCAKCYGMNMATAEKINIGESVGIIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AIVSEING---TIRIDETKKKRTVVVIGETEE-ISYDIPFGSRLKVSNGDVISAGDEITEGSVNPHDVLRIKGPNGVKNYLLSEVQKVYRLQGVDINDKHLEVVVRQMTRKIKIEESGDTEFLPGTMVDIFDFQEENAK-AEEEGKETAKGRITLLGITKAALATDSFLSSASFQETTRVLTDAAIKGKVDPLLG 1135
>gi|28212180|ref|NP_783124.1| DNA-directed RNA polymerase subunit beta' [Clostridium tetani E88] >gi|28204624|gb|AAO37061.1| DNA-directed RNA polymerase beta chain [Clostridium tetani E88] (1150 aa)
Score = 2615, Expect = 0.0e+00, Identities = 554/1244 (44%), Positives = 811/1244 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNG 1253
           ++QIGLASPEKIREWS GEV K ETINY++LKPE+DGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +YIV+D                        KET   L+K L         E     AI++     F   +   ++   +EE+                          DL++  K++ E L+ S     I   +L+RRLEA++  + S+N+P+WMI+  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLK+++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELKMYQ G+P  M L+LFKPF++ +L++           +  NIKSA++++    + +W ++ +VI   PVLLNRAPTLHRLGIQAF+P+LVEG+AI+LHPLV TA+NADFDGDQMAVH+PLS EA AEAR ++LA+ +IL P DGKP+  PTQDMVLG+YYLT++K N  G+G +F++ +E    YQ+  + +H+ I +  S    K+   +   GI+  T GK+I N+ +P+++ +++       +  N++            K +V     K +L +++N  + K+      I+   +DKIK+ G+ YST  A T+S  D+     K++   ETD +V ++ K Y++G +++DERY++V+  W+  T+ V+ ++ K + +     N I +MA+SGARG+ S   QL+GMRGLM+                 IE+PI+ SF EGL VSEYF S++GARKG  DTA+KT+ SGY+TR+LVD +QDVIV  EDC +K+G   E+ E  +   +IE L+ERL  R+   D++ P + ++L    E I    A E+  +G+ K+++RSV  CK ++G+C KC+G ++ T + +    ++G+IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R+++LF+   PK    +I+SEI G   +I+         VV I  ++E I+Y +PF S L+V  GD +  G +ITEGS++  ++L++ G   V+NY++ EVQKVYRLQG++I DK++EV++RQ+T K++I++SG+++F  G ++DI  F++EN K    + K  A     + G+ +A   T SFL++ASFQ+T ++LTDA +KG++D L G
  S:    24 ALQIGLASPEKIREWSRGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECHCGKYKRVRYKGIVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLMLDMSPRSLEKVLYFASYIVID-----------------------PKET-PLLKKQLLN-------EKEYREAIENYGEEGFVAGMGAESVQKLLEEI--------------------------DLNQVSKELKEALKTSTGQKKI---RLIRRLEAVESFRKSSNRPDWMIIDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKMYQCGLPKEMALELFKPFVMKKLVQGG---------LSHNIKSAKRMVERVQSEVWDVLEEVISDHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLVCTAYNADFDGDQMAVHLPLSVEAQAEARFLMLAAHNILKPSDGKPVCVPTQDMVLGSYYLTLDKENAIGEGRIFSSPEEAIMAYQIGDIDIHAHIKVRIS----KEVDGEEVCGIIDCTPGKLIFNESIPQDLGFVD-----RSVPGNEV------------KLEVDFLINKSSLGKLINKCYMKHGPTKTSIM---LDKIKEKGYHYSTIGAITVSTSDMVVPEAKKRLLAETDVEVNKIDKMYRRGFISEDERYERVIEKWTKTTDLVADELMKNLDR----FNPIFMMADSGARGSKSQIKQLAGMRGLMANPSG-----------KIIELPIRASFREGLDVSEYFISTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREEDCGSKEG--FEISEIREGNEIIEPLSERLTGRYSAEDIIDPNTGEILVKKEEYIDGEKAEEVEKSGVKKIKIRSVFTCKSKHGVCAKCYGMNMATAEKINIGESVGIIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRVEELFEARKPKGL--AIVSEING---TIRIDETKKKRTVVVIGETEE-ISYDIPFGSRLKVSNGDVISAGDEITEGSVNPHDVLRIKGPNGVKNYLLSEVQKVYRLQGVDINDKHLEVVVRQMTRKIKIEESGDTEFLPGTMVDIFDFQEENAK-AEEEGKETAKGRITLLGITKAALATDSFLSSASFQETTRVLTDAAIKGKVDPLLG 1150
>gi|154484473|ref|ZP_02026921.1| hypothetical protein EUBVEN_02187 [Eubacterium ventriosum ATCC 27560] >gi|149734321|gb|EDM50238.1| hypothetical protein EUBVEN_02187 [Eubacterium ventriosum ATCC 27560] (1270 aa)
Score = 2611, Expect = 0.0e+00, Identities = 570/1274 (44%), Positives = 824/1274 (64%)
  Q:     3 SKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTG-MRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKL-----------NMPGQGMLFANVDELKT--------VYQMKKVH----------------------------------VHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           S+      I+IGLASPEKIREWS GEVTK ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G +C++CGVE+T++ VRRER+G +ELA P++HIW  K +P  S++ L+LDIS + +E+V+YF +YIVLD          ++K+V+                K  RE YE                                          F G  R G+GAEAI ELL +ID++KE + +  +L ++      K  K+V+RLE  +  ++S NKPEWMIL  I V PPD RP++QL+GG+F TSD+N  YR+II RN RLKR+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+          +    NIKSA+K++      +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TAFNADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLTM+++            +     ++   +E+K          + M K H                                  +H  I +  + F  +     GI+ TT+G+ + N++LP+++ ++         +D D ++   D+   + KK++     K+ L +++N       +         +D IK +G+++ST++A T+S  D+     K++   + +  V+E+ K+Y++G LTD+ERYK+V+  W +  N+++  +   + K     N+I +MA+SGARG+     QL+GMRGLM+ +              TIE+PIK++F EGL V EYF S++GARKGM+DTA++T+ SGY+TR+LVD +QD+I+ + DC   K      IED   G+ VIESL ER+  R    + ++     ++  A  +IT   A  IV  G+  V++R++L CK   G+C KC+G ++ T + V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +II+E  G V+ IK +     I +VT   + ES  Y +P+ S++++ +G  ++ G ++TEGSI+  +LLK+ G+  V++Y+I+EVQ+VYRLQG+EI DK++EVI+RQ+  K+++  +G+S+F  G  +++  F + NE+L  ++ K PAT   ++ G+ +A   T SFL+AASFQ+T ++LT+A + G++D L GLKENVI G LIP GTG K   D+
  S:     7 SEQVSFDKIKIGLASPEKIREWSRGEVTKPETINYRTLKPEKDGLFCEKIFGPSKDWECHCGKYKKIRYKGVVCDRCGVEVTKASVRRERMGSVELATPVSHIWYFKGIP--SRMGLILDISPRVLEKVLYFASYIVLD----PMETTLDYKQVLS--------------EKEFREAYEE-----------------------------------------FGGKFRVGMGAEAIKELLMDIDVEKEAEQLKSELFEATGQ---KKAKIVKRLEVFEAFRNSGNKPEWMILDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLKRLLELGAPEIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELV---------ANGTAHNIKSAKKMVERLQTEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGAPVAVPSQDMVLGIYYLTMDRMVDHSKEEEIASTVAEDAPIYDTDEEIKEALDKGIIGAHDMIKYHADDRVVICEPVDALGHSFSDINQAILAYENKEISLHQRIKVKRTVFNGEGKEVTGIIDTTLGRCLFNEILPQDLGFVKRE------TDEDYLKLEVDFH--VGKKQL-----KQILEKVIN-------NHGATKTAEVLDNIKAMGYKFSTRAAMTVSISDMTVPESKKQILADAEHTVDEITKHYRRGFLTDEERYKEVIETWQAADNELTTALLSGLDK----YNNIFMMADSGARGSDKQIKQLAGMRGLMADTTG-----------KTIELPIKSNFREGLDVLEYFISAHGARKGMSDTALRTADSGYLTRRLVDVSQDLIIRDVDCCEGKAIPFMEIEDLVDGNEVIESLEERITGRTAA-ETMYDAEGNMIVKANHMITPKRAARIVATGVKSVKIRTILTCKSHVGVCAKCYGANMATGQRVQVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKGL--AIIAEF-GGVAEIKETKKKREI-IVTNPETGESKAYLIPYGSKIKILDGAVLEAGDELTEGSINPHDLLKIKGLRAVQDYMIREVQRVYRLQGVEINDKHVEVIVRQMLKKIKVDTAGDSEFLPGTTVEVLDFNEVNEQL-EAEGKEPATGTQIMLGITKASLATSSFLSAASFQETTRVLTEAAINGKVDPLVGLKENVIIGKLIPAGTGMKRYGDV 1220
>gi|160894091|ref|ZP_02074869.1| hypothetical protein CLOL250_01645 [Clostridium sp. L2-50] >gi|156864124|gb|EDO57555.1| hypothetical protein CLOL250_01645 [Clostridium sp. L2-50] (1254 aa)
Score = 2607, Expect = 0.0e+00, Identities = 577/1262 (45%), Positives = 831/1262 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKN--FNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLN--NPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTI-LEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGID------------------KVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSK--ESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKK 1271
           +I+IGLASPEKIREWS+GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G IC++CGVE+T++ VRRER+GHIELAAP++HIW  K +P  S++ L+LDIS + +E+V+YF +YIVLD      PK+    +K+V+          T  + RK                                        EE F + S     R G+GAE+I ELL+ IDLDKE +++  +L+   N+S  K  ++++RLE ++  ++S NKPEWMI+  I V PPD RP++QL+GG+F TSD+N  YR+II RN RL+R++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL         T     +NIK+A+K++   +  +W ++  VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TAFNADFDGDQMAVH+PL+ EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLTMEK    G+G  F + +E    Y+ K++ +HS I +  +   +      GI+ TT+G+++ N+++P+++ Y++  NPDN+ +L          +    + KK++     K  L + +N  H     A +      +D +K IG++YST+ A ++S  D+    EK++   +   +V+++ K +++GL+T++ERY  VV  W      ++K +   + K     N+I +MA+SGARG+     QL+GMRGLM+ +              TIE+PIK++F EGL V EYF S++GARKG++DTA++T+ SGY+TR+LVD +QD+I+   DC   K    +EV    +   VIES  ER+  R+ + + V+ K   +L  A  +++   A  IV+ G+D                  K+++R++L CK   G+C KC+G ++ T + V+   A G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK    +II+E  GKV       DN     V I N +  ES  Y +P+ S ++V +   ++ G ++TEGS++  ++LK+ GI  V++Y+++EVQ+VYRLQG++I DK+IE+I+RQ+  K++I+D+G+S +  G ++D+  F   NE+LI ++ K PA    ++ G+ +A   T SF++AASFQ+T K+LTDA +K ++D LNGLKENVI G LIP GTG K
  S:    19 AIRIGLASPEKIREWSHGEVKKPETINYRTLKPEKDGLFCERIFGPSKDWECHCGKYKKIRYKGIICDRCGVEVTKASVRRERMGHIELAAPVSHIWYFKGIP--SRMGLILDISPRVLEKVLYFASYIVLD------PKDTPLTYKQVL----------TEQEYRKA---------------------------------------EEDFGYGS----FRAGMGAESIQELLRAIDLDKESEELKAELK---NSSGQKRARIIKRLEVVEAFRNSENKPEWMIMDVIPVIPPDIRPMVQLDGGRFATSDLNDLYRRIINRNNRLRRLLDLNAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKEL---------TASGRANNIKAAKKMVEKLEPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNADFDGDQMAVHLPLTVEAQAECRFLLLSPNNLLKPSDGAPVAVPSQDMVLGIYYLTMEKDGDIGEGKFFKSKNEALLAYENKEITLHSKIKVRRTVTTEDGAEVTGIIDTTLGRLLFNEIIPQDLGYVDRTNPDNILKL----------EIDFHVGKKQL-----KPILDKCINT-HGATKTAEV------LDDVKAIGYKYSTRGAISVSISDMKVPDEKKQILADAQTQVDKITKMFRRGLMTEEERYLAVVKVWEEADKVLTKALLDGLDK----YNNIFMMADSGARGSNQQIKQLAGMRGLMADTTG-----------RTIELPIKSNFREGLDVLEYFISAHGARKGLSDTALRTADSGYLTRRLVDVSQDLIIRETDCCAGKAIPGMEVEAFMEGKEVIESFQERITGRY-LAESVYDKDGNLLVKANHMVSPKRAALIVNQGVDSNGVPFLDPDTGVTRQDAKLKIRTILTCKSHLGVCAKCYGANMATGQPVQVGEAAGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVEELFEARKPKGL--AIIAEFGGKVQ----LRDNKKKREVVITNDETGESKAYLIPYGSRIKVLDDQVLEAGDELTEGSVNPHDILKIKGIRAVQDYMLREVQRVYRLQGVDINDKHIEIIVRQMLKKIRIEDNGDSSYLPGTLVDVLDFEDTNEQLI-AEGKQPAEGSQVMLGITKASLATDSFMSAASFQETTKVLTDAAIKSKVDPLNGLKENVIIGKLIPAGTGMK 1186
>gi|1495275|emb|CAA61514.1| DNA-directed RNA polymerase [Bacillus anthracis] (1052 aa)
Score = 2596, Expect = 0.0e+00, Identities = 533/1135 (46%), Positives = 750/1135 (66%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASP+KIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC CGKYK+++++G +C++CGVE+T + VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K         L S+K  +  R +   T          +A+M                                          GAEAI +LL++IDLDKE   + E+L+ ++     +  + ++RLE ++  ++S N+P WMIL  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL++K          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+    G+GM+F + +E    YQ   VH+H+ + +  SA     F    K+ +L+TTVGK+I N++LPE   Y+N P   NLE E      VE G + +  I  ++    F+KK L  I+  + +++    +      +D++K++GF+YSTK+  T+   D+    EK++   E   KV+ + K +++GL+T++ERY +V+S WS+  + +   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I++     VIESL +RL+ RF    V HP++ +VL    ++IT+ +A+ + ++G++ V +RS   C   +G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   +++ISEI+G +++I    D   ++V   +   E+  Y +P+ + L+V  G K+  G ++TEGSID KELLKV  I  V+ Y+++EVQK
  S:    10 MKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDGLFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKK-------QLLSEKEYRAYRDRYGSTF---------QAAM------------------------------------------GAEAIKKLLQDIDLDKEVDFLKEELKTAQGQ---RRTRAIKRLEVLEAFRNSGNEPSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKG---------LAHNIKSAKRKIERVQPEVWDVLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKDANEALLAYQNGYVHLHTRVAVAASAVNNVTFTEEQKNMLLLTTVGKLIFNEILPESFPYINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRF---KITETSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEEERYDRVISIWSNAKDVIQGKLMKSLNK----RNPIFMMSDSGARGNXSNFTQLAGMRGLMANPSG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREDDCGTDRGLLIGAIKE--GNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDIAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QAVISEIDGVIAAINDVKDRQEVVV---QGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLREVQK 1052
>gi|153852612|ref|ZP_01994049.1| hypothetical protein DORLON_00022 [Dorea longicatena DSM 13814] >gi|149754254|gb|EDM64185.1| hypothetical protein DORLON_00022 [Dorea longicatena DSM 13814] (1225 aa)
Score = 2596, Expect = 0.0e+00, Identities = 561/1267 (44%), Positives = 831/1267 (65%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTI--LEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGID-------KVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +I+IGLASPEKI EWS GEVTK ETINY++LKPEKDGLF E IFGP KD+EC CGKYKKI+++G +C++CGVE+T++ VRRER+GHI LAAP++HIW  K +P  S++ L+LD+S + +E+V+YF +YIVLD+G                                   +Y+ +  EA  + A + K    F                          R G+GAE+I ELL+NIDL+KEY ++ E L+ +      K  ++V+RLE ++  ++S NKPEWMI+ NI V PPD RP++QL+GG+F TSD+N  YR+II RN RL+R+++  AP II+ NEKR+LQEAVDAL DN  R +P+ G   R LKSLS+ LKGK G FRQNLLGKRVDYSGRSVIV+GPELK+YQ G+P  M ++LFKPF++ EL+         ++    NIK+A+K++      +W ++ +VIK+ PV+LNRAPTLHRLGIQAFEPILVEGKAI+LHPLV TAFNADFDGDQMAVH+PLS EA AE R ++L+  ++L P DG P+  P+QDMVLG YYLT E+    G+GM+F + +E    Y+   V +HS + +  S        K G + +TVG+ + N+++P+++ +++      E+  N+++    +    + KK++     K+ L +++N      + A+ E+    +D +K +G++ ST++A T+S  D+    +K +  +     V+++ K +++GL+T++ERYK+VV  W +  + ++K +   + K     N+I +MA+SGARG+     QL+GMRGLM+ +  +           TIE+PIK++F EGL V EYF S++GARKGM+DTA++T+ SGY+TR+LVD +Q++I++  DC      I  + V        VIESL ER+  R+   ++V  K   +L  A  ++T   A  I   G+D       ++++R++L C+  +G+C KC+G ++ T + V+   A+G+IAAQSIGEPGTQLTMRTFH+GGV+ G +I QG  R+++LF+   PK    +II+EI G  +++  +     I +VT + + ES  Y +P+ S ++V +G +++ G ++TEGS++  ++L++ G+  V++Y+I+EVQ+VYRLQG+EI DK+IEVI+RQ+  K++I++SG+++F  G  +D   F   NE L  ++ K PAT   +I G+ +A   T SFL+AASFQ+T K+LT+A +KG++D L GLKENVI G  IP GTG +   DI
  S:    17 AIKIGLASPEKILEWSKGEVTKPETINYRTLKPEKDGLFCEKIFGPSKDWECHCGKYKKIRYKGVVCDRCGVEVTKASVRRERMGHIALAAPVSHIWYFKGIP--SRMGLILDLSPRTLEKVLYFASYIVLDKGESDL-------------------------------MYKQVLSEAEYQEA-REKWGSAF--------------------------RVGMGAESIKELLENIDLEKEYTELTEGLKGATGQ---KRARIVKRLEVVEAFRESGNKPEWMIMTNIPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLRRLLELGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKSGRFRQNLLGKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMKELV---------QNGTAHNIKNAKKMVERLQPEVWDVLEEVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNADFDGDQMAVHLPLSVEAQAECRFLLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTQERPGAKGEGMIFKSFNEALLAYENAAVTLHSRVKVRVSKKMPDGTVKTGTVESTVGRFMFNEIIPQDLGFVD-----REVEGNELL---LEVDFHVGKKQL-----KQILEKVINT---HGATATAEV----LDHVKAMGYKLSTRAAMTVSISDMTVPPQKPEMIKNAQDTVDKITKNFKRGLITEEERYKEVVETWKATDDALTKALLDGLDK----YNNIFMMADSGARGSDKQIKQLAGMRGLMADTTGH-----------TIELPIKSNFREGLDVLEYFMSAHGARKGMSDTALRTADSGYLTRRLVDVSQELIIHEVDCAKPGMPIPGMYVKAFMDGNEVIESLQERITGRYICENIVD-KDGNILVKANHMVTPKRAELICKKGVDEKGEPLTQIKIRTILTCRSHSGVCAKCYGANMATGEPVQVGEAVGIIAAQSIGEPGTQLTMRTFHSGGVAGG-DITQGLPRVEELFEARKPKGL--AIITEIAG-TANLNDTKKKREI-IVTNRETGESKAYLIPYGSRIKVADGAELEAGDELTEGSVNPHDILRIKGLRAVQDYMIQEVQRVYRLQGVEINDKHIEVIVRQMLKKIRIEESGDTEFLPGTNVDRLEFEDVNEAL-EAEGKEPATGEQIIMGITKASLATNSFLSAASFQETTKVLTEAAIKGKVDPLVGLKENVIIGKHIPAGTGMRKYRDI 1178
>gi|1495658|emb|CAA61512.1| DNA-directed RNA polymerase [Listeria grayi] (1053 aa)
Score = 2569, Expect = 0.0e+00, Identities = 525/1135 (46%), Positives = 749/1135 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S+K  +  R K  K                                                       G+GAEAI ++L +IDL+KE +++  +L+ ++     +  + +RRLE ++  ++S N+P WMIL  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPFI+ EL+ +          +  NIKSA++ I      +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G++F +++E    Y    VH+HS IG+   +   ++F ++    +LITTVGK++ N +LPE   Y+N P   NLE E      V+   D +T I  + +   F K  L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+   KVE++ K +++GL+T DERY++V+  W++  +++     KLI   E L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++ +++    ++IT+ +A +I+ AGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++ I+E+ G+V SI+   D    L +TI+   +  +Y VP+ + LRVE G  +  G  +TEGSID K L++V  +  V+ Y++ EVQK
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEKEYRVYREKYGKNFHA---------------------------------------------------GMGAEAIKKILSDIDLEKETQELKAELQTAQGQ---RRTRAIRRLEVMEAFRNSGNEPSWMILDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFIMKELVSRG---------LAHNIKSAKRKIERMAAEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGLVFKDINEAMIAYTNGYVHLHSRIGVYAGSIQNERFTEEQRKQLLITTVGKLVFNTILPESFPYINEPTKYNLEIETPTKYFVDTTTDVKTHIANQPLIDPFKKGILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGITVGIADILTLQEKPEILEKAHDKVEKITKQFRRGLITGDERYERVIGVWNAAKDEIQN---KLILSLERL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYARKTIRHPETNEIIVKENDLITEDIAVQIIGAGIEEVSIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QATITEVAGEVVSIEEGRDRG--LEITIQGVDDRRSYTVPYTARLRVEVGSMLDRGEALTEGSIDPKALIRVRDVLSVQEYLLAEVQK 1053
>gi|2500614|sp|P77882|RPOC_LISGR DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) (1053 aa)
Score = 2569, Expect = 0.0e+00, Identities = 525/1135 (46%), Positives = 749/1135 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASP+KIR WS+GEV K ETINY++LKPE+DGLF E IFGP+KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LV+D+S + +E+++YF +Y+V + G+    K         L S+K  +  R K  K                                                       G+GAEAI ++L +IDL+KE +++  +L+ ++     +  + +RRLE ++  ++S N+P WMIL  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPFI+ EL+ +          +  NIKSA++ I      +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ N  G+G++F +++E    Y    VH+HS IG+   +   ++F ++    +LITTVGK++ N +LPE   Y+N P   NLE E      V+   D +T I  + +   F K  L  I+  + +K+    +      +D++KD+GF+ STK+  T+   D+    EK +  E+   KVE++ K +++GL+T DERY++V+  W++  +++     KLI   E L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGLTV EYF S++GARKG+TDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  ++ I +     +IE L ERL  R+    + HP++ +++    ++IT+ +A +I+ AGI++V +RS   C  ++G+C+KC+G +L T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   ++ I+E+ G+V SI+   D    L +TI+   +  +Y VP+ + LRVE G  +  G  +TEGSID K L++V  +  V+ Y++ EVQK
  S:    10 MKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDGLFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKK-------QLLSEKEYRVYREKYGKNFHA---------------------------------------------------GMGAEAIKKILSDIDLEKETQELKAELQTAQGQ---RRTRAIRRLEVMEAFRNSGNEPSWMILDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFIMKELVSRG---------LAHNIKSAKRKIERMAAEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGLVFKDINEAMIAYTNGYVHLHSRIGVYAGSIQNERFTEEQRKQLLITTVGKLVFNTILPESFPYINEPTKYNLEIETPTKYFVDTTTDVKTHIANQPLIDPFKKGILGNIIAEVFKKF---HITETSKMLDRMKDLGFKISTKAGITVGIADILTLQEKPEILEKAHDKVEKITKQFRRGLITGDERYERVIGVWNAAKDEIQN---KLILSLERL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLTIKAIRE--GTEIIEPLEERLEGRYARKTIRHPETNEIIVKENDLITEDIAVQIIGAGIEEVSIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRIQEIFEARNPKG--QATITEVAGEVVSIEEGRDRG--LEITIQGVDDRRSYTVPYTARLRVEVGSMLDRGEALTEGSIDPKALIRVRDVLSVQEYLLAEVQK 1053
>gi|167749851|ref|ZP_02421978.1| hypothetical protein EUBSIR_00819 [Eubacterium siraeum DSM 15702] >gi|167657163|gb|EDS01293.1| hypothetical protein EUBSIR_00819 [Eubacterium siraeum DSM 15702] (1187 aa)
Score = 2565, Expect = 0.0e+00, Identities = 557/1259 (44%), Positives = 798/1259 (63%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILN-QDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGK--VSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDK----VPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLASP++IR WS G V + ETINY++ KPE+ GL+ E IFGP KD+EC+CGKYK+I+F+GKICE+CGVE+T + VRRER+GHIELAAP++HIW  K    PS+I  VLDIS K +E+V+YF  YIV+D G+    K    K+++             K    +RE YE  D  A M                                          GAEAI ELL  IDLDK  +++ ++L  ++     K  KL++RL+ ++  + S N+PEWMIL  I V PPD RP++ L+GG+F TSD+N  YR++I RN RL ++ + +AP II+ NEKR+LQEAVDAL DN    + + G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LKM Q G+P  M ++LFKPF++ EL K+          I +NIKSA K++   +D  +W  + +VIK  PVLLNRAPTLHRLGIQAF P+LVEG+AI+LHPLV TAFNADFDGDQMAVH+PLS EA  EART++LA+ ++L P DG+P+  PTQDMVLG+YYLT++K    G+G +F + +E    Y    + +HS I +  +       P+  I+  TVG+++ N+ +P+++ +++  D  ++      +E G   R             KK L +I++   + +      +    +DKIK +G++YSTK+A T++  D     EK+      D +V+E+ +Y+  G +++ ER  +V+S W    NQ + D+   + K     N I +MA+SGARG+ +   QL+GMRGL++ +             +TIE+PI+ ++ EGL + EYF SS GARKG+ DTA++T+ SGY+TR+LVD +Q+VIV  +DC T  G  +++ E  +   +IESL ERL  R+   D     + +VL    ++IT+A A  IV +G+  V++RSVL C  E+G+C KC+G+ L   K +    A+G+IAAQSIGEPGTQLTMRTFHTGG++S  +I QG  R+++LF+   PK    +I+++  GK  +  IK +      +++T  + +E   Y VPF  +L++++GD ++ G  +TEGS++  ++L+V G E V+NYII EVQKVYRLQG++I DK+IEVI+RQ+  K ++ + G+S    G +ID N   K N +L    +      P     ++ G+ +A   T SF++AASFQ+T ++LTDA + G++D L GLKENVI G LIP GTG
  S:     1 MKIGLASPDQIRAWSYGVVERPETINYRTQKPERGGLYCEKIFGPTKDWECSCGKYKRIRFKGKICERCGVEVTRNKVRRERMGHIELAAPVSHIWYFKG--TPSRIGQVLDISPKRLEEVLYFTKYIVVDPGDTVLTK----KQILT-----------EKEYADMRERYED-DFRAEM------------------------------------------GAEAIKELLCEIDLDKLSEELKKELEDTQQGQ--KRVKLLKRLDVVEAFRLSGNRPEWMILDCIPVIPPDLRPMVMLDGGRFATSDLNDLYRRVINRNNRLTKMKELHAPDIIIRNEKRMLQEAVDALIDNGRHGRAVTGPSNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPDLKMDQCGLPKEMAIELFKPFVMKELDKRG---------IANNIKSARKMVEQAKDPAVWDALEEVIKDHPVLLNRAPTLHRLGIQAFMPVLVEGRAIKLHPLVCTAFNADFDGDQMAVHLPLSEEAQNEARTLMLAAKNLLKPSDGRPVTVPTQDMVLGSYYLTIDKPGEKGEGKVFRDFNEAIMAYNEGDITIHSAIKVRVTKDVGGDHPETKIIDATVGRILFNEHIPQDLGFVDRNDPEKKFD----LEIGFKVR-------------KKELGKIIDKCLKVHGTP---MTAQVLDKIKAMGYKYSTKAAITVAVCDATIPPEKKDILANADAQVQEINEYFNNGFISNAERKSQVLSVW----NQATTDVTVALTKGLDDYNPIYMMADSGARGSTNQIRQLAGMRGLIANTSG-----------ETIEIPIRANYREGLNILEYFISSRGARKGLADTALRTADSGYLTRRLVDVSQEVIVRTDDCGTTDG--IDIYEIREGKELIESLEERLTGRYLAEDFTD-DNGEVLVSKDKLITEADAKMIVASGVKTVKIRSVLTCHAEHGVCAKCYGSSLANGKKITIGEAVGIIAAQSIGEPGTQLTMRTFHTGGIASAEDITQGLPRVEELFESRRPKN--AAIMAKHSGKTRIDEIKKTRH----VIITTADGEEH-PYPVPFGYKLKIQDGDFIEAGETLTEGSVNPHDVLEVKGEEAVQNYIIAEVQKVYRLQGVDINDKHIEVIVRQMMRKARVTNPGSSYLLPGSVIDKNELVKVNNELEQRKEAGEQIEPVECEAVLLGITKAALATDSFMSAASFQETTRVLTDAAIHGKVDPLLGLKENVIIGKLIPAGTG 1150
>gi|1495742|emb|CAA61516.1| DNA-directed RNA polymerase [Pediococcus acidilactici] (1055 aa)
Score = 2556, Expect = 0.0e+00, Identities = 524/1140 (45%), Positives = 747/1140 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDNLEELS---DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KDYECACGKYK+I+++G +C++CGVE+T+S VRRER+GHIELAAP+ HIW  K +P  S++ LVLD+S + +E+++YF +Y+V+D G+    K    K+++      + +E R+KL +                                                   G RF   IG EAI  LL+++DL+KE   + E+L+++   S  K  + VRRL+ I+    S N P+WM++  I V PPD RP++QL+GG+F TSD+   YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQ  FRQNLLGKRVDYSGRSVI +GP LKM Q+G+PV M ++LFKPFI+ EL+ +          + SNIK+A++ I  +D  ++ ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMV+GNY+LTME+    G+GM+F ++DE+K   Q   V +H+ IG+  S+ P+K F    +  ILITT GK++ ND+LP++  YLN P N + ++   D   +E G+D    + ++ +   F    LS+++  ++++Y      ++   +D++KD+GF  ST S  T+   D+    +K        KKV  + K +++GL+TDDERY++V+  W+   +++ + +      P+   N I +M++SGARGNISNFTQL+GMRGLM+           K+    +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I   +   +IE L +R++ R+ +  V++P++ KV+    E+I +  A EI+DAGI +V +RS   C   +G+C+KC+G ++ T   VE   A+G +AAQSIGEPGTQLTMR FHTGGV+   +I QG  R++++ +   PK    + ISE+ G V SI+  P       VT+K   +S  Y +P  + ++V EGD +  G+ + EGSID K+L+KV  +    NY++ E+QK
  S:     5 NKFESMQIGLASPDKIRMWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDYECACGKYKRIRYKGIVCDRCGVEVTKSKVRRERMGHIELAAPVTHIWYFKGIP--SRMGLVLDMSPRSLEEIIYFASYVVVDPGDTPLEK----KQLL------TEREYRAKLDEY--------------------------------------------------GNRFVAKIGGEAIQALLQSVDLEKEANLLKEELKEA---SGQKRTRAVRRLDIIEAFIKSGNHPDWMVMDAIPVMPPDLRPMVQLDGGRFATSDLKHLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQEGFRQNLLGKRVDYSGRSVIDVGPSLKMNQMGLPVPMAMELFKPFIMKELVSRN---------LASNIKNAKRKIDRKDEEVYDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLACEAYNADFDGDQMAIHVPLSNEAQAEARLLMLAAHHILAPKDGKPVVTPSQDMVIGNYWLTMERAESVGEGMIFNDLDEVKLALQNGYVSIHTRIGVRASSMPEKPFTDQQRQQILITTAGKMLFNDILPKDFVYLNAPTNEKLVNGTPDEYFLEAGEDIHEQLNQRPLLSPFKSGFLSDVIAEVYKQYKVTETSLL---LDRMKDLGFYRSTLSGLTVGIADITNLPDKPAIIAAAHKKVATVTKQFRRGLITDDERYERVIGIWNDAKDEIQQRLMDTFD-PQ---NPIFMMSDSGARGNISNFTQLAGMRGLMAAP-------NGKI----MELPILSNFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQDVIVREKDCGTDRGLLITAI--AEGNEMIEPLYDRILGRYTMKSVINPETGKVIVGQNEMIDERSAQEIIDAGIQEVTIRSAFTCNTAHGVCEKCYGRNMATGDRVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGNADITQGLPRIQEIVEARNPKG--PAEISEVTGVVESIEEDPAE-GTKEVTVKGETDSRTYSLPITARMKVAEGDYIHRGAPLNEGSIDPKKLIKVRDVLSTENYLLSEIQK 1055
>gi|2500616|sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) (1055 aa)
Score = 2555, Expect = 0.0e+00, Identities = 524/1140 (45%), Positives = 747/1140 (65%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNPDNLEELS---DNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPEKDGLFDE IFGP KDYECACGKYK+I+++G +C++CGVE+T+S VRRER+GHIELAAP+ HIW  K +P  S++ LVLD+S + +E+++YF +Y+V+D G+    K    K+++      + +E R+KL +                                                   G RF   IG EAI  LL+++DL+KE   + E+L+++   S  K  + VRRL+ I+    S N P+WM++  I V PPD RP++QL+GG+F TSD+   YR++I RN RLKR++  NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQ  FRQNLLGKRVDYSGRSVI +GP LKM Q+G+PV M ++LFKPFI+ EL+ +          + SNIK+A++ I  +D  ++ ++  VIK+ PVLLNRAPTLHRLGIQAFEP+LV GKA+RLHPL   A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMV+GNY+LTME+    G+GM+F ++DE+K   Q   V +H+ IG+  S+ P+K F    +  ILITT GK++ ND+LP++  YLN P N + ++   D   +E G+D    + ++ +   F    LS+++  ++++Y      ++   +D++KD+GF  ST S  T+   D+    +K        KKV  + K +++GL+TDDERY++V+  W+   +++ + +      P+   N I +M++SGARGNISNFTQL+GMRGLM+           K+    +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVIV  +DC T +G ++  I   +   +IE L +R++ R+ +  V++P++ KV+    E+I +  A EI+DAGI +V +RS   C   +G+C+KC+G ++ T   VE   A+G +AAQSIGEPGTQLTMR FHTGGV+   +I QG  R++++ +   PK    + ISE+ G V SI+  P       VT+K   +S  Y +P  + ++V EGD +  G+ + EGSID K+L+KV  +    NY++ E+QK
  S:     5 NKFESMQIGLASPDKIRMWSYGEVKKPETINYRTLKPEKDGLFDERIFGPTKDYECACGKYKRIRYKGIVCDRCGVEVTKSKVRRERMGHIELAAPVTHIWYFKGIP--SRMGLVLDMSPRSLEEIIYFASYVVVDPGDTPLEK----KQLL------TEREYRAKLDEY--------------------------------------------------GNRFVAKIGGEAIQALLQSVDLEKEANLLKEELKEA---SGQKRTRAVRRLDIIEAFIKSGNHPDWMVMDAIPVMPPDLRPMVQLDGGRFATSDLKHLYRRVINRNNRLKRLLDLNAPGIIVQNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQEGFRQNLLGKRVDYSGRSVIDVGPSLKMNQMGLPVPMAMELFKPFIMKELVSRN---------LASNIKNAKRKIDRKDEEVYDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLACEAYNADFDGDQMAIHVPLSNEAQAEARLLMLAAHHILAPKDGKPVVTPSQDMVIGNYWLTMERAESVGEGMIFNDLDEVKLALQNGYVSIHTRIGVRASSMPEKPFTDQQRQQILITTAGKMLFNDILPKDFVYLNAPTNEKLVNGTPDEYFLEAGEDIHEQLNQRPLLSPFKSGFLSDVIAEVYKQYKVTETSLL---LDRMKDLGFYRSTLSGLTVGIADITNLPDKPAIIAAAHKKVATVTKQFRRGLITDDERYERVIGIWNDAKDEIQQRLMDTFD-PQ---NPIFMMSDSGARGNISNFTQLAGMRGLMAAP-------NGKI----MELPILSNFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQDVIVREKDCGTDRGLLITAI--AEGNEMIEPLYDRILGRYTMKSVINPETGKVIVGQNEMIDERSAQEIIDAGIQEVTIRSAFTCNTAHGVCEKCYGRNMATGDRVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGNADITQGLPRIQEIVEARNPKG--PAEISEVTGVVESIEEDPAE-GTKEVTVKGETDSRTYSLPITARMKVAEGDYIHRGAPLNEGSIDPKKLIKVRDVLSTENYLLSEIQK 1055
>gi|39938747|ref|NP_950513.1| DNA-directed RNA polymerase beta' subunit [Onion yellows phytoplasma OY-M] >gi|81565114|sp|Q6YQW2|RPOC_ONYPE DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|39721856|dbj|BAD04346.1| DNA-directed RNA polymerase beta' subunit [Onion yellows phytoplasma OY-M] (1353 aa)
Score = 2547, Expect = 0.0e+00, Identities = 569/1258 (45%), Positives = 816/1258 (64%)
  Q:    12 QIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLG--KDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTME-------------------KLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSA----FPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKAS-PDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +I LA+PE+IR+WS GEVT  ETINY++ KPE  GLF + IFGPV D++CAC K K++  + + C KCGVE TE+ VRRER+GHIEL  PI H W       PS+++++L+I  K++E++VY+V+Y+V+D G  +    F  KE+                                        I  T Y            E ++ F ++F  +    GAEA+ +LL+N++L+K  K + + L  SEN+   K + +++RLE I+    S+NKPEWM++  I V PP  RP++ L+GG+F T+++N  YR+I+ RN RLK+ +   AP +I+ NEKR+LQEAVDALFDNA   K  +   +  RPLKSLSE L+GKQG FRQNLLGKRVDYSGRSVI++GP+L+M+Q G+P  M + LFKPFI+ +L    + +G  K       K+A  +    +  +W  + +V+K+ PVLLNRAPTLHRLGIQAF+P L++GKAIRLHPLVT AFNADFDGDQMA++VPLS EA AEAR ++L S +IL PK+G P++TP+QDMVLGNYYLT+E                   +     +G  FA+++E KT YQ K++H+H+ I I   A    F ++Q  K   L+TT+GK+I ND+LP    Y+N P   NL+ +  D   +  G + + F++K    K F KK LS I+      +    +      +D IK++GF+YST +  T+S  D+  Y+ K++  +E + +  +++ +Y  G LTD ER + V++ W ++ +++ + + K  Q+     N I +M+ SGARG++SNFTQL+GMRGLM+               + IEVP+K SF EGL VSE+F S++GARKG TDTA+KT++SGY+TR+LVD TQD++V  EDC + +G ++E +     G  I SL +R++ RF   D+ HPK+  ++    E+IT++ A EI+ A I KV +RS+L C  E GIC K +G +L TNKLVE   A+GVIAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R+++LF++  PK   K++ISE++GK+  I      NP I++    +      Y +  + ++ V + + V PG K+T GS+D+KELL+VAG    + YI++EVQKVYR Q + I+DK+IE+II Q+  ++ I D G++    G  I IN F+K N K+ L ++K+ A    +I G+  +  ++ S L+AASFQ+T KIL DA +KG+ D L GLKENVI G LIP GTG
  S:   140 KIRLAAPEEIRQWSYGEVTSYETINYRTYKPEISGLFCQKIFGPVVDFQCACSK-KQVSIKSQFCNKCGVEFTETKVRRERMGHIELQTPIVHTWYLNS--SPSRLAILLNIKTKQLEEIVYYVSYVVIDPGKTE----FKPKEI----------------------------------------ITETQYS-----------EALYEFGNAFVAL---TGAEAVKKLLENLNLEKTIKVLRKSL--SENSKQ-KRESIIKRLEIIESFHQSDNKPEWMVMDVIPVLPPGLRPMVPLDGGRFATTEVNDLYRRILNRNNRLKKQMLQKAPRLIIKNEKRMLQEAVDALFDNAKTSKKNVNNVEKNRPLKSLSEMLRGKQGRFRQNLLGKRVDYSGRSVIIVGPDLEMHQCGVPREMAIILFKPFILKKL---QETKGIDK-------KNANTIYEKMNEEVWNALEEVVKEHPVLLNRAPTLHRLGIQAFDPKLIDGKAIRLHPLVTPAFNADFDGDQMAIYVPLSLEAQAEARLLMLVSNNILDPKNGNPVVTPSQDMVLGNYYLTIEEKKDRTINSYDAAQRTAEHQYKHRNEGAFFADINEAKTAYQNKEIHLHTRIFIKPQAINLSFTEEQRQK--YLMTTLGKLIFNDILPPSFPYINEPTQFNLDVKTPDAYFLAPGTNPKQFLKKLPTPKPFNKKFLSMIIACF---FKQMKITETSKMLDHIKNLGFKYSTIAGITVSFADINTYSNKQELLQEVEARNIQIETWYNDGFLTDAERRRLVINEWKNIRDEIQEGLMKEFQQ----DNHIFMMSESGARGSVSNFTQLAGMRGLMNNPKG-----------EIIEVPVKASFREGLKVSEFFISTHGARKGSTDTALKTAESGYLTRRLVDVTQDIVVIKEDCNSDRGFVVEAM--ISDGKEIVSLKQRIMGRFASCDICHPKTNALIIARNELITESKAQEIITAKIKKVPIRSILTCNCEYGICAKDYGVNLATNKLVEIGEAVGVIAAQSIGEPGTQLTMRTFHTGGVASASDITQGLPRIEELFEVRKPKG--KALISELKGKIKKIDKIRSQNPEIVITEENDPDTEHRYILEPNVDILVSKNNSVYPGQKLTSGSVDLKELLRVAGTTEAQKYILEEVQKVYRAQNVYISDKHIEIIIHQMFKQILIIDEGDTQLLPGTEITINNFKKANLKM-LEENKLLAVGRPIILGITRSSLRSDSLLSAASFQETTKILIDAAIKGKTDHLYGLKENVIIGGLIPAGTG 1327
>gi|152964650|ref|YP_001360434.1| DNA-directed RNA polymerase subunit beta' [Kineococcus radiotolerans SRS30216] >gi|151359167|gb|ABS02170.1| DNA-directed RNA polymerase, beta' subunit [Kineococcus radiotolerans SRS30216] (1293 aa)
Score = 2539, Expect = 0.0e+00, Identities = 548/1259 (43%), Positives = 819/1259 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEV-IDLSSQK------SSKETRSK-LRKTLREIYES---IDVEASMENAIKHKIARTFYDTLAESNMPFSI---------------EEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGI------PTSA--FPKKQFPKDGILI-TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVI--ESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGT-NIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ E IR WS+GEV K ETINY++LKPEKDGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T + VRRER+GHIELAAP+ HIW  K +P  S++  +LD++ K++E+V+YF  Y++    +    ++F+  E  I++  ++      S  ETR+K L + L E+       DV   +  + + ++A+      AE +   +I               E ++  +    G+ F  G+GA A+ + L++ DL+ E + + E +   +     KT+ L +RL+ +     + N PE M+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+NNEKR+LQEAVDALFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+  +  +         NIKSA++++      +W ++++VI + PVLLNRAPTLHRLGIQAFEP LVEGKAI++HPLV TAFNADFDGDQMAVHVPLS EA AEAR ++L+S +IL P DG+P+  PTQDM++G Y+LT ++ ++ G+G  F+++ E    +  K++++++ + I      PTSA   P+     D + + TT+G+ + N+ LP +  Y+N                                  KK LS IVN L  +Y       V +T+D +K+ GF ++T+S TT+S  DV     K+   E  + K E++++ Y++GL+TDDER ++++  W+  TN V+KD+E  +  P +  N+I  M +SGARGN     QL+GMRGLM+               + I  P+K SF EGLTV E+F +++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  +DC T +G  + + E    GS+   + +   +  R    DVV     +V+ PAG  +   V + +V+ G++ ++VRSVL C+   G C +C+G  L + KLV+   A+G++AAQSIGEPGTQLTMRTFHTGG +S + +I  G  R+ +LF+   PK    + ISE+ G+ + I+ + D    +VVT  +  E + Y V     L VE+G  V+ G K+ +G++D K++L++ G   V+ +++ EVQ+VYR QG+ I DK+IEVI+RQ+  +V I +   S+   G++++   F +EN + ++++   P++    + G+ +A   T S+L+AASFQ+T ++LT+A ++G+ D L GLKENVI G LIP GTG
  S:    10 LRIGLATAEDIRTWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVP--SRLGYLLDLAPKDLEKVIYFAAYMITSVDDEARQRDFSSLEAQIEVEKREVENRRDSDVETRAKTLEQDLAELEAEGAKSDVRRKVRESAEREMAQIRRRADAEIDRLATIWDRFRTLKVQDLEGDEVLYRAMRERFGLYFEGGMGAAALQKRLQSFDLEAEAESLRETIATGKGQR--KTRAL-KRLKVVSAFLTTRNSPEGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKQMALELFKPFVMKRLVDLSHAQ---------NIKSAKRMVERARPVVWDVLSEVITEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHVPLSAEAQAEARILMLSSNNILKPADGRPVTMPTQDMIIGLYHLTADRDDVAGEGRQFSSLAEAIMAFDAKQLNLNAKVRIRLSGVVPTSAMALPEDWQQGDDLDVETTLGRALFNETLPVDYEYVN------------------------------VVVDKKQLSAIVNDLAERYPKVQ---VAATLDALKEAGFHWATRSGTTVSIADVVTPPNKQAILETYEAKAEKVQQQYERGLITDDERRQELIEIWTQATNDVAKDLEAAM--PTH--NTIHRMVSSGARGNWMQMRQLAGMRGLMANPKG-----------EIIPRPVKASFREGLTVGEFFITTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREDDCGTFRGLSMPIAEKNSDGSLRRHDDVETSVYARTLATDVV--VDGEVVLPAGSDLGDVVIDALVERGVESLKVRSVLTCESRVGTCARCYGRSLASGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHTGGAASESGDITHGLPRVVELFEARTPKG--NAPISEVAGR-TRIEET-DKGRKIVVTPDDGAEEVEYPVTRRQRLLVEDGTHVEVGQKLVQGAVDPKQVLRILGPRRVQMHLVDEVQEVYRSQGVSIHDKHIEVIVRQMLKRVTIIEQNGSELLPGELVERARFEEENRR-VMAEGGQPSSGRPELMGITKASLATDSWLSAASFQETTRVLTNAAMEGKSDPLLGLKENVIIGKLIPAGTG 1239
>gi|117927509|ref|YP_872060.1| DNA-directed RNA polymerase subunit beta' [Acidothermus cellulolyticus 11B] >gi|160175230|sp|A0LRL4|RPOC_ACIC1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|117647972|gb|ABK52074.1| DNA-directed RNA polymerase, beta' subunit [Acidothermus cellulolyticus 11B] (1304 aa)
Score = 2534, Expect = 0.0e+00, Identities = 542/1259 (43%), Positives = 811/1259 (64%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIV--LDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESI------DVEASMENAIKHKIARTFYDTLAESNMPFS-IEEVFNF-----ISSFTG---------------MRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLI------LNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSII------------GIPTSAFPKKQFPKDGILI-TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSV--IESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ + IR+WS+GEV K ETINY++L+PEKDGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T S VRRER+GHIELAAP+ HIW  K +P  S++  +LD++ K++E+V+YF  Y++  +DE   +     + +  I +  Q+  K    +L +  R++ E +        +A  +  ++    R        +      I+EVF       +    G                R G+GA+AI E L++ +L+ E + + E++R   N    K  + ++RL+ I    ++ N P  M+L  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+NNEKR+LQEAVDALFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+     +         NIKSAE+++      L++   +W ++ +VIK+ PVLLNRAPTLHRLGIQAFEP LVEGKAI++HPLV  AFNADFDGDQMAVH+PLS EA AEAR ++L+S +IL P DG+P+  P+QDMV G YYLT  K    G+G +F++  E      + ++ + + I            G  +   P    P D +L+ TT+G+++ N+ LP +  ++N                                 TKK LS IVN L  +Y      +V + +D++K +GF ++T++  TIS  DV     K++  E  + K E++++ Y++GL+TDDER ++++  W+  T  V++++E    K     N + +M NSGARGN+    Q++GMRGL++               + I  PIK++F EGL+V EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  EDC T++   + +      G++  + ++   +  R    DV+     KVLA  G  I      E++  G+++V VRSVL C+ + G+C  C+G  L + KLV+   A+G+IAAQSIGEPGTQLTMRTFHTGGV+ G +I  G  R+ +LF+   PK    + ISE+ G+V       +    +++T  +  E ++Y+V   + LRV EG+ V+ G+++ EG+++  E+L++ G   V+ ++++EVQ+VYR QG+ I DK+IE+I+RQ+  +V I +SG+++F  G++++   F +EN + ++++   PATA  ++ G+ +A   T S+L+AASFQ+T ++LTDA +  + D L GLKENVI G LIP GTG
  S:    10 LRIGLATADDIRQWSHGEVKKPETINYRTLRPEKDGLFCERIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGVP--SRLGYLLDLAPKDLEKVIYFAAYMITWVDE-EARHRDLPSLEAQISVEKQEIEKRMNVELEERARKLEEDLAALEAEGAKADAKRKVREAAEREMRQIRERAQKEIDRIDEVFTRFKNLKVQDLEGDEVLYRELRDRFGQYFRGGMGAQAIKERLESFNLEAEAEALREQIR---NGRGQKKARALKRLKVISAFLNTRNSPMGMVLDCIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKVMALELFKPFVMKRLVDLNHAQ---------NIKSAERMVERATSGLSRYAMVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCAAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILKPADGRPVTMPSQDMVFGIYYLTTIKPGATGEGRVFSSDAEAIMARDLGELDIQAKIKVRLKDVVAVDDGTGSWTPPDGWQPGDPLLVETTLGRILFNEALPPDYRFIN------------------------------YELTKKDLSTIVNDLAERYPKV---MVAACLDEMKTLGFHWATRAGVTISISDVVMPPRKQEILEAYEAKAEKVQRQYERGLITDDERRQELIEIWTQATADVAREMEANFPK----DNPVFMMVNSGARGNMMQVRQIAGMRGLVANPKG-----------EIIPRPIKSNFREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREEDCGTERAISMRIGVKGPDGTLTRLPTVETSVYARTLAEDVI--VDGKVLAAKGSDIGDLTITELLAHGVEQVRVRSVLTCESKLGVCAACYGRSLASGKLVDVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVA-GEDITHGLPRVVELFEARTPKG--VAPISEVTGRVKI--EETEKARKIIITPDDGSEEVSYQVSKRARLRVAEGEHVEVGTQLVEGTVNPHEVLRILGPRAVQVHLVQEVQEVYRSQGVPIHDKHIEIIVRQMLKRVNILESGDTEFLPGELVERPKFEEENRR-VVAEGGTPATARPVLMGITKASLATESWLSAASFQETTRVLTDAAINAKSDPLLGLKENVIIGKLIPAGTG 1247
>gi|1495299|emb|CAA61515.1| DNA-directed RNA polymerase [Brochothrix thermosphacta] (1053 aa)
Score = 2532, Expect = 0.0e+00, Identities = 526/1135 (46%), Positives = 741/1135 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASP+KIR WS GEV K ETINY++LKPE+DGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K    K+++      S +E R                      A + K  ++F                          + G+GAEAI  LL  +DL+ E  ++ E+L+ ++     +  + +RRLE ++  + S NKP WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVD L DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV GP LKMYQ G+P  M ++LFKPF++ EL         T+  +  NIKSA++ I      IW ++  VI++ PVLLNRAPTLHRLGIQAFEPILVEG+AIRLHPLV TA+NADFDGDQMAVHVPLSPEA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLT+E+ N+ G+G++F +++E    YQ   VH+HS + +  ++   + F     + +LITTVGK+I N +LP    YLN P   NLE  + +   V    D +  IEK+     F KK L EI+  + + +    +      +D++KD GF+YST +  T+   D+    +K +    +  +V+ + K +++GL+TD+ERY++V++ W++  +Q+     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGL V EYF SS+GARKG+TDTA+KT+ SGY+TR+LVD  QDVIV   +  +  G ++  I   +   VIE+L ERL  R+    V HP++ +V+    E+ T+ +A  I  AGI +V +RSV  C  ++G+ +  +G DL+T   VE   A+G++AAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK    ++I+E+ G+V +I+   +    + VT   ++E+  Y VP  + L+V+ GD V+ G  + +GSID KELL V  +  V NY++ EVQK
  S:    10 MKIGLASPDKIRSWSFGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTEAGDTALDK----KQLL------SEREYR----------------------AYREKYGQSF--------------------------QAGMGAEAIKRLLDAVDLEGEVTELKEELKSAQGQ---RRTRAIRRLEVLEAFRHSGNKPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDGLIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVCGPSLKMYQCGLPREMAIELFKPFVMREL---------TQRGLAHNIKSAKRKIERHSPEIWDVLEDVIREHPVLLNRAPTLHRLGIQAFEPILVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSPEAQAEARILMLAANHILNPKDGKPVVTPSQDMVLGNYYLTLERENIVGEGLVFTDINEAMIAYQNGYVHLHSRVAVAAASLGNETFTAEQNNQLLITTVGKMIFNSILPPSFPYLNEPTKTNLEVATPSQYFVPTTTDVKAHIEKQAFLLPFKKKNLEEIIAQIFKLF---HITETSKMLDRMKDQGFKYSTLAGITVGISDIIVVKDKPEILAASHDEVDNVTKMFKRGLMTDEERYERVIAIWNAAKDQLQN---KLIAGLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLNVLEYFISSHGARKGLTDTALKTADSGYLTRRLVDVAQDVIVRETNDGSDHGLLVSDI--VEGPEVIETLTERLEGRYSAKTVRHPETNEVMIRPDELFTQEIAEAIPAAGIKEVWIRSVFTCNTKHGVSKISYGKDLSTGSEVEVGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--HAVITELTGEVKAIEEKANRQREITVT--GTQETRTYTVPMVARLKVKVGDAVRRGDPLMDGSIDPKELLHVTDVITVENYLLGEVQK 1053
>gi|2500612|sp|P77839|RPOC_BROTH DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) (1053 aa)
Score = 2532, Expect = 0.0e+00, Identities = 526/1135 (46%), Positives = 741/1135 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDND-IVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASP+KIR WS GEV K ETINY++LKPE+DGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +P  S++ LVLD+S + +E+V+YF +Y+V + G+    K    K+++      S +E R                      A + K  ++F                          + G+GAEAI  LL  +DL+ E  ++ E+L+ ++     +  + +RRLE ++  + S NKP WM+L  + V PP+ RP++QLEGG+F TSD+N  YR++I RN RLKR++   APSII+ NEKR+LQEAVD L DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV GP LKMYQ G+P  M ++LFKPF++ EL         T+  +  NIKSA++ I      IW ++  VI++ PVLLNRAPTLHRLGIQAFEPILVEG+AIRLHPLV TA+NADFDGDQMAVHVPLSPEA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLT+E+ N+ G+G++F +++E    YQ   VH+HS + +  ++   + F     + +LITTVGK+I N +LP    YLN P   NLE  + +   V    D +  IEK+     F KK L EI+  + + +    +      +D++KD GF+YST +  T+   D+    +K +    +  +V+ + K +++GL+TD+ERY++V++ W++  +Q+     KLI   + L N I +M +SGARGNISNFTQL+GMRGLM+                 +E+PI ++F EGL V EYF SS+GARKG+TDTA+KT+ SGY+TR+LVD  QDVIV   +  +  G ++  I   +   VIE+L ERL  R+    V HP++ +V+    E+ T+ +A  I  AGI +V +RSV  C  ++G+ +  +G DL+T   VE   A+G++AAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK    ++I+E+ G+V +I+   +    + VT   ++E+  Y VP  + L+V+ GD V+ G  + +GSID KELL V  +  V NY++ EVQK
  S:    10 MKIGLASPDKIRSWSFGEVKKPETINYRTLKPERDGLFCERIFGPTKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGIP--SRMGLVLDMSPRALEEVIYFASYVVTEAGDTALDK----KQLL------SEREYR----------------------AYREKYGQSF--------------------------QAGMGAEAIKRLLDAVDLEGEVTELKEELKSAQGQ---RRTRAIRRLEVLEAFRHSGNKPSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQNEKRMLQEAVDGLIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVCGPSLKMYQCGLPREMAIELFKPFVMREL---------TQRGLAHNIKSAKRKIERHSPEIWDVLEDVIREHPVLLNRAPTLHRLGIQAFEPILVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSPEAQAEARILMLAANHILNPKDGKPVVTPSQDMVLGNYYLTLERENIVGEGLVFTDINEAMIAYQNGYVHLHSRVAVAAASLGNETFTAEQNNQLLITTVGKMIFNSILPPSFPYLNEPTKTNLEVATPSQYFVPTTTDVKAHIEKQAFLLPFKKKNLEEIIAQIFKLF---HITETSKMLDRMKDQGFKYSTLAGITVGISDIIVVKDKPEILAASHDEVDNVTKMFKRGLMTDEERYERVIAIWNAAKDQLQN---KLIAGLDRL-NPIFMMQDSGARGNISNFTQLAGMRGLMADPSG-----------RIVELPITSNFREGLNVLEYFISSHGARKGLTDTALKTADSGYLTRRLVDVAQDVIVRETNDGSDHGLLVSDI--VEGPEVIETLTERLEGRYSAKTVRHPETNEVMIRPDELFTQEIAEAIPAAGIKEVWIRSVFTCNTKHGVSKISYGKDLSTGSEVEVGEAVGIVAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--HAVITELTGEVKAIEEKANRQREITVT--GTQETRTYTVPMVARLKVKVGDAVRRGDPLMDGSIDPKELLHVTDVITVENYLLGEVQK 1053
>gi|57234591|ref|YP_181346.1| DNA-directed RNA polymerase, beta' subunit [Dehalococcoides ethenogenes 195] >gi|115305562|sp|Q3Z8V3|RPOC_DEHE1 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|57225039|gb|AAW40096.1| DNA-directed RNA polymerase, beta' subunit [Dehalococcoides ethenogenes 195] (1295 aa)
Score = 2525, Expect = 0.0e+00, Identities = 551/1274 (43%), Positives = 819/1274 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVL---DEGNGKFPKNFNF---KEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAE--------SNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK-----------------------------------------ASPD-----------NPNILV-----VTIKNSKESINYK--------VPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNKM 1283
           +I+I LASP++IR WS GEVTK ETINY++LKPE+DGLF E IFGP+KD+ECACGKYK+I+++G IC+KCGVEI  + VRRER+GHIELA P+ HIW T+ +P  S++ L+L++S + +E+++Y+ ++I+    DE   K  K+      + V D  S+  ++  + +      E    +  + S E     +  +   D L +         N  + +++ F+ +         +GAEA+L+LL  ID+DKE   + ++ R   +TS  + KK  ++L+ ++  + S+NKPEWMI+  + V PPD RP++QL+GG+F TSD+N  YR++I RN RL+ +++  AP II+ NEKR+LQEAVD+L DN  R K +        KSLS+ L+GKQG FRQNLLGKRVDYSGRSVIV+GP LK+ Q G+P  M L+LFKPF++H L+         +D +  NIKSA +L+      ++ I+ +V+K+RPV+LNRAPTLHRL IQAFEP+L++G A+RLHPLV +AFNADFDGDQMAVHVPLS  AV EAR  +L+  +++ P  G+P+++P+ DMV G YYLT  +    G+G +F++ +E K  Y+M  + + +II        K +  K  +L TT G++I NDVLP+E+          E  + DI +                       S I  I+ R Y   S + +   +DKIK +GF+Y+T S  +I+  D+    EK K     D++    +  + +GL+T+DERY  ++  W   T++++  I+    K      S+ +MANSGA+GNIS   Q++G+RGLM+                 I+ PIK+S  EGLT  EYF S++GARKG+ DTA++TS SGY+TR+L+D TQDVI+  EDC T  GT    I + K   ++  L +R++ R+   +VVHP++ +++    E I +A A  I +AGI +V VRS L C+  +G+C++C+G DL   +LV+  TA+G+IAAQSIGEPGTQLT+RTFHTGGV  G +I  G  R+++LF+  PPK   +SIISEI+G+   I+                                         ASP+           + N++      V++  S  +I Y         +P   +++V+ GD V+ G ++T+GSI+ +++L + G + V+ Y+++EVQKVY  QG+ I DK+IEVI RQ+  KV+I  SG++D   G+++D   +   N K +L++   PATA  ++ G+  A   T S+LAAASFQ+T ++LTDA + G++D L+GLKENVI G LIP    K   E  +E   ++
  S:     9 AIRISLASPDQIRSWSYGEVTKPETINYRTLKPERDGLFCERIFGPIKDFECACGKYKRIRYKGIICDKCGVEIARAKVRRERMGHIELACPVGHIWFTRGIP--SRVGLLLNLSTRSLERIIYYSHFIITGVNDEAREKAIKDLEVISSQRVADKGSEVDTRVAQMEAEDATVEAINQVRRDFSTEREQMEEDIQLLIDQLKDLQIGNLLTENQYYELKQRFSNV-----FEASMGAEALLKLLSYIDMDKERSKLIQETR---STSGQRRKKAGKQLQLVEAFRRSSNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLQHLMEIGAPEIIIRNEKRMLQEAVDSLIDNGRRGKSVAVNGDHKAKSLSDLLRGKQGRFRQNLLGKRVDYSGRSVIVVGPSLKLSQCGLPRRMALELFKPFVMHRLV---------RDGLAPNIKSARRLVERARPEVYDILEEVVKERPVMLNRAPTLHRLSIQAFEPVLIDGSALRLHPLVCSAFNADFDGDQMAVHVPLSKAAVKEARETMLSIHNMMLPSSGEPVVSPSLDMVFGCYYLTTTRPGAKGEGKIFSDFEEAKHYYEMGIIDLRAII--------KVRDGKGNMLETTTGRIIFNDVLPKEV----------EFQNMDIPK-----------------------SAIKKIIGRCYKILSSQDMAVMLDKIKQLGFKYATSSGISIAMSDISVPREKAKLVAAADERTAISEGQFARGLITEDERYNSIIETWMETTDRITDAIQAGFDK----QGSVYMMANSGAKGNISQIRQMAGLRGLMTNPSG-----------RIIDFPIKSSLREGLTTLEYFISTHGARKGLADTALRTSGSGYLTRRLIDVTQDVIILQEDCGTSNGTW---IVEPKEKGMLPPLVDRVLGRWAAHNVVHPQTGEIIVGNNEEIDEAKAKAIGEAGITEVFVRSPLTCEATHGMCRRCYGRDLGRVRLVDMNTAVGIIAAQSIGEPGTQLTLRTFHTGGV-VGVDITTGLPRVEELFEARPPKV--QSIISEIDGEAEVIENENGRHIRIFSDEVYQDEYELPSGWKTQVQSGQWVDSGMVLASPEMEGKSKAVVQSDQNVVARVAGEVSVDGSLITIKYSESEEREYAIPAAMQIKVKTGDSVRAGQQLTDGSINPQDILSILGRDAVQKYLVEEVQKVYYSQGVHINDKHIEVIARQMLIKVRIDSSGDTDLVPGELVDKFRYEDINAK-VLAEGGEPATAHTVLMGITRASLSTESWLAAASFQETTRVLTDAAIYGKVDKLSGLKENVIIGKLIP-AQCKSCKEATVERAERI 1278
>gi|119714959|ref|YP_921924.1| DNA-directed RNA polymerase subunit beta' [Nocardioides sp. JS614] >gi|160175585|sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|119535620|gb|ABL80237.1| DNA-directed RNA polymerase, beta' subunit [Nocardioides sp. JS614] (1290 aa)
Score = 2520, Expect = 0.0e+00, Identities = 533/1266 (42%), Positives = 805/1266 (63%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNF--------KEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFS-IEEVFNFISS------------FTGMR--FG------IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIP-TSAFPKKQFPKDG------ILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERL--INRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           +QIGLA+ + IR WS+GEV K ETINY++LKPE+DGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++  +LD++ K++E+V+YF  Y++         ++ +         +E ++    +S  +   KL + L  + E+   +A     +K    R        +      ++EV+N   S            +  M+  FG      +GA AI + L++ D++ E + + + +   +    ++    ++RL+ +   + + NKP+ M+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+NNEKR+LQEAVD+LFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV GP+LK++Q G+P  M L+LFKPF++  L+  +  +         NIKSA++++      +W ++ +VI + PVLLNRAPTLHRLGIQAFEP L+EGKAI++HPLV +AFNADFDGDQMAVH+PLS EA AEAR ++L++ +IL P DG+P+  PTQDM++G ++LT ++   PG G  FA+  E    +   ++ + S + I  T   P  +   D        L TT+G+ + N+ LP +  Y+N              E G                 KK L  IVN L  +Y+      V +++D +KD GF ++T+S  T+S  DV    +K       + +  +++K +++GL+TD+ER ++++  W+  +N+V K +E    +     N I +M +SGA GN++   Q++ MRGL++               + I  PIK++F EGLTV EYF +++GARKG+ DTA++T+ SGY+TR+LVD +QDVI+  +DC T++G    + E  + G+V+++ N       R    DV HP++ +VL  AGE +      E++ AG+++V+VRSVL C  + G C KC+G  L T KLV+   A+G+IAAQSIGEPGTQLTMRTFHTGGV+S  +I QG  R+ +LF+   PK   +S ISE  G+V +I+ S D    +++T  +  E   Y V   S L V +GD ++ G  +T G+ D +++L++ G+   + +++ EVQ VYR QG+ I DK+IE+I+RQ+  ++ + +SG+++     ++D   F +EN + ++S+   PA+   ++ G+ +A   T S+L+AASFQ+T ++LTDA + G+ DSL GLKENVI G LIP GTG +   +I
  S:    10 LQIGLATADDIRTWSHGEVKKPETINYRTLKPERDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGV--PSRLGYLLDLAPKDLEKVIYFAAYMITAVDEDARHRDLSSLEGKVGLERERLEKRRDQSIDDRAKKLEEDLAAL-EAEGAKADQRRKVKDGAEREMKQLRDRAQREIDRLDEVWNTFKSLKVQDLMGDEMLYREMKNWFGKYFEGHMGATAIQKRLESFDIEAEVELLRDTIANGKGQRKVRA---LKRLKVVDAFRKTGNKPQGMVLDAVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDSLFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVSGPQLKLHQCGLPKQMALELFKPFVMKRLVDLSHAQ---------NIKSAKRMVERARPVVWDVLEEVITEHPVLLNRAPTLHRLGIQAFEPQLIEGKAIQIHPLVCSAFNADFDGDQMAVHLPLSAEAQAEARILMLSTNNILKPSDGRPVTMPTQDMIIGLFFLTTDRDGQPGDGRAFASPAEAIMAFDRGEISLQSKVRIRFTDIVPPLELGADWEQGQAVSLETTLGRALFNETLPADYPYVN-------------YEVG-----------------KKALGAIVNDLAERYTKVE---VAASLDALKDTGFHWATRSGVTVSIDDVTTPGDKADILSGYEAQAAKVQKQFERGLVTDEERRQELIEIWTQASNEVGKAMEANFDR----ANPIYMMVDSGASGNMNQIRQVAAMRGLVANPKG-----------EIIPRPIKSNFREGLTVLEYFIATHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREDDCGTERGLPKRIGERREDGTVVKAENAETAAYARTSAVDVAHPETGEVLVRAGEDLGDVKIGELISAGVEEVKVRSVLTCDAKTGTCAKCYGRSLATGKLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVASADDITQGLPRVVELFEARSPKG--RSPISEAAGRV-TIEES-DKARKVLITPDDGSEVQEYPVSKRSRLLVGDGDHIEVGQMLTVGTPDPQDVLRILGVRRAQEHLVDEVQAVYRSQGVSIHDKHIEIIVRQMLRRITVIESGDTNLLPSDLVDRVRFEEENRR-VVSEGGKPASGRPVLMGITKASLATESWLSAASFQETTRVLTDAAIHGRSDSLRGLKENVIIGKLIPAGTGLERYRNI 1245
>gi|114152143|sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase beta' chain (RNAP beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) (1057 aa)
Score = 2520, Expect = 0.0e+00, Identities = 526/1135 (46%), Positives = 747/1135 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP+ QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQK
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMAQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRNFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQK 1057
>gi|1495791|emb|CAA61517.1| DNA-directed RNA polymerase [Staphylococcus aureus] (1057 aa)
Score = 2520, Expect = 0.0e+00, Identities = 526/1135 (46%), Positives = 747/1135 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNLEELSDN----DIVEWGK-DYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQK 1145
           ++IGLASPEKIR WS GEV K ETINY++LKPEKDGLF E IFGP KD+EC+CGKYK+++++G +C++CGVE+T+S VRRER+GHIELAAP++HIW  K +  PS++ L+LD+S + +E+V+YF +Y+V+D G     K                        KTL         EA           R +YD                +   F       G + +LE    IDLD+E K + ++L   E+ +  +  + ++RLE ++  ++S NKP WMIL  + + PP+ RP+ QL+GG+F TSD+N  YR++I RN RLKR++   AP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LKMYQ G+P  M L+LFKPF++ EL+++          I +NIK+A+  I   D+ +W ++ +VI++ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLVTTA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLT+E+ +    G +F N +E+   Y    VH+H+ IG+  S+F    F ++    IL T+VGK+I N+++P+  +Y+N P  +NLE  + N    D    G+   + + E +++ + F KK L  I+  +  ++S     ++   +D++KD+GF++S+K+  T+   D+    +K++  +E +K V+ + K + +GL+T++ERY  VV  W+   +Q+  ++ + + K    TN I +M++SGARGN SNFTQL+GMRGLM+                 IE+PI +SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D K G+ +IE   ER+  R+    + HP++ +++    E+IT  +A +I DAGI+++ +RS   C   +G+C+KC+G +L T + VE   A+G IAAQSIGEPGTQLTMRTFHTGGV +G++I QG  R++++F+   PK   +++I+EIEG V  IK + D    +VV  K + E+ +Y     S + VE G  V+ G  +TEGSI+ K  L VAG+    +Y++KEVQK
  S:    10 MKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHIWYFKGI--PSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEK------------------------KTLLS-------EAEF---------RDYYD---------------KYPGQFVAKMGAEGIKDLLE---EIDLDEELKLLRDEL---ESATGQRLTRAIKRLEVVESFRNSGNKPSWMILDVLPIIPPEIRPMAQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQRE---------IATNIKNAKSKIERMDDEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVHVPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFNNTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFAYINEPTQENLERKTPNRNFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRFSITDTSMM---LDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRGLITEEERYNAVVEIWTDAKDQIQGELMQSLDK----TNPIFMMSDSGARGNASNFTQLAGMRGLMAAPSG-----------KIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLL---VSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDELITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGV-AGSDITQGLPRIQEIFEARNPKG--QAVITEIEGVVEDIKLAKDRQQEIVV--KGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATESYLLKEVQK 1057
>gi|163811830|ref|ZP_02203512.1| DNA-directed RNA polymerase, beta' subunit [Dehalococcoides sp. VS] >gi|157404486|gb|EDO70524.1| DNA-directed RNA polymerase, beta' subunit [Dehalococcoides sp. VS] (1295 aa)
Score = 2519, Expect = 0.0e+00, Identities = 550/1263 (43%), Positives = 812/1263 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVL---DEGNGKFPKNFNF---KEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAE--------SNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPK------------------------------------------------QWEKSII----SEIEGKVSSIKASPDNPNILV----------VTIKNSK-ESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIP--CGTGKKS 1272
           +I+I LASP++IR WS GEVTK ETINY++LKPE+DGLF E IFGP+KD+ECACGKYK+I+++G IC+KCGVEI  + VRRER+GHIELA P+ HIW T+ +P  S++ L+L++S + +E+++Y+ ++I+    DE   K  K+      + V D  S+  +K  + +      E    +  + S E     +  +   D L +         N  + +++ F+ +         +GAEA+L+LL  ID+DKE   + ++ R   +TS  + KK  ++L+ ++  + S+NKPEWMI+  + V PPD RP++QL+GG+F TSD+N  YR++I RN RL+ +++  AP II+ NEKR+LQEAVD+L DN  R K +        KSLS+ L+GKQG FRQNLLGKRVDYSGRSVIV+GP LK+ Q G+P  M L+LFKPF++H L++         D +  NIKSA +L+      ++ I+ +V+K+RPV+LNRAPTLHRL IQAFEP+L++G A+RLHPLV +AFNADFDGDQMAVHVPLS  AV EAR  +L+  +++ P  G+P+++P+ DMV G YYLT  +    G+G +F++ +E K  Y+M  + + +II        K +  K  +L TT G++I NDVLP+ +          E  + DI +                       S I  I+ R Y   S + +   +DKIK +GF+Y+T S  +I+  D+    EK K     D++    +  + +GL+T+DERY  ++  W   T++++  I+    K      S+ +MANSGA+GNIS   Q++G+RGLM+                 I+ PIK+S  EGLT  EYF S++GARKG+ DTA++TS SGY+TR+L+D TQDVI+  EDC T  GT    I + K   ++  L +R++ R+   +VVHP++ +++    E I +A A  I +AGI +V VRS L C+  +G+C++C+G DL   +LV+  TA+G+IAAQSIGEPGTQLT+RTFHTGGV  G +I  G  R+++LF+  PPK                                                QW  S +     E+EGK  ++  S  N    V          +TIK S+ E   Y +P   +++V+ GD V+ G ++T+GSI+ +++L + G + V+ Y+++EVQKVY  QG+ I DK+IEVI RQ+  KV+I  SG++D   G+++D   +   N K +L++   PATA  ++ G+  A   T S+LAAASFQ+T ++LTDA + G++D L+GLKENVI G LIP  C + K++
  S:     9 AIRISLASPDQIRSWSYGEVTKPETINYRTLKPERDGLFCERIFGPIKDFECACGKYKRIRYKGIICDKCGVEIARAKVRRERMGHIELACPVGHIWFTRGIP--SRVGLLLNLSTRSLERIIYYSHFIITAVNDEAREKAIKDLEVISSQRVADKGSEVDTKVAQMEAEDATVEAINQVRRDFSAEREQMEEDIQLLIDQLKDLQIGNLLTENQYYELKQRFSNV-----FEASMGAEALLKLLSYIDMDKERSKLIQETR---STSGQRRKKAGKQLQLVEAFRRSSNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLQHLMEIGAPEIIIRNEKRMLQEAVDSLIDNGRRGKSVAVNGDHKAKSLSDLLRGKQGRFRQNLLGKRVDYSGRSVIVVGPSLKLSQCGLPRRMALELFKPFVMHRLVR---------DGLAPNIKSARRLVERARPEVYDILEEVVKERPVMLNRAPTLHRLSIQAFEPVLIDGSALRLHPLVCSAFNADFDGDQMAVHVPLSKAAVKEARETMLSIHNMMLPSSGEPVVSPSLDMVFGCYYLTTTRPGAKGEGKVFSDFEEAKHYYEMGIIDLRAII--------KVRDGKGNMLETTTGRIIFNDVLPKAV----------EFQNMDIPK-----------------------SAIKKIIGRCYKILSSQDMAIMLDKIKQLGFKYATSSGISIAMSDISVPREKAKLVAAADERTAISEGQFARGLITEDERYNSIIETWMETTDRITDAIQAGFDK----QGSVYMMANSGAKGNISQIRQMAGLRGLMTNPSG-----------RIIDFPIKSSLREGLTALEYFISTHGARKGLADTALRTSGSGYLTRRLIDVTQDVIILQEDCGTSNGTW---IVEPKEKGMLPPLVDRVLGRWAAHNVVHPQTGEIIVENNEEIDEAKAKAIGEAGITEVFVRSPLTCEATHGMCRRCYGRDLGRVRLVDMNTAVGIIAAQSIGEPGTQLTLRTFHTGGVV-GVDITTGLPRVEELFEARPPKVQSIISEIDGAVEVIENENGRHIRIASDEVYQDEYELPSGWKTQVQSGQWVDSGMVLASPEMEGKSKAVVQSDQNVVARVAGEVSVDGNLITIKYSESEEREYAIPAAMQIKVKTGDSVRAGQQLTDGSINPQDILSILGRDAVQKYLVEEVQKVYYSQGVHINDKHIEVIARQMLIKVRIDSSGDTDLVPGELVDKFRYEDINAK-VLAEGGEPATAHTVLMGITRASLSTESWLAAASFQETTRVLTDAAIYGKVDKLSGLKENVIIGKLIPAQCKSCKEA 1270
>gi|85057740|ref|YP_456656.1| DNA-directed RNA polymerase beta' chain [Aster yellows witches'-broom phytoplasma AYWB] >gi|109893825|sp|Q2NJ16|RPOC_AYWBP DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|84789845|gb|ABC65577.1| DNA-directed RNA polymerase beta' chain [Aster yellows witches'-broom phytoplasma AYWB] (1353 aa)
Score = 2515, Expect = 0.0e+00, Identities = 566/1258 (44%), Positives = 814/1258 (64%)
  Q:    12 QIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLG--KDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTME-------------------KLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTS----AFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPD--NLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKAS-PDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +I LA+PE+IR+WS GEVT  ETINY++ KPE  GLF + IFGPV D++CAC K K++  + + C KCGVE TE+ VRRER+GHIEL  PI H W       PS+++++L+I  K++E++VY+V+Y+V+D G  +    F  KE+                                        I  T Y            E ++ F ++F  +    GAEA+ +LL+N++L+K  K + + L  SEN+   K + +++RLE I+    S+NKPEWM++  I V PP  RP++ L+GG+F T+++N  YR+I+ RN RLK+ +   AP +I+ NEKR+LQEAVDALFDN    K  +   +  RPLKSLSE L+GKQG FRQNLLGKRVDYSGRSVI++GP+L+M+Q G+P  M + LFKPFI+ +L    + +G  K       K+A  +    +  +W  + +V+K+ PVLLNRAPTLHRLGIQAF+P L++GKAIRLHPLVT AFNADFDGDQMA++VPLS EA AEAR ++L S +IL PK+G P++TP+QDMVLGNYYLT+E                   +     +G  FA+++E KT YQ K++H+H+ I I       +F ++Q  K   L+TT+GK+I ND+LP    Y+N P   NL+ +  D   +  G + + F++K    K F KK LS I+      +    +      +D IK++GF+YST +  T+S  D+  Y+ K++  +E + +  +++ +++ G LTD ER + V++ W ++ +++ + + K  ++     N I +M+ SGARG++SNFTQL+GMRGLM+               + IEVP+K SF EGL VSE+F S++GARKG TDTA+KT++SGY+TR+LVD TQD++V  EDC + +G I+E +     G  I SL +R++ RF   D+ HPK+  ++    E+I ++ A EI+ A I KV +RS+L C  E GIC K +G +L TNKLVE   A+GVIAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R+++LF++  PK   K++ISE++GK+  I      NP I++    +      Y +  + ++ V + + V PG K+T GS+D+KELL+VAG   V+ YI++EVQKVYR Q + I+DK+IE+II Q+  ++ I D G++    G  I IN F+K N K+ L + K  A    +I G+  +  ++ S L+AASFQ+T KIL DA +KG+ D L GLKENVI G LIP GTG
  S:   140 KIRLAAPEEIRQWSYGEVTSYETINYRTYKPEISGLFCQKIFGPVVDFQCACSK-KQVSIKSQFCNKCGVEFTETKVRRERMGHIELQTPIVHTWYLNS--SPSRLAILLNIKTKQLEEIVYYVSYVVIDPGKTE----FKPKEI----------------------------------------ITETQYS-----------EALYEFGNTFVAL---TGAEAVKKLLENLNLEKTIKVLRKSL--SENSKQ-KRESIIKRLEIIESFHQSDNKPEWMVMDVIPVLPPGLRPMVPLDGGRFATTEVNDLYRRILNRNNRLKKQMLQKAPRLIIKNEKRMLQEAVDALFDNTKTSKKNVNNVEKNRPLKSLSEMLRGKQGRFRQNLLGKRVDYSGRSVIIVGPDLEMHQCGVPREMAIILFKPFILKKL---QETKGIDK-------KNANTIYEKMNEEVWNALEEVVKEHPVLLNRAPTLHRLGIQAFDPKLIDGKAIRLHPLVTPAFNADFDGDQMAIYVPLSLEAQAEARLLMLVSNNILDPKNGNPVVTPSQDMVLGNYYLTIEEKKDRTINSYDSAQRTAEHQFKHRNEGTFFADINEAKTAYQNKEIHLHTRIFIKPQTINLSFTEEQRQK--YLMTTLGKLIFNDILPPSFPYINEPTQFNLDVKTPDAYFLPPGTNPKQFLKKLPTPKPFNKKFLSMIIACF---FKQMKITETSKMLDHIKNLGFKYSTIAGITVSFADINTYSNKQELLQEVETRNIQIETWHKDGFLTDAERRRLVINEWKTIRDEIQEGLMKEFKQ----DNHIFMMSESGARGSVSNFTQLAGMRGLMNNPKG-----------EIIEVPVKASFREGLKVSEFFISTHGARKGSTDTALKTAESGYLTRRLVDVTQDIVVIKEDCNSDRGFIVEAM--MSDGKEIVSLKKRIMGRFASCDICHPKTNTLIVARNELIIESKAQEIITAKIKKVPIRSILTCNCEYGICAKDYGVNLATNKLVEIGEAVGVIAAQSIGEPGTQLTMRTFHTGGVASASDITQGLPRIEELFEVRKPKG--KALISELKGKIKKIDKIRSQNPEIVITEENDPDTEHRYILEPNVDILVSKNNIVYPGQKLTSGSVDLKELLRVAGTTEVQKYILEEVQKVYRAQNVYISDKHIEIIIHQMFKQILIIDEGDTHLLPGTEITINKFKKANLKM-LEEKKRLAVGRPIILGITRSSLRSDSLLSAASFQETTKILIDAAIKGKTDHLYGLKENVIIGGLIPAGTG 1327
>gi|191639438|ref|YP_001988604.1| DNA-directed RNA polymerase subunit beta (RNAP subunit beta ) (Transcriptase subunit beta ) (RNA polymerase subunit beta ) [Lactobacillus casei] >gi|190713740|emb|CAQ67746.1| DNA-directed RNA polymerase subunit beta (RNAP subunit beta ) (Transcriptase subunit beta ) (RNA polymerase subunit beta ) [Lactobacillus casei BL23] (1220 aa)
Score = 2515, Expect = 0.0e+00, Identities = 499/1039 (48%), Positives = 713/1039 (68%)
  Q:   231 IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNL-EELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +GAEAI ELL++++LDKE  ++ E L+ ++     K  + +RRL+ +   K+S N P WM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAPSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LK YQ G+P  M L+LFKPF++ EL+K+          + SNIK+A + I  QD+ +W ++  VIK+RPVLLNRAPTLHRLGIQAFEP+LV+GK+IRLHPLV  A+NADFDGDQMA+HVPLS EA+AEAR ++LA+ HIL PKDGKPI+TP+QD+VLGNYYLTME+    G+GM+F + +E+    Q   VH+HS IGI T++F  K F  D    I++T+VGK I N+++P++  YLN P  DN+   + D   ++ G+D   ++E   +   F K  LS+I+  + + Y    ++     +D +K +G+  ST S  T+   D+    EK +  E   KKV  + K +++GL+TD+ER+ +V+  W    N    DI++ +       N I +M++SGARGNISNFTQL+GMRGLM+                 +EVP+ ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G ++  I +     +IE L +RL+ RF + DV+ PKS +VL     ++ +  A  IVDAG++ V +RSV  C  ++G+CQKC+G ++ T + VE   A+G +AAQSIGEPGTQLTMR FHTGGV+ G +I QG  R++++F+   PK   +++I+E+ G++++I  +P   +   +T+K   ++  Y VP+ S + V EGD +  G ++T GSID K+L+KV  +    NY++ EVQKVYR+QG++I DK++EV++RQ+  K+++ D G+++   G ++DI  F+++N + I+S   +PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:   170 MGAEAIKELLQDVELDKEVAELKEDLKSAQGQ---KRTRAIRRLDILDAFKESGNDPAWMVMDTIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPWLKFYQCGVPREMALELFKPFVMRELVKRD---------MASNIKNARRKIDRQDDDVWDVLEDVIKERPVLLNRAPTLHRLGIQAFEPVLVDGKSIRLHPLVCEAYNADFDGDQMAIHVPLSDEAMAEARMLMLAAHHILAPKDGKPIVTPSQDVVLGNYYLTMEQKGREGEGMIFKDTNEVLMALQNGYVHLHSRIGIATNSFTDKPFTDDQKQKIMVTSVGKAIFNEIMPKDFPYLNEPTQDNIVNGVPDKYFIDKGEDINDYLEDAPLIDPFKKGFLSDIIAQVFKVY---KVQRTSDLLDDMKTLGYTQSTNSGLTVGIADITNLKEKPEIVEAAHKKVATVSKQFRRGLITDEERHDRVIQTW----NDAKDDIQQKLVDSFDPNNPISMMSDSGARGNISNFTQLAGMRGLMAAPNG-----------GMMEVPVISNFREGLSVMEMFMSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLVVSAIRE--GNEMIEPLYDRLVGRFTMKDVLDPKSGEVLVKRNTLMDEDTAQMIVDAGVESVTIRSVFTCNTKHGVCQKCYGRNMATGEQVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGGEDITQGLPRVQEIFEARNPKG--EAVITEVTGEITAIDENPAE-HTREITVKGETDTRTYSVPYASSVAVAEGDHINRGERLTGGSIDPKQLIKVRDVMATENYLLSEVQKVYRMQGVDIGDKHVEVMVRQMLRKIRVMDPGDTNILPGTLLDIADFKEKNTQAIISGG-IPATGRPVLLGITKASLETNSFLSAASFQETTRVLTDASIRGKNDPLIGLKENVIIGKIIPAGTG 1178
Score = 503, Expect = 3.4e-48, Identities = 87/144 (60%), Positives = 118/144 (81%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPK 149
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPE+DGLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLD+S + +E+++YF +Y+V+D G+    K
  S:     5 NKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPERDGLFDERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDMSPRSLEEIIYFASYVVIDPGDTPMEK 146
>gi|157150109|ref|YP_001451192.1| DNA-directed RNA polymerase subunit beta' [Streptococcus gordonii str. Challis substr. CH1] >gi|189043957|sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|157074903|gb|ABV09586.1| DNA-directed RNA polymerase, beta chain [Streptococcus gordonii str. Challis substr. CH1] (1215 aa)
Score = 2514, Expect = 0.0e+00, Identities = 501/1039 (48%), Positives = 715/1039 (68%)
  Q:   231 IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +GAEAI +LLK +DL+ E   + E+L+ +     +K    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F ++DE     +   VH+H+ +GI T +   P  +  K  IL+TTVGK++ N ++PEE+ YL  P N    E + D   +E GKD +  I+  ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +L+  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I D K   +IE L ERL+ R+    + HP++ +VL PA  ++T+ +A ++V+AG+ +V +RSVL C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + ++VE GD+V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DI  F   N  +++S   VPATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:   171 MGAEAIQDLLKQVDLEAEIAVLKEELKTATGQKRVKA---VRRLDVLDAFYKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMVFKDMDEAVMALRNGYVHLHTRVGITTDSLAKPWTESQKHKILMTTVGKILFNAIMPEELPYLQEPTNANLTEGVPDKYFLESGKDIKEAIQALELNVPFKKKNLGNIIAEIFKRFRTTE---TSALLDRLKNLGYHHSTLAGLTVGIADIPVVEDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLVANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLITSITDGK--EMIEPLEERLVGRYTKKSIKHPETGEVLVPADVLVTEDMARQVVNAGVTEVTIRSVLTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASSSDITQGLPRVQEIFEARNPKG--EAVITEVKGEVTAIEEDASTRTKKVFV---KGQTGEGEYVVPFTARMKVEVGDQVSRGAALTEGSIQPKHLLAVRDVLSVETYLLAEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDITDFTDANRDVVISGG-VPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTG 1178
Score = 478, Expect = 2.5e-45, Identities = 82/136 (60%), Positives = 111/136 (81%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLD 141
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G IC++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D
  S:     5 NRFKSMQITLASPNKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIICDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID 138
>gi|116495959|ref|YP_807693.1| DNA-directed RNA polymerase subunit beta' [Lactobacillus casei ATCC 334] >gi|122262641|sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|116106109|gb|ABJ71251.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Lactobacillus casei ATCC 334] (1220 aa)
Score = 2514, Expect = 0.0e+00, Identities = 499/1039 (48%), Positives = 713/1039 (68%)
  Q:   231 IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKD---GILITTVGKVILNDVLPEEMSYLNNP--DNL-EELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +GAEAI ELL++++LDKE  ++ E L+ ++     K  + +RRL+ +   K+S N P WM++  I V PPD RP++QLEGG+F TSD+N  YR++I RN RLKR++  NAPSII+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVI +GP LK YQ G+P  M L+LFKPF++ EL+K+          + SNIK+A + I  QD+ +W ++  VIK+RPVLLNRAPTLHRLGIQAFEP+LV+GK+IRLHPLV  A+NADFDGDQMA+HVPLS EA+AEAR ++LA+ HIL PKDGKPI+TP+QD+VLGNYYLTME+    G+GM+F + +E+    Q   VH+HS IGI T++F  K F  D    I++T+VGK I N+++P++  YLN P  DN+   + D   ++ G+D   ++E   +   F K  LS+I+  + + Y    ++     +D +K +G+  ST S  T+   D+    EK +  E   KKV  + K +++GL+TD+ER+ +V+  W    N    DI++ +       N I +M++SGARGNISNFTQL+GMRGLM+                 +EVP+ ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G ++  I +     +IE L +RL+ RF + DV+ PKS +VL     ++ +  A  IVDAG++ V +RSV  C  ++G+CQKC+G ++ T + VE   A+G +AAQSIGEPGTQLTMR FHTGGV+ G +I QG  R++++F+   PK   +++I+E+ G++++I  +P   +   +T+K   ++  Y VP+ S + V EGD +  G ++T GSID K+L+KV  +    NY++ EVQKVYR+QG++I DK++EV++RQ+  K+++ D G+++   G ++DI  F+++N + I+S   +PAT   ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:   170 MGAEAIKELLQDVELDKEVAELKEDLKSAQGQ---KRTRAIRRLDILDAFKESGNDPAWMVMDTIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPSIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIDVGPWLKFYQCGVPREMALELFKPFVMRELVKRD---------MASNIKNARRKIDRQDDDVWDVLEDVIKERPVLLNRAPTLHRLGIQAFEPVLVDGKSIRLHPLVCEAYNADFDGDQMAIHVPLSDEAMAEARMLMLAAHHILAPKDGKPIVTPSQDVVLGNYYLTMEQKGREGEGMIFKDTNEVLMALQNGYVHLHSRIGIATNSFTDKPFTDDQKQKIMVTSVGKAIFNEIMPKDFPYLNEPTQDNIVNGVPDKYFIDKGEDINDYLEDAPLIDPFKKGFLSDIIAQVFKVY---KVQRTSDLLDDMKTLGYTQSTNSGLTVGIADITNLKEKPEIVEAAHKKVATVSKQFRRGLITDEERHDRVIQIW----NDAKDDIQQKLVDSFDPNNPISMMSDSGARGNISNFTQLAGMRGLMAAPNG-----------GMMEVPVISNFREGLSVMEMFMSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGLVVSAIRE--GNEMIEPLYDRLVGRFTMKDVLDPKSGEVLVKRNTLMDEDTAQMIVDAGVESVTIRSVFTCNTKHGVCQKCYGRNMATGEQVEVGEAVGTVAAQSIGEPGTQLTMRNFHTGGVAGGEDITQGLPRVQEIFEARNPKG--EAVITEVTGEITAIDENPAE-HTREITVKGETDTRTYSVPYASSVAVAEGDHINRGERLTGGSIDPKQLIKVRDVMATENYLLSEVQKVYRMQGVDIGDKHVEVMVRQMLRKIRVMDPGDTNILPGTLLDIADFKEKNTQAIISGG-IPATGRPVLLGITKASLETNSFLSAASFQETTRVLTDASIRGKNDPLIGLKENVIIGKIIPAGTG 1178
Score = 503, Expect = 3.4e-48, Identities = 87/144 (60%), Positives = 118/144 (81%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPK 149
           ++  S+QIGLASP+KIR WS GEV K ETINY++LKPE+DGLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T S VRRER+GHIELAAP+ HIW  K +  PS++ LVLD+S + +E+++YF +Y+V+D G+    K
  S:     5 NKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPERDGLFDERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVTHIWYFKGI--PSRMGLVLDMSPRSLEEIIYFASYVVIDPGDTPMEK 146
>gi|73748444|ref|YP_307683.1| DNA-directed RNA polymerase, beta' subunit [Dehalococcoides sp. CBDB1] >gi|115305563|sp|Q3ZX00|RPOC_DEHSC DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|73660160|emb|CAI82767.1| DNA-directed RNA polymerase, beta' subunit [Dehalococcoides sp. CBDB1] (1295 aa)
Score = 2509, Expect = 0.0e+00, Identities = 549/1263 (43%), Positives = 818/1263 (64%)
  Q:    10 SIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVL---DEGNGKFPKNFNF---KEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAE--------SNMPFSIEEVFNFISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK-----------------------------------------ASPD-----------NPNILV-----VTIKNSKESINYK--------VPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIP--CGTGKKS 1272
           +I+I LASP++IR WS GEVTK ETINY++LKPE+DGLF E IFGP+KD+ECACGKYK+I+++G IC+KCGVEI  + VRRER+GHIELA P+ HIW T+ +P  S++ L+L++S + +E+++Y+ ++I+    D+   K  K+      + V D  S+  ++  + +      E    I  + S E     +  +   D L +         N  + +++ F+ +         +GAEA+L+LL  ID+DKE   + ++ R   +TS  + KK  ++L+ ++  + S+NKPEWMI+  + V PPD RP++QL+GG+F TSD+N  YR++I RN RL+ +++  AP II+ NEKR+LQEAVD+L DN  R K +        KSLS+ L+GKQG FRQNLLGKRVDYSGRSVIV+GP LK+ Q G+P  M L+LFKPF++H L+         +D +  NIKSA +L+      ++ I+ +V+K RPVLLNRAPTLHRL IQAFEP+L++G A+RLHPLV +AFNADFDGDQMAVHVPLS  AV EAR  +L+  +++ P  G+P+++P+ DMV G YYLT  +    G+G +F + +E K  Y+M  + + +II        K +  K  +L TT G++I NDVLP+ +          E  + DI +                       S I  I+ R Y   S + +   +DKIK++GF+++T S  +I+  D+    EK K     D++    +  + +GL+T+DERY  ++  W   T++++  I+    K      S+ +MANSGA+GNIS   Q++G+RGLM+                 I+ PIK+S  EGLT  EYF S++GARKG+ DTA++TS SGY+TR+L+D TQDVI+  EDC T  GT   +IE  + G ++  L +R++ R+   +VVHP++ +++    E I +  A  I +AGI +V VRS L C+  +G+C++C+G DL   +LV+  TA+G+IAAQSIGEPGTQLT+RTFHTGGV  G +I  G  R+++LF+  PPK   +SIISEI+G V  I+                                         ASP+           + N++      VT++ +  +I Y         +P   +++V+ GD ++ G ++T+GSI+ +++L + G + V+ Y+++EVQKVY  QG+ I DK+IEVI RQ+  KV+I  SG++D   G+++D   +   N K +L++   PATA  ++ G+  A   T S+LAAASFQ+T ++LTDA + G++D L+GLKENVI G LIP  C + K++
  S:     9 AIRISLASPDQIRSWSYGEVTKPETINYRTLKPERDGLFCERIFGPIKDFECACGKYKRIRYKGIICDKCGVEIARAKVRRERMGHIELACPVGHIWFTRGIP--SRVGLLLNLSTRSLERIIYYSHFIITAVNDDAREKAIKDLEVISSQRVADKGSEVDTRVAQMEAEDATVEAINQIRRDFSTEREQMEEDIQLLIDQLKDLQKGNLLTENQYYELKQRFSNV-----FEASMGAEALLKLLSYIDMDKERSKLIQETR---STSGQRRKKAGKQLQLVEAFRRSSNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLQHLMEIGAPEIIIRNEKRMLQEAVDSLIDNGRRGKSVAVNGDHKAKSLSDLLRGKQGRFRQNLLGKRVDYSGRSVIVVGPSLKLSQCGLPRRMALELFKPFVMHRLV---------RDGLAPNIKSARRLVERARPEVYDILEEVVKDRPVLLNRAPTLHRLSIQAFEPVLIDGSALRLHPLVCSAFNADFDGDQMAVHVPLSKAAVKEARETMLSIHNMMLPSSGEPVVSPSLDMVFGCYYLTTTRPGAKGEGKIFGDFEEAKRYYEMGIIDLRAII--------KVRDGKGNMLETTTGRIIFNDVLPKAV----------EFQNMDIPK-----------------------SAIKKIIGRCYKILSSQDMAVMLDKIKELGFKFATSSGISIAMSDISVPREKTKLVAAADERTAIAEGQFARGLITEDERYNSIIETWMETTDRITDAIQAGFDK----QGSVYMMANSGAKGNISQIRQMAGLRGLMTNPSG-----------RIIDFPIKSSLREGLTALEYFISTHGARKGLADTALRTSGSGYLTRRLIDVTQDVIILQEDCGTANGTW--IIEPKEKG-MLPPLVDRILGRWTAHNVVHPQTGEIIVDNNEEIDEIKAKAIGEAGITEVFVRSPLTCESTHGMCRRCYGRDLGRVRLVDMNTAVGIIAAQSIGEPGTQLTLRTFHTGGV-VGVDITTGLPRVEELFEARPPKV--QSIISEIDGVVEVIENENGRHIRIASDEVYQDEYELPSGWKTQVQSRQWVDSGMVLASPELEGKSKAVVQSDQNVVARVAGEVTVEGNLITIKYSESEEREYTIPAAMQIKVKTGDTIRAGQQLTDGSINPQDILSILGRDAVQKYLVEEVQKVYYSQGVHINDKHIEVIARQMLIKVRIDSSGDTDLVPGELVDKFRYEDINAK-VLAEGGEPATAHTVLMGITRASLSTESWLAAASFQETTRVLTDAAIYGRVDKLSGLKENVIIGKLIPAQCKSCKEA 1270
>gi|159039843|ref|YP_001539096.1| DNA-directed RNA polymerase subunit beta' [Salinispora arenicola CNS-205] >gi|189043952|sp|A8M538|RPOC_SALAI DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|157918678|gb|ABW00106.1| DNA-directed RNA polymerase, beta' subunit [Salinispora arenicola CNS-205] (1297 aa)
Score = 2505, Expect = 0.0e+00, Identities = 547/1259 (43%), Positives = 798/1259 (63%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRS--------KLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFS-IEEVFN-----------------------FISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHS--------IIGIPTS------AFPKKQFPKDGILI-TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDT-KSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ + IR+WS+GEV K ETINY++LKPEKDGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T S VRRER+GHIELAA + HIW  K +P  S++  +LD++ K++E+++YF +Y+V         ++    E   L+ ++ S+ +R         KL   L E+ E+   +A +   +K    R        +      ++EV +                       F   FTG   G+GAEAI  L++N+DLD E + + E +R  +    I+    ++RL+ +    ++ N P  M+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+I   AP II+NNEKR+LQEAVDALFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+     +         NIKSA++++  Q   +W ++ +VI + PVLLNRAPTLHRLGIQAFEP LVEGKAI++HPLV TAFNADFDGDQMAVHVPLS EA AEAR ++L+S +IL P DGKP+  PTQDM++G Y+LT       G+G  F++  E +  +   ++H+ +        ++G+ T         P+     D I + TT+G+V+ N+ LP    ++N                                  K  LS IVN L  ++   +L    +T+D +K+ GF ++T S  TI   DV     K +  +  +K+ + + K YQ+GL+T +ER  +++  W+  TN+V+K+++  + +     N +  M NSGARGN+    Q++ +RGL++               + I  PIK S+ EGL+V EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVI+  EDC T +   ++V + T ++GS V+    E  ++   + D +      V+A  G  I   + + IV AG++ V VRSVL C+ + G+C  C+G  L T K V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   K+ I++  G+V  ++    +  I+VV    S E +  K+     L   +GD V+ G K+T G+ID  ELL++ G   V+ ++ +EVQ+VYR QG+ I DK+IE+IIRQ+  +V + DSG+++F  G ++D   F  EN +L+ S+   PA    ++ G+ +A   T S+L+AASFQ+T ++LTDA +  + DSL GLKENVI G LIP GTG
  S:    10 LRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPQRDWECYCGKYKRVRFKGIICERCGVEVTRSKVRRERMGHIELAASVTHIWYFKGVP--SRLGYLLDLAPKDLEKIIYFASYVVTSVDAEARHRDLATIENEILAEKRQSENSRDSEIEKRAGKLEADLAEL-EAEGAKADVRRKVKEGGEREMRQIRDRAQREIDRLDEVLDTFRKLEPKQLVTDELLYRELRDRFGEYFTG---GMGAEAIKALVQNMDLDAEAESLRETIRTGKGQRKIRA---LKRLKVVAAFLNTRNSPLGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPKLKLHQCGLPKQMALELFKPFVMKRLVDLNHAQ---------NIKSAKRMVERQRPVVWDVLEEVIGEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHVPLSAEAQAEARILMLSSNNILKPADGKPVTMPTQDMIIGLYHLTHRTSGERGEGRAFSSDAEARMAFDNGELHLQAPVKIRLRGLVGVETGPGAESWTAPEGWVEGDPITVETTLGRVLFNEALPPGYRFVN------------------------------YEIRKGQLSAIVNDLAERFPKVAL---AATLDGLKEAGFHWATWSGVTIGMEDVLAPPRKREVLDRYEKEADRIDKQYQRGLMTAEERRGELIEIWTKATNEVAKEMDTALPQ----ENPLWKMINSGARGNLLQLRQIAAIRGLVANPKG-----------EIIPRPIKASYREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREEDCGTDRAIPMQVGQQTGEAGSLVVHEHAETSVHARTLADDIKGPDGTVVAERGADINSILVDRIVAAGVESVRVRSVLTCESKLGVCGACYGRSLPTGKTVDVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGEDITQGLPRVQEIFEARIPKG--KAPIADTPGRV-RLEDGERSRKIIVVPDDGSDEIVYDKISKRVRLLANDGDHVEVGEKLTVGTIDPHELLRILGPRAVQVHLTQEVQEVYRSQGVLIHDKHIEIIIRQMLKRVTVIDSGSTEFLPGVLVDRALFESENRRLV-SEGGEPAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAIHARSDSLIGLKENVIIGKLIPAGTG 1246
>gi|160177567|sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|160177572|sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') (1215 aa)
Score = 2505, Expect = 0.0e+00, Identities = 502/1039 (48%), Positives = 708/1039 (68%)
  Q:   231 IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +GAEAI +LLK +DL KE   + E+L+ +     IK    VRRL+ +     S NKPEWMIL  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          I  N+K+A++LI   D+ IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+   VH+H+ +GI T +   P K   K  +++TTVGK++ N ++PE + YL  P+N    E   D   +E G D +  I +  +   F KK L  I+  + +++         + +D++KD+G+ +ST +  T+   D+P    K +  EE+ ++VE++KK +++G++TDDERY  V   W S   ++ K   +L++K +   N IV+M +SGARGNISNF+QL+GMRGLMS                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D K   +IE L ERL  R+    V HP++  V+    ++IT+ +A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   +++I+E++G+V +I+  AS     + V   K       Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DI  F   N +++++   +PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D+L GLKENVI G +IP GTG
  S:   171 MGAEAIQDLLKQVDLPKEIAALKEELKTASGQKRIKA---VRRLDVLDAFYKSGNKPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNELYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IAGNVKAAKRLIERGDDRIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMVFKDADEAVMAYRNGYVHLHTRVGIATDSLDKPWKDNQKHKVMMTTVGKILFNAIMPEGLPYLQEPNNANLTEGTPDKYFLEPGSDIKAAIAELPINPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEESHERVEQIKKQFRRGMITDDERYAAVTDEWRSAKEKLEK---RLVEKQD-PKNPIVMMMDSGARGNISNFSQLAGMRGLMSAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLDIRSITDGK--EMIEPLEERLQGRYTKKTVKHPETGAVIIGPNQLITEDIAREIVNAGVEQVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNSDITQGLPRVQEIFEARNPKG--EAVITEVKGEVIAIEEDASTRTKKVFV---KGKTGEGEYVVPFTARMKVEVGDQVARGAALTEGSIQPKRLLEVRDVLAVETYLLSEVQKVYRSQGVEIGDKHIEVMVRQMLRKVRVMDPGDTDLLMGTLMDITDFTDANAEVVIAGG-IPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKRDNLLGLKENVIIGKIIPAGTG 1178
Score = 476, Expect = 4.1e-45, Identities = 82/136 (60%), Positives = 110/136 (80%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLD 141
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE+DGLFDE IFGP KD+EC+CGKYK+I+++G  C++CGVE+T + VRRER+GHIEL API+HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPERDGLFDEVIFGPTKDWECSCGKYKRIRYKGITCDRCGVEVTRAKVRRERMGHIELKAPISHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID 138
>gi|81096692|ref|ZP_00875027.1| DNA-directed RNA polymerase [Streptococcus suis 89/1591] >gi|80977254|gb|EAP40802.1| DNA-directed RNA polymerase [Streptococcus suis 89/1591] (1215 aa)
Score = 2504, Expect = 0.0e+00, Identities = 504/1039 (48%), Positives = 708/1039 (68%)
  Q:   231 IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +GAEAI +LLK +DL KE   + E+L+ +     IK    VRRL+ +     S NKPEWMIL  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          I  N+K+A++LI   D+ IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+   VH+H+ +GI T +   P K   K  I++TTVGK++ N ++PE + YL  P+N    E   D   +E G D +  I +  +   F KK L  I+  + +++         + +D++KD+G+ +ST +  T+   D+P    K +  EE+ ++VE++KK +++G++TDDERY  V   W S   ++ K   +L++K +   N IV+M +SGARGNISNF+QL+GMRGLMS                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D K   +IE L ERL  R+    V HP++  V+    ++IT+ +A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   +++I+E++G+V +I+  AS     + V   K       Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DI+ F   N + +++   VPATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D+L GLKENVI G +IP GTG
  S:   171 MGAEAIQDLLKQVDLPKEIAALKEELKTASGQKRIKA---VRRLDVLDAFYKSGNKPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNELYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IAGNVKAAKRLIERGDDRIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMVFKDADEAVMAYRNGYVHLHTRVGIATDSLDKPWKDNQKHKIMMTTVGKILFNAIMPEGLPYLQEPNNANLTEGTPDKYFLESGSDIKAAIAELPINPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEESHERVEQIKKQFRRGMITDDERYAAVTDEWRSAKEKLEK---RLVEKQD-PKNPIVMMMDSGARGNISNFSQLAGMRGLMSAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLDIRSITDGK--EMIEPLEERLQGRYTKKTVKHPETGAVIIGPNQLITEDIAREIVNAGVEQVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNSDITQGLPRVQEIFEARNPKG--EAVITEVKGEVIAIEEDASTRTKKVFV---KGKTGEGEYVVPFTARMKVEVGDQVARGAALTEGSIQPKRLLEVRDVLAVETYLLSEVQKVYRSQGVEIGDKHIEVMVRQMLRKVRVMDPGDTDLLMGTLMDISDFTDANAETVIAGG-VPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKRDNLLGLKENVIIGKIIPAGTG 1178
Score = 476, Expect = 4.5e-45, Identities = 82/136 (60%), Positives = 110/136 (80%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLD 141
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE+DGLFDE IFGP KD+EC+CGKYK+I+++G  C++CGVE+T + VRRER+GHIEL API+HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D
  S:     5 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPERDGLFDEVIFGPTKDWECSCGKYKRIRYKGITCDRCGVEVTRAKVRRERMGHIELKAPISHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID 138
>gi|146317780|ref|YP_001197492.1| DNA-directed RNA polymerase subunit beta' [Streptococcus suis 05ZYH33] >gi|146319972|ref|YP_001199683.1| DNA-directed RNA polymerase subunit beta' [Streptococcus suis 98HAH33] >gi|145688586|gb|ABP89092.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Streptococcus suis 05ZYH33] >gi|145690778|gb|ABP91283.1| DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Streptococcus suis 98HAH33] (1235 aa)
Score = 2502, Expect = 0.0e+00, Identities = 502/1039 (48%), Positives = 708/1039 (68%)
  Q:   231 IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +GAEAI +LLK +DL KE   + E+L+ +     IK    VRRL+ +     S NKPEWMIL  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          I  N+K+A++LI   D+ IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME     G+GM+F + DE    Y+   VH+H+ +GI T +   P K   K  +++TTVGK++ N ++PE + YL  P+N    E   D   +E G D +  I +  +   F KK L  I+  + +++         + +D++KD+G+ +ST +  T+   D+P    K +  EE+ ++VE++KK +++G++TDDERY  V   W S   ++ K   +L++K +   N IV+M +SGARGNISNF+QL+GMRGLMS                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G  +  I D K   +IE L ERL  R+    V HP++  V+    ++IT+ +A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S ++I QG  R++++F+   PK   +++I+E++G+V +I+  AS     + V   K       Y VPF + ++VE GD+V  G+ +TEGSI  K LL+V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DI  F   N +++++   +PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D+L GLKENVI G +IP GTG
  S:   191 MGAEAIQDLLKQVDLPKEIAALKEELKTASGQKRIKA---VRRLDVLDAFYKSGNKPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNELYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IAGNVKAAKRLIERGDDRIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMVFKDADEAVMAYRNGYVHLHTRVGIATDSLDKPWKDNQKHKVMMTTVGKILFNAIMPEGLPYLQEPNNANLTEGTPDKYFLEPGSDIKAAIAELPINPPFKKKNLGNIIAEIFKRFRTTE---TSALLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEESHERVEQIKKQFRRGMITDDERYAAVTDEWRSAKEKLEK---RLVEKQD-PKNPIVMMMDSGARGNISNFSQLAGMRGLMSAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLDIRSITDGK--EMIEPLEERLQGRYTKKTVKHPETGAVIIGPNQLITEDIAREIVNAGVEQVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNSDITQGLPRVQEIFEARNPKG--EAVITEVKGEVIAIEEDASTRTKKVFV---KGKTGEGEYVVPFTARMKVEVGDQVARGAALTEGSIQPKRLLEVRDVLAVETYLLSEVQKVYRSQGVEIGDKHIEVMVRQMLRKVRVMDPGDTDLLMGTLMDITDFTDANAEVVIAGG-IPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKRDNLLGLKENVIIGKIIPAGTG 1198
Score = 476, Expect = 4.5e-45, Identities = 82/136 (60%), Positives = 110/136 (80%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLD 141
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE+DGLFDE IFGP KD+EC+CGKYK+I+++G  C++CGVE+T + VRRER+GHIEL API+HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D
  S:    25 NRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPERDGLFDEVIFGPTKDWECSCGKYKRIRYKGITCDRCGVEVTRAKVRRERMGHIELKAPISHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID 158
>gi|125717056|ref|YP_001034189.1| DNA-directed RNA polymerase subunit beta' [Streptococcus sanguinis SK36] >gi|160175786|sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|125496973|gb|ABN43639.1| DNA-directed RNA polymerase I, beta chain (160 kDa subunit), putative [Streptococcus sanguinis SK36] (1215 aa)
Score = 2499, Expect = 0.0e+00, Identities = 504/1039 (48%), Positives = 712/1039 (68%)
  Q:   231 IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF--PKKQFPKDGILITTVGKVILNDVLPEEMSYLNNPDN---LEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLI--QKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIK--ASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +GAEAI +LLK +DL+ E   + E+L+ +     IK    VRRL+ +     S NKPEWM+L  + V PPD RP++QL+GG+F  SD+N  YR++I RN RL R+++ NAP II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVD+SGRSVI +GP LKMYQ G+P  M ++LFKPF++ E++ +          IV N+K+A++L+   D  IW I+ +VIK+ PVLLNRAPTLHRLGIQAFEP+L++GKA+RLHPLV  A+NADFDGDQMA+HVPLS EA AEAR ++LA+ HIL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F ++DE     +   VH+H+ +GI T +   P  +  K  ILITTVGK++ N ++PEE+ YL  P N    E +     +E G+D +  IE+ ++   F KK L  I+  + +++         + +D++K++G+ +ST +  T+   D+P   +K +  EE+ K+VE++ K +++G++TDDERY  V + W +   ++ K   +L+  Q P+   N IV+M +SGARGNISNF+QL+GMRGLM+                 +E+PI ++F EGL+V E F S++GARKGMTDTA+KT+ SGY+TR+LVD  QDVI+  +DC T +G ++  I + K   +IESL ERL  R+    V HP++  V+    E+IT+  A EIV+AG+++V +RSV  C   +G+C+ C+G +L T   VE   A+G IAAQSIGEPGTQLTMRTFHTGGV+S T+I QG  R++++F+   PK   +++I+E++G+V++I+  AS     + V   K       Y VPF + ++VE GD+V  G+ +TEGSI  K LL V  +  V  Y++ EVQKVYR QG+EI DK+IEV++RQ+  KV++ D G++D  +G ++DI  F   N  +++S   VPATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA ++G+ D L GLKENVI G +IP GTG
  S:   171 MGAEAIQDLLKQVDLEAEIAVLKEELKTASGQKRIKA---VRRLDVLDAFYKSGNKPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARD---------IVQNVKAAKRLVERGDERIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEEAGREGEGMIFKDMDEAVMALRNGYVHLHTRVGIATDSLNKPWTEDQKHKILITTVGKILFNAIMPEELPYLQEPTNANLTEGVPAKYFLESGQDIKEVIEQLEINVPFKKKNLGNIIAEIFKRFRTTE---TSALLDRLKNLGYHHSTLAGLTVGIADIPVVEDKAEIIEESHKRVEQITKQFRRGMITDDERYNAVTAEWRAAREKLEK---RLVANQDPK---NPIVMMMDSGARGNISNFSQLAGMRGLMAAPNG-----------RIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVIIREDDCGTDRGLLITSITEGK--EMIESLEERLNGRYTKKTVKHPETGAVIIGPNELITEDKAREIVNAGVEEVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNTDITQGLPRVQEIFEARNPKG--EAVITEVKGEVTAIEEDASTRTKKVFV---KGQTGEGEYVVPFTARMKVEVGDQVSRGAALTEGSIQPKHLLAVRDVLSVETYLLAEVQKVYRSQGVEIGDKHIEVMVRQMIRKVRVMDPGDTDLLMGTLMDITDFTDANRDVVISGG-VPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKENVIIGKIIPAGTG 1178
Score = 475, Expect = 5.1e-45, Identities = 81/136 (59%), Positives = 111/136 (81%)
  Q:     6 SRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLD 141
           +R  S+QI LASP K+R WS GEV K ETINY++LKPE++GLFDE IFGP KD+ECACGKYK+I+++G +C++CGVE+T + VRRER+GHIEL AP++HIW  K +  PS++ L LD+S + +E+V+YF  Y+V+D
  S:     5 NRFKSMQITLASPNKVRSWSYGEVKKPETINYRTLKPEREGLFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHIWYFKGI--PSRMGLTLDMSPRALEEVIYFAAYVVID 138
>gi|84494795|ref|ZP_00993914.1| DNA-directed RNA polymerase beta' subunit [Janibacter sp. HTCC2649] >gi|84384288|gb|EAQ00168.1| DNA-directed RNA polymerase beta' subunit [Janibacter sp. HTCC2649] (1297 aa)
Score = 2493, Expect = 0.0e+00, Identities = 540/1259 (42%), Positives = 806/1259 (64%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIV----LDEGNGKFPK-----NFNFKEV-------IDLSSQK-----SSKETRSKLRKTLREIYESIDVEASM----ENAIKHKIARTF--YDTLAESNMPFSIEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMK--------KVHVHSIIGIPTSAFPKKQFPKDGILI------TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVI---EDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ + IREWS+GEV K ETINY++LKPEKDGLF E IFGP +D+ECACGKYK+++F+G ICE+CGVE+T + VRRER+GHIELAAP+ HIW  K +P  S++  +LD++ K++E+V+YF  Y++    +++ +   P          KE+       +D  ++K     ++ E         R++ +S + E +      +A   ++A+ +  +  L   ++    E ++  +    G+ F  G+GA AI + L++ DLD E + + E +   +     KT+ L +RL+ +     + NKP  M+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+NNEKR+LQEAVD+LFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+     +         NIKSA++++    + +W ++ +VI + PVLLNRAPTLHRLGIQAFEP LVEGKAI++HPLV TAFNADFDGDQMAVHVPLS EA AEAR ++L+S +IL P DG+P+  PTQDM++G ++LT       G+G +F+ V E +  +           ++ +H ++  P +  P+   P D   +      T++G  + N+ LP +  ++N+                                 KK LS IVN L  +YS      V +++D +K+ GF ++T+S  T++  DV     K +  E  + K  +++  Y++GL+TDDER ++++  W+  TN+V+K++E  I      TN+I  M +SGARGN     Q++GMRGL+S               + I  PI+ +F EGL+V E+F S++G+RKG+ DTA++T+ SGY+TR+LVD +QDVI+  +DC T +G  + +    E T + ++ E +   +  R    DVV  +S  V+A AG  +   V + +  AG+D V+VRSVL C  + G C  C+G  L T KLV+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+ +LF+   PK    S I+E  G+V+      D    +++T  +  E   Y V   + L V +G  V+ G++ T GSID K++L++ G   V+ +++ EVQ VYR QG+ I DK+IEVI+RQ+  ++ I ++G++D   G + +   F  EN + ++++   PA+    + G+ +A   T S+L+AASFQ+T ++LT+A ++G+ D+L GLKENVI G LIP GTG
  S:    10 LRIGLATADSIREWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECACGKYKRVRFKGIICERCGVEVTRAAVRRERMGHIELAAPVTHIWYFKGVP--SRLGYLLDLAPKDLEKVIYFAAYMITSVDVEQRHTDLPSLEAQIEVEKKELENRRDADVDTRAKKLEGDIAALEAEGAKSDAKRKVRDSAEREMNQIRKRADAQVERLAQVWDRFKNLKVQDLEGD-EILYREMRDRFGLYFEGGMGAAAIQKRLESFDLDAEAELLREIIATGKGQK--KTRSL-KRLKVVSAFMTTTNKPAGMVLDAVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDSLFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKQMALELFKPFVMKRLVDLDHAQ---------NIKSAKRMVERHRSVVWDVLEEVITEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHVPLSAEAQAEARILMLSSNNILKPADGRPVTMPTQDMIIGLFHLTSPIEGSQGEGRVFSTVYEARMAFDAGEILLGTPVRIRLHHVVPTPGAVLPEGVVPDDEGFVPEWLADTSLGNALFNETLPMDYPFVNH------------------------------QVDKKALSTIVNDLAERYSKVQ---VAASLDALKEYGFHWATRSGITVAISDVVTPPRKLEILEGYEVKATKVQVQYERGLITDDERRQELIEIWTQATNEVAKEMEANIPA----TNTIFRMVSSGARGNWMQLRQIAGMRGLVSNPKG-----------EIIPRPIRANFREGLSVLEFFISTHGSRKGLADTALRTADSGYLTRRLVDVSQDVIIREDDCGTDRGLAMPIAATDERTGNRTLHEDVETSVYARTLAEDVVG-ESGAVMAEAGIDLGDLVISALFAAGVDSVKVRSVLTCDSKVGTCALCYGRSLATGKLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVVELFEARTPKG--VSPIAEASGRVTI--EETDKARRILLTPDDGSEEHAYPVSKRARLLVTDGQSVEVGTQFTVGSIDPKQVLRILGPRKVQMHLVDEVQHVYRQQGVSIHDKHIEVIVRQMLRRITIIEAGDADLLPGMLAERGRFEDENRR-VVAEGGTPASGRPELMGITKASLATESWLSAASFQETTRVLTEAAMEGKSDTLLGLKENVILGKLIPAGTG 1244
>gi|145596443|ref|YP_001160740.1| DNA-directed RNA polymerase subunit beta' [Salinispora tropica CNB-440] >gi|189043953|sp|A4XBQ5|RPOC_SALTO DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|145305780|gb|ABP56362.1| DNA-directed RNA polymerase, beta' subunit [Salinispora tropica CNB-440] (1297 aa)
Score = 2491, Expect = 0.0e+00, Identities = 547/1259 (43%), Positives = 797/1259 (63%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNFNFKEVIDLSSQKSSKETRS--------KLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFS-IEEVFN-----------------------FISSFTGMRFGIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGI---------------PTSAFPKKQFPKDGILI-TTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDT-KSGS-VIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ + IR+WS+GEV K ETINY++LKPEKDGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T S VRRER+GHIELAA + HIW  K +P  S++  +LD++ K++E+++YF +Y+V         ++    E   L+ ++ S+ +R         KL   L E+ E+   +A +   +K    R        +      ++EV +                       F   FTG   G+GAEAI  L++N+DLD E + + E +R  +    I+    ++RL+ +    +++N P  M+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+I   AP II+NNEKR+LQEAVDALFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+     +         NIKSA++++  Q   +W ++ +VI + PVLLNRAPTLHRLGIQAFEP LVEGKAI++HPLV TAFNADFDGDQMAVHVPLS EA AEAR ++L+S +IL P DGKP+  PTQDM++G Y+LT       G+G  F++  E +  +   ++H+ + + I               P +A P+     D I + TT+G+V+ N+ LP    ++N                                  K  LS IVN L  ++   +L    +T+D +K+ GF ++T S  TI   DV     K +     +K+ + + K YQ+GL+T +ER  +++  W+  TN+V+K+++  + +     N +  M NSGARGN+    Q++ +RGL++               + I  PIK S+ EGL+V EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVI+  EDC T +   ++V +   ++GS V+    E  ++   + D +      V+A  G  I   + ++IV AG++ V VRSVL C+ + G+C  C+G  L T K V+   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R++++F+   PK   K+ I++  G+V  I+    +  I+VV    S E    K+     L   +GD V+ G ++T G+ID  ELL++ G   V+ ++ +EVQ+VYR QG+ I DK+IE+IIRQ+  +V + DSG+++F  G ++D   F  EN +L+ S+   PA    ++ G+ +A   T S+L+AASFQ+T ++LTDA +  + DSL GLKENVI G LIP GTG
  S:    10 LRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPQRDWECYCGKYKRVRFKGIICERCGVEVTRSKVRRERMGHIELAASVTHIWYFKGVP--SRLGYLLDLAPKDLEKIIYFASYVVTSVDAEARHRDLATIENEILAEKRQSENSRDSEIEKRAGKLEADLAEL-EAEGAKADVRRKVKEGGEREMRQIRDRAQREIDRLDEVLDTFRKLEPKQLVTDELLYRELRDRFGEYFTG---GMGAEAIKALVQNMDLDAEAESLRETIRTGKGQRKIRA---LKRLKVVAAFLNTSNSPLGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPKLKLHQCGLPKQMALELFKPFVMKRLVDLNHAQ---------NIKSAKRMVERQRPVVWDVLEEVIGEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHVPLSAEAQAEARILMLSSNNILKPADGKPVTMPTQDMIIGLYHLTHRTPGERGEGRAFSSDAEARMAFDNGELHLQAPVKIRLRGLVGVESGPGAEPWTA-PEGWVEGDPITVETTLGRVLFNETLPPGYRFVN------------------------------YEIRKGQLSAIVNDLAERFPKVAL---AATLDGLKEAGFHWATWSGVTIGMEDVLAPPRKREILGRYEKEADRIDKQYQRGLMTAEERRGELIEIWTKATNEVAKEMDTALPQ----ENPLWKMINSGARGNLLQLRQIAAIRGLVANPKG-----------EIIPRPIKASYREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREEDCGTDRAIPMQVGQQAGEAGSLVVHEHAETSVHARTLADDIKGPDGTVVAERGADINSILVDKIVAAGVESVRVRSVLTCESKLGVCGACYGRSLPTGKTVDVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGEDITQGLPRVQEIFEARIPKG--KAPIADTPGRV-RIEDGERSRKIIVVPDDGSDEIAYDKISKRVRLLANDGDHVEVGERLTVGTIDPHELLRILGPRAVQVHLTQEVQEVYRSQGVLIHDKHIEIIIRQMLKRVTVIDSGSTEFLPGVLVDRALFESENRRLV-SEGGEPAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAIHARSDSLIGLKENVIIGKLIPAGTG 1246
>gi|163840926|ref|YP_001625331.1| DNA-directed RNA polymerase subunit beta' [Renibacterium salmoninarum ATCC 33209] >gi|189043949|sp|A9WSX9|RPOC_RENSM DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|162954402|gb|ABY23917.1| DNA-directed RNA polymerase beta' chain [Renibacterium salmoninarum ATCC 33209] (1299 aa)
Score = 2486, Expect = 0.0e+00, Identities = 539/1277 (42%), Positives = 809/1277 (63%)
  Q:     3 SKSSRITSIQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVL---------DEGNGKFPKNFNFKEVIDLSSQKSS---KETRSKLRKTLREIYESIDVEASMENAIKH-----KIARTFYDTLAESNMPFS---------IEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAF-PKKQFP--------KDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVI--ESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGG---VSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEE 1279
           S  +   S+QIGLA+   IR+WS GEV K ETINY++LKPEKDGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T + VRRER+GHIELAAP+ HIW  K +P  S++  +LD++ K++E+V+YF  Y++          D  N +   +   K+++D      +   ++   +L K   E  ++ D + + ++A +      K A    D L +    F           E ++  +    G+ F   +GAEAI + L+N D+  E + + + +   +N    +  + ++RL+ +     + N P  M+L  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+NNEKR+LQEAVD+LFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+     +         NIKSA++++      +W ++ ++I + PVLLNRAPTLHRLGIQAFEP+LVEGKAI+LHPLV  AFNADFDGDQMAVH+PLSPEA AEAR ++L+S +IL P DG+P+  P+QDM++G Y+LT +++   G+G +F +  E    +    +H++S + I    F P + +         +  I+ T++G+V+ ND LP +  ++      E+++D                        K  LSEIVN L  +Y      +V +T+D +KD GF ++T+S  T++  D+    EK       + K  +++  ++KGL+ DDER ++++  W    NQ + D+   ++K    +N+I  M +SGARGN     Q++G+RGL++               + I  PIK+S+ EGL+V EYF +++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  +DC T+ G  L +     +G ++  E +   +  R    +V   K K VLA AG  +   +  E+  AG+ +V+VRSVL C+   G C +C+G  L T KLV+   A+G+IAAQSIGEPGTQLTMRTFHTGG    S G +I QG  R+++LF+   PK    + I+E  G+V+      +    LV+T  +  E I Y +   + L V +GD+V+ G K+  G++D K++L+V G    + ++++EVQ+VYR QG+ I DK++EVI+RQ+  +V + +SG+S+   G++ +   F  EN + ++S+ + PA+  N + G+ +A   T S+L+AASFQ+T ++LT A ++G+ D L GLKENVI G LIP GTG     DI  E
  S:     2 SSEATFGSMQIGLATASDIRDWSFGEVKKPETINYRTLKPEKDGLFCEKIFGPSRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVP--SRLGYLLDLAPKDLEKVIYFAAYMITSVDDEMRHADLPNLQAEHDLEKKQLVDTRDSDIAGIARDLEGELTKLEGEGAKAADKKKARDSADRQMANIRKRADADIDRLDQVWDRFKGLKVTDLEGDEGLYRELRDRYGLYFEGSMGAEAIKKRLENFDMAAESESLRDTI---QNGKGQRKTRALKRLKVVNAFLTTKNSPLGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDSLFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKQMALELFKPFVMKRLVDLNHAQ---------NIKSAKRMVERYRPQVWDVLEEIITEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCGAFNADFDGDQMAVHLPLSPEAQAEARVLMLSSNNILKPSDGRPVTLPSQDMIIGLYHLTTKRVGSAGEGRIFTSPSEAIMAHDAGVLHLNSTVKIRLDNFVPGEDWEAPAGWEAGQPAIVETSLGQVLFNDTLPADYPWV------EKVAD------------------------KGQLSEIVNDLAERYPKV---VVAATLDNLKDAGFYWATRSGVTVAISDIEVPAEKPAILAGYEVKAAKVQSQFEKGLIADDERRQELIDIW----NQATNDVADAMRKSLSASNTINRMVSSGARGNWMQVRQIAGIRGLVANPKG-----------EIIPRPIKSSYREGLSVLEYFIATHGARKGLADTALRTANSGYLTRRLVDVSQDVIVREDDCGTEYGLTLPIAVADSNGELVMHEEVENSVYARTLATEVTDAKGK-VLAAAGADVGDVLIAELFAAGVTEVKVRSVLTCESAVGTCAQCYGRSLATGKLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGAVSASRGEDITQGLPRIQELFEARTPKG--VAPIAEAAGRVNI--EETERQMRLVLTPDDGTEEIAYPILRRARLLVADGDRVEVGQKLVVGAVDPKQVLRVLGPRAAQKHLVEEVQRVYRSQGVGIHDKHVEVIVRQMLRRVTVIESGDSNLLPGELAERGRFETENRR-VVSEGQKPASGRNELMGITKASLATESWLSAASFQETTRVLTQAAMEGKSDPLLGLKENVIIGKLIPAGTGLPRYTDITVE 1252
>gi|119026336|ref|YP_910181.1| DNA-directed RNA polymerase subunit beta' [Bifidobacterium adolescentis ATCC 15703] >gi|160175264|sp|A1A316|RPOC_BIFAA DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|118765920|dbj|BAF40099.1| DNA-directed RNA polymerase beta chain [Bifidobacterium adolescentis ATCC 15703] (1337 aa)
Score = 2485, Expect = 0.0e+00, Identities = 539/1259 (42%), Positives = 825/1259 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVL----DEGNGKFP---KNFNFKEVIDLSSQKSSK--ETRSKLRKTLREIYESIDVEAS----MENAIKHKIA--RTFYD--------------TLAESNMPFSIEEVFNFISSFTGMRFG--IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHS--IIGIPTS-AFPKKQFP---------------------KDG--ILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSV--IESLNERLINRFPIFDVVHPKS-KKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ + IR WS GEV K ETINY++LKPEKDGLF E IFGP +D+ECACGKYK+++F+G +CE+CGVE+T+S VRRER+GHIELAAP+ HIW  K +P  S++  +LDI+ K++E+V+YF  Y+V     ++ +   P   + F+  E+ +L  +++++  E   K+   L E+    + + S    + N+ + ++A  RT YD              TL   +M   ++ ++  +    G  F   +GAEAI + L++ DL+   K + E++   +  +  +  + ++RL+ +     + NKPE M+L  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+I+  AP I+LNNEKR+LQEAVD+LFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP L+M+Q G+P  M L+LFKPF+I  L+    D+G        N+KSA++L+   D+ +W ++ +VI + PVLLNRAPTLHRLGIQAFEPILVEGKAI L PL   AFNADFDGDQMAVH+PLS EA AEAR++++AS +IL P DG  +  P+QDM+LG YYLT       GQG +F++++E +      ++ + +  +I +P     PK   P                      DG  +  T+ G+++ N  LP +  ++N                              +   KK LS+IV+ +  +YS A    V +T+D +KD+GF  +  S  + +  DV +  E ++Y E+ + + +++ + Y+ G+LT++ER +++V  W+  T++VS+ +E+         N++ I+  SGARGN+    Q++GMRGL++               + I  P+K+++ +GL+V EYF S +GARKG+ DTA++T++SGY+TR+LVD +QDVIV  EDC TK+G  ++V E    G++  +++ +    +R    DV+ P   + VL  AG+ ++  V N++V  G+++V+ RSVL C+ + G+C KC+G  L TNKLV+   A+G++AAQSIGEPGTQLT+R+FH+GGV+S ++I QG  R+ +LF+   PK   ++ I+E  G V  ++ +     + +    +S E I Y V   + + V++GD V+ G+++ EGS+D K++L++ G    +  I++EV  VYR QG++I DK+IEVI+ Q+  ++ + DSG++D   G+++D   F+  N + + +  K PA     + G+ +A   T S+L+AASFQ+T ++LT+A +  ++D L GLKENVI G LIP GTG
  S:    10 LRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTKSRVRRERMGHIELAAPVTHIWFFKGVP--SRLGYLLDIAPKDLEKVIYFAAYMVTKVDEEQRHQDLPDLQQEFD-NEIANLEKRRNAEIEERAKKVEADLAELEAEGEAKGSARAKLRNSAEREMAAIRTRYDEQIQRLSAVFDRFKTLKPGDMEGDVD-LWREMEDRYGDYFEGCMGAEAIKKRLQDFDLEAASKQLREEI---DTGTGQRKARALKRLKVVNAFLTTGNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVIKRLV----DQG-----FAQNMKSAKRLVDRADSEVWGVLEEVISEHPVLLNRAPTLHRLGIQAFEPILVEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVTMPSQDMILGLYYLTTVIDGAKGQGRVFSSLEEAEMALDKHEIDMQAKVLIRLPQDFVLPKDWEPGEVKVVDPEPGSPDVVKEERFHDGSVLFATSYGRILFNGTLPVDYPFVN------------------------------EQAPKKRLSKIVDDIATRYSTAQ---VAATLDALKDLGFTRAPWSGVSFAFSDVIQPPELDEYIEKYEGEADKVNENYEIGMLTEEERRQELVDLWTKCTSEVSEAVEEHFDS----KNNLAIIVQSGARGNMMQINQIAGMRGLVANPKG-----------EIIPRPVKSNYRKGLSVLEYFISQHGARKGLADTALRTAESGYLTRRLVDVSQDVIVREEDCGTKRGLTMKVGERDAEGNLHLVKAADGGPYSRLLAADVIDPADGETVLYKAGDALSMDVLNDLVAHGVEEVKARSVLTCESKRGVCAKCYGWSLATNKLVDVGEAVGIVAAQSIGEPGTQLTLRSFHSGGVASASDITQGLPRVTELFEARTPKG--EAPIAEFAG-VVKVEDTERGRQVTLKPDDDSVEPIVYPVTRRAPMLVKDGDHVEAGTQLIEGSVDPKKILRILGPRAAQVNIVEEVHTVYRSQGVDIHDKHIEVIVHQMLRRITVIDSGDTDLLPGELVDKARFKAANMEAVKNGGK-PAAGRPELMGITKASLATDSWLSAASFQETTRVLTEAALNQKVDDLKGLKENVIIGKLIPAGTG 1260
>gi|171742262|ref|ZP_02918069.1| hypothetical protein BIFDEN_01368 [Bifidobacterium dentium ATCC 27678] >gi|171277876|gb|EDT45537.1| hypothetical protein BIFDEN_01368 [Bifidobacterium dentium ATCC 27678] (1337 aa)
Score = 2484, Expect = 0.0e+00, Identities = 531/1272 (41%), Positives = 822/1272 (64%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVL----DEGNGKFPK---NFNFKEVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPF--SIEEVFNFISSFTGMRFG-----------------------IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHS--IIGIPTS-AFPKKQFPK---------------------DG--ILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVI--ESLNERLINRFPIFDVVHPKS-KKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDIIEEGNK 1282
           ++IGLA+ + IR WS GEV K ETINY++LKPEKDGLF E IFGP +D+ECACGKYK+++F+G +CE+CGVE+T+S VRRER+GHIELAAP+ HIW  K +P  S++  +LDI+ K++E+V+YF  Y+V     ++ +   P     F+  E+ +L  ++++ E   + +K   ++ + ++ E   + + + K+  +    +A     F   I+ +      F  ++ G                       +GAEAI + L++ DLD   K + E++   +  +  +  + ++RL+ +     + NKPE M+L  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+I+  AP I+LNNEKR+LQEAVD+LFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP L+M+Q G+P  M L+LFKPF+I  L+               N+KSA++L+   D+ +W ++ +VI + PVLLNRAPTLHRLGIQAFEPILVEGKAI L PL   AFNADFDGDQMAVH+PLS EA AEAR++++AS +IL P DG  +  P+QDM+LG YYLT       GQG +F++++E +      ++ + +  +I +P     PK   P                      DG  +  T+ G+++ N  LP +  ++N+                                 KK LS+IV+ +  +Y  A    V +T+D +KD+GF  +  S  + +  DV +  E+++Y E+ + + +++ + Y+ G+LT++ER ++++  W+  T++VS+ +E+         N++ I+  SGARGN+    Q++GMRGL++               + I  P+K+++ +GL+V EYF S +GARKG+ DTA++T++SGY+TR+LVD +QDVIV  EDC TK+G  ++V E  ++G+++  ++ +    +R    DV+ P   + VL  AG+ ++  V N++V  G+++V+ RSVL C+ + G+C KC+G  L TNKLV+   A+G++AAQSIGEPGTQLT+R+FH+GGV+S ++I QG  R+ +LF+   PK   ++ I+E  G V  ++ +     + +    +S E I Y V   + + V++GD V+ G+++ EGS+D K++L++ G    +  I++EV  VYR QG++I DK+IEVI+ Q+  ++ + DSG++D   G+++D   F+  N + + +  K PA     + G+ +A   T S+L+AASFQ+T ++LT+A +  ++D L GLKENVI G LIP GTG     + + E +K
  S:    10 LRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTKSRVRRERMGHIELAAPVTHIWFFKGVP--SRLGYLLDIAPKDLEKVIYFAAYMVTGVDEEQRHQDLPDLQDEFD-TEITNLEKRRNA-EIEDRAKKVEADLAQ-LEAEGEAKGSARAKLRNSAEREMAAIRTRFDEQIQRLNAVFDRFKNLKPGDMEGDVDLWREMEDRYGDYFEGCMGAEAIKKRLQDFDLDAAAKQLREEI---DTGTGQRKARALKRLKVVNAFLTTGNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVIKRLVDLN---------YAQNMKSAKRLVDRGDSEVWGVLEEVIAEHPVLLNRAPTLHRLGIQAFEPILVEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVTMPSQDMILGLYYLTTVIDGAKGQGRVFSSLEEAEMALDKHEIDMQAKVLIRLPQDFVLPKDWEPSELKVVDPEPGSPDVVKEERFHDGSVLFATSYGRILFNSTLPLDYPFVNDQA------------------------------PKKRLSKIVDDIATRYPTAQ---VAATLDALKDMGFTRAPWSGVSFAFSDVIQPPERDEYIEKYEAEADKVNENYEIGMLTEEERRQELIDLWTKCTSEVSEAVEEHFDS----KNNLAIIVQSGARGNMMQINQIAGMRGLVANPKG-----------EIIPRPVKSNYRDGLSVLEYFISQHGARKGLADTALRTAESGYLTRRLVDVSQDVIVREEDCGTKRGLPMKVGERDENGNLVLVKAADGGPYSRLLASDVIDPADGETVLYKAGDALSMDVLNDLVAHGVEEVKARSVLTCESKRGVCAKCYGWSLATNKLVDVGEAVGIVAAQSIGEPGTQLTLRSFHSGGVASASDITQGLPRVTELFEARTPKG--EAPIAEFPG-VVKVEDTDRGRQVTLKPDDDSVEPIVYPVTRRAPMLVKDGDHVEAGTQLIEGSVDPKKILRILGPRAAQVNIVEEVHTVYRSQGVDIHDKHIEVIVHQMLRRITVIDSGDTDLLPGELVDQARFKAANMEAVKNGGK-PAAGRPELMGITKASLATDSWLSAASFQETTRVLTEAALSQKVDDLKGLKENVIIGKLIPAGTGLARYRNAVVEPDK 1273
>gi|154488234|ref|ZP_02029351.1| hypothetical protein BIFADO_01808 [Bifidobacterium adolescentis L2-32] >gi|154083385|gb|EDN82430.1| hypothetical protein BIFADO_01808 [Bifidobacterium adolescentis L2-32] (1337 aa)
Score = 2483, Expect = 0.0e+00, Identities = 538/1259 (42%), Positives = 825/1259 (65%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVL----DEGNGKFP---KNFNFKEVIDLSSQKSSK--ETRSKLRKTLREIYESIDVEAS----MENAIKHKIA--RTFYD--------------TLAESNMPFSIEEVFNFISSFTGMRFG--IGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHS--IIGIPTS-AFPKKQFP---------------------KDG--ILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSV--IESLNERLINRFPIFDVVHPKS-KKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ + IR WS GEV K ETINY++LKPEKDGLF E IFGP +D+ECACGKYK+++F+G +CE+CGVE+T+S VRRER+GHIELAAP+ HIW  K +P  S++  +LDI+ K++E+V+YF  Y+V     ++ +   P   + F+  E+ +L  +++++  E   K+   L E+    + + S    + N+ + ++A  RT YD              TL   +M   ++ ++  +    G  F   +GAEAI + L++ DL+   K + E++   +  +  +  + ++RL+ +     + NKPE M+L  I V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR+I+  AP I+LNNEKR+LQEAVD+LFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP L+M+Q G+P  M L+LFKPF+I  L+    D+G        N+KSA++L+   D+ +W ++ +VI + PVLLNRAPTLHRLGIQAFEPILVEGKAI L PL   AFNADFDGDQMAVH+PLS EA AEAR++++AS +IL P DG  +  P+QDM+LG YYLT       GQG +F++++E +      ++ + +  +I +P     PK   P                      DG  +  T+ G+++ N  LP +  ++N                              +   KK LS+IV+ +  +YS A + +   T+D +KD+GF  +  S  + +  DV +  E ++Y E+ + + +++ + Y+ G+LT++ER +++V  W+  T++VS+ +E+         N++ I+  SGARGN+    Q++GMRGL++               + I  P+K+++ +GL+V EYF S +GARKG+ DTA++T++SGY+TR+LVD +QDVIV  EDC TK+G  ++V E    G++  +++ +    +R    DV+ P   + VL  AG+ ++  V N++V  G+++V+ RSVL C+ + G+C KC+G  L TNKLV+   A+G++AAQSIGEPGTQLT+R+FH+GGV+S ++I QG  R+ +LF+   PK   ++ I+E  G V  ++ +     + +    +S E I Y V   + + V++GD V+ G+++ EGS+D K++L++ G    +  I++EV  VYR QG++I DK+IEVI+ Q+  ++ + DSG++D   G+++D   F+  N + + +  K PA     + G+ +A   T S+L+AASFQ+T ++LT+A +  ++D L GLKENVI G LIP GTG
  S:    10 LRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTKSRVRRERMGHIELAAPVTHIWFFKGVP--SRLGYLLDIAPKDLEKVIYFAAYMVTKVDEEQRHQDLPDLQQEFD-NEIANLEKRRNAEIEERAKKVEADLAELEAEGEAKGSARAKLRNSAEREMAAIRTRYDEQIQRLSAVFDRFKTLKPGDMEGDVD-LWREMEDRYGDYFEGCMGAEAIKKRLQDFDLEAASKQLREEI---DTGTGQRKARALKRLKVVNAFLTTGNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVIKRLV----DQG-----FAQNMKSAKRLVDRADSEVWGVLEEVISEHPVLLNRAPTLHRLGIQAFEPILVEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVTMPSQDMILGLYYLTTVIDGAKGQGRVFSSLEEAEMALDKHEIDMQAKVLIRLPQDFVLPKDWEPGEVKVVDPEPGSPDVVKEERFHDGSVLFATSYGRILFNGTLPVDYPFVN------------------------------EQAPKKRLSKIVDDIATRYSTAQVAV---TLDALKDLGFTRAPWSGVSFAFSDVIQPPELDEYIEKYEGEADKVNENYEIGMLTEEERRQELVDLWTKCTSEVSEAVEEHFDS----KNNLAIIVQSGARGNMMQINQIAGMRGLVANPKG-----------EIIPRPVKSNYRKGLSVLEYFISQHGARKGLADTALRTAESGYLTRRLVDVSQDVIVREEDCGTKRGLTMKVGERDAEGNLHLVKAADGGPYSRLLAADVIDPADGETVLYKAGDALSMDVLNDLVAHGVEEVKARSVLTCESKRGVCAKCYGWSLATNKLVDVGEAVGIVAAQSIGEPGTQLTLRSFHSGGVASASDITQGLPRVTELFEARTPKG--EAPIAEFAG-VVKVEDTERGRQVTLKPDDDSVEPIVYPVTRRAPMLVKDGDHVEAGTQLIEGSVDPKKILRILGPRAAQVNIVEEVHTVYRSQGVDIHDKHIEVIVHQMLRRITVIDSGDTDLLPGELVDKARFKAANMEAVKNGGK-PAAGRPELMGITKASLATDSWLSAASFQETTRVLTEAALNQKVDDLKGLKENVIIGKLIPAGTG 1260
>gi|72163052|ref|YP_290709.1| DNA-directed RNA polymerase subunit beta' [Thermobifida fusca YX] >gi|90111035|sp|Q47LI6|RPOC_THEFY DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (Transcriptase subunit beta') (RNA polymerase subunit beta') >gi|71916784|gb|AAZ56686.1| RNA polymerase I subunit A, N-terminal [Thermobifida fusca YX] (1291 aa)
Score = 2483, Expect = 0.0e+00, Identities = 540/1266 (42%), Positives = 811/1266 (64%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIVLDEGNGKFPKNF-NFKEVIDLSSQ-------KSSKETRSKLRKTLREIYES---IDVEASMENAIKHKI------ARTFYDTLAESNMPFS---------IEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGI--------PTSAFPKKQFP--KDGILITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLN--ERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTGKKSNEDI 1276
           ++IGLA+ + IR+WS+GEV K ETINY++LKPEKDGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T + VRRER+GHIELAAP+ HIW  K +P  S++  +LD++ K++E+V+YF  Y+V         ++  + +  I +  Q        + +E   KL   L E+ E     D    +  A + +I      A+   D L E    F           E+++  +    G  F  G+GA+AI E L N DL+ E + + E +R  +     K  + ++RL+ +    ++ N P  M+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+NNEKR+LQEAVDALFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+     +         NIKSA++++      +W ++ +VI + PVLLNRAPTLHRLGIQAFEP LVEGKAI++HPLV TAFNADFDGDQMAVH+PLS EA AEAR ++LA+ +IL P DGKP+  PTQDMV+G YYLT  K    G+G  F+N+ E    Y + ++ + + I +        P +  P + +   +  IL TT+G+ + N+  PE+  ++N                              +   KK LS +V  L  KYS      V +T+D +KD G+ ++T+S  TIS  DV     K++  ++ +++ +++++ Y++GL++DDER ++++  W+  T++V+KD+E+    P    N + +M NSG+RGN     Q++ +RGL+S +             +TI  PIK+S+ EGLTV EYF S++G RKG+ DTA++T+ SGY+TR+LVD  QDVIV   DC T +    E+ E    G+++   N       R    DVV     KV+A      T+A+ ++++ AG+ ++ +RS L C+ + G+C  C+G  L T K V+   A+G+IAAQSIGEPGTQLTMRTFH GG ++G +I  G  R+++LF+   PK    + ISE+EG+V  I+ +  +  I+VV    S E ++Y+VP  + L V++G +V+ G ++ +G+++  E+L++ G   V+ +++ EVQ+VY+ QG+ I DK+IE+I+RQ+  +V + +SG++    G++I+   F + N + ++++   PA+A  ++ G+ +A   T S+L+AASFQ+T ++LT+  + G+ D L GLKENVI G LIP GTG     +I
  S:    10 LRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVP--SRLGYLLDLAPKDLEKVIYFAAYMVTWVDTEARERDLPSLEAQISVERQHLEQRRDSAIEERHRKLEADLAELEEQGAKADARRKVREAAEREIRQIRDRAQREIDRLEEVWNRFKNLKVQDLEGDEQLYREMRDRFGKYFRGGMGAQAIKERLANFDLEAEAEKLREIIRTGKGQ---KKARALKRLKVVSAFLNTRNSPMGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKQMALELFKPFVMKRLVDLNHAQ---------NIKSAKRMVERARPVVWDVLEEVISEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHLPLSAEAQAEARILMLATNNILKPSDGKPVTMPTQDMVIGLYYLTTMKEGAKGEGRAFSNIGEAIMAYDLGELDLQAKIKLRVEGDTVPPVNWEPPEDYQPGQPYILETTLGRYLFNETTPEDYPFVN------------------------------QQMGKKQLSALVTELAEKYSKVQ---VATTLDALKDAGYYWATRSGLTISISDVIPPPNKQQILDKYEQQAQKIQRQYERGLISDDERRQELIHIWTKATDEVAKDMEE--NSPP--DNPVWMMVNSGSRGNPLQVRQIAAIRGLVSNTKG-----------ETIPRPIKSSYREGLTVLEYFISTHGQRKGLADTALRTADSGYLTRRLVDVAQDVIVREVDCGTDRFLWQEIGERRPDGTIVRKHNVENTGFGRTLAEDVV--VDGKVIATKLSDTTEALIDKLLAAGVTRIRIRSALVCESKIGVCATCYGRSLATGKPVDVGEAVGIIAAQSIGEPGTQLTMRTFHMGG-TAGQDITHGLPRVQELFEARVPKG--VAPISEVEGRV-RIEETDKSRKIIVVPDDGSDE-VSYQVPMRAPLLVQDGQRVEVGQQLVQGTVNPHEILRILGPRAVQQHLVSEVQEVYKSQGVSIHDKHIEIIVRQMLKRVNVLESGDTKLLPGEMIERPKFEEINRR-VVAEGGQPASARPVLLGITKASLATESWLSAASFQETTRVLTENAIHGKSDPLLGLKENVIIGKLIPAGTGMPQYRNI 1245
>gi|196251031|ref|ZP_03149713.1| DNA-directed RNA polymerase, beta' subunit [Geobacillus sp. G11MC16] >gi|196209503|gb|EDY04280.1| DNA-directed RNA polymerase, beta' subunit [Geobacillus sp. G11MC16] (1012 aa)
Score = 2479, Expect = 0.0e+00, Identities = 497/1004 (49%), Positives = 700/1004 (69%)
  Q:   266 KTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGIPTSAFPKKQFP---KDGILITTVGKVILNDVLPEEMSYLNNP--DNLE-ELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIESLNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           +  ++++RLE ++  + S N P WM+L  + V PP+ RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP+II+ NEKR+LQEAVDAL DN  R +P+ G   RPLKSLS  LKGKQG FRQNLLGKRVDYSGRSVIV+GP LKMYQ G+P  M L+LFKPF++ EL+++          +  NIKSA++ I      +W ++  VIK+ PVLLNRAPTLHRLGIQAFEP LVEG+AIRLHPLV TA+NADFDGDQMAVHVPLS EA AEAR ++LA+ +IL PKDGKP++TP+QDMVLGNYYLTME+    G+GM+F + DE    Y    VH+HS I I   +   + F     + +L+TTVGK+I N++LP+   Y+N P  +N+E    D   ++ G D R  I K+++   F KK L +I+  + +++    +      +D++KD+GF+YSTK+  TI   D+    EK++  +E   KV+ + K +++GL+TD+ERY++V+S WS+  +++   + K + K     N I +M++SGARGN SNFTQL+GMRGLM+                 IE+PIK+SF EGLTV EYF S++GARKG+ DTA+KT+ SGY+TR+LVD  QDVIV  EDC T +G +   + D     V+  L ERL+ R+    V HP++ +V+    E+IT+ +ANEI+ AGI +V +RSV  C   +G+C+KC+G ++ T   VE   A+G+IAAQSIGEPGTQLTMRTFHTGGV +G +I QG  R+++LF+   PK   +++ISEI+G V +I  + DN   +VV  ++  E+ +Y  P+++ L+VEEG  V+ G ++TEGS+D K+LL+V  I  V+ Y+++EVQKVYR+QG+EI+DK+IEV++RQ+  KV++ D+G++D   G ++D++ F   N + I  + K PATA  ++ G+ +A  +T SFL+AASFQ+T ++LTDA +KG+ D L GLKENVI G L+P GTG
  S:    15 RRARIIKRLEVLESFRSSGNDPAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERG---------LAHNIKSAKRKIERVHPEVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFKDTDEALLAYHNGYVHLHSRIAIHAGSLKNETFTPEQNNKLLLTTVGKLIFNEILPKSFPYINEPTTENIEGRTPDKYFLDKGVDVREEIRKRELVPPFKKKVLGQIIAEVFKRF---KITETSKMLDRMKDLGFQYSTKAGITIGVSDIVVLPEKQEILDEAQAKVDTVLKQFRRGLITDEERYERVISVWSAAKDKIQDRLMKSLDK----RNPIFMMSDSGARGNASNFTQLAGMRGLMANPAG-----------RIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIVREEDCGTDRGILARALTD--GTEVVVKLEERLVGRYAHKTVHHPETGEVIVRKDEMITEDIANEIIKAGITEVWIRSVFACNTRHGVCKKCYGRNMATGMDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGV-AGDDITQGLPRVQELFEARNPKG--QAVISEIDGTVVAINETRDNQYEIVV--QSEVETRSYVAPYNARLKVEEGQHVERGQELTEGSVDPKQLLRVRDITSVQEYLLREVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDVLPGTLLDVHQFTDVNAQAI-REGKRPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIGKLVPAGTG 989
>gi|158317798|ref|YP_001510306.1| DNA-directed RNA polymerase subunit beta' [Frankia sp. EAN1pec] >gi|158113203|gb|ABW15400.1| DNA-directed RNA polymerase, beta' subunit [Frankia sp. EAN1pec] (1296 aa)
Score = 2478, Expect = 0.0e+00, Identities = 538/1259 (42%), Positives = 794/1259 (63%)
  Q:    11 IQIGLASPEKIREWSNGEVTKSETINYKSLKPEKDGLFDEAIFGPVKDYECACGKYKKIKFRGKICEKCGVEITESIVRRERVGHIELAAPIAHIWMTKELPCPSKISLVLDISYKEIEQVVYFVNYIV----LDEGNGKFP----------------KNFNFK--------EVIDLSSQKSSKETRSKLRKTLREIYESIDVEASMENAIKHKIARTFYDTLAESNMPFSIEEVFNFISSFTGMRF--GIGAEAILELLKNIDLDKEYKDIYEKLRKSENTSDIKTKKLVRRLEAIKWLKDSNNKPEWMILKNIVVTPPDTRPIIQLEGGKFTTSDINSFYRKIIIRNERLKRVIQNNAPSIILNNEKRLLQEAVDALFDNASRKKPLLGKDKRPLKSLSEHLKGKQGLFRQNLLGKRVDYSGRSVIVIGPELKMYQVGIPVSMILKLFKPFIIHELIKKTDDEGNTKDPIVSNIKSAEKLILNQDNTIWPIINKVIKQRPVLLNRAPTLHRLGIQAFEPILVEGKAIRLHPLVTTAFNADFDGDQMAVHVPLSPEAVAEARTIILASWHILGPKDGKPIITPTQDMVLGNYYLTMEKLNMPGQGMLFANVDELKTVYQMKKVHVHSIIGI------PTS--AFPKKQFPKDGI-LITTVGKVILNDVLPEEMSYLNNPDNLEELSDNDIVEWGKDYRTFIEKKKVYKAFTKKTLSEIVNILHRKYSDASLEIVPSTMDKIKDIGFEYSTKSATTISAFDVPEYTEKEKYFEETDKKVEEMKKYYQKGLLTDDERYKKVVSAWSSVTNQVSKDIEKLIQKPEYLTNSIVIMANSGARGNISNFTQLSGMRGLMSKSYNYDQKQKSKVIKDTIEVPIKNSFIEGLTVSEYFNSSYGARKGMTDTAMKTSKSGYMTRKLVDATQDVIVNNEDCKTKKGTILEVIEDTKSGSVIES--LNERLINRFPIFDVVHPKSKKVLAPAGEIITKAVANEIVDAGIDKVEVRSVLHCKEENGICQKCFGTDLTTNKLVEKYTAIGVIAAQSIGEPGTQLTMRTFHTGGVSSGTNIAQGFERLKQLFDIIPPKQWEKSIISEIEGKVSSIKASPDNPNILVVTIKNSKESINYKVPFDSELRVEEGDKVKPGSKITEGSIDVKELLKVAGIEVVRNYIIKEVQKVYRLQGIEIADKYIEVIIRQLTNKVQIQDSGNSDFFIGQIIDINTFRKENEKLILSDDKVPATAVNLIFGLDEAPSKTGSFLAAASFQDTKKILTDACVKGQIDSLNGLKENVIFGNLIPCGTG 1269
           ++IGLA+ + IR+WS GEV K ETINY++LKPEKDGLF E IFGP +D+EC CGKYK+++F+G ICE+CGVE+T + VRRER+GHIELAAP+ HIW  K +P  S++  +LD++ K++E+V+YF  Y++    +D  +   P                KN + +        ++  L ++ +  + R K+R++       I   +  +     ++   F +   +   P   E +F  +    G  F  G+GAEA+   L + DL  E + + E +R  +     K  + ++RL+ +    ++ N P  M+L  + V PPD RP++QL+GG+F TSD+N  YR++I RN RLKR++   AP II+NNEKR+LQEAVDALFDN  R +P+ G   RPLKSLS+ LKGKQG FRQNLLGKRVDYSGRSVIV+GP+LK++Q G+P  M L+LFKPF++  L+     +         NIKSA++++      +W ++ +VI + PVLLNRAPTLHRLGIQAFEP LVEGKAI++HPLV TAFNADFDGDQMAVH+PLS EA AEAR ++L+S +IL P  G+P+  P+ DMV G ++L+       G+G  F++V E +  +  +++H+ + I +      P +  A P    P D   L TT G+ +LN+ LPE   ++N   N                              KK  + IVN L  +Y       V +T+D +K  GF ++T+S  T++  DV     K +  +E +++ E ++K + +G L+D+ER  ++V  W+  TN++++ +E     PE  TN +  + NSGA GN+    QL+GMRGL+S               + I  PIK +F EGLTV EYF S++GARKG+ DTA++T+ SGY+TR+LVD +QDVIV  EDC T++G +  +      G ++           R    D V  +  +V+ PAG      V  +I++AGI+ V VRS L C+   G+C  C+G  L T KLV+   A+G++AAQSIGEPGTQLTMRTFH+GGV +G +I QG  R+ +LF+   PK   K+ ISE+ G+V  I+ +     +++V    S+E I Y V   S LRV EG++V+ G+++ +G++D  E+L++ G   V+ +++ +VQ+VYR QG+ I DK+IE+IIRQ+  +V + +SG +    G++++   F  EN +++    + PA+A  ++ G+ +A   T S+L+AASFQ+T ++LTDA +  + DSL GLKENVI G LIP GTG
  S:    10 LRIGLATADDIRQWSFGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVP--SRLGYLLDLAPKDLEKVIYFAAYMITKVDIDSRHRDLPTLEARIGVEKQQLEDKKNADVETRQRKLEEDLAQLEAEGAKGDARRKVRESAEREMRQIRDRSQRKIDDLDRVFDRFKNMKVQDLEP--DELLFRELRDRFGQYFEGGMGAEALQHRLADFDLAAEAESLRETIRSGKGQ---KKARALKRLKVVSAFLNTRNSPMGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKQMALELFKPFVMKRLVDLNHAQ---------NIKSAKRMVERARPVVWDVLEEVITEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILSPASGRPLAMPSLDMVTGVFHLSRVSEGAIGEGRFFSSVAEAQMAFDAREIHLQARIQVRLRESTPPAEWAPPADWLPGDPFTLETTFGRCLLNEALPEGYPFINAQLN------------------------------KKAQAAIVNDLAERYPKIQ---VAATLDALKSAGFYWATRSGVTVAIEDVVAPPNKAQILDEYEQRAERVEKQFGRGFLSDEERRSELVQIWTEATNKIAEAMEA--NFPE--TNPVYTLVNSGAAGNMMQIRQLAGMRGLVSNPKG-----------EIIPRPIKANFREGLTVVEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREEDCGTERGILTRIARKGPDGVLVRDRYAETSAYARSLASDAVDAQG-EVVVPAGADAGDVVIGQIIEAGIESVRVRSALTCESRMGVCAHCYGRSLATGKLVDVGEAVGIVAAQSIGEPGTQLTMRTFHSGGV-AGDDITQGLPRVVELFEARSPKG--KAPISEVTGRV-KIEETEKTFKVVIVPDDGSEE-IAYPVSRRSRLRVREGERVEVGAQLIDGAVDPHEVLRILGPRQVQLHLVDQVQEVYRSQGVSIHDKHIEIIIRQMLKRVNVLESGETTLLPGELVERARFEGENRRVVEIGGQ-PASARPVLMGITKASLATESWLSAASFQETTRVLTDAAINARSDSLVGLKENVIIGKLIPAGTG 1238
>