>gi|26553533|ref|NP_757467.1| 50S ribosomal protein L13 [Mycoplasma penetrans HF-2] >gi|26453539|dbj|BAC43871.1| ribosomal protein L13 [Mycoplasma penetrans HF-2] (146 aa)
Score = 689, Expect = 2.9e-71, Identities = 146/146 (100%), Positives = 146/146 (100%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN
  S:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
>gi|31541342|gb|AAP56643.1| RplM [Mycoplasma gallisepticum R] (154 aa)
Score = 452, Expect = 9.9e-44, Identities = 85/143 (59%), Positives = 116/143 (81%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           MQKTT  K   A  N+KWY++DAS L+LG+LAV+AAN+LRGKNK DFTPNVDCGDYLII+NSDK+VL+ +K D EKWY HS Y+GG+K ++GR M++ YSD+L+Y AI+ MLPKN L++ +++KL +YK+  H+  AQ+P ++
  S:     8 MQKTTMQKPVVATKNRKWYLVDASGLVLGRLAVKAANLLRGKNKPDFTPNVDCGDYLIILNSDKVVLTGNKLDNEKWYRHSNYMGGIKSRTGREMVDHYSDQLVYDAIRRMLPKNRLAKDMMRKLKVYKNDRHEHDAQQPTKL 150
>gi|13358142|ref|NP_078416.1| 50S ribosomal protein L13 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762450|ref|YP_001752662.1| ribosomal protein L13 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508614|ref|ZP_02958121.1| ribosomal protein L13 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701868|ref|ZP_02971528.1| ribosomal protein L13 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|81789047|sp|Q9PPR2|RL13_UREPA 50S ribosomal protein L13 >gi|189041027|sp|B1AJL8|RL13_UREP2 50S ribosomal protein L13 >gi|11276752|pir||E82873 ribosomal protein L13 UU577 [imported] - Ureaplasma urealyticum >gi|6899586|gb|AAF30991.1|AE002156_6 ribosomal protein L13 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828027|gb|ACA33289.1| ribosomal protein L13 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182676072|gb|EDT87977.1| ribosomal protein L13 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701172|gb|EDU19454.1| ribosomal protein L13 [Ureaplasma parvum serovar 6 str. ATCC 27818] (148 aa)
Score = 447, Expect = 3.7e-43, Identities = 85/145 (58%), Positives = 119/145 (82%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP--MEIKL 145
           MQK++ +K E A+A ++WY++DA++L+LG+L+V+ A+ILRGKNKVD+TPNVD GDY+++INSDK+VL+  KA RE WY HS YIGGL+ +SG  MI KYSD+LI  ++KGMLPKN L++ ++ KLFIYK+  H   AQ+P  +E+KL
  S:     1 MQKSSMLKKEVAIARRQWYLVDATDLVLGRLSVKVADILRGKNKVDYTPNVDAGDYVVVINSDKVVLTGQKALRENWYNHSHYIGGLRTRSGEEMISKYSDELIRRSVKGMLPKNKLAKQILNKLFIYKNDKHPHEAQQPTILELKL 147
>gi|12045278|ref|NP_073089.1| 50S ribosomal protein L13 [Mycoplasma genitalium G37] >gi|1350663|sp|P47657|RL13_MYCGE 50S ribosomal protein L13 >gi|3845010|gb|AAC71644.1| ribosomal protein L13 [Mycoplasma genitalium G37] >gi|166078710|gb|ABY79328.1| ribosomal protein L13 [synthetic Mycoplasma genitalium JCVI-1.0] (146 aa)
Score = 441, Expect = 1.8e-42, Identities = 85/140 (60%), Positives = 111/140 (79%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           MQKT+ +  E A+ N+KWY++DAS L+LGKLAV+AAN++RGKNK +FTPN DCGD+LIIINSD++VL+ +K D E WY HS Y+GG+K+ SGR MI K SDKL++ A+KGMLP N LSR LI K+ ++K+  H   AQKP
  S:     1 MQKTSMLTKEEAIKNRKWYLVDASGLVLGKLAVKAANLIRGKNKANFTPNQDCGDHLIIINSDQVVLTGNKKDNEFWYHHSQYMGGIKKTSGRDMINKNSDKLVFNAVKGMLPDNRLSRRLITKVHVFKNDKHNMEAQKP 140
>gi|13508356|ref|NP_110306.1| 50S ribosomal protein L13 [Mycoplasma pneumoniae M129] >gi|2500254|sp|P75178|RL13_MYCPN 50S ribosomal protein L13 >gi|1673891|gb|AAB95873.1| ribosomal protein L13 [Mycoplasma pneumoniae M129] (146 aa)
Score = 430, Expect = 3.2e-41, Identities = 83/140 (59%), Positives = 109/140 (77%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           MQKT+ +  E A   ++WY++DA+ L+LGKLAV+AA+++RGKNKVDFTPN DCGDYLIIINSD++VL+ +K + E WY HS YIGG+K+ SGR M++K SDKL+Y A+KGMLP N LSR  I K+ ++K   H   AQKP
  S:     1 MQKTSMLTKEQANKRRQWYIVDAAGLVLGKLAVKAADLIRGKNKVDFTPNQDCGDYLIIINSDQVVLTGNKKENEFWYHHSQYIGGIKKVSGRDMLKKQSDKLVYNAVKGMLPDNRLSRRWITKVHVFKGDKHNMEAQKP 140
>gi|15644203|ref|NP_229253.1| 50S ribosomal protein L13 [Thermotoga maritima MSB8] >gi|148270470|ref|YP_001244930.1| 50S ribosomal protein L13 [Thermotoga petrophila RKU-1] >gi|170289135|ref|YP_001739373.1| ribosomal protein L13 [Thermotoga sp. RQ2] >gi|166199627|sp|A5IMD1|RL13_THEP1 50S ribosomal protein L13 >gi|7674184|sp|Q9X1G5|RL13_THEMA 50S ribosomal protein L13 >gi|4982019|gb|AAD36522.1|AE001797_2 ribosomal protein L13 [Thermotoga maritima MSB8] >gi|147736014|gb|ABQ47354.1| LSU ribosomal protein L13P [Thermotoga petrophila RKU-1] >gi|170176638|gb|ACB09690.1| ribosomal protein L13 [Thermotoga sp. RQ2] (149 aa)
Score = 360, Expect = 4.1e-33, Identities = 71/145 (48%), Positives = 102/145 (70%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +QKTT +K E     +KWYV+DAS  +LG+LA   A IL GK+K ++TP+VD GDY+I++N+DK+VL+  K D++ +Y HSGY GGLK  + R M+EK+ ++LI+ A+K MLPKN   R ++K+L +Y    H   AQKP  I+L
  S:     7 VQKTTMIKPEEV--ERKWYVVDASGKVLGRLATRIAKILMGKHKPNYTPHVDTGDYVIVVNADKVVLTGKKLDQKVYYWHSGYPGGLKSLTARQMLEKHPERLIWLAVKRMLPKNRKGRKMLKRLKVYASPEHPHQAQKPEPIEL 149
>gi|38233170|ref|NP_938937.1| 50S ribosomal protein L13 [Corynebacterium diphtheriae NCTC 13129] >gi|81698594|sp|Q6NJ52|RL13_CORDI 50S ribosomal protein L13 >gi|38199429|emb|CAE49073.1| 50S ribosomal protein L13 [Corynebacterium diphtheriae] (147 aa)
Score = 355, Expect = 1.5e-32, Identities = 63/125 (50%), Positives = 93/125 (74%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYVIDA++++LG+LA  AA++LRGK K  F PNVDCGD++I+IN+DK+ +SS+K +RE  Y HSGY GGLK  +    +E + ++++  +I+GM+P N LSR  +KKL ++  + H  AAQKP
  S:    13 RKWYVIDATDVVLGRLATHAADLLRGKGKPQFAPNVDCGDHVIVINADKVHVSSNKREREMRYRHSGYPGGLKTMTLGRSLEVHPERVVEESIRGMMPHNRLSRASVKKLHVFAGSEHPYAAQKP 137
>gi|68264434|emb|CAI37922.1| 50S ribosomal protein L13 [Corynebacterium jeikeium K411] (190 aa)
Score = 355, Expect = 1.8e-32, Identities = 70/129 (54%), Positives = 94/129 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP--MEIK 144
           +KWYVIDA++++LG+LAV AA++LRGK K  F PNVDCGD +IIIN+DK+ +SS+K +RE  Y HSGY GGLK  S    +E + ++++  A+KGM+P N LSR  IKKL ++    H   AQKP   EIK
  S:    56 RKWYVIDATDVVLGRLAVTAADLLRGKKKPYFAPNVDCGDNVIIINADKVHVSSNKREREMRYRHSGYPGGLKTMSLGRSLELHPERVVEEAVKGMMPHNKLSRASIKKLRVFAGPEHTFEAQKPETYEIK 186
>gi|120402478|ref|YP_952307.1| 50S ribosomal protein L13 [Mycobacterium vanbaalenii PYR-1] >gi|166231001|sp|A1T551|RL13_MYCVP 50S ribosomal protein L13 >gi|119955296|gb|ABM12301.1| LSU ribosomal protein L13P [Mycobacterium vanbaalenii PYR-1] (147 aa)
Score = 352, Expect = 3.6e-32, Identities = 69/135 (51%), Positives = 100/135 (74%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           +A    + WYVIDA++++LG+LAVEAA +LRGK+K  FTPNVD GD++I+IN+DKI LS DK +++  Y HSGY GGL+++S   +++K+  +++  AI GMLP N LSR + KKL +Y    H  +AQ+P+  EIK
  S:     7 KAGDTTRTWYVIDATDVVLGRLAVEAAKLLRGKHKPTFTPNVDGGDFVIVINADKIALSGDKLNKKFAYRHSGYPGGLRKRSIGELLQKHPTRVVENAIVGMLPHNKLSRQVQKKLKVYAGPEHPHSAQQPVPFEIK 143
>gi|89332921|dbj|BAE82516.1| 50S ribosomal protein L13 [Desulfitobacterium hafniense Y51] (163 aa)
Score = 352, Expect = 3.7e-32, Identities = 69/140 (49%), Positives = 95/140 (67%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +  T F K  A    +KWYVIDA+ L LG+LA EAA ILRGK+K  FTPNVD GD++IIIN++K+VL+ +K D++ +  HSGY GGLKE   R +++   ++ +  A+KGMLP N L   +  KL +Y+D NH   AQ+P
  S:    20 LMSTFFAKANAV--ERKWYVIDAAGLPLGRLATEAARILRGKHKPTFTPNVDTGDHVIIINAEKVVLTGNKLDQKMYRRHSGYPGGLKETPYRKLMQNMPERAVEHAVKGMLPHNKLGAQMYTKLKVYRDENHPHQAQQP 157
>gi|41410343|ref|NP_963179.1| 50S ribosomal protein L13 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118466515|ref|YP_883521.1| 50S ribosomal protein L13 [Mycobacterium avium 104] >gi|166230996|sp|A0QKT3|RL13_MYCA1 50S ribosomal protein L13 >gi|81700271|sp|Q73S31|RL13_MYCPA 50S ribosomal protein L13 >gi|41399177|gb|AAS06795.1| RplM [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167802|gb|ABK68699.1| ribosomal protein L13 [Mycobacterium avium 104] (147 aa)
Score = 350, Expect = 6.1e-32, Identities = 65/135 (48%), Positives = 97/135 (71%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           +A    + WYVIDA++++LG+LAV AAN+LRGK+K  F PNVD GD++I++N+DK+  S  K D++  Y HSGY GGL+ ++   +++K+ D+++  AI GMLPKN LSR + +KL +Y    H   AQ+P+  EIK
  S:     7 KAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDGGDFVIVVNADKVAFSGQKLDKKLAYRHSGYPGGLRSRTIGELMQKHPDRVVADAIVGMLPKNKLSRQIQRKLRVYAGPEHPHTAQQPIPYEIK 143
>gi|15610579|ref|NP_217960.1| 50S ribosomal protein L13 [Mycobacterium tuberculosis H37Rv] >gi|15843038|ref|NP_338075.1| 50S ribosomal protein L13 [Mycobacterium tuberculosis CDC1551] >gi|31794620|ref|NP_857113.1| 50S ribosomal protein L13 [Mycobacterium bovis AF2122/97] >gi|121639364|ref|YP_979588.1| 50S ribosomal protein L13 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148663308|ref|YP_001284831.1| 50S ribosomal protein L13 [Mycobacterium tuberculosis H37Ra] >gi|148824653|ref|YP_001289407.1| 50S ribosomal protein L13 [Mycobacterium tuberculosis F11] >gi|167966785|ref|ZP_02549062.1| 50S ribosomal protein L13 [Mycobacterium tuberculosis H37Ra] >gi|194542098|ref|YP_002077129.1| 50S ribosomal protein L13 rplM [Mycobacterium tuberculosis C] >gi|166230997|sp|A1KPD0|RL13_MYCBP 50S ribosomal protein L13 >gi|166230999|sp|A5U8B9|RL13_MYCTA 50S ribosomal protein L13 >gi|54039090|sp|P66066|RL13_MYCBO 50S ribosomal protein L13 >gi|54041819|sp|P66065|RL13_MYCTU 50S ribosomal protein L13 >gi|2104364|emb|CAB08692.1| PROBABLE 50S RIBOSOMAL PROTEIN L13 RPLM [Mycobacterium tuberculosis H37Rv] >gi|13883381|gb|AAK47889.1| ribosomal protein L13 [Mycobacterium tuberculosis CDC1551] >gi|31620217|emb|CAD95660.1| PROBABLE 50S RIBOSOMAL PROTEIN L13 RPLM [Mycobacterium bovis AF2122/97] >gi|121495012|emb|CAL73498.1| Probable 50S ribosomal protein L13 rplM [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124599568|gb|EAY58672.1| 50S ribosomal protein L13 rplM [Mycobacterium tuberculosis C] >gi|134151559|gb|EBA43604.1| 50S ribosomal protein L13 rplM [Mycobacterium tuberculosis str. Haarlem] >gi|148507460|gb|ABQ75269.1| 50S ribosomal protein L13 [Mycobacterium tuberculosis H37Ra] >gi|148723180|gb|ABR07805.1| 50S ribosomal protein L13 rplM [Mycobacterium tuberculosis F11] (147 aa)
Score = 350, Expect = 7.0e-32, Identities = 63/136 (46%), Positives = 97/136 (71%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +A    + WYVIDA++++LG+LAV AAN+LRGK+K  F PNVD GD++I+IN+DK+ +S DK   +  Y HSGY GGL +++   +++++ D+++  AI GMLPKN LSR + +KL +Y    H  +AQ+P+  +L
  S:     7 KAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKLQHKMVYRHSGYPGGLHKRTIGELMQRHPDRVVEKAILGMLPKNRLSRQIQRKLRVYAGPEHPHSAQQPVPYEL 142
>gi|109648979|ref|ZP_01372878.1| ribosomal protein L13 [Desulfitobacterium hafniense DCB-2] >gi|109640276|gb|EAT49832.1| ribosomal protein L13 [Desulfitobacterium hafniense DCB-2] (143 aa)
Score = 349, Expect = 8.9e-32, Identities = 69/137 (50%), Positives = 94/137 (68%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           T F K  A    +KWYVIDA+ L LG+LA EAA ILRGK+K  FTPNVD GD++IIIN++K+VL+ +K D++ +  HSGY GGLKE   R +++   ++ +  A+KGMLP N L   +  KL +Y+D NH   AQ+P
  S:     3 TFFAKANAV--ERKWYVIDAAGLPLGRLATEAARILRGKHKPTFTPNVDTGDHVIIINAEKVVLTGNKLDQKMYRRHSGYPGGLKETPYRKLMQNMPERAVEHAVKGMLPHNKLGAQMYTKLKVYRDENHPHQAQQP 137
>gi|108768521|gb|ABG07243.1| LSU ribosomal protein L13P [Mycobacterium sp. MCS] >gi|119693287|gb|ABL90360.1| LSU ribosomal protein L13P [Mycobacterium sp. KMS] >gi|126233560|gb|ABN96960.1| LSU ribosomal protein L13P [Mycobacterium sp. JLS] (153 aa)
Score = 344, Expect = 3.2e-31, Identities = 70/135 (51%), Positives = 99/135 (73%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           +A    + WYVIDA++++LG+LAVEAA +LRGK+K  FTPNVD GD++I+IN++KI +S DK + +  Y HSGY GGL+ ++ G L+I K+  +++  AI GMLP   LSR + KKL +Y   NH  AAQ+P+  EIK
  S:    13 KAGDTTRSWYVIDATDVVLGRLAVEAAKLLRGKHKPTFTPNVDGGDFVIVINAEKIAVSGDKLNNKYAYRHSGYPGGLRRRTIGELLI-KHPTRVVENAIVGMLPHTKLSRQVQKKLKVYAGPNHPHAAQQPIPFEIK 149
>gi|15827097|ref|NP_301360.1| 50S ribosomal protein L13 [Mycobacterium leprae TN] >gi|585864|sp|P38014|RL13_MYCLE 50S ribosomal protein L13 >gi|467123|gb|AAA17305.1| rplM; large ribosomal subunit protein L13; B229_C3_232 [Mycobacterium leprae] >gi|13092645|emb|CAC29872.1| 50S ribosomal protein L13 [Mycobacterium leprae] (147 aa)
Score = 343, Expect = 4.4e-31, Identities = 63/127 (49%), Positives = 95/127 (74%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           WYVIDA++++LG+LA  AA +LRGK+K  F PNVD GD++I+IN+DK+ +S DK   +  Y HSGY GGL++++   +++K+ D+++  AI GMLPKN LSR + +KL +Y   +H  +AQ+P+  EIK
  S:    15 WYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRVVEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIK 143
>gi|84494733|ref|ZP_00993852.1| 50S ribosomal protein L13 [Janibacter sp. HTCC2649] >gi|84384226|gb|EAQ00106.1| 50S ribosomal protein L13 [Janibacter sp. HTCC2649] (147 aa)
Score = 342, Expect = 6.0e-31, Identities = 61/128 (47%), Positives = 95/128 (74%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ--KPMEI 143
           + W++IDA++++LG+LAV+ A +LRGK+K  F P+VD GD++IIIN++K+ L+  KA++++ Y HSG+ GGL+ ++   M+EKY +K +  A++GMLP+ TL R  + KL +Y  A H  AAQ  KP EI
  S:    13 RTWHIIDATDVVLGRLAVQTATLLRGKHKPTFAPHVDGGDFVIIINAEKVALTGAKAEQKRAYRHSGFPGGLRSRNYVEMLEKYPEKAVEKAVRGMLPRTTLGRQQLTKLKVYAGAEHPHAAQQPKPFEI 142
>gi|25027142|ref|NP_737196.1| 50S ribosomal protein L13 [Corynebacterium efficiens YS-314] >gi|81750149|sp|Q8FS20|RL13_COREF 50S ribosomal protein L13 >gi|23492423|dbj|BAC17396.1| putative 50S ribosomal protein L13 [Corynebacterium efficiens YS-314] (147 aa)
Score = 340, Expect = 9.7e-31, Identities = 65/129 (50%), Positives = 94/129 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP--MEIK 144
           +KWYVIDA++++LG+LA  AA++LRGK K  F PNVDCGD++IIIN+DK+ ++S+K DRE  Y HSGY GGLK  +    +E + ++++  +I GM+P N L+   +KKL ++  + H  AAQKP   EIK
  S:    13 RKWYVIDATDVVLGRLATHAADLLRGKGKPLFAPNVDCGDHVIIINADKVAITSNKRDREMRYRHSGYPGGLKSMTLGRSLELHPERVLEESITGMMPHNKLTAASVKKLHVFAGSEHPYAAQKPETYEIK 143
>gi|145225526|ref|YP_001136204.1| 50S ribosomal protein L13 [Mycobacterium gilvum PYR-GCK] >gi|189041010|sp|A4TEL3|RL13_MYCGI 50S ribosomal protein L13 >gi|145218012|gb|ABP47416.1| LSU ribosomal protein L13P [Mycobacterium gilvum PYR-GCK] (147 aa)
Score = 338, Expect = 1.5e-30, Identities = 67/135 (49%), Positives = 96/135 (71%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           +A    + WYVIDA++++LG+LAVEAA +LRGK+K  FTPNVD GD++IIIN+DKI LS DK  ++  Y+HSGY GGL++++   ++ K+  +++  AI GMLP   L R + KKL +Y    H   AQ+P+  EIK
  S:     7 KAGDTTRSWYVIDATDVVLGRLAVEAAKLLRGKHKPTFTPNVDGGDFVIIINADKISLSGDKLTKKFAYSHSGYPGGLRKRAIGDLLAKHPTRVVENAITGMLPHTKLGRQIQKKLKVYAGPEHPHTAQQPVPFEIK 143
>gi|15828966|ref|NP_326326.1| 50S ribosomal protein L13 [Mycoplasma pulmonis UAB CTIP] >gi|75544401|sp|Q98Q73|RL13_MYCPU 50S ribosomal protein L13 >gi|14089909|emb|CAC13668.1| 50S RIBOSOMAL PROTEIN L13 [Mycoplasma pulmonis] (144 aa)
Score = 336, Expect = 2.7e-30, Identities = 69/145 (47%), Positives = 103/145 (71%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M++TT VK++    NKKW++IDA  ++LGKLA   A+ILRGKNK DFTPNVD GD ++IIN++K+VL+++K + +K+Y+HSGY GGLK  +   +  K    ++  A+KGMLP   L R   + L++Y  + HKQ AQ+P+ I++
  S:     1 MRQTTIVKHKEV--NKKWFLIDADGVVLGKLATLTASILRGKNKPDFTPNVDMGDNIVIINAEKVVLTANKEEDKKYYSHSGYPGGLKVINAAKLRAKKPIAIVEKAVKGMLPHTKLGRQQFRNLYVYAGSVHKQEAQQPVRIEV 143
>gi|134298134|ref|YP_001111630.1| 50S ribosomal protein L13 [Desulfotomaculum reducens MI-1] >gi|189041002|sp|A4J152|RL13_DESRM 50S ribosomal protein L13 >gi|134050834|gb|ABO48805.1| LSU ribosomal protein L13P [Desulfotomaculum reducens MI-1] (143 aa)
Score = 334, Expect = 4.9e-30, Identities = 70/138 (50%), Positives = 93/138 (67%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KTTF+   A +  +KWYVIDA    LG++A EAA ILRGK+   FTP+VD GD++I+IN+DK++L+  K D++ +  HSGY GGLKE S R M+EK  + ++  AIKGMLP N L     KKL +Y  + H   AQKP
  S:     2 KTTFMAKPADV-QRKWYVIDAEGKPLGRVAAEAARILRGKHTPMFTPHVDTGDHVIVINADKVILTGKKLDQKMYTRHSGYPGGLKEFSYRTMMEKRPELIVEKAIKGMLPHNRLGAQQFKKLKVYVGSEHSHEAQKP 138
>gi|114777705|ref|ZP_01452665.1| 50S ribosomal protein L13 [Mariprofundus ferrooxydans PV-1] >gi|114551921|gb|EAU54455.1| 50S ribosomal protein L13 [Mariprofundus ferrooxydans PV-1] (143 aa)
Score = 333, Expect = 5.4e-30, Identities = 55/131 (41%), Positives = 95/131 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +KWY++DA++L+LG+LA E A +LRGK++ ++TP+ DCGD++++IN++KI ++ +K   + +Y H+G++G LK  +      K+ +++I  A+KGM+PK  L R ++KKL +Y   +H  AAQ+P  +KLN
  S:    13 RKWYIVDATDLVLGRLATEIATVLRGKHRPEYTPHADCGDHIVVINAEKIRVTGNKEQAKIYYHHTGFVGSLKSITLEKQRAKHPERIIESAVKGMMPKGPLGRSMLKKLKVYAGGDHPHAAQQPEAMKLN 143
>gi|111023133|ref|YP_706105.1| 50S ribosomal protein L13 [Rhodococcus sp. RHA1] >gi|122955184|sp|Q0S3D9|RL13_RHOSR 50S ribosomal protein L13 >gi|110822663|gb|ABG97947.1| 50S ribosomal protein L13 [Rhodococcus sp. RHA1] (147 aa)
Score = 333, Expect = 5.9e-30, Identities = 65/135 (48%), Positives = 98/135 (72%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           +A    + W+VIDA++++LG+LAV+AAN+LRGK+K  F P+VD GD+++IIN++K+ +S +K + +  Y HSG+ GGLK +S   +++K  D+L+  AI GMLPKN L R +  KL +Y   NH  AAQ+P+  EIK
  S:     7 KAGDVTRTWHVIDATDVVLGRLAVQAANLLRGKHKPTFAPHVDGGDFVVIINAEKVAISGNKREGKFLYHHSGHPGGLKSRSVGEVLDKNPDRLVEKAIVGMLPKNKLGRAISSKLKVYAGPNHPHAAQQPVPFEIK 143
>gi|47093537|ref|ZP_00231298.1| ribosomal protein L13 [Listeria monocytogenes str. 4b H7858] >gi|153204248|ref|ZP_01945045.1| ribosomal protein L13 [Listeria monocytogenes HPB2262] >gi|47018097|gb|EAL08869.1| ribosomal protein L13 [Listeria monocytogenes str. 4b H7858] >gi|133734028|gb|EBA35726.1| ribosomal protein L13 [Listeria monocytogenes HPB2262] (145 aa)
Score = 333, Expect = 5.9e-30, Identities = 68/138 (49%), Positives = 95/138 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT++     +  +KWYVIDA+ + LG+L+ E A+ILRGKNK  FTP++D GD++IIIN+ KI L+  KA  + +Y HS Y GGLK ++   M     +KL+  +IKGMLPKN+L R L KKL +Y  A H+ AAQ+P
  S:     2 RTTYMAKPGEV-ERKWYVIDATGVSLGRLSSEVASILRGKNKPQFTPHIDTGDFVIIINAGKIGLTGKKATDKIYYRHSQYPGGLKSRTAGEMRTNNPEKLLELSIKGMLPKNSLGRQLFKKLHVYGGAEHEHAAQQP 138
>gi|114567806|ref|YP_754960.1| 50S ribosomal protein L13 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|118573459|sp|Q0AUL5|RL13_SYNWW 50S ribosomal protein L13 >gi|114338741|gb|ABI69589.1| LSU ribosomal protein L13P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (144 aa)
Score = 333, Expect = 6.2e-30, Identities = 67/136 (49%), Positives = 97/136 (71%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           T+V   A + ++KWYVIDAS+  LG+L+ E A+ILRGK+K  FTP+VD GD++I+IN+ KI L+ DK +++K+  H+GY GGL+E   R +++K  +K I  A++GMLP N L R +IKKL +Y  + H   AQKP
  S:     3 TYVAKPAEV-DRKWYVIDASDKTLGRLSSEVASILRGKHKPIFTPHVDTGDFVIVINAAKIKLTGDKLNQKKFRHHTGYPGGLREMDYRTLLQKRPEKAIEAAVQGMLPHNRLGRSMIKKLKVYSGSEHPHQAQKP 137
>gi|172056173|ref|YP_001812633.1| ribosomal protein L13 [Exiguobacterium sibiricum 255-15] >gi|171988694|gb|ACB59616.1| ribosomal protein L13 [Exiguobacterium sibiricum 255-15] (145 aa)
Score = 332, Expect = 7.6e-30, Identities = 64/138 (46%), Positives = 96/138 (69%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TTF+  +A    +KW +IDA    LG+L+ E A++LRGK+K  FTP+VDCGD++I+IN +KIVL+ +K D++ +Y HSG+ GGLK+   R ++    ++++  AIKGMLPK +L R +  KL +Y    HKQ AQ+P
  S:     2 RTTFMA-KATDVERKWLLIDAEGKTLGRLSSEVASLLRGKHKPTFTPHVDCGDHVILINVEKIVLTGNKLDKKVYYRHSGHPGGLKQTVARDLLANKPERMLELAIKGMLPKGSLGRQMFNKLHVYAGDTHKQEAQQP 138
>gi|16801807|ref|NP_472075.1| 50S ribosomal protein L13 [Listeria innocua Clip11262] >gi|81774196|sp|Q927P2|RL13_LISIN 50S ribosomal protein L13 >gi|16415282|emb|CAC97972.1| ribosomal protein L13 [Listeria innocua] (145 aa)
Score = 332, Expect = 8.6e-30, Identities = 68/138 (49%), Positives = 95/138 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT++     +  +KWYVIDA+ + LG+L+ E A+ILRGKNK  FTP++D GD++IIIN+ KI L+  KA  + +Y HS Y GGLK ++   M     +KL+  +IKGMLPKN+L R L KKL +Y  + H+ AAQKP
  S:     2 RTTYMAKPGEV-ERKWYVIDATGVSLGRLSSEVASILRGKNKPQFTPHIDTGDFVIIINAGKIGLTGKKATDKIYYRHSQYPGGLKSRTAGEMRTNNPEKLLELSIKGMLPKNSLGRQLFKKLHVYGGSEHEHAAQKP 138
>gi|90962374|ref|YP_536290.1| 50S ribosomal protein L13 [Lactobacillus salivarius UCC118] >gi|118573408|sp|Q1WSC2|RL13_LACS1 50S ribosomal protein L13 >gi|90821568|gb|ABE00207.1| LSU ribosomal protein L13P [Lactobacillus salivarius UCC118] (147 aa)
Score = 331, Expect = 9.2e-30, Identities = 66/144 (45%), Positives = 99/144 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +TT++     +  +KWYV+DA+++ LG+L+   A+ILRGKNK  FTPNVD GDY+I+IN++K+ L+  KA  + +Y HS + GGLK ++     EK  +KL+  ++KGMLPK TL R   KKL +Y+ A+HK  AQ+P  + +N
  S:     2 RTTYIAKPGEV-ERKWYVVDATDVPLGRLSSAVASILRGKNKPTFTPNVDTGDYVIVINAEKVALTGRKASNKVYYHHSNHPGGLKARTAGDYREKDPEKLLALSVKGMLPKGTLGRQQAKKLHVYRGADHKHEAQQPEVLDIN 144
>gi|33864025|ref|NP_895585.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. MIT 9313] >gi|124024022|ref|YP_001018329.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. MIT 9303] >gi|166231011|sp|A2CC54|RL13_PROM3 50S ribosomal protein L13 >gi|81712662|sp|Q7V521|RL13_PROMM 50S ribosomal protein L13 >gi|33635609|emb|CAE21933.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. MIT 9313] >gi|123964308|gb|ABM79064.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. MIT 9303] (150 aa)
Score = 330, Expect = 1.3e-29, Identities = 55/131 (41%), Positives = 95/131 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           ++W+++DA N  LG+LA E A++LRGKNK  FTP++D GD+++++N+DKI +S +KA+++ +  HSG  GG+K ++ + + ++  ++++  AIKGMLP N L R L +KL +Y+   H  +AQ+P  ++LN
  S:    14 RQWFLVDAENQTLGRLATEVASVLRGKNKPSFTPHLDTGDFVVVVNADKIRVSGNKANQKLYRRHSGRPGGMKVETFQALQDRLPERIVEKAIKGMLPHNALGRQLFRKLKVYRGPEHPHSAQRPQTLQLN 144
>gi|16804635|ref|NP_466120.1| 50S ribosomal protein L13 [Listeria monocytogenes EGD-e] >gi|46908769|ref|YP_015158.1| 50S ribosomal protein L13 [Listeria monocytogenes str. 4b F2365] >gi|116873963|ref|YP_850744.1| 50S ribosomal protein L13 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153168762|ref|ZP_01928523.1| ribosomal protein L13 [Listeria monocytogenes FSL N1-017] >gi|153175902|ref|ZP_01931161.1| ribosomal protein L13 [Listeria monocytogenes FSL N3-165] >gi|153180761|ref|ZP_01933757.1| ribosomal protein L13 [Listeria monocytogenes F6900] >gi|153185646|ref|ZP_01936196.1| ribosomal protein L13 [Listeria monocytogenes J0161] >gi|153192353|ref|ZP_01939345.1| ribosomal protein L13 [Listeria monocytogenes J2818] >gi|153197625|ref|ZP_01941852.1| ribosomal protein L13 [Listeria monocytogenes 10403S] >gi|167015696|ref|ZP_02278229.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL J1-194] >gi|167058673|ref|ZP_02280930.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL F2-515] >gi|167213221|ref|ZP_02283528.1| 50S ribosomal protein L13 [Listeria monocytogenes LO28] >gi|167215264|ref|ZP_02285571.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL R2-503] >gi|167218393|ref|ZP_02288029.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL J1-175] >gi|167344692|ref|ZP_02290533.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL J1-208] >gi|167405413|ref|ZP_02310169.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL J2-003] >gi|167455065|ref|ZP_02321288.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL J2-064] >gi|168266815|ref|ZP_02688780.1| 50S ribosomal protein L13 [Listeria monocytogenes FSL J2-071] >gi|123461445|sp|A0ALT3|RL13_LISW6 50S ribosomal protein L13 >gi|81698739|sp|Q71WI1|RL13_LISMF 50S ribosomal protein L13 >gi|81768739|sp|Q8Y458|RL13_LISMO 50S ribosomal protein L13 >gi|16412085|emb|CAD00675.1| ribosomal protein L13 [Listeria monocytogenes] >gi|46882042|gb|AAT05335.1| ribosomal protein L13 [Listeria monocytogenes str. 4b F2365] >gi|116742841|emb|CAK21965.1| rplM [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126941782|gb|EBA19661.1| ribosomal protein L13 [Listeria monocytogenes J0161] >gi|127632798|gb|EBA22232.1| ribosomal protein L13 [Listeria monocytogenes 10403S] >gi|127763857|gb|EBA24675.1| ribosomal protein L13 [Listeria monocytogenes J2818] >gi|133725996|gb|EBA27694.1| ribosomal protein L13 [Listeria monocytogenes FSL N1-017] >gi|133728615|gb|EBA30313.1| ribosomal protein L13 [Listeria monocytogenes FSL N3-165] >gi|133731708|gb|EBA33406.1| ribosomal protein L13 [Listeria monocytogenes F6900] (145 aa)
Score = 330, Expect = 1.3e-29, Identities = 67/138 (48%), Positives = 95/138 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT++     +  +KWYVIDA+ + LG+L+ E A+ILRGKNK  FTP++D GD++IIIN+ KI L+  KA  + +Y HS Y GGLK ++   M     +KL+  +IKGMLPKN+L R L KKL +Y  + H+ AAQ+P
  S:     2 RTTYMAKPGEV-ERKWYVIDATGVSLGRLSSEVASILRGKNKPQFTPHIDTGDFVIIINAGKIGLTGKKATDKIYYRHSQYPGGLKSRTAGEMRTNNPEKLLELSIKGMLPKNSLGRQLFKKLHVYGGSEHEHAAQQP 138
>gi|83648542|ref|YP_436977.1| 50S ribosomal protein L13 [Hahella chejuensis KCTC 2396] >gi|118573406|sp|Q2S9X2|RL13_HAHCH 50S ribosomal protein L13 >gi|83636585|gb|ABC32552.1| ribosomal protein L13 [Hahella chejuensis KCTC 2396] (142 aa)
Score = 329, Expect = 1.6e-29, Identities = 62/143 (43%), Positives = 99/143 (69%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KT   K E     + WYVIDA++  LG+L+ E A  LRGK+K ++TP+VD GDY++++N++K+ ++ +KA  + +Y H+GY GGLKE S   +I+   +++I  A+KGM+P+N L R ++KKL +Y  A H   AQ+P+E+K+
  S:     2 KTISAKPETV--KRDWYVIDATDKTLGRLSTEIARRLRGKHKAEYTPHVDTGDYIVVVNAEKVRVTGNKAQDKMYYRHTGYPGGLKEMSFDKLIQHAPERVIETAVKGMMPRNPLGRAMLKKLKVYASAEHPHTAQQPIELKI 142
>gi|118581489|ref|YP_902739.1| 50S ribosomal protein L13 [Pelobacter propionicus DSM 2379] >gi|166982781|sp|A1ATL1|RL13_PELPD 50S ribosomal protein L13 >gi|118504199|gb|ABL00682.1| LSU ribosomal protein L13P [Pelobacter propionicus DSM 2379] (142 aa)
Score = 329, Expect = 1.6e-29, Identities = 64/130 (49%), Positives = 96/130 (73%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WY++DA  ++LG+LA + ANILRGKNK  +TP+VD GD++I++N++KI L+  K   + +Y+HSG+ GGLKE S   ++EK  ++LI  A+KGMLPKN LSR+++KKL IY  ++H   AQ+P  + L
  S:    13 RDWYLVDAQEMVLGRLASQIANILRGKNKAIYTPSVDTGDFVIVVNAEKIALTGRKLADKSYYSHSGFPGGLKEISAGKLLEKKPEELIKRAVKGMLPKNKLSRHMLKKLKIYAGSSHPHDAQQPKVLAL 142
>gi|88807911|ref|ZP_01123422.1| 50S ribosomal protein L13 [Synechococcus sp. WH 7805] >gi|88787950|gb|EAR19106.1| 50S ribosomal protein L13 [Synechococcus sp. WH 7805] (150 aa)
Score = 329, Expect = 1.7e-29, Identities = 57/132 (43%), Positives = 94/132 (71%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++WY++DA N  LG+LA E A++LRGKNK  FTP++D GD+++++N+DKI +S +K  ++ +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R + +KL +YK A H  AAQ+P  ++L+
  S:    13 DRQWYLVDAENQTLGRLATEVASVLRGKNKASFTPHLDTGDFVVVVNADKIRVSGNKPQQKLYRRHSGRPGGMKVETFAHLQERLPERIVEKAIKGMLPHNALGRQMFRKLKVYKGAEHPHAAQQPKPLQLD 144
>gi|56418674|ref|YP_145992.1| 50S ribosomal protein L13 [Geobacillus kaustophilus HTA426] >gi|81675958|sp|Q5L3Q6|RL13_GEOKA 50S ribosomal protein L13 >gi|56378516|dbj|BAD74424.1| 50S ribosomal protein L13 [Geobacillus kaustophilus HTA426] (145 aa)
Score = 329, Expect = 1.9e-29, Identities = 60/125 (48%), Positives = 88/125 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYV+DA+   LG+LA E A +LRGK+K  FTP+VDCGD++I+IN+DK+ L+  K  ++ +Y HS Y GGLK ++   M   Y +++I  A++GMLPK +L R + KKL +Y+ + H   AQKP
  S:    14 RKWYVVDAAGKTLGRLASEVAALLRGKHKPTFTPHVDCGDHVIVINADKVELTGKKLTKKLYYRHSLYPGGLKVRTALEMRTNYPEQMIERAVRGMLPKGSLGRQMFKKLHVYRGSEHPHQAQKP 138
>gi|158319578|ref|YP_001512085.1| 50S ribosomal protein L13 [Alkaliphilus oremlandii OhILAs] >gi|166982411|sp|A8MLH5|RL13_ALKOO 50S ribosomal protein L13 >gi|158139777|gb|ABW18089.1| ribosomal protein L13 [Alkaliphilus oremlandii OhILAs] (143 aa)
Score = 328, Expect = 2.0e-29, Identities = 59/130 (45%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KWYV+DA    LG+L+ E A ILRGKNK +FTP+VD GD++I++N++K+ L+  K D+  +  H+G+ GGL++ S R ++ +  + L+Y A+KGMLPK  L R ++ KL +Y   NHK  AQ+P  ++L
  S:    13 RKWYVVDAEGKTLGRLSSEIATILRGKNKPEFTPHVDTGDFVIVVNAEKVALTGKKLDQSFYTYHTGHPGGLRQVSFRRLLAEKPESLVYNAVKGMLPKTRLGRQMLTKLKVYAGPNHKHEAQQPEALEL 142
>gi|88856974|ref|ZP_01131624.1| 50S ribosomal protein L13 [marine actinobacterium PHSC20C1] >gi|88813791|gb|EAR23663.1| 50S ribosomal protein L13 [marine actinobacterium PHSC20C1] (148 aa)
Score = 327, Expect = 2.7e-29, Identities = 61/131 (46%), Positives = 91/131 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           ++W +IDA++++LG+LA  AA +LRGK+K  F P++D GD++IIIN++K+ L+  K  ++K Y HSGY GGL   +   M+EK+  + +  AI+GMLPKN+L R  + KL +Y  A H  AAQ+PM   LN
  S:    14 REWVIIDATDIVLGRLASHAAILLRGKHKATFAPHMDMGDFVIIINAEKVALTGSKLAQKKAYRHSGYPGGLTATTYSEMLEKHPTRAVEKAIRGMLPKNSLGRAQLTKLKVYAGAEHPHAAQQPMPYTLN 144
>gi|87300887|ref|ZP_01083729.1| 50S ribosomal protein L13 [Synechococcus sp. WH 5701] >gi|87284758|gb|EAQ76710.1| 50S ribosomal protein L13 [Synechococcus sp. WH 5701] (150 aa)
Score = 327, Expect = 2.7e-29, Identities = 59/132 (44%), Positives = 93/132 (70%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++W+++DA N  LG+LA E A++LRGKNK  FTP++D GD+++IIN+DKI +S +KA ++ +  HSG  GG+K ++   +  +  ++++  AIKGMLP N L R L +KL +YK A H  AAQ+P  + L+
  S:    13 DRQWFLVDAENQTLGRLASEVASVLRGKNKPTFTPHLDTGDFVVIINADKIRISGNKASQKIYRRHSGRPGGMKTETFEALQARLPERIVEKAIKGMLPHNALGRQLFRKLKVYKGAEHPHAAQQPQVLALD 144
>gi|94987001|ref|YP_594934.1| 50S ribosomal protein L13 [Lawsonia intracellularis PHE/MN1-00] >gi|118573410|sp|Q1MQW4|RL13_LAWIP 50S ribosomal protein L13 >gi|94731250|emb|CAJ54613.1| ribosomal protein L13 [Lawsonia intracellularis PHE/MN1-00] (144 aa)
Score = 327, Expect = 2.8e-29, Identities = 55/129 (42%), Positives = 96/129 (74%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +W+++DA N ILG+LA + A+ LRGK+K +F P++D GDY++++N ++I ++ +K +++K+Y HSGY+GGLKE + + ++EK   +++  A++GMLPKN L R ++KKL +Y    H+  AQ+P+ + L
  S:    14 QWFLVDAHNKILGRLAAQIAHRLRGKHKPEFAPHIDNGDYIVVVNCEQIKVTGNKQEQKKYYRHSGYVGGLKETTLKTLLEKKPAEVLIHAVRGMLPKNRLGRAMLKKLKVYAGPEHQHIAQQPIPLSL 142
>gi|89210522|ref|ZP_01188910.1| Ribosomal protein L13, bacterial and organelle form [Halothermothrix orenii H 168] >gi|89159784|gb|EAR79444.1| Ribosomal protein L13, bacterial and organelle form [Halothermothrix orenii H 168] (144 aa)
Score = 327, Expect = 2.8e-29, Identities = 62/130 (47%), Positives = 95/130 (73%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYV+DA++ +LG+LA + A ILRGK+K  FTP+VD GDY+I++N+DK+ L+  K +++K+Y HSGY GGLKE S   +++   + +I  A++GMLP N L R +IKKL +Y   +H   AQKP +++L
  S:    15 RQWYVVDATDKVLGRLATKIAEILRGKHKPTFTPHVDTGDYVIVVNADKVKLTGRKWEQKKYYRHSGYPGGLKEMSYEKLLQTKPELIIEKAVRGMLPHNRLGRKMIKKLKVYAGPDHPHEAQKPEKLEL 144
>gi|116075741|ref|ZP_01473000.1| 50S ribosomal protein L13 [Synechococcus sp. RS9916] >gi|116067056|gb|EAU72811.1| 50S ribosomal protein L13 [Synechococcus sp. RS9916] (168 aa)
Score = 327, Expect = 3.1e-29, Identities = 56/132 (42%), Positives = 94/132 (71%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++WY++DA N  LG+LA E A++LRGKNK  +TP++D GD+++++N+DKI +S  K+ ++ +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R L +KL +YK + H  AAQ+P  ++L+
  S:    31 DRQWYLVDAENQTLGRLATEVASVLRGKNKATYTPHLDTGDFVVVVNADKIRVSGSKSQQKLYRRHSGRPGGMKVETFEHLQERLPERIVEKAIKGMLPHNALGRQLFRKLKVYKGSEHPHAAQQPKPLQLD 162
>gi|28377871|ref|NP_784763.1| 50S ribosomal protein L13 [Lactobacillus plantarum WCFS1] >gi|81733727|sp|Q88XU8|RL13_LACPL 50S ribosomal protein L13 >gi|28270704|emb|CAD63610.1| ribosomal protein L13 [Lactobacillus plantarum WCFS1] (147 aa)
Score = 326, Expect = 3.4e-29, Identities = 64/138 (46%), Positives = 94/138 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT++     + ++KWYV+DA+++ LG+L+   A+ILRGKNK  FTPNVD GD +I+IN+ K+ L+  KA+R+ +Y H+ Y GGLKE++    + K   KLI  ++KGMLP N+L   +  KL +Y  A H Q AQKP
  S:     2 RTTYMAKPGEI-DRKWYVVDATDVPLGRLSTVVASILRGKNKPTFTPNVDTGDNVIVINASKVALTGKKAERKIYYHHTAYAGGLKERTAGDFLAKEPTKLIETSVKGMLPHNSLGHKMGLKLHVYAGAEHTQQAQKP 138
>gi|113954140|ref|YP_729641.1| 50S ribosomal protein L13 [Synechococcus sp. CC9311] >gi|123327986|sp|Q0ID31|RL13_SYNS3 50S ribosomal protein L13 >gi|113881491|gb|ABI46449.1| ribosomal protein L13 [Synechococcus sp. CC9311] (150 aa)
Score = 326, Expect = 3.9e-29, Identities = 58/132 (43%), Positives = 92/132 (69%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++WY++DA N  LG+LA E A++LRGKNK  FTP++D GD++I++N+DKI +S  K  ++ +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R L +KL +YK   H  AAQ+P  ++L+
  S:    13 DRQWYLVDAENQTLGRLATEVASVLRGKNKASFTPHLDTGDFVIVVNADKIRVSGKKPQQKLYRRHSGRPGGMKVETFEHLQERLPERIVEKAIKGMLPHNALGRQLFRKLKVYKGTEHPHAAQQPKTLQLD 144
>gi|159901454|ref|YP_001547701.1| 50S ribosomal protein L13 [Herpetosiphon aurantiacus ATCC 23779] >gi|159894493|gb|ABX07573.1| ribosomal protein L13 [Herpetosiphon aurantiacus ATCC 23779] (144 aa)
Score = 326, Expect = 4.0e-29, Identities = 56/131 (42%), Positives = 99/131 (75%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +A+   ++W V+DA N +LG+LA + A ++RGK+K  +TP++D GD++I++N++KI ++ DKA+++ +Y HS + GGLK  + ++M++ + +++IY A+KGMLP+N LSR++IKKL +Y   +H  A+Q P
  S:     7 KASEIQREWLVVDAQNQVLGRLATQIATLIRGKHKPTYTPSMDGGDFVIVVNAEKIRVTGDKANQKIYYRHSNFPGGLKRTAYKVMMQTHPERIIYFAVKGMLPRNRLSRHIIKKLKVYAGESHPHASQSP 137
>gi|46580922|ref|YP_011730.1| 50S ribosomal protein L13 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120601776|ref|YP_966176.1| 50S ribosomal protein L13 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166230980|sp|A1VBD3|RL13_DESVV 50S ribosomal protein L13 >gi|81699027|sp|Q728T4|RL13_DESVH 50S ribosomal protein L13 >gi|46450342|gb|AAS96990.1| ribosomal protein L13 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562005|gb|ABM27749.1| LSU ribosomal protein L13P [Desulfovibrio vulgaris subsp. vulgaris DP4] (144 aa)
Score = 325, Expect = 4.4e-29, Identities = 55/131 (41%), Positives = 95/131 (72%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           N++W+V+DA + ILG+LA + A+ LRGK+K +F P++D GD+++++N +KI ++  K D++K+Y HSGY+GGL+E S   ++    ++++  A++GMLP+N L R ++ KL +Y+   H  AAQKP  ++L
  S:    12 NREWFVVDAEDKILGRLATQIAHRLRGKHKPEFAPHMDNGDFIVVVNCEKIKVTGKKLDQKKYYNHSGYVGGLRETSLEKLLASKPEEVLLKAVRGMLPRNRLGRAMLTKLKVYRGTEHPHAAQKPTPLEL 142
>gi|87124989|ref|ZP_01080836.1| 50S ribosomal protein L13 [Synechococcus sp. RS9917] >gi|86167309|gb|EAQ68569.1| 50S ribosomal protein L13 [Synechococcus sp. RS9917] (150 aa)
Score = 325, Expect = 4.5e-29, Identities = 58/132 (43%), Positives = 93/132 (70%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++WY++DA N  LG+LA E A++LRGKNK  +TP++D GD++I++N+DKI +S +KA  + +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R L +KL +Y+ A H  AAQ+P  + L+
  S:    13 DRQWYLVDAENQTLGRLATEVASVLRGKNKASYTPHLDTGDFVIVVNADKIRVSGNKAQDKLYRRHSGRPGGMKVETFAHLQERLPERIVEKAIKGMLPHNALGRQLFRKLKVYRGAEHPHAAQQPKPLALD 144
>gi|23097606|ref|NP_691072.1| 50S ribosomal protein L13 [Oceanobacillus iheyensis HTE831] >gi|81747261|sp|Q8ETV4|RL13_OCEIH 50S ribosomal protein L13 >gi|22775829|dbj|BAC12107.1| 50S ribosomal protein L13 [Oceanobacillus iheyensis HTE831] (145 aa)
Score = 325, Expect = 5.0e-29, Identities = 67/138 (48%), Positives = 95/138 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TTF+ NEA +  +KW V+DA    LG+LA E A+ILRGK+K  +TP+ D GD +IIIN+DKI L+ +K + + +Y HS + GGLKE++   M  KY ++++  A+KGMLPK  L R + KKL +Y+ A H   AQKP
  S:     2 RTTFMANEANI-ERKWLVVDAEGQRLGRLASEVASILRGKHKATYTPHADTGDNVIIINADKIELTGNKINDKMYYRHSNHPGGLKERNAYEMRTKYPEQMLEIAVKGMLPKGPLGRKMGKKLHVYRGAEHNHQAQKP 138
>gi|119715134|ref|YP_922099.1| 50S ribosomal protein L13 [Nocardioides sp. JS614] >gi|166231004|sp|A1SF27|RL13_NOCSJ 50S ribosomal protein L13 >gi|119535795|gb|ABL80412.1| LSU ribosomal protein L13P [Nocardioides sp. JS614] (147 aa)
Score = 325, Expect = 5.3e-29, Identities = 66/129 (51%), Positives = 91/129 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQK--PMEIK 144
           ++W VIDA++++LG+LAV+ AN+LRGK+K  F P+VD GD++II+N++K+ LS DKA  +  Y HSGY GGL       ++EK + K I  A+ GMLPKN L R ++KKL +Y   NH   AQK  P EIK
  S:    13 REWLVIDATDVVLGRLAVQTANLLRGKHKAIFAPHVDTGDFVIIVNAEKVALSGDKATTKMAYRHSGYPGGLTATPIGEILEKDARKAIEKAVWGMLPKNKLGRQMLKKLKVYSGPNHPHQAQKATPFEIK 143
>gi|117648013|gb|ABK52115.1| LSU ribosomal protein L13P [Acidothermus cellulolyticus 11B] (172 aa)
Score = 324, Expect = 5.7e-29, Identities = 56/130 (43%), Positives = 90/130 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++W+VIDA  ++LG+LA + A +LRGK+K  F P+VD GD++I++N+DK+VL+  K D++  Y HSGY GGLK    R ++ ++ +++I  A++GMLP N+L R + KKL +Y    H   AQ+P   ++
  S:    38 RRWHVIDADGVVLGRLAAQVARLLRGKHKPIFAPHVDTGDFVIVVNADKVVLTGRKLDQKIAYRHSGYPGGLKATPYRKLLAEHPERVIEKAVRGMLPHNSLGRRMAKKLKVYAGPEHPHRAQQPTPFEI 167
>gi|88811463|ref|ZP_01126718.1| 50S ribosomal protein L13 [Nitrococcus mobilis Nb-231] >gi|88791352|gb|EAR22464.1| 50S ribosomal protein L13 [Nitrococcus mobilis Nb-231] (142 aa)
Score = 324, Expect = 5.9e-29, Identities = 59/136 (43%), Positives = 95/136 (69%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +AA   + WY++DAS   LG+LA + A  LRGK+K +FTP+VD GDY++++N++K+ ++  K   + +Y H+GYIG LK  +   +I+K  +++I  A+KGMLPKN L R ++KKL +Y    H+  AQ+PM+++L
  S:     7 KAADVKRDWYIVDASGKTLGRLATQLAFRLRGKHKPEFTPHVDTGDYIVVVNAEKVAVTGRKVSDKVYYHHTGYIGSLKRITFGQLIDKAPERVIQTAVKGMLPKNRLGRQMLKKLKVYAGPEHRHEAQQPMQLEL 142
>gi|78169842|gb|ABB26939.1| LSU ribosomal protein L13P [Synechococcus sp. CC9902] (173 aa)
Score = 324, Expect = 5.9e-29, Identities = 57/132 (43%), Positives = 92/132 (69%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++WYV+DA N  LG+LA E A+ILRGKN  +FTP++D GD+++++N++KI +S  K  ++ +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R + +KL +YK   H  +AQKP  ++LN
  S:    36 DRQWYVVDAENQTLGRLATEVASILRGKNNPNFTPHLDTGDFVVVVNAEKIQVSGKKPQQKLYRRHSGRPGGMKVETFESLQERIPERIVEKAIKGMLPHNALGRQMYRKLKVYKGTEHPHSAQKPQPLQLN 167
>gi|78189607|ref|YP_379945.1| 50S ribosomal protein L13 [Chlorobium chlorochromatii CaD3] >gi|78171806|gb|ABB28902.1| LSU ribosomal protein L13P [Chlorobium chlorochromatii CaD3] (151 aa)
Score = 324, Expect = 6.1e-29, Identities = 60/146 (41%), Positives = 98/146 (67%)
  Q:     1 MQKTTFVKN---EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K    + A   + WYVIDA  L+LG++A E A +LRGK+K  FTP++D GD++++ N++K++L+  K++++ ++THS Y GG++    + +I    +++I  A+ GMLP N L R L +KL +Y   NH  A+Q P+E+K+N
  S:     3 MSKTLSFKTYSAKPAEVERTWYVIDAEGLVLGRMASEIAKVLRGKHKPQFTPHIDTGDFIVVTNAEKVLLTGRKSEQKTYFTHSHYPGGVRIDEVKDVIRTKPERVIENAVWGMLPHNNLGRQLFRKLKVYAGTNHPHASQSPIEMKIN 151
>gi|67923565|ref|ZP_00517038.1| Ribosomal protein L13, bacterial and organelle form [Crocosphaera watsonii WH 8501] >gi|67854591|gb|EAM49877.1| Ribosomal protein L13, bacterial and organelle form [Crocosphaera watsonii WH 8501] (161 aa)
Score = 324, Expect = 6.5e-29, Identities = 66/146 (45%), Positives = 100/146 (68%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M K   +K E  + +K+WYVIDA++  LG+LA E ANILRGKNK  +TP++D GD++I+IN++K+V++  K+ ++ +  HSG  GG+K ++   + ++  +++I  A+KGMLPKN L R L  KL +Y   NH   AQKP E+ LN
  S:    11 MVKEEILKPE--MLDKQWYVIDATDQRLGRLASEVANILRGKNKPIYTPHMDTGDFVIVINAEKVVVTGRKSSQKLYRRHSGRPGGMKVETFEKLQKRIPERIIEKAVKGMLPKNALGRQLFTKLKVYPGPNHPHEAQKPQELTLN 154
>gi|92114329|ref|YP_574257.1| 50S ribosomal protein L13 [Chromohalobacter salexigens DSM 3043] >gi|118573392|sp|Q1QVF0|RL13_CHRSD 50S ribosomal protein L13 >gi|91797419|gb|ABE59558.1| LSU ribosomal protein L13P [Chromohalobacter salexigens DSM 3043] (142 aa)
Score = 323, Expect = 7.8e-29, Identities = 57/130 (43%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WYV+DA++  LG+LA E A  LRGK+K ++TP+VD GDY++++N++K+ ++ +KA  + +Y H+GY GGL+  S   +I+   +++I  A+KGMLPK  L R +  KL +Y  A H  AAQ+P+E+ L
  S:    13 RDWYVVDATDKTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVVNAEKVRVTGNKAQAKNYYRHTGYPGGLRSMSFEKLIDHAPERVIESAVKGMLPKGPLGRAMYSKLKVYAGAEHPHAAQQPLELNL 142
>gi|116072174|ref|ZP_01469442.1| 50S ribosomal protein L13 [Synechococcus sp. BL107] >gi|116065797|gb|EAU71555.1| 50S ribosomal protein L13 [Synechococcus sp. BL107] (150 aa)
Score = 323, Expect = 8.3e-29, Identities = 57/132 (43%), Positives = 91/132 (68%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++WYV+DA N  LG+LA E A+ILRGKN   FTP++D GD+++++N++KI +S  K  ++ +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R + +KL +YK   H  +AQKP  ++LN
  S:    13 DRQWYVVDAENQTLGRLATEVASILRGKNNPSFTPHLDTGDFVVVVNAEKIQVSGKKPQQKLYRRHSGRPGGMKVETFESLQERIPERIVEKAIKGMLPHNALGRQMFRKLKVYKGTEHPHSAQKPQPLQLN 144
>gi|54022833|ref|YP_117075.1| 50S ribosomal protein L13 [Nocardia farcinica IFM 10152] >gi|81680278|sp|Q5Z1I0|RL13_NOCFA 50S ribosomal protein L13 >gi|54014341|dbj|BAD55711.1| putative ribosomal protein L13 [Nocardia farcinica IFM 10152] (147 aa)
Score = 323, Expect = 8.4e-29, Identities = 62/135 (45%), Positives = 97/135 (71%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           +A    ++WYVIDA++++LG+LAV+AAN+LRGKNK  + P+VD GD++IIIN++K+ +S +K   +  + HSG+ GGLK ++   ++E   ++L+  A+KGM+PKN L   +  KL +Y   NH  AAQ+P+  EIK
  S:     7 KAGDVTRQWYVIDATDVVLGRLAVQAANLLRGKNKPTYAPHVDGGDFVIIINAEKVAISGNKRQDKLIHHHSGHPGGLKSRTVGQVLETRPERLVEKAVKGMIPKNKLGNAIAGKLKVYAGPNHPHAAQQPVPFEIK 143
>gi|29831500|ref|NP_826134.1| 50S ribosomal protein L13 [Streptomyces avermitilis MA-4680] >gi|81718054|sp|Q82DL9|RL13_STRAW 50S ribosomal protein L13 >gi|29608616|dbj|BAC72669.1| putative ribosomal protein L13 [Streptomyces avermitilis MA-4680] (147 aa)
Score = 323, Expect = 9.3e-29, Identities = 62/130 (47%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYVIDA +++LG+LA  AANILRGK+K  + P+VD GD++IIIN+DK+ LS +K  ++  Y HSGY GGL+      ++ K  +K +  AIKGM+PKNTL R ++ KL +Y    H  AAQ+P+  ++
  S:    13 RQWYVIDAQDVVLGRLATTAANILRGKHKPIYAPHVDAGDFVIIINADKVHLSGNKKTQKLAYRHSGYPGGLRSVRYDELLAKNPEKAVEKAIKGMIPKNTLGRQVLSKLKVYSGDQHPHAAQQPVPFEI 142
>gi|19551815|ref|NP_599817.1| 50S ribosomal protein L13 [Corynebacterium glutamicum ATCC 13032] >gi|62389470|ref|YP_224872.1| 50S ribosomal protein L13 [Corynebacterium glutamicum ATCC 13032] >gi|145294751|ref|YP_001137572.1| 50S ribosomal protein L13 [Corynebacterium glutamicum R] >gi|81761424|sp|Q8NST6|RL13_CORGL 50S ribosomal protein L13 >gi|166230978|sp|A4QBS3|RL13_CORGB 50S ribosomal protein L13 >gi|21323346|dbj|BAB97974.1| Ribosomal protein L13 [Corynebacterium glutamicum ATCC 13032] >gi|41324804|emb|CAF19286.1| RIBOSOMAL PROTEIN L13 [Corynebacterium glutamicum ATCC 13032] >gi|140844671|dbj|BAF53670.1| hypothetical protein [Corynebacterium glutamicum R] (147 aa)
Score = 320, Expect = 1.8e-28, Identities = 62/129 (48%), Positives = 92/129 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP--MEIK 144
           +KWYVIDA++++LG+LA  AA++LRGK K  + PNVDCGD++I+IN+DK+ ++S+K +RE  Y HSGY GGLK  +    ++ + ++ I  +I GM+P N L+    KKL ++  + H  AAQKP   EIK
  S:    13 RKWYVIDATDVVLGRLATHAADLLRGKGKPLYAPNVDCGDHVIVINADKVAVTSNKREREMRYRHSGYPGGLKSMTLGRSLDLHPERTIEDSIVGMMPHNKLTAASAKKLHVFSGSEHPYAAQKPEAYEIK 143
>gi|90416992|ref|ZP_01224921.1| Ribosomal protein L13 [marine gamma proteobacterium HTCC2207] >gi|90331339|gb|EAS46583.1| Ribosomal protein L13 [marine gamma proteobacterium HTCC2207] (142 aa)
Score = 320, Expect = 1.9e-28, Identities = 56/130 (43%), Positives = 94/130 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+++DA    LG+LAVE A  LRGK+K ++TP+VD GDY++++N++KI ++ +KA ++ +Y+H+GY GGLK+ +   +IEK  +++I  A+KGMLP+  L R + +KL +Y  + H  AAQ+P  ++L
  S:    13 RDWFIVDAEGKTLGRLAVEIATRLRGKHKPEYTPHVDTGDYIVVVNAEKIGVTGNKATQKTYYSHTGYPGGLKDITFDKLIEKAPERVIQSAVKGMLPRGPLGREMFRKLKVYVGSAHPHAAQQPQALEL 142
>gi|78211902|ref|YP_380681.1| 50S ribosomal protein L13 [Synechococcus sp. CC9605] >gi|118573458|sp|Q3AMQ6|RL13_SYNSC 50S ribosomal protein L13 >gi|78196361|gb|ABB34126.1| ribosomal protein L13 [Synechococcus sp. CC9605] (150 aa)
Score = 320, Expect = 2.1e-28, Identities = 56/132 (42%), Positives = 89/132 (67%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++WYV+DA N  LG+LA E A +LRGK    FTP++D GD+++++N++KI +S  K  ++ +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R + +KL +YK   H  AAQKP  ++LN
  S:    13 DRQWYVVDAENQTLGRLATEVAAVLRGKTNPSFTPHLDTGDFVVVVNAEKIKVSGRKPQQKLYRRHSGRPGGMKVETFEALQERIPERIVEKAIKGMLPHNALGRQMFRKLKVYKGTEHPHAAQKPQPLQLN 144
>gi|110798874|ref|YP_697059.1| 50S ribosomal protein L13 [Clostridium perfringens ATCC 13124] >gi|168205199|ref|ZP_02631204.1| ribosomal protein L13 [Clostridium perfringens E str. JGS1987] >gi|168216666|ref|ZP_02642291.1| ribosomal protein L13 [Clostridium perfringens NCTC 8239] >gi|169347140|ref|ZP_02866082.1| ribosomal protein L13 [Clostridium perfringens C str. JGS1495] >gi|182625770|ref|ZP_02953537.1| ribosomal protein L13 [Clostridium perfringens D str. JGS1721] >gi|118573394|sp|Q0TMT1|RL13_CLOP1 50S ribosomal protein L13 >gi|110673521|gb|ABG82508.1| ribosomal protein L13 [Clostridium perfringens ATCC 13124] >gi|169296823|gb|EDS78952.1| ribosomal protein L13 [Clostridium perfringens C str. JGS1495] >gi|170663313|gb|EDT15996.1| ribosomal protein L13 [Clostridium perfringens E str. JGS1987] >gi|177908926|gb|EDT71413.1| ribosomal protein L13 [Clostridium perfringens D str. JGS1721] >gi|182381136|gb|EDT78615.1| ribosomal protein L13 [Clostridium perfringens NCTC 8239] (144 aa)
Score = 319, Expect = 2.5e-28, Identities = 64/136 (47%), Positives = 92/136 (67%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +A    +KWYV+DA+   LG++A + A+ILRGKNK  FTPNVDCGD++I+IN++K+VL+  K D++    HS Y GGLKE   R ++EK  +     A++ MLP   L R ++KKL +Y+ A H  AAQKP  ++L
  S:     7 KAQEVERKWYVVDAAGKPLGRVASQVASILRGKNKPTFTPNVDCGDFVIVINAEKVVLTGKKLDQKMLRKHSLYAGGLKETPYREVLEKKPEFAFEEAVRRMLPTGVLGRKMLKKLNVYRGAEHDHAAQKPEVLEL 142
>gi|18311352|ref|NP_563286.1| 50S ribosomal protein L13 [Clostridium perfringens str. 13] >gi|110802797|ref|YP_699629.1| 50S ribosomal protein L13 [Clostridium perfringens SM101] >gi|81766500|sp|Q8XHV6|RL13_CLOPE 50S ribosomal protein L13 >gi|118573395|sp|Q0SQH8|RL13_CLOPS 50S ribosomal protein L13 >gi|18146036|dbj|BAB82076.1| 50S ribosomal protein L13 [Clostridium perfringens str. 13] >gi|110683298|gb|ABG86668.1| ribosomal protein L13 [Clostridium perfringens SM101] (144 aa)
Score = 319, Expect = 2.5e-28, Identities = 64/136 (47%), Positives = 92/136 (67%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +A    +KWYV+DA+   LG++A + A+ILRGKNK  FTPNVDCGD++I+IN++K+VL+  K D++    HS Y GGLKE   R ++EK  +     A++ MLP   L R ++KKL +Y+ A H  AAQKP  ++L
  S:     7 KAQEVERKWYVVDAAGKPLGRVASQVASILRGKNKPTFTPNVDCGDFVIVINAEKVVLTGKKLDQKMLRKHSLYAGGLKETPYREVLEKKPEFAFEEAVRRMLPTGVLGRKMLKKLNVYRGAEHNHAAQKPEVLEL 142
>gi|69245533|ref|ZP_00603497.1| Ribosomal protein L13, bacterial and organelle form [Enterococcus faecium DO] >gi|68195784|gb|EAN10221.1| Ribosomal protein L13, bacterial and organelle form [Enterococcus faecium DO] (176 aa)
Score = 319, Expect = 2.7e-28, Identities = 63/138 (45%), Positives = 93/138 (67%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT++     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP++D GD++I+IN+DK+ L+  KA  + +Y HS Y GGLK  +   +  K S +LI  ++KGMLPKNTL R    KL +Y  A H  AAQ+P
  S:    31 RTTYMAKPGEV-ERKWYVVDATDVPLGRLSTVVASVLRGKNKPTFTPHLDTGDFVIVINADKVKLTGKKATDKIYYRHSNYPGGLKSITAGELRAKNSRRLIETSVKGMLPKNTLGRKQFTKLNVYGGAEHPHAAQQP 167
>gi|52145074|ref|YP_081753.1| 50S ribosomal protein L13 [Bacillus cereus E33L] >gi|81689822|sp|Q63H58|RL13_BACCZ 50S ribosomal protein L13 >gi|51978543|gb|AAU20093.1| ribosomal protein L13 (50S ribosomal protein L13) [Bacillus cereus E33L] (145 aa)
Score = 318, Expect = 2.9e-28, Identities = 65/138 (47%), Positives = 94/138 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TTF+  +A    +KWYV+DA    LG+LA E A+ILRGKNK  FTP+VD GD++IIIN++KI L+ +K + + +Y H+ + GGLK+++  ++   Y  +++  AIKGMLPK  L R + KKL +Y  A H   AQKP
  S:     2 RTTFMA-KANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTFTPHVDTGDHVIIINAEKIHLTGNKLNDKMYYRHTNHPGGLKQRTALVLRTNYPVQMLELAIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKP 138
>gi|33866625|ref|NP_898184.1| 50S ribosomal protein L13 [Synechococcus sp. WH 8102] >gi|81712232|sp|Q7U4H5|RL13_SYNPX 50S ribosomal protein L13 >gi|33633403|emb|CAE08608.1| 50S ribosomal protein L13 [Synechococcus sp. WH 8102] (150 aa)
Score = 318, Expect = 3.0e-28, Identities = 58/146 (39%), Positives = 97/146 (66%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT+  + ++    ++WY++DA N  LG+LA E A +LRGKN   FTP++D GD+++++N++KI +S  K  ++ +  HSG  GG+K ++   + ++  ++++  AIKGMLP N L R + +KL +YK + H  AAQKP  ++LN
  S:     1 MNKTSLPQIDSL--ERQWYLVDAENKTLGRLATEVAAVLRGKNNPSFTPHLDTGDFVVVVNAEKIRVSGSKPTQKLYRRHSGRPGGMKTETFEALQDRIPERIVEKAIKGMLPHNALGRQMFRKLKVYKGSEHPHAAQKPQPLQLN 144
>gi|116749104|ref|YP_845791.1| 50S ribosomal protein L13 [Syntrophobacter fumaroxidans MPOB] >gi|166982881|sp|A0LIV4|RL13_SYNFM 50S ribosomal protein L13 >gi|116698168|gb|ABK17356.1| LSU ribosomal protein L13P [Syntrophobacter fumaroxidans MPOB] (142 aa)
Score = 318, Expect = 3.1e-28, Identities = 68/143 (47%), Positives = 96/143 (67%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KT   K EA+   +KW ++DA N +LG+LA   A  LRGK+   FTP+VD GD++++IN+DK+ L+ +K D++ +Y HSGY+GG+K +S R +     +KL+  A+ GMLPKN L R LIKKL +YK A H   AQ+P  I L
  S:     2 KTISAKFEAS--QRKWILVDAENQVLGRLASRIAMRLRGKHLPAFTPHVDLGDFVVVINADKVQLTGNKWDQKLYYRHSGYMGGVKVQSARKLNAGNPEKLLRLAVWGMLPKNRLGRKLIKKLKVYKGAEHPHEAQQPTRIAL 142
>gi|148263122|ref|YP_001229828.1| 50S ribosomal protein L13 [Geobacter uraniireducens Rf4] >gi|146396622|gb|ABQ25255.1| LSU ribosomal protein L13P [Geobacter uraniireducens Rf4] (143 aa)
Score = 318, Expect = 3.2e-28, Identities = 63/145 (43%), Positives = 100/145 (68%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M+ T   K +     + WY++D  N +LG++A E AN+LRGKNK  +TP+VD GD++I++N++KI L+ +K+  + +Y+HSG+ GGLKE S   ++EK  + +I  A+KGMLPKN L+R+++KKL IY   +H   AQ+P  + +
  S:     1 MKTTQVAKKDEV--TRDWYLVDVDNKVLGRVATEIANVLRGKNKPVYTPSVDTGDFVIVVNAEKIALTGNKSADKIYYSHSGFPGGLKEISAGKLMEKKPEDIIKKAVKGMLPKNKLARHMLKKLKIYSGTDHPHKAQQPKALNI 143
>gi|145219271|ref|YP_001129980.1| 50S ribosomal protein L13 [Prosthecochloris vibrioformis DSM 265] >gi|189041014|sp|A4SDB9|RL13_PROVI 50S ribosomal protein L13 >gi|145205435|gb|ABP36478.1| LSU ribosomal protein L13P [Prosthecochloris vibrioformis DSM 265] (149 aa)
Score = 318, Expect = 3.3e-28, Identities = 63/146 (43%), Positives = 96/146 (65%)
  Q:     1 MQKTTFVKNEAAL---ANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K  +A      +KWYV+DA   ILG++A E A +LRGK+K +FTP++D GD++++ N++K+ LS  K D + +++HS Y GG+K    + ++ K  +K+I  A+ GMLP N L R L KKL +Y  A H   +Q P+E+K+N
  S:     1 MSKTLSFKTYSAKPGDVERKWYVVDAEGQILGRMAAEIAKVLRGKHKPEFTPHIDTGDFIVVTNAEKVALSGKKLDAKAYFSHSQYPGGVKFNHVKDLLRKKPEKVIEHAVWGMLPHNNLGRQLFKKLKVYPGATHPHESQSPIEMKVN 149
>gi|21674597|ref|NP_662662.1| 50S ribosomal protein L13 [Chlorobium tepidum TLS] >gi|81790779|sp|Q8KBK4|RL13_CHLTE 50S ribosomal protein L13 >gi|21647796|gb|AAM73004.1| ribosomal protein L13 [Chlorobium tepidum TLS] (150 aa)
Score = 318, Expect = 3.3e-28, Identities = 62/146 (42%), Positives = 97/146 (66%)
  Q:     1 MQKTTFVKNEAAL---ANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K  +A      + W++IDA N +LG++A + AN+LRGK+K  FTP++D GD++++ N+ K+ LS  K D + +++HS Y GG++  S + +++K  +K+I  A+ GMLP N L R L KKL +Y    H  AAQ P+E+K+N
  S:     1 MSKTLSFKTYSAKPGEVKRTWHIIDAENQVLGRMAAQIANVLRGKHKPQFTPHIDTGDFVVVTNAAKVALSGKKRDDKTYFSHSHYPGGVRIDSVKDLLQKKPEKVIEHAVWGMLPHNNLGRQLFKKLKVYAGPEHPHAAQMPVEMKIN 149
>gi|145596375|ref|YP_001160672.1| 50S ribosomal protein L13 [Salinispora tropica CNB-440] >gi|159039773|ref|YP_001539026.1| 50S ribosomal protein L13 [Salinispora arenicola CNS-205] >gi|189041019|sp|A8M4C0|RL13_SALAI 50S ribosomal protein L13 >gi|189041022|sp|A4XBI7|RL13_SALTO 50S ribosomal protein L13 >gi|145305712|gb|ABP56294.1| LSU ribosomal protein L13P [Salinispora tropica CNB-440] >gi|157918608|gb|ABW00036.1| ribosomal protein L13 [Salinispora arenicola CNS-205] (147 aa)
Score = 318, Expect = 3.5e-28, Identities = 62/129 (48%), Positives = 91/129 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           ++W+VIDAS+++LG+LA  AA +LRGK+K  F P+VD GD+++I+N+ K+ L+ +K  ++  Y HSGY GGLK+     ++ K  ++ I  A+KGMLP N L R LIKKL +Y  A H   AQ+P+  EIK
  S:    13 RQWHVIDASDVVLGRLATHAATLLRGKHKPTFAPHVDTGDFVVIVNAGKVALTGNKRQQKIAYRHSGYPGGLKQLGYDELLTKRPERAIELAVKGMLPHNKLGRKLIKKLKVYAGAEHPHGAQQPVPFEIK 143
>gi|21223113|ref|NP_628892.1| 50S ribosomal protein L13 [Streptomyces coelicolor A3(2)] >gi|2500256|sp|Q53874|RL13_STRCO 50S ribosomal protein L13 >gi|1155337|gb|AAC46060.1| ScoL13 [Streptomyces coelicolor A3(2)] >gi|3449246|emb|CAA20390.1| 50S ribosomal protein L13 [Streptomyces coelicolor A3(2)] (147 aa)
Score = 317, Expect = 4.0e-28, Identities = 60/130 (46%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++W+VIDA +++LG+LA  AA+ILRGK+K  + P+VD GD++IIIN+DK+ LS +K  ++  Y HSGY GGL+      +++K  +K +  AIKGMLPKN+L R ++ KL +YK   H   AQ+P   ++
  S:    13 RQWHVIDAQDVVLGRLATTAASILRGKHKPIYAPHVDTGDFVIIINADKVHLSGNKRTQKMAYRHSGYPGGLRSVRYDELLDKNPEKAVEKAIKGMLPKNSLGRQMLSKLKVYKGDQHPHGAQQPQPFEI 142
>gi|110833437|ref|YP_692296.1| 50S ribosomal protein L13 [Alcanivorax borkumensis SK2] >gi|118573377|sp|Q0VS24|RL13_ALCBS 50S ribosomal protein L13 >gi|110646548|emb|CAL16024.1| 50S ribosomal protein L13 [Alcanivorax borkumensis SK2] (142 aa)
Score = 317, Expect = 4.3e-28, Identities = 62/143 (43%), Positives = 94/143 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KT   K E+    + WYV+DAS   LG+LA E A+ LRGK+K +FTP+VD GDY+++IN+DK+ ++  KA  + +Y H+GY GGLKE +   +  +  + +I  AIKGMLP+N L R + +KL +Y    H   AQ+P ++++
  S:     2 KTYSAKPESV--KRDWYVVDASGKTLGRLATEVASRLRGKHKPEFTPHVDTGDYIVVINADKVAVTGKKASDKMYYRHTGYPGGLKEANFATLQAEKPEMIIEKAIKGMLPRNPLGRAMFRKLKVYAGTEHPHTAQQPQQLEI 142
>gi|189500936|ref|YP_001960406.1| ribosomal protein L13 [Chlorobium phaeobacteroides BS1] >gi|189496377|gb|ACE04925.1| ribosomal protein L13 [Chlorobium phaeobacteroides BS1] (150 aa)
Score = 317, Expect = 4.3e-28, Identities = 67/146 (45%), Positives = 96/146 (65%)
  Q:     1 MQKTTFVKNEAAL---ANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K  +A      +KWYV+DA   +LG+LA E A ILRGK+K  FTP+VD GD++I+ N+ KI LS  K D++ +++HS Y GG+K ++ + M+ K  +K+I  A+ GMLP N L R L KKL +Y    H   +Q P+E+K+N
  S:     1 MSKTISFKTYSAKPGEVERKWYVVDAEGKVLGRLASEIATILRGKHKPQFTPHVDTGDFVIVTNAGKIGLSGKKLDQKTYFSHSNYPGGVKIENLKDMLRKKPEKVIEKAVWGMLPHNNLGRALFKKLKVYAGPEHPHVSQSPVEMKVN 149
>gi|42631745|ref|ZP_00157283.1| COG0102: Ribosomal protein L13 [Haemophilus influenzae R2866] >gi|53732749|ref|ZP_00349562.1| COG0102: Ribosomal protein L13 [Haemophilus influenzae R2846] >gi|68250025|ref|YP_249137.1| 50S ribosomal protein L13 [Haemophilus influenzae 86-028NP] >gi|145630751|ref|ZP_01786529.1| 50S ribosomal protein L13 [Haemophilus influenzae 22.4-21] >gi|145632787|ref|ZP_01788520.1| 50S ribosomal protein L13 [Haemophilus influenzae 3655] >gi|145634979|ref|ZP_01790686.1| 50S ribosomal protein L13 [Haemophilus influenzae PittAA] >gi|145638940|ref|ZP_01794548.1| 50S ribosomal protein L13 [Haemophilus influenzae PittII] >gi|148825986|ref|YP_001290739.1| 50S ribosomal protein L13 [Haemophilus influenzae PittEE] >gi|166230988|sp|A5UC55|RL13_HAEIE 50S ribosomal protein L13 >gi|81335551|sp|Q4QKH0|RL13_HAEI8 50S ribosomal protein L13 >gi|68058224|gb|AAX88477.1| 50S ribosomal protein L13 [Haemophilus influenzae 86-028NP] >gi|144983633|gb|EDJ91093.1| 50S ribosomal protein L13 [Haemophilus influenzae R3021] >gi|144986443|gb|EDJ93009.1| 50S ribosomal protein L13 [Haemophilus influenzae 3655] >gi|145267845|gb|EDK07842.1| 50S ribosomal protein L13 [Haemophilus influenzae PittAA] >gi|145271912|gb|EDK11821.1| 50S ribosomal protein L13 [Haemophilus influenzae PittII] >gi|148716146|gb|ABQ98356.1| 50S ribosomal protein L13 [Haemophilus influenzae PittEE] (142 aa)
Score = 317, Expect = 4.3e-28, Identities = 60/136 (44%), Positives = 92/136 (67%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I+IN+DK+ ++  K   + +Y H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y  A H+ AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVINADKVAVTGRKETDKLYYWHTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLPKGPLGRAMFRKLKVYAGAEHQHAAQQP 137
>gi|30018412|ref|NP_830043.1| 50S ribosomal protein L13 [Bacillus cereus ATCC 14579] >gi|30260333|ref|NP_842710.1| 50S ribosomal protein L13 [Bacillus anthracis str. Ames] >gi|42779224|ref|NP_976471.1| 50S ribosomal protein L13 [Bacillus cereus ATCC 10987] >gi|47525399|ref|YP_016748.1| 50S ribosomal protein L13 [Bacillus anthracis str. 'Ames Ancestor'] >gi|47570255|ref|ZP_00240906.1| ribosomal protein L13 [Bacillus cereus G9241] >gi|49183177|ref|YP_026429.1| 50S ribosomal protein L13 [Bacillus anthracis str. Sterne] >gi|49481687|ref|YP_034494.1| 50S ribosomal protein L13 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118475911|ref|YP_893062.1| 50S ribosomal protein L13 [Bacillus thuringiensis str. Al Hakam] >gi|165873349|ref|ZP_02217950.1| ribosomal protein L13 [Bacillus anthracis str. A0488] >gi|166995383|ref|ZP_02261843.1| 50S ribosomal protein L13 [Bacillus cereus AH820] >gi|167937005|ref|ZP_02524080.1| 50S ribosomal protein L13 [Bacillus cereus AH1134] >gi|168138399|ref|ZP_02581628.1| 50S ribosomal protein L13 [Bacillus cereus B4264] >gi|168163722|ref|ZP_02598955.1| 50S ribosomal protein L13 [Bacillus cereus H3081.97] >gi|170689689|ref|ZP_02880867.1| ribosomal protein L13 [Bacillus anthracis str. A0465] >gi|190567437|ref|ZP_03020351.1| ribosomal protein L13 [Bacillus anthracis Tsiankovskii-I] >gi|196035957|ref|ZP_03103358.1| ribosomal protein L13 [Bacillus cereus W] >gi|196041108|ref|ZP_03108404.1| ribosomal protein L13 [Bacillus cereus NVH0597-99] >gi|196046232|ref|ZP_03113459.1| ribosomal protein L13 [Bacillus cereus 03BB108] >gi|166230961|sp|A0R8L2|RL13_BACAH 50S ribosomal protein L13 >gi|81697011|sp|Q6HPM6|RL13_BACHK 50S ribosomal protein L13 >gi|81700041|sp|Q73F63|RL13_BACC1 50S ribosomal protein L13 >gi|81714799|sp|Q81J13|RL13_BACCR 50S ribosomal protein L13 >gi|81715482|sp|Q81VP9|RL13_BACAN 50S ribosomal protein L13 >gi|29893952|gb|AAP07244.1| LSU ribosomal protein L13P [Bacillus cereus ATCC 14579] >gi|30253654|gb|AAP24196.1| ribosomal protein L13 [Bacillus anthracis str. Ames] >gi|42735139|gb|AAS39079.1| ribosomal protein L13 [Bacillus cereus ATCC 10987] >gi|47500547|gb|AAT29223.1| ribosomal protein L13 [Bacillus anthracis str. 'Ames Ancestor'] >gi|47553079|gb|EAL11479.1| ribosomal protein L13 [Bacillus cereus G9241] >gi|49177104|gb|AAT52480.1| ribosomal protein L13 [Bacillus anthracis str. Sterne] >gi|49333243|gb|AAT63889.1| ribosomal protein L13 (50S ribosomal protein L13) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118415136|gb|ABK83555.1| LSU ribosomal protein L13P [Bacillus thuringiensis str. Al Hakam] >gi|164710917|gb|EDR16493.1| ribosomal protein L13 [Bacillus anthracis str. A0488] >gi|170666360|gb|EDT17145.1| ribosomal protein L13 [Bacillus anthracis str. A0465] >gi|190561564|gb|EDV15535.1| ribosomal protein L13 [Bacillus anthracis Tsiankovskii-I] >gi|195991326|gb|EDX55293.1| ribosomal protein L13 [Bacillus cereus W] >gi|196022977|gb|EDX61657.1| ribosomal protein L13 [Bacillus cereus 03BB108] >gi|196028043|gb|EDX66654.1| ribosomal protein L13 [Bacillus cereus NVH0597-99] (145 aa)
Score = 317, Expect = 4.7e-28, Identities = 66/138 (47%), Positives = 93/138 (67%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TTF+  +A    +KWYV+DA    LG+LA E A+ILRGKNK  FTP+VD GD++IIIN++KI L+ +K + + +Y H+ + GGLK+++   M   Y  +++  AIKGMLPK  L R + KKL +Y  A H   AQKP
  S:     2 RTTFMA-KANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTFTPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLELAIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKP 138
>gi|15677879|ref|NP_275047.1| 50S ribosomal protein L13 [Neisseria meningitidis MC58] >gi|15793386|ref|NP_283208.1| 50S ribosomal protein L13 [Neisseria meningitidis Z2491] >gi|121635715|ref|YP_975960.1| 50S ribosomal protein L13 [Neisseria meningitidis FAM18] >gi|161869135|ref|YP_001598301.1| 50S ribosomal protein L13 [Neisseria meningitidis 053442] >gi|166231002|sp|A1KWD6|RL13_NEIMF 50S ribosomal protein L13 >gi|189041011|sp|A9M087|RL13_NEIM0 50S ribosomal protein L13 >gi|81707115|sp|Q7DD49|RL13_NEIMB 50S ribosomal protein L13 >gi|81783913|sp|Q9JQM8|RL13_NEIMA 50S ribosomal protein L13 >gi|7227319|gb|AAF42377.1| 50S ribosomal protein L13 [Neisseria meningitidis MC58] >gi|120867421|emb|CAM11193.1| 50S ribosomal protein L13 [Neisseria meningitidis FAM18] >gi|121051379|emb|CAM07671.1| 50S ribosomal protein L13 [Neisseria meningitidis Z2491] >gi|161594688|gb|ABX72348.1| 50S ribosomal protein L13 [Neisseria meningitidis 053442] (143 aa)
Score = 317, Expect = 4.7e-28, Identities = 58/130 (44%), Positives = 94/130 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++W+VIDA + +LG++A E A+ LRGK+K ++TP+VD GDY+I+IN+DK+ ++  K + +K++ HSG+ GG+ E++ R M E++  + +  A+KGMLPK  L   +IKKL +Y  A H  AAQ+P  ++L
  S:    13 REWFVIDAQDKVLGRVAAEVASRLRGKHKPEYTPHVDTGDYIIVINADKLRVTGAKFEDKKYFRHSGFPGGIYERTFREMQEQFPGRALEQAVKGMLPKGPLGYAMIKKLKVYAGAEHAHAAQQPKVLEL 142
>gi|121998856|ref|YP_001003643.1| 50S ribosomal protein L13 [Halorhodospira halophila SL1] >gi|166230990|sp|A1WYS9|RL13_HALHL 50S ribosomal protein L13 >gi|121590261|gb|ABM62841.1| LSU ribosomal protein L13P [Halorhodospira halophila SL1] (142 aa)
Score = 317, Expect = 4.8e-28, Identities = 57/134 (42%), Positives = 94/134 (70%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   + WY++DA++  LG+LA E A+ LRGK+K  FTP+VD GDY+++IN+DKI L+  K   ++++ H+G+ GG+K +S   + E++ ++LI  A++GM+PKN L R ++KKL +Y    H+  AQ+P  ++L
  S:     9 AEVQRDWYLVDATDKTLGRLASEVAHRLRGKHKPVFTPHVDAGDYIVVINADKIRLTGRKERDKQYFWHTGFPGGIKSRSVAEVRERHPERLIESAVRGMMPKNRLGRAMLKKLKVYAGNEHRHHAQQPQPLEL 142
>gi|67156166|ref|ZP_00417792.1| Ribosomal protein L13, bacterial and organelle form [Azotobacter vinelandii AvOP] >gi|67086496|gb|EAM05965.1| Ribosomal protein L13, bacterial and organelle form [Azotobacter vinelandii AvOP] (142 aa)
Score = 316, Expect = 5.0e-28, Identities = 58/130 (44%), Positives = 93/130 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WYV+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+++IN++++ ++  K+  + +Y+HSG+ GG+K  S   +I K  +++I  A+KGMLPKN L R + +KL +YK A H   AQ+P E+K+
  S:    13 RDWYVVDAAGQTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKSSDKIYYSHSGFPGGIKSISFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYKGAVHPHTAQQPQELKI 142
>gi|104783475|ref|YP_609973.1| 50S ribosomal protein L13 [Pseudomonas entomophila L48] >gi|122401949|sp|Q1I596|RL13_PSEE4 50S ribosomal protein L13 >gi|95112462|emb|CAK17189.1| 50S ribosomal protein L13 [Pseudomonas entomophila L48] (142 aa)
Score = 316, Expect = 5.4e-28, Identities = 56/130 (43%), Positives = 94/130 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++W+V+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+++IN++++ ++  K+  + +Y+HSG+ GG+KE +   +I K  +++I  A+KGMLPKN L R + +KL +Y  A H   AQ+P E+K+
  S:    13 REWFVVDAAGQTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKSSDKMYYSHSGFPGGIKEINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYAGAAHPHTAQQPQELKI 142
>gi|51894177|ref|YP_076868.1| 50S ribosomal protein L13 [Symbiobacterium thermophilum IAM 14863] >gi|81691986|sp|Q67JX6|RL13_SYMTH 50S ribosomal protein L13 >gi|51857866|dbj|BAD42024.1| 50S ribosomal protein L13 [Symbiobacterium thermophilum IAM 14863] (143 aa)
Score = 316, Expect = 5.6e-28, Identities = 63/132 (47%), Positives = 89/132 (67%)
  Q:     9 NEAALAN-----KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           N+  +AN     +KWYV+DA    LG+LA + A ILRGK+K  FTP+VDCGD++II+N++KI ++  K   + +Y HSGY GG K  +   MI +  ++++  AIKGMLP N L R + +KL +Y    H  AAQKP
  S:     2 NKTYMANPQNVERKWYVVDAEGKTLGRLASKVAAILRGKHKPTFTPHVDCGDFVIIVNAEKIQVTGKKVTDKVYYRHSGYPGGQKATTFEQMIARRPERVLELAIKGMLPHNRLGRQMYRKLKVYAGPEHPHAAQKP 138
>gi|116334237|ref|YP_795764.1| 50S ribosomal protein L13 [Lactobacillus brevis ATCC 367] >gi|122269081|sp|Q03PY9|RL13_LACBA 50S ribosomal protein L13 >gi|116099584|gb|ABJ64733.1| LSU ribosomal protein L13P [Lactobacillus brevis ATCC 367] (147 aa)
Score = 316, Expect = 5.6e-28, Identities = 59/126 (46%), Positives = 90/126 (71%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           ++KWY++DA+++ LG+LA   A+ILRGKNK  FTPNVD GD +I+IN++K+ L+  KA  + +Y H+G+ GGLK ++     ++  +KLI  +++GMLPKN+L   +  KL +Y  A+HK  AQKP
  S:    13 DRKWYIVDATDVSLGRLASVVASILRGKNKPTFTPNVDTGDNVIVINAEKVALTGRKASNKIYYHHTGFAGGLKSRTAGNFRDENPEKLIETSVQGMLPKNSLGHQMALKLHVYAGADHKHEAQKP 138
>gi|26988050|ref|NP_743475.1| 50S ribosomal protein L13 [Pseudomonas putida KT2440] >gi|148549613|ref|YP_001269715.1| 50S ribosomal protein L13 [Pseudomonas putida F1] >gi|167035525|ref|YP_001670756.1| 50S ribosomal protein L13 [Pseudomonas putida GB-1] >gi|166199603|sp|A5W8S1|RL13_PSEP1 50S ribosomal protein L13 >gi|189041015|sp|B0KFU8|RL13_PSEPG 50S ribosomal protein L13 >gi|81733483|sp|Q88N97|RL13_PSEPK 50S ribosomal protein L13 >gi|24982772|gb|AAN66939.1|AE016322_6 ribosomal protein L13 [Pseudomonas putida KT2440] >gi|148513671|gb|ABQ80531.1| LSU ribosomal protein L13P [Pseudomonas putida F1] >gi|166862013|gb|ABZ00421.1| ribosomal protein L13 [Pseudomonas putida GB-1] (142 aa)
Score = 316, Expect = 5.9e-28, Identities = 56/130 (43%), Positives = 93/130 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++W+V+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+++IN++++ ++  K+  + +Y+HSG+ GG+KE +   +I K  +++I  A+KGMLPKN L R + +KL +Y  A H   AQ+P E+K+
  S:    13 REWFVVDAAGQTLGRLATEIATRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKSSDKMYYSHSGFPGGIKEINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYAGAAHPHTAQQPQELKI 142
>gi|52307390|gb|AAU37890.1| RplM protein [Mannheimia succiniciproducens MBEL55E] (147 aa)
Score = 315, Expect = 6.3e-28, Identities = 60/140 (42%), Positives = 94/140 (67%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + KT   K E     + WYV+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+I+IN+DK+ ++  K   + +Y H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y  + H+ AAQ+P
  S:     5 LMKTFVAKPETV--KRDWYVVDATGKTLGRLATELASRLRGKHKAEYTPHVDTGDYIIVINADKVAVTGRKETDKVYYWHTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLPKGPLGRAMFRKLKVYAGSQHEHAAQQP 142
>gi|91785173|ref|YP_560379.1| 50S ribosomal protein L13 [Burkholderia xenovorans LB400] >gi|187925327|ref|YP_001896969.1| ribosomal protein L13 [Burkholderia phytofirmans PsJN] >gi|118573389|sp|Q13UB2|RL13_BURXL 50S ribosomal protein L13 >gi|91689127|gb|ABE32327.1| LSU ribosomal protein L13P [Burkholderia xenovorans LB400] >gi|187716521|gb|ACD17745.1| ribosomal protein L13 [Burkholderia phytofirmans PsJN] (142 aa)
Score = 315, Expect = 6.6e-28, Identities = 58/130 (44%), Positives = 94/130 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYVIDA++ +LG++A E A+ LRGK+K +FTP+VD GD++I+IN+ K+ ++ +KA  +K+Y HSGY GG+ E +   M E++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:    13 REWYVIDATDKVLGRVASEVAHRLRGKHKPEFTPHVDTGDFIIVINAGKLRVTGNKATDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEATHPHSAQQPKALEI 142
>gi|30249455|ref|NP_841525.1| 50S ribosomal protein L13 [Nitrosomonas europaea ATCC 19718] >gi|81722177|sp|Q82UK0|RL13_NITEU 50S ribosomal protein L13 >gi|30138818|emb|CAD85395.1| Ribosomal protein L13 [Nitrosomonas europaea ATCC 19718] (144 aa)
Score = 315, Expect = 6.8e-28, Identities = 58/130 (44%), Positives = 93/130 (71%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +W+V+DA++ +LG+LA   A+ LRGK+K  +TP+VD GDY+++IN+DK+ ++ +KA+ +K+Y HSGY GG+ E + + M E++  + +  A+KGMLPK  L   +IKKL IY    H  AAQ+P  +++N
  S:    14 EWFVVDATDKVLGRLAAAIAHRLRGKHKPIYTPHVDTGDYIVVINADKLRVTGNKAEDKKYYRHSGYPGGIYETTFKKMHERFPTRPLEKAVKGMLPKGPLGYAMIKKLKIYAGDTHPHAAQQPQPLEIN 143
>gi|50904075|gb|AAT87790.1| LSU ribosomal protein L13P [Streptococcus pyogenes MGAS10394] (183 aa)
Score = 315, Expect = 7.2e-28, Identities = 63/140 (45%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++KI L+  KA  + +YTHS Y GGLK  +   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:    36 MNKTTFMAKPGQV-ERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKIKLTGKKATDKVYYTHSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 174
>gi|26110239|gb|AAN82425.1|AE016767_185 50S ribosomal protein L13 [Escherichia coli CFT073] >gi|91074224|gb|ABE09105.1| 50S ribosomal subunit protein L13 [Escherichia coli UTI89] (167 aa)
Score = 315, Expect = 7.3e-28, Identities = 59/140 (42%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + KT   K E     + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    25 LMKTFTAKPETV--KRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQP 162
>gi|90022806|ref|YP_528633.1| 50S ribosomal protein L13 [Saccharophagus degradans 2-40] >gi|118573442|sp|Q21FV8|RL13_SACD2 50S ribosomal protein L13 >gi|89952406|gb|ABD82421.1| LSU ribosomal protein L13P [Saccharophagus degradans 2-40] (142 aa)
Score = 315, Expect = 7.9e-28, Identities = 60/143 (41%), Positives = 94/143 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KT   K E     + WY+IDA    LG++A E A+ LRGK+K +FTP+VD GDY+++IN++K+ ++  KA  + +Y+H+G+IGG+K  S   +I+K  ++ I  A+KGMLP+  L R + KKL +Y  + H   AQ+P E+ +
  S:     2 KTISAKPETV--KRDWYIIDADGKTLGRMAAEIAHRLRGKHKPEFTPHVDTGDYIVVINAEKVRVTGRKATDKMYYSHTGFIGGIKSISFEKLIDKAPERTIQNAVKGMLPRGPLGRAMFKKLKVYGGSEHPHTAQQPQELNI 142
>gi|152984503|ref|YP_001350341.1| 50S ribosomal protein L13 [Pseudomonas aeruginosa PA7] >gi|166231014|sp|A6VBA6|RL13_PSEA7 50S ribosomal protein L13 >gi|150959661|gb|ABR81686.1| ribosomal protein L13 [Pseudomonas aeruginosa PA7] (142 aa)
Score = 314, Expect = 8.3e-28, Identities = 57/130 (43%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+++IN++++ ++  K   + +Y HSG+ GG+K  +   +I K  +++I  A+KGMLPKN L R + +KL +YK ANH   AQ+P E+K+
  S:    13 RDWFVVDAAGQTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKTTDKMYYHHSGFPGGIKSINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYKGANHPHTAQQPQELKI 142
>gi|194334611|ref|YP_002016471.1| ribosomal protein L13 [Prosthecochloris aestuarii DSM 271] >gi|194312429|gb|ACF46824.1| ribosomal protein L13 [Prosthecochloris aestuarii DSM 271] (149 aa)
Score = 314, Expect = 8.6e-28, Identities = 58/131 (44%), Positives = 92/131 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +KWY++DA   +LG+LA E A +LRGK+K  FTP++D GD++I+ N++KI LS  K D++ +++HS Y GG++  + + +++K  +++I  A+ GMLP N L R L KKL +YK   H  AAQ P+E+ +N
  S:    19 RKWYIVDAEGKVLGRLASEIAKVLRGKHKAQFTPHIDTGDFVIVTNAEKIGLSGKKMDQKTYFSHSNYPGGVRIDNVKDVLQKKPEQVIEKAVWGMLPHNNLGRQLFKKLKVYKGTEHPHAAQCPVEMNVN 149
>gi|51245179|ref|YP_065063.1| 50S ribosomal protein L13 [Desulfotalea psychrophila LSv54] >gi|81692864|sp|Q6ANL8|RL13_DESPS 50S ribosomal protein L13 >gi|50876216|emb|CAG36056.1| probable 50S ribosomal protein L13 [Desulfotalea psychrophila LSv54] (142 aa)
Score = 314, Expect = 9.4e-28, Identities = 60/125 (48%), Positives = 89/125 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           K+WYV+DA N +LG+LA E A+ LRGK+K  F+  +D GD++++ N++KI L+  K D + +Y H+GYIGG+KE S + ++EK+   LI  A++GMLPKN + R  +KKL +Y  A H  AAQ+P
  S:    13 KEWYVVDAENKVLGRLASEIASRLRGKHKPTFSSFIDNGDFIVVTNAEKIALTGKKWDDKTYYRHTGYIGGIKETSAKELLEKHPTDLITKAVRGMLPKNKMGRAQLKKLKVYVGAAHPHAAQQP 137
>gi|116493131|ref|YP_804866.1| 50S ribosomal protein L13 [Pediococcus pentosaceus ATCC 25745] >gi|122265405|sp|Q03EE8|RL13_PEDPA 50S ribosomal protein L13 >gi|116103281|gb|ABJ68424.1| LSU ribosomal protein L13P [Pediococcus pentosaceus ATCC 25745] (147 aa)
Score = 314, Expect = 9.8e-28, Identities = 63/143 (44%), Positives = 96/143 (67%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +TT++     +  +KWY++DA+++ LG+L+   A+ILRGKNK  FTPNVD GD++I+IN++KI L+  KA  + +Y H+ + GG+K K+   M EK  ++LI  +IKGMLP NTL R    KL +Y  + H Q AQ P ++ +
  S:     2 RTTYLAKPGEV-ERKWYIVDATDIPLGRLSTVVASILRGKNKPTFTPNVDTGDFVIVINAEKIKLTGRKATGKIYYHHTLHPGGIKSKTAGEMREKTPERLIETSIKGMLPHNTLGRKQALKLHVYAGSEHNQQAQNPEKLDI 143
>gi|94542786|gb|ABF32835.1| LSU ribosomal protein L13P [Streptococcus pyogenes MGAS9429] >gi|94544732|gb|ABF34780.1| LSU ribosomal protein L13P [Streptococcus pyogenes MGAS10270] >gi|94546675|gb|ABF36722.1| LSU ribosomal protein L13P [Streptococcus pyogenes MGAS2096] >gi|94548645|gb|ABF38691.1| LSU ribosomal protein L13P [Streptococcus pyogenes MGAS10750] (183 aa)
Score = 314, Expect = 1.0e-27, Identities = 62/140 (44%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK  +   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:    36 MNKTTFMAKPGQV-ERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKVYYTHSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 174
>gi|118573454|sp|Q14KZ8|RL13_SPICI 50S ribosomal protein L13 >gi|110005510|emb|CAK99832.1| 50s ribosomal protein l13 [Spiroplasma citri] (146 aa)
Score = 314, Expect = 1.0e-27, Identities = 68/145 (46%), Positives = 95/145 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M++TT + +      KKWYVIDA  L+LG+LA + A ILRGKNK  +TP+VDCGD +II+N+DKI LS +K   + +Y HS + GGLK  + + M+ K     +  AIKGMLPKN L   L + LF+Y    H   AQ+P++++L
  S:     1 MRQTTILNSTKV--EKKWYVIDAQGLVLGRLASKVAMILRGKNKPSYTPHVDCGDNVIILNADKINLSGNKLKGKMYYHHSQHPGGLKRTTAKNMLVKKPIYPVEHAIKGMLPKNKLGSKLFRNLFVYAGNEHPHEAQQPIKLEL 143
>gi|86135105|ref|ZP_01053687.1| 50S ribosomal protein L13 [Tenacibaculum sp. MED152] >gi|85821968|gb|EAQ43115.1| 50S ribosomal protein L13 [Polaribacter dokdonensis MED152] (151 aa)
Score = 314, Expect = 1.0e-27, Identities = 63/140 (45%), Positives = 90/140 (64%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           V   AA  NK+W ++DA    LG+LA + A ++RGK K ++TP+VDCGD ++IIN++KIVL+ +K   + +  H+GY GG +  +   M EK   +LI  A+KGMLPKNTL   L + L++Y    HK A Q+P  I LN
  S:     9 VSANAATVNKEWVLVDADGQTLGRLASKVAKLIRGKYKPNYTPHVDCGDNVVIINAEKIVLTGNKMRDKSYIRHTGYPGGQRSLTATEMFEKDPTRLIEKAVKGMLPKNTLGSALYRNLYVYAGGEHKHAGQEPKAINLN 148
>gi|71803392|gb|AAX72745.1| LSU ribosomal protein L13P [Streptococcus pyogenes MGAS6180] (183 aa)
Score = 314, Expect = 1.1e-27, Identities = 62/140 (44%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK  +   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:    36 MNKTTFMAKPGQV-ERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKVYYTHSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 174
>gi|78186289|ref|YP_374332.1| 50S ribosomal protein L13 [Pelodictyon luteolum DSM 273] >gi|118573426|sp|Q3B5U2|RL13_PELLD 50S ribosomal protein L13 >gi|78166191|gb|ABB23289.1| LSU ribosomal protein L13P [Pelodictyon luteolum DSM 273] (149 aa)
Score = 313, Expect = 1.1e-27, Identities = 61/146 (41%), Positives = 95/146 (65%)
  Q:     1 MQKTTFVKNEAAL---ANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K  +A      +KWYVIDA   +LG++A E A +LRGK+K  FTP+VD GD++++ N++K+ LS +K + + +++HS Y GG++  S + ++ K  +K+I  A+ GMLP N L R L +KL +Y    H   AQ P E+K++
  S:     1 MSKTLSFKTYSAKPADVERKWYVIDAEGQVLGRMAAEIARVLRGKHKPQFTPHVDTGDFIVVTNAEKVALSGNKENLKTYFSHSHYPGGVRVDSVKDLLRKKPEKIIEHAVWGMLPHNNLGRQLFRKLKVYAGTQHPHEAQAPTEMKIH 149
>gi|16273350|ref|NP_439595.1| 50S ribosomal protein L13 [Haemophilus influenzae Rd KW20] >gi|145629444|ref|ZP_01785242.1| 50S ribosomal protein L13 [Haemophilus influenzae 22.1-21] >gi|145636155|ref|ZP_01791825.1| 50S ribosomal protein L13 [Haemophilus influenzae PittHH] >gi|145641605|ref|ZP_01797182.1| 50S ribosomal protein L13 [Haemophilus influenzae R3021] >gi|148826946|ref|YP_001291699.1| 50S ribosomal protein L13 [Haemophilus influenzae PittGG] >gi|166230989|sp|A5UEW0|RL13_HAEIG 50S ribosomal protein L13 >gi|1172955|sp|P44387|RL13_HAEIN 50S ribosomal protein L13 >gi|1574283|gb|AAC23093.1| ribosomal protein L13 (rpL13) [Haemophilus influenzae Rd KW20] >gi|144978287|gb|EDJ88051.1| 50S ribosomal protein L13 [Haemophilus influenzae 22.1-21] >gi|145270677|gb|EDK10610.1| 50S ribosomal protein L13 [Haemophilus influenzae PittHH] >gi|145273652|gb|EDK13521.1| 50S ribosomal protein L13 [Haemophilus influenzae 22.4-21] >gi|148718188|gb|ABQ99315.1| 50S ribosomal protein L13 [Haemophilus influenzae PittGG] (142 aa)
Score = 313, Expect = 1.1e-27, Identities = 59/136 (43%), Positives = 91/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I+IN+DK+ ++  K   + +Y H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y    H+ AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVINADKVAVTGRKETDKLYYWHTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLPKGPLGRAMFRKLKVYAGGEHQHAAQQP 137
>gi|59802332|ref|YP_209044.1| 50S ribosomal protein L13 [Neisseria gonorrhoeae FA 1090] >gi|75507276|sp|Q5F5A5|RL13_NEIG1 50S ribosomal protein L13 >gi|59719227|gb|AAW90632.1| putative 50S ribosomal protein L13 [Neisseria gonorrhoeae FA 1090] (143 aa)
Score = 313, Expect = 1.2e-27, Identities = 57/130 (43%), Positives = 94/130 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++W+VIDA + +LG++A E A+ LRGK+K ++TP+VD GDY+I+IN+DK+ ++  K + +K++ HSG+ GG+ E++ R M +++  + +  A+KGMLPK  L   +IKKL +Y  A H  AAQ+P  ++L
  S:    13 REWFVIDAQDKVLGRVATEVASRLRGKHKPEYTPHVDTGDYIIVINADKLRVTGAKFEDKKYFRHSGFPGGIYERTFREMQDQFPGRALEQAVKGMLPKGPLGYAMIKKLKVYAGAEHAHAAQQPKVLEL 142
>gi|89095038|ref|ZP_01167966.1| 50S ribosomal protein L13 [Oceanospirillum sp. MED92] >gi|89080670|gb|EAR59914.1| 50S ribosomal protein L13 [Oceanospirillum sp. MED92] (142 aa)
Score = 313, Expect = 1.2e-27, Identities = 60/141 (42%), Positives = 92/141 (65%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TFV   A +  + WYV+DA    LG+LA E A  LRGK+K ++TP+VD GDY++++N++K+ ++ +K   + +Y H+G+ GGLKE S   M+E + ++ I  A+KGMLPK  L R +  KL +Y  A H   AQ+P E+ +
  S:     3 TFVAKPAEV-KRDWYVVDAEGKTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVVNAEKVGVTGNKRKDKTYYHHTGFPGGLKEASFEKMVETFPERTIELAVKGMLPKGPLGRAMYAKLKVYAGAEHPHQAQQPKELNI 142
>gi|194557303|ref|YP_002092329.1| Ribosomal protein L13 [Burkholderia cenocepacia PC184] >gi|105891945|gb|ABF75110.1| LSU ribosomal protein L13P [Burkholderia cenocepacia AU 1054] >gi|116646791|gb|ABK07432.1| LSU ribosomal protein L13P [Burkholderia cenocepacia HI2424] >gi|124871094|gb|EAY62810.1| Ribosomal protein L13 [Burkholderia cenocepacia PC184] (176 aa)
Score = 313, Expect = 1.4e-27, Identities = 58/130 (44%), Positives = 92/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GD++IIIN+ K+ ++ +K   +K+Y HSGY GG+ E +   M E++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:    47 REWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIIINASKLKVTGNKTLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEATHPHSAQQPKALEI 176
>gi|85858180|ref|YP_460382.1| 50S ribosomal protein L13 [Syntrophus aciditrophicus SB] >gi|118573455|sp|Q2LPM2|RL13_SYNAS 50S ribosomal protein L13 >gi|85721271|gb|ABC76214.1| LSU ribosomal protein L13P [Syntrophus aciditrophicus SB] (142 aa)
Score = 312, Expect = 1.4e-27, Identities = 63/141 (44%), Positives = 103/141 (73%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           T+   E+ +A ++WY+IDA   +LG++A E A  LRGK+K ++TP+VD GD+++++N++K+VL+  K   + +Y HSGY GGLKEK+ G++M EK +D +++ A+KGMLPKN+L R +++KL +Y   +H+  AQ P  + L
  S:     3 TYQAKESEVA-REWYLIDAEGQVLGRMASEIARRLRGKHKPEYTPHVDTGDFIVVVNAEKMVLTGKKLRDKIYYHHSGYPGGLKEKTAGKMMQEKPTD-VLWLAVKGMLPKNSLGRRMLRKLKVYAGNDHRHEAQCPKVLPL 142
>gi|110616641|gb|ABF05308.1| 50S ribosomal subunit protein L13 [Shigella flexneri 5 str. 8401] (160 aa)
Score = 312, Expect = 1.4e-27, Identities = 59/140 (42%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + KT   K E     + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    18 LMKTFTAKPETV--KRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQP 155
>gi|194337371|ref|YP_002019165.1| ribosomal protein L13 [Pelodictyon phaeoclathratiforme BU-1] >gi|194309848|gb|ACF44548.1| ribosomal protein L13 [Pelodictyon phaeoclathratiforme BU-1] (149 aa)
Score = 312, Expect = 1.5e-27, Identities = 58/146 (39%), Positives = 99/146 (67%)
  Q:     1 MQKTTFVKN---EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K    + A  ++KWYV+DA   +LG++A E A +LRGK+K  FTP++D GD++++ N++K+ L+  K +++ +++HS Y GG+K    + +++K  +++I  A+ GMLP N L R L +KL +Y  + H  A+Q P+E+K+N
  S:     1 MSKTLSFKTYSAKPAEVDRKWYVVDAEGQVLGRMASEIAKVLRGKHKPQFTPHIDTGDFIVVTNAEKVALTGKKEEQKSYFSHSQYPGGVKIDHVKDLLKKRPERIIENAVWGMLPHNNLGRQLFRKLKVYAGSEHPHASQAPVEMKVN 149
>gi|114321391|ref|YP_743074.1| 50S ribosomal protein L13 [Alkalilimnicola ehrlichei MLHE-1] >gi|118573378|sp|Q0A6F3|RL13_ALHEH 50S ribosomal protein L13 >gi|114227785|gb|ABI57584.1| LSU ribosomal protein L13P [Alkalilimnicola ehrlichei MLHE-1] (142 aa)
Score = 312, Expect = 1.6e-27, Identities = 59/134 (44%), Positives = 93/134 (69%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY++++N++KI ++ +KA  + ++ H+GYIG +K  S   +I+K  +++I  A+KGMLPKN L R +IKKL +Y    H+ AAQ+P  + +
  S:     9 ADVQRDWYVVDANGKTLGRLASEVAYRLRGKHKPEYTPHVDTGDYIVVVNAEKIAVTGNKASDKMYHQHTGYIGNMKSISFEKLIDKAPERVIEKAVKGMLPKNRLGRAMIKKLKVYAGGEHRHAAQQPQPLDI 142
>gi|16329914|ref|NP_440642.1| 50S ribosomal protein L13 [Synechocystis sp. PCC 6803] >gi|2500257|sp|P73294|RL13_SYNY3 50S ribosomal protein L13 >gi|1652400|dbj|BAA17322.1| 50S ribosomal protein L13 [Synechocystis sp. PCC 6803] (151 aa)
Score = 312, Expect = 1.6e-27, Identities = 59/132 (44%), Positives = 90/132 (68%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           + KWYVIDA    LG+LA E A ILRGKNK  FTP++D GD++IIIN++KI ++  K +++ +  HSG  GG+KE++   +  +  ++++  A++GMLPKN+L R L  KL +Y   +H  AAQ+P  + +N
  S:    13 DHKWYVIDAEGQRLGRLATEVATILRGKNKPTFTPHMDTGDFVIIINAEKIEVTGRKREQKLYRRHSGRPGGMKEETFEKLQVRLPERIVESAVRGMLPKNSLGRKLFTKLKVYAGPSHPHAAQQPETLVIN 144
>gi|266922|sp|Q00990|RL13_STACA 50S ribosomal protein L13 >gi|46912|emb|CAA45367.1| ribosomal protein L13 [Staphylococcus carnosus] >gi|383760|prf||1904196A ribosomal protein L13 (145 aa)
Score = 312, Expect = 1.7e-27, Identities = 65/143 (45%), Positives = 95/143 (66%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + TF+ NE+ +  +KWYVIDA+   LG+L+ E A+ILRGK+K  +TP+VD GDY+IIIN+ +I ++  KA  + +Y HS Y GG+K  +   + EK  ++L+  +IKGMLP + L     KKLF+Y  A H  AAQ+P   +L
  S:     2 RQTFMANESNI-ERKWYVIDAAGQTLGRLSSEVASILRGKHKATYTPHVDSGDYVIIINAGQIEMTGKKASDKVYYRHSNYPGGIKSITAGELREKNPERLLEISIKGMLPSSRLGEKQGKKLFVYGGAEHPHAAQQPENYEL 143
>gi|82545540|ref|YP_409487.1| 50S ribosomal protein L13 [Shigella boydii Sb227] >gi|187733712|ref|YP_001881862.1| ribosomal protein L13 [Shigella boydii CDC 3083-94] >gi|118573449|sp|Q31W99|RL13_SHIBS 50S ribosomal protein L13 >gi|81246951|gb|ABB67659.1| 50S ribosomal subunit protein L13 [Shigella boydii Sb227] >gi|187430704|gb|ACD09978.1| ribosomal protein L13 [Shigella boydii CDC 3083-94] (142 aa)
Score = 311, Expect = 2.0e-27, Identities = 55/125 (44%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKCTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQP 137
>gi|57867746|ref|YP_189362.1| 50S ribosomal protein L13 [Staphylococcus epidermidis RP62A] >gi|81673649|sp|Q5HM31|RL13_STAEQ 50S ribosomal protein L13 >gi|57638404|gb|AAW55192.1| ribosomal protein L13 [Staphylococcus epidermidis RP62A] (145 aa)
Score = 311, Expect = 2.3e-27, Identities = 66/143 (46%), Positives = 90/143 (62%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + TF+ NE+ +  +KWYVIDA    LG+L+ E A ILRGKNKV +TP+VD GDY+IIIN+ KI  + +K   + +Y HS + GGLK  S   +     ++L+  +IKGMLP   L     KKLF+Y  A H  AAQ+P   +L
  S:     2 RQTFMANESNI-ERKWYVIDAEGQTLGRLSSEVAAILRGKNKVTYTPHVDTGDYVIIINASKIEFTGNKEQDKMYYRHSNHPGGLKSISAGELKRTNPERLLETSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYEL 143
>gi|49076472|gb|AAT49567.1| PA4433 [synthetic construct] (143 aa)
Score = 311, Expect = 2.4e-27, Identities = 56/130 (43%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+++IN++++ ++  K   + +Y HSG+ GG+K  +   +I K  +++I  A+KGMLPKN L R + +KL +YK A+H   AQ+P E+K+
  S:    13 RDWFVVDAAGRTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKTTDKMYYHHSGFPGGIKSINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYKGASHPHTAQQPQELKI 142
>gi|83591241|ref|YP_431250.1| 50S ribosomal protein L13 [Moorella thermoacetica ATCC 39073] >gi|118573421|sp|Q2RFT2|RL13_MOOTA 50S ribosomal protein L13 >gi|83574155|gb|ABC20707.1| LSU ribosomal protein L13P [Moorella thermoacetica ATCC 39073] (144 aa)
Score = 310, Expect = 2.4e-27, Identities = 59/129 (45%), Positives = 93/129 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM--EIK 144
           +KWYVIDA+   LG++A EAA +LRGK+K  FTP+VD GDY+IIIN+ K+ L+ +K  ++++  H+GY GGL+  +   ++  + ++ +  A+KGM+P N+L R ++KKL +Y+  +H  AAQ+P   EIK
  S:    13 RKWYVIDAAGKTLGRVATEAARLLRGKHKPIFTPHVDTGDYVIIINAAKVRLTGNKLQKKQYIRHTGYPGGLRVMNYATLLRTFPERAVEKAVKGMIPHNSLGRKMVKKLKVYRGDSHPHAAQQPQVWEIK 143
>gi|49474262|ref|YP_032304.1| 50S ribosomal protein L13 [Bartonella quintana str. Toulouse] >gi|81696036|sp|Q6FZQ6|RL13_BARQU 50S ribosomal protein L13 >gi|49239766|emb|CAF26153.1| 50s ribosomal protein l13 [Bartonella quintana str. Toulouse] (154 aa)
Score = 310, Expect = 2.5e-27, Identities = 58/125 (46%), Positives = 91/125 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW +IDA NL+LG+LA   AN LRGK+K  FTP+VD GD +I+IN+DKIVL+  K   +K+Y H+GYIGG+KE++ R ++E ++ ++++  A++ M+P+  L R  ++ L +Y  + +  AAQ+P
  S:    13 KKWVIIDAENLVLGRLAAFVANRLRGKHKATFTPHVDDGDNVIVINADKIVLTGKKYTDKKYYWHTGYIGGIKERTARQILEGRFPERVVEKAVERMIPRGPLGRRQLRNLHVYAGSQNPHAAQQP 138
>gi|163938151|ref|YP_001643035.1| 50S ribosomal protein L13 [Bacillus weihenstephanensis KBAB4] >gi|163860348|gb|ABY41407.1| ribosomal protein L13 [Bacillus weihenstephanensis KBAB4] (145 aa)
Score = 310, Expect = 2.5e-27, Identities = 63/138 (45%), Positives = 93/138 (67%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TTF+  +A    +KWYV+DA    LG+L+ E A+ILRGK+K  FTP+VD GD++IIIN++KI L+ +K + + +Y H+ + GGLK+++   M   Y  +++  AIKGMLPK  L R + KKL +Y  A H   AQ+P
  S:     2 RTTFMA-KANEVERKWYVVDAEGQTLGRLSTEVASILRGKHKPTFTPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLELAIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQQP 138
>gi|88704080|ref|ZP_01101795.1| 50S ribosomal protein L13 [gamma proteobacterium KT 71] >gi|88701907|gb|EAQ99011.1| 50S ribosomal protein L13 [Congregibacter litoralis KT71] (142 aa)
Score = 310, Expect = 2.7e-27, Identities = 56/128 (43%), Positives = 90/128 (70%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           WYV+DA++  LG+LA E A+ LRGK+K ++TP+VD GDY+++IN++K+ ++  K   + ++ H+GY GGLK  S   +I+K  +++I GA+KGMLP+N L R +  KL +Y    H  AAQ+P  +++
  S:    15 WYVVDATDKTLGRLASEIAHRLRGKHKAEYTPHVDTGDYIVVINAEKVHVTGAKRTDKMYHRHTGYPGGLKSLSFEKLIDKAPERVIQGAVKGMLPRNPLGRAMFSKLKVYAGDAHPHAAQQPQPLQV 142
>gi|82701695|ref|YP_411261.1| 50S ribosomal protein L13 [Nitrosospira multiformis ATCC 25196] >gi|118573423|sp|Q2YBK2|RL13_NITMU 50S ribosomal protein L13 >gi|82409760|gb|ABB73869.1| LSU ribosomal protein L13P [Nitrosospira multiformis ATCC 25196] (144 aa)
Score = 310, Expect = 2.7e-27, Identities = 58/131 (44%), Positives = 92/131 (70%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           N++W+VIDA+  +LG+LA E A+ LRGK+K  +TP+VD GD++++IN DK+ ++ +KA+ + +Y HSGY GG+ E S   M  ++  + +  A+KGMLPK  L   ++KKL IY  A H  AAQ+P ++++
  S:    12 NREWFVIDAAGKVLGRLAAEIAHRLRGKHKPIYTPHVDTGDFIVVINVDKMRVTGNKAESKMYYRHSGYPGGIYETSFAKMHARFPGRPLEKAVKGMLPKGPLGYAMLKKLKIYAGAAHPHAAQQPRQLEV 142
>gi|15599629|ref|NP_253123.1| 50S ribosomal protein L13 [Pseudomonas aeruginosa PAO1] >gi|107099982|ref|ZP_01363900.1| hypothetical protein PaerPA_01001003 [Pseudomonas aeruginosa PACS2] >gi|116052466|ref|YP_792779.1| 50S ribosomal protein L13 [Pseudomonas aeruginosa UCBPP-PA14] >gi|194549890|ref|YP_002084918.1| 50S ribosomal protein L13 [Pseudomonas aeruginosa C3719] >gi|194555741|ref|YP_002090768.1| 50S ribosomal protein L13 [Pseudomonas aeruginosa 2192] >gi|122257527|sp|Q02H07|RL13_PSEAB 50S ribosomal protein L13 >gi|81783576|sp|Q9HVY2|RL13_PSEAE 50S ribosomal protein L13 >gi|9950666|gb|AAG07821.1|AE004857_12 50S ribosomal protein L13 [Pseudomonas aeruginosa PAO1] >gi|115587687|gb|ABJ13702.1| ribosomal protein L13 [Pseudomonas aeruginosa UCBPP-PA14] >gi|126170836|gb|EAZ56347.1| 50S ribosomal protein L13 [Pseudomonas aeruginosa C3719] >gi|126198134|gb|EAZ62197.1| 50S ribosomal protein L13 [Pseudomonas aeruginosa 2192] (142 aa)
Score = 310, Expect = 2.7e-27, Identities = 56/130 (43%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+++IN++++ ++  K   + +Y HSG+ GG+K  +   +I K  +++I  A+KGMLPKN L R + +KL +YK A+H   AQ+P E+K+
  S:    13 RDWFVVDAAGQTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKTTDKMYYHHSGFPGGIKSINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYKGASHPHTAQQPQELKI 142
>gi|15900228|ref|NP_344832.1| 50S ribosomal protein L13 [Streptococcus pneumoniae TIGR4] >gi|15902315|ref|NP_357865.1| 50S ribosomal protein L13 [Streptococcus pneumoniae R6] >gi|116516171|ref|YP_815792.1| 50S ribosomal protein L13 [Streptococcus pneumoniae D39] >gi|148983702|ref|ZP_01817021.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP3-BS71] >gi|148988036|ref|ZP_01819499.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP6-BS73] >gi|148994679|ref|ZP_01823783.1| ribosomal protein L13 [Streptococcus pneumoniae SP9-BS68] >gi|148996720|ref|ZP_01824438.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP11-BS70] >gi|149001586|ref|ZP_01826559.1| ribosomal protein L13 [Streptococcus pneumoniae SP14-BS69] >gi|149006048|ref|ZP_01829777.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP18-BS74] >gi|149011166|ref|ZP_01832471.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP19-BS75] >gi|168484168|ref|ZP_02709120.1| ribosomal protein L13 [Streptococcus pneumoniae CDC1873-00] >gi|168486579|ref|ZP_02711087.1| ribosomal protein L13 [Streptococcus pneumoniae CDC1087-00] >gi|168489772|ref|ZP_02713971.1| ribosomal protein L13 [Streptococcus pneumoniae SP195] >gi|168490776|ref|ZP_02714919.1| ribosomal protein L13 [Streptococcus pneumoniae CDC0288-04] >gi|168494708|ref|ZP_02718851.1| ribosomal protein L13 [Streptococcus pneumoniae CDC3059-06] >gi|168576708|ref|ZP_02722566.1| ribosomal protein L13 [Streptococcus pneumoniae MLV-016] >gi|169833297|ref|YP_001693822.1| ribosomal protein L13 [Streptococcus pneumoniae Hungary19A-6] >gi|182683278|ref|YP_001835025.1| 50S ribosomal protein L13 [Streptococcus pneumoniae CGSP14] >gi|14971767|gb|AAK74472.1| ribosomal protein L13 [Streptococcus pneumoniae TIGR4] >gi|15457822|gb|AAK99075.1| 50S Ribosomal protein L13 [Streptococcus pneumoniae R6] >gi|116076747|gb|ABJ54467.1| ribosomal protein L13 [Streptococcus pneumoniae D39] >gi|147757295|gb|EDK64334.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP11-BS70] >gi|147760044|gb|EDK67033.1| ribosomal protein L13 [Streptococcus pneumoniae SP14-BS69] >gi|147762404|gb|EDK69365.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP18-BS74] >gi|147764802|gb|EDK71732.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP19-BS75] >gi|147923849|gb|EDK74961.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP3-BS71] >gi|147926500|gb|EDK77573.1| 50S ribosomal protein L13 [Streptococcus pneumoniae SP6-BS73] >gi|147927079|gb|EDK78119.1| ribosomal protein L13 [Streptococcus pneumoniae SP9-BS68] >gi|168995799|gb|ACA36411.1| ribosomal protein L13 [Streptococcus pneumoniae Hungary19A-6] >gi|172042551|gb|EDT50597.1| ribosomal protein L13 [Streptococcus pneumoniae CDC1873-00] >gi|182628612|gb|ACB89560.1| 50S ribosomal protein L13 [Streptococcus pneumoniae CGSP14] >gi|183570403|gb|EDT90931.1| ribosomal protein L13 [Streptococcus pneumoniae CDC1087-00] >gi|183571848|gb|EDT92376.1| ribosomal protein L13 [Streptococcus pneumoniae SP195] >gi|183574818|gb|EDT95346.1| ribosomal protein L13 [Streptococcus pneumoniae CDC0288-04] >gi|183575404|gb|EDT95932.1| ribosomal protein L13 [Streptococcus pneumoniae CDC3059-06] >gi|183577568|gb|EDT98096.1| ribosomal protein L13 [Streptococcus pneumoniae MLV-016] (148 aa)
Score = 310, Expect = 2.7e-27, Identities = 63/140 (45%), Positives = 94/140 (67%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS + GGLK+ S   +  K + +LI  ++KGMLP NTL R    KL ++  A H  AAQ+P
  S:     1 MNKTTFMAKPGQV-ERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQP 139
>gi|121602570|ref|YP_989186.1| 50S ribosomal protein L13 [Bartonella bacilliformis KC583] >gi|166230962|sp|A1UT83|RL13_BARBK 50S ribosomal protein L13 >gi|120614747|gb|ABM45348.1| ribosomal protein L13 [Bartonella bacilliformis KC583] (154 aa)
Score = 310, Expect = 2.8e-27, Identities = 61/136 (44%), Positives = 95/136 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF +  A +  KKW +IDA NL+LG+LA   AN LRGK+K  FTP+VD GD +I+IN+DK+VL+  K   +K+Y H+GYIGG+KE++ R ++E ++ +++I  A++ M+P+  L R  ++ L +Y  + H   AQ+P
  S:     3 TFSQKPAEVV-KKWILIDAENLVLGRLATLVANRLRGKHKPTFTPHVDDGDNVIVINADKVVLTGKKYTDKKYYWHTGYIGGIKERTARQILEGRFPERIIEKAVERMIPRGPLGRRQMRNLRVYAGSQHPHEAQQP 138
>gi|15925208|ref|NP_372742.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus Mu50] >gi|15927798|ref|NP_375331.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus N315] >gi|21283866|ref|NP_646954.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus MW2] >gi|49484432|ref|YP_041656.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49487000|ref|YP_044221.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650802|ref|YP_187017.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus COL] >gi|82751808|ref|YP_417549.1| 50S ribosomal protein L13 [Staphylococcus aureus RF122] >gi|87161168|ref|YP_494807.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus USA300] >gi|88196130|ref|YP_500947.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268658|ref|YP_001247601.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus JH9] >gi|150394723|ref|YP_001317398.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus JH1] >gi|151222332|ref|YP_001333154.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980533|ref|YP_001442792.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus Mu3] >gi|161510422|ref|YP_001576081.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727001|ref|ZP_02759278.1| ribosomal protein L13 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122538869|sp|Q2FW38|RL13_STAA8 50S ribosomal protein L13 >gi|123484815|sp|Q2FES1|RL13_STAA3 50S ribosomal protein L13 >gi|123549318|sp|Q2YYM8|RL13_STAAB 50S ribosomal protein L13 >gi|166199623|sp|A7X5B4|RL13_STAA1 50S ribosomal protein L13 >gi|172049002|sp|A6QJ60|RL13_STAAE 50S ribosomal protein L13 >gi|189041024|sp|A6U3U3|RL13_STAA2 50S ribosomal protein L13 >gi|189041025|sp|A5IV02|RL13_STAA9 50S ribosomal protein L13 >gi|189041026|sp|A8Z325|RL13_STAAT 50S ribosomal protein L13 >gi|81693976|sp|Q5HDZ0|RL13_STAAC 50S ribosomal protein L13 >gi|81696286|sp|Q6G7A3|RL13_STAAS 50S ribosomal protein L13 >gi|81696448|sp|Q6GEL7|RL13_STAAR 50S ribosomal protein L13 >gi|81704223|sp|Q7A089|RL13_STAAW 50S ribosomal protein L13 >gi|81705252|sp|Q7A473|RL13_STAAN 50S ribosomal protein L13 >gi|81781104|sp|Q99S51|RL13_STAAM 50S ribosomal protein L13 >gi|13702018|dbj|BAB43310.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus N315] >gi|14247991|dbj|BAB58380.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus Mu50] >gi|21205308|dbj|BAB96002.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus MW2] >gi|49242561|emb|CAG41282.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245443|emb|CAG43920.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284988|gb|AAW37082.1| ribosomal protein L13 [Staphylococcus aureus subsp. aureus COL] >gi|82657339|emb|CAI81780.1| 50S ribosomal protein L13 [Staphylococcus aureus RF122] >gi|87127142|gb|ABD21656.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203688|gb|ABD31498.1| ribosomal protein L13 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741727|gb|ABQ50025.1| LSU ribosomal protein L13P [Staphylococcus aureus subsp. aureus JH9] >gi|149947175|gb|ABR53111.1| ribosomal protein L13 [Staphylococcus aureus subsp. aureus JH1] >gi|150375132|dbj|BAF68392.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722668|dbj|BAF79085.1| 50S ribosomal protein L13 [Staphylococcus aureus subsp. aureus Mu3] >gi|160369231|gb|ABX30202.1| ribosomal protein L13 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (145 aa)
Score = 310, Expect = 2.9e-27, Identities = 64/143 (44%), Positives = 91/143 (63%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + TF+ NE+ +  +KWYVIDA    LG+L+ E A+ILRGKNKV +TP+VD GDY+I+IN+ KI  + +K   + +Y HS + GG+K  +   +     ++LI  +IKGMLP   L     KKLF+Y  A H  AAQ+P   +L
  S:     2 RQTFMANESNI-ERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYEL 143
>gi|25010284|ref|NP_734679.1| 50S ribosomal protein L13 [Streptococcus agalactiae NEM316] >gi|77409661|ref|ZP_00786331.1| ribosomal protein L13 [Streptococcus agalactiae COH1] >gi|77413796|ref|ZP_00789976.1| ribosomal protein L13 [Streptococcus agalactiae 515] >gi|23094636|emb|CAD45854.1| 50S ribosomal protein L13 [Streptococcus agalactiae NEM316] >gi|77160158|gb|EAO71289.1| ribosomal protein L13 [Streptococcus agalactiae 515] >gi|77171730|gb|EAO74929.1| ribosomal protein L13 [Streptococcus agalactiae COH1] (148 aa)
Score = 309, Expect = 3.4e-27, Identities = 63/140 (45%), Positives = 93/140 (66%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK+ S   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:     1 MNKTTFMAKPGQV-ERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKASDKIYYTHSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 139
>gi|74313761|ref|YP_312180.1| 50S ribosomal protein L13 [Shigella sonnei Ss046] >gi|118573451|sp|Q3YX17|RL13_SHISS 50S ribosomal protein L13 >gi|73857238|gb|AAZ89945.1| 50S ribosomal subunit protein L13 [Shigella sonnei Ss046] (142 aa)
Score = 309, Expect = 3.4e-27, Identities = 56/125 (44%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ S   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQVSFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQP 137
>gi|78221827|ref|YP_383574.1| 50S ribosomal protein L13 [Geobacter metallireducens GS-15] >gi|118573404|sp|Q39Y25|RL13_GEOMG 50S ribosomal protein L13 >gi|78193082|gb|ABB30849.1| LSU ribosomal protein L13P [Geobacter metallireducens GS-15] (143 aa)
Score = 309, Expect = 3.6e-27, Identities = 61/145 (42%), Positives = 98/145 (67%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M+ T   K E     + W+++DA N +LG++A E ANILRGK K  +TP+VD GD+++++N++KI L+ +K   + +Y+HSG+ GG+K  +   +IEK  + LI  A+KGMLPKN L+R+++KKL +Y    H   AQ+P  +++
  S:     1 MKTTKVAKKEEV--TRDWFLVDADNKVLGRMATEIANILRGKKKPIYTPSVDTGDFVVVVNAEKIQLTGNKLADKMYYSHSGFPGGIKSIAAGKLIEKKPEDLIRKAVKGMLPKNKLARHMLKKLKVYAGPAHPHEAQQPKTLEI 143
>gi|15606909|ref|NP_214290.1| 50S ribosomal protein L13 [Aquifex aeolicus VF5] >gi|7674160|sp|O67722|RL13_AQUAE 50S ribosomal protein L13 >gi|2984157|gb|AAC07691.1| ribosomal protein L13 [Aquifex aeolicus VF5] (144 aa)
Score = 309, Expect = 3.7e-27, Identities = 63/143 (44%), Positives = 98/143 (68%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KT  +K E     +KW+V+DA+   LG+LA E A ILRGK+K  + P+VDCGD++I+IN++KI ++  K +++K+Y HS Y GGLKE++ + M+E   +++I  A+K MLPKN L   ++KKL +Y+   H   AQKP  +++
  S:     2 KTYRIKPEEV--ERKWWVVDATGKTLGRLASEIAKILRGKHKPYYQPDVDCGDFVIVINAEKIRVTGKKLEQKKYYWHSRYPGGLKERTLKWMLENKPEEVIRLAVKRMLPKNRLGHRMLKKLKVYRGPEHPHQAQKPQPLEV 142
>gi|87120443|ref|ZP_01076337.1| 50S ribosomal protein L13 [Marinomonas sp. MED121] >gi|86164086|gb|EAQ65357.1| 50S ribosomal protein L13 [Marinomonas sp. MED121] (147 aa)
Score = 309, Expect = 3.7e-27, Identities = 57/141 (40%), Positives = 94/141 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TF    A +  + W+VIDA    LG+LA E A  LRGK+K ++TP+VD GDY+++IN++K+ ++ +KA  +++Y H+GY GGL+  +   +I+   ++++  A+KGMLPK  L R + KK+ +Y    H  AAQ+P+E+ +
  S:     8 TFTAKPAEV-RRDWFVIDAEGKTLGRLATEIARRLRGKHKAEYTPHVDTGDYIVVINAEKVHVTGNKAKAKQYYRHTGYPGGLRSMNFETLIDHAPERVLELAVKGMLPKGPLGRAMHKKMKVYAGTQHPHAAQQPLELNI 147
>gi|22536398|ref|NP_687249.1| 50S ribosomal protein L13 [Streptococcus agalactiae 2603V/R] >gi|76787735|ref|YP_328944.1| 50S ribosomal protein L13 [Streptococcus agalactiae A909] >gi|76798156|ref|ZP_00780409.1| ribosomal protein L13 [Streptococcus agalactiae 18RS21] >gi|77405338|ref|ZP_00782433.1| ribosomal protein L13 [Streptococcus agalactiae H36B] >gi|77410934|ref|ZP_00787290.1| ribosomal protein L13 [Streptococcus agalactiae CJB111] >gi|22533225|gb|AAM99121.1|AE014201_19 ribosomal protein L13 [Streptococcus agalactiae 2603V/R] >gi|76562792|gb|ABA45376.1| ribosomal protein L13 [Streptococcus agalactiae A909] >gi|76586515|gb|EAO63020.1| ribosomal protein L13 [Streptococcus agalactiae 18RS21] >gi|77162989|gb|EAO73944.1| ribosomal protein L13 [Streptococcus agalactiae CJB111] >gi|77176016|gb|EAO78790.1| ribosomal protein L13 [Streptococcus agalactiae H36B] (148 aa)
Score = 309, Expect = 3.7e-27, Identities = 63/140 (45%), Positives = 93/140 (66%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK+ S   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:     1 MNKTTFMAKPGQV-ERKWYVVDAADVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKASDKIYYTHSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 139
>gi|55820195|ref|YP_138637.1| 50S ribosomal protein L13 [Streptococcus thermophilus LMG 18311] >gi|55822083|ref|YP_140524.1| 50S ribosomal protein L13 [Streptococcus thermophilus CNRZ1066] >gi|116627053|ref|YP_819672.1| 50S ribosomal protein L13 [Streptococcus thermophilus LMD-9] >gi|55736180|gb|AAV59822.1| 50S ribosomal protein L13 [Streptococcus thermophilus LMG 18311] >gi|55738068|gb|AAV61709.1| 50S ribosomal protein L13 [Streptococcus thermophilus CNRZ1066] >gi|116100330|gb|ABJ65476.1| LSU ribosomal protein L13P [Streptococcus thermophilus LMD-9] (148 aa)
Score = 309, Expect = 3.8e-27, Identities = 63/140 (45%), Positives = 93/140 (66%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK+ S   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:     1 MNKTTFMAKPGQV-ERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 139
>gi|72163013|ref|YP_290670.1| 50S ribosomal protein L13 [Thermobifida fusca YX] >gi|118573460|sp|Q47LM5|RL13_THEFY 50S ribosomal protein L13 >gi|71916745|gb|AAZ56647.1| LSU ribosomal protein L13P [Thermobifida fusca YX] (149 aa)
Score = 309, Expect = 3.8e-27, Identities = 57/126 (45%), Positives = 88/126 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM 141
           ++W+VIDAS+++LG+LA   A +LRGK+K  + P+VD GDY+I++N+DK+VL+  K ++++ Y HSGY GGL+      ++ K   + +  A+KGMLPKN+L R + KKL +Y    H   AQKP+
  S:    13 RQWHVIDASDVVLGRLASRVATLLRGKHKPYYAPHVDTGDYVIVVNADKVVLTGKKLEQKRAYRHSGYPGGLRSIPYSELMAKNPARAVEKAVKGMLPKNSLGRRMAKKLKVYAGPEHPHQAQKPV 138
>gi|33152550|ref|NP_873903.1| 50S ribosomal protein L13 [Haemophilus ducreyi 35000HP] >gi|81713014|sp|Q7VLF6|RL13_HAEDU 50S ribosomal protein L13 >gi|33148774|gb|AAP96292.1| 50S ribosomal protein L13 [Haemophilus ducreyi 35000HP] (140 aa)
Score = 309, Expect = 4.0e-27, Identities = 60/136 (44%), Positives = 92/136 (67%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV   A    + WYV+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+I+IN++K+V++  K   + +Y H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:     3 TFV---AETVKRDWYVVDAAGKTLGRLATELASRLRGKHKAEYTPHVDTGDYIIVINAEKVVVTGKKETDKIYYWHTGYVGGIKDATFKEMISRRPEAVIEIAVKGMLPKGPLGRDMFRKLKVYAGNTHNHAAQQP 135
>gi|65317588|ref|ZP_00390547.1| COG0102: Ribosomal protein L13 [Bacillus anthracis str. A2012] (140 aa)
Score = 309, Expect = 4.1e-27, Identities = 62/125 (49%), Positives = 86/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYV+DA    LG+LA E A+ILRGKNK  FTP+VD GD++IIIN++KI L+ +K + + +Y H+ + GGLK+++   M   Y  +++  AIKGMLPK  L R + KKL +Y  A H   AQKP
  S:     9 RKWYVVDAEGQTLGRLASEVASILRGKNKPTFTPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLELAIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKP 133
>gi|15612731|ref|NP_241034.1| 50S ribosomal protein L13 [Bacillus halodurans C-125] >gi|81788227|sp|Q9KGD5|RL13_BACHD 50S ribosomal protein L13 >gi|10172780|dbj|BAB03887.1| 50S ribosomal protein L13 [Bacillus halodurans C-125] (145 aa)
Score = 308, Expect = 4.2e-27, Identities = 64/125 (51%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYV+DA    LG+LA E A+ILRGK+K  +TP+VD GD++IIIN++KI L+ +K   + +Y HSG+ GGLKE     M     +K++  AIKGMLPKNTL R    KL +Y  + HK  AQKP
  S:    14 RKWYVVDAEGQTLGRLASEVASILRGKHKPTYTPHVDTGDHVIIINAEKIHLTGNKLQDKIYYRHSGHPGGLKETRAADMRANKPEKMLELAIKGMLPKNTLGRKQGMKLHVYAGSEHKHQAQKP 138
>gi|113460895|ref|YP_718962.1| 50S ribosomal protein L13 [Haemophilus somnus 129PT] >gi|118573405|sp|Q0I2N3|RL13_HAES1 50S ribosomal protein L13 >gi|112822938|gb|ABI25027.1| LSU ribosomal protein L13P [Haemophilus somnus 129PT] (142 aa)
Score = 308, Expect = 4.2e-27, Identities = 57/136 (41%), Positives = 92/136 (67%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+++IN++K+ ++ +K   + +Y H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y  + H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIVVINAEKVAVTGNKETDKLYYWHTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLPKGPLGRAMFRKLKVYAGSEHNHAAQQP 137
>gi|194507222|ref|YP_002019760.1| 50S ribosomal protein L13 [Burkholderia pseudomallei Pasteur 52237] >gi|76581450|gb|ABA50925.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 1710b] >gi|83654957|gb|ABC39020.1| ribosomal protein L13 [Burkholderia thailandensis E264] >gi|157939174|gb|EDO94844.1| 50S ribosomal protein L13 [Burkholderia pseudomallei Pasteur 52237] (179 aa)
Score = 308, Expect = 4.4e-27, Identities = 58/136 (42%), Positives = 94/136 (69%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +A    ++WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GD++I+IN+ K+ ++ +K   +K+Y HSGY GG+ E +   M E++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:    44 KAHEVTREWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIVINASKLKVTGNKTLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEATHPHSAQQPKALEI 179
>gi|132659|sp|P12629|RK13_SPIOL 50S ribosomal protein L13, chloroplast precursor (CL13) >gi|189096134|pdb|3BBO|L Chain L, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome >gi|170133|gb|AAA34040.1| ribosomal protein L13 (250 aa)
Score = 308, Expect = 4.4e-27, Identities = 56/131 (42%), Positives = 90/131 (68%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KKWYV+DA++LILG++A   A  +RGKN   +TP+VD G ++I++N+DK+ +S  K  ++ +  HSG  GGLKE++   + ++  +++I  A++GMLPK  L RYL   L +YK A H   AQ+P+++ L
  S:   111 DKKWYVVDATDLILGRMASTIAIHIRGKNLASYTPSVDMGAFVIVVNADKVAVSGKKRTQKLYRRHSGRPGGLKEETFDQLQKRIPERIIEHAVRGMLPKGRLGRYLFNHLKVYKGAEHPHQAQQPIDLPL 241
>gi|77460915|ref|YP_350422.1| 50S ribosomal protein L13 [Pseudomonas fluorescens PfO-1] >gi|118573431|sp|Q3K723|RL13_PSEPF 50S ribosomal protein L13 >gi|77384918|gb|ABA76431.1| LSU ribosomal protein L13P [Pseudomonas fluorescens PfO-1] (142 aa)
Score = 308, Expect = 4.4e-27, Identities = 56/130 (43%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+++IN+++I ++  K   + +Y+HSG+ GG+K  +   +I K  +++I  A+KGMLPKN L R + +KL +Y  A H   AQ+P E+K+
  S:    13 RDWFVVDAAGQTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEQIRVTGAKTTDKMYYSHSGFPGGIKSINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYAGAAHPHTAQQPQELKI 142
>gi|15803765|ref|NP_289799.1| 50S ribosomal protein L13 [Escherichia coli O157:H7 EDL933] >gi|15833358|ref|NP_312131.1| 50S ribosomal protein L13 [Escherichia coli O157:H7 str. Sakai] >gi|16131121|ref|NP_417698.1| 50S ribosomal subunit protein L13 [Escherichia coli str. K-12 substr. MG1655] >gi|16762105|ref|NP_457722.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16766640|ref|NP_462255.1| 50S ribosomal protein L13 [Salmonella typhimurium LT2] >gi|29143594|ref|NP_806936.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|30064564|ref|NP_838735.1| 50S ribosomal protein L13 [Shigella flexneri 2a str. 2457T] >gi|56415273|ref|YP_152348.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56480292|ref|NP_709028.2| 50S ribosomal protein L13 [Shigella flexneri 2a str. 301] >gi|89109993|ref|AP_003773.1| 50S ribosomal subunit protein L13 [Escherichia coli W3110] >gi|110643465|ref|YP_671195.1| 50S ribosomal protein L13 [Escherichia coli 536] >gi|117625515|ref|YP_858838.1| 50S ribosomal protein L13 [Escherichia coli APEC O1] >gi|157154937|ref|YP_001464704.1| 50S ribosomal protein L13 [Escherichia coli E24377A] >gi|157162709|ref|YP_001460027.1| 50S ribosomal protein L13 [Escherichia coli HS] >gi|161486103|ref|NP_755851.2| 50S ribosomal protein L13 [Escherichia coli CFT073] >gi|161506092|ref|YP_001573204.1| 50S ribosomal protein L13 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161616361|ref|YP_001590326.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|162138363|ref|YP_542636.2| 50S ribosomal protein L13 [Escherichia coli UTI89] >gi|162139327|ref|YP_690613.2| 50S ribosomal protein L13 [Shigella flexneri 5 str. 8401] >gi|162139537|ref|YP_218270.2| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|168223482|ref|ZP_02648714.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168228665|ref|ZP_02653896.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168262638|ref|ZP_02684611.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168463425|ref|ZP_02697342.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168477451|ref|ZP_02706474.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168708805|ref|ZP_02741082.1| 50S ribosomal protein L13 [Escherichia coli O157:H7 str. EC4045] >gi|168718044|ref|ZP_02750321.1| 50S ribosomal protein L13 [Escherichia coli O157:H7 str. EC4206] >gi|168734765|ref|ZP_02767042.1| 50S ribosomal protein L13 [Escherichia coli O157:H7 str. EC4115] >gi|168754210|ref|ZP_02779217.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4401] >gi|168763765|ref|ZP_02788772.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4501] >gi|168769084|ref|ZP_02794091.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4486] >gi|168777623|ref|ZP_02802630.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4196] >gi|168781372|ref|ZP_02806379.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4076] >gi|168786114|ref|ZP_02811121.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC869] >gi|168795864|ref|ZP_02820871.1| 50S ribosomal protein L13 [Escherichia coli O157:H7 str. EC4042] >gi|168800941|ref|ZP_02825948.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC508] >gi|170018525|ref|YP_001723479.1| ribosomal protein L13 [Escherichia coli ATCC 8739] >gi|170082763|ref|YP_001732083.1| 50S ribosomal subunit protein L13 [Escherichia coli str. K12 substr. DH10B] >gi|170681781|ref|YP_001745503.1| ribosomal protein L13 [Escherichia coli SMS-3-5] >gi|170765685|ref|ZP_02900496.1| ribosomal protein L13 [Escherichia albertii TW07627] >gi|188494773|ref|ZP_03002043.1| ribosomal protein L13 [Escherichia coli 53638] >gi|191168169|ref|ZP_03029965.1| ribosomal protein L13 [Escherichia coli B7A] >gi|193065365|ref|ZP_03046436.1| ribosomal protein L13 [Escherichia coli E22] >gi|193070325|ref|ZP_03051268.1| ribosomal protein L13 [Escherichia coli E110019] >gi|194429107|ref|ZP_03061637.1| ribosomal protein L13 [Escherichia coli B171] >gi|194439173|ref|ZP_03071254.1| ribosomal protein L13 [Escherichia coli 101-1] >gi|194442420|ref|YP_002042600.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194451041|ref|YP_002047373.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194470150|ref|ZP_03076134.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194737700|ref|YP_002116293.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195939426|ref|ZP_03084808.1| 50S ribosomal protein L13 [Escherichia coli O157:H7 str. EC4024] >gi|76363497|sp|P0AA10|RL13_ECOLI 50S ribosomal protein L13 >gi|166230982|sp|A1AGC4|RL13_ECOK1 50S ribosomal protein L13 >gi|166982660|sp|A7ZSC5|RL13_ECO24 50S ribosomal protein L13 >gi|166982661|sp|A8A540|RL13_ECOHS 50S ribosomal protein L13 >gi|189041004|sp|B1IQP8|RL13_ECOLC 50S ribosomal protein L13 >gi|189041020|sp|A9MNY0|RL13_SALAR 50S ribosomal protein L13 >gi|189041021|sp|A9N840|RL13_SALPB 50S ribosomal protein L13 >gi|81678003|sp|Q5PJS5|RL13_SALPA 50S ribosomal protein L13 >gi|88930450|sp|P0AA14|RL13_SALTI 50S ribosomal protein L13 >gi|92090376|sp|P0AA11|RL13_ECOL6 50S ribosomal protein L13 >gi|92090377|sp|P0AA15|RL13_SHIFL 50S ribosomal protein L13 >gi|93141050|sp|P0AA12|RL13_ECO57 50S ribosomal protein L13 >gi|118573400|sp|Q0TCN5|RL13_ECOL5 50S ribosomal protein L13 >gi|118573401|sp|Q1R6A9|RL13_ECOUT 50S ribosomal protein L13 >gi|118573443|sp|Q57JC3|RL13_SALCH 50S ribosomal protein L13 >gi|118597362|sp|P0AA13|RL13_SALTY 50S ribosomal protein L13 >gi|25295185|pir||AG0908 ribosomal protein L13 [similarity] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|33357909|pdb|1P85|H Chain H, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome >gi|33357937|pdb|1P86|H Chain H, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome >gi|83754070|pdb|2AW4|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754126|pdb|2AWB|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666579|pdb|1VS6|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666631|pdb|1VS8|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116667442|pdb|2GYA|H Chain H, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 >gi|116667494|pdb|2GYC|H Chain H, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli Ribosome Complex Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1143 >gi|118138100|pdb|2I2T|J Chain J, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138154|pdb|2I2V|J Chain J, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|157836064|pdb|2QOV|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 50s Subunit Of The First 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836116|pdb|2QOX|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 50s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836168|pdb|2QOZ|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 50s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836220|pdb|2QP1|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 50s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|158429739|pdb|2QAM|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 50s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429791|pdb|2QAO|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 50s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429849|pdb|2QBA|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 50s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429901|pdb|2QBC|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 50s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429953|pdb|2QBE|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The First 70s Ribosome, With Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430006|pdb|2QBG|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The Second 70s Ribosome, With Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430059|pdb|2QBI|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The First 70s Ribosome, With Gentamicin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430112|pdb|2QBK|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The Second 70s Ribosome, With Gentamicin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431412|pdb|2Z4L|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The First 70s Ribosome, With Paromomycin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431465|pdb|2Z4N|J Chain J, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The Second 70s Ribosome, With Paromomycin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|168988740|pdb|2VHM|J Chain J, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 1 Of 4) >gi|168988771|pdb|2VHN|J Chain J, Structure Of Pdf Binding Helix In Complex With The Ribosome. (Part 2 Of 4) >gi|169404610|pdb|2RDO|J Chain J, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound >gi|12517852|gb|AAG58359.1|AE005551_2 50S ribosomal subunit protein L13 [Escherichia coli O157:H7 EDL933] >gi|42855|emb|CAA26041.1| unnamed protein product [Escherichia coli] >gi|606170|gb|AAA58033.1| 50S ribosomal subunit protein L13 [Escherichia coli] >gi|1789626|gb|AAC76263.1| 50S ribosomal subunit protein L13 [Escherichia coli str. K-12 substr. MG1655] >gi|13363577|dbj|BAB37527.1| 50S ribosomal subunit protein L13 [Escherichia coli O157:H7 str. Sakai] >gi|16421904|gb|AAL22214.1| 50S ribosomal subunit protein L13 [Salmonella typhimurium LT2] >gi|16504408|emb|CAD07861.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139229|gb|AAO70796.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|30042823|gb|AAP18546.1| 50S ribosomal subunit protein L13 [Shigella flexneri 2a str. 2457T] >gi|56129530|gb|AAV79036.1| 50S ribosomal subunit protein L13 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56383843|gb|AAN44735.2| 50S ribosomal subunit protein L13 [Shigella flexneri 2a str. 301] >gi|85676024|dbj|BAE77274.1| 50S ribosomal subunit protein L13 [Escherichia coli W3110] >gi|110345057|gb|ABG71294.1| 50S ribosomal protein L13 [Escherichia coli 536] >gi|115514639|gb|ABJ02714.1| 50S ribosomal protein L13 [Escherichia coli APEC O1] >gi|157068389|gb|ABV07644.1| ribosomal protein L13 [Escherichia coli HS] >gi|157076967|gb|ABV16675.1| ribosomal protein L13 [Escherichia coli E24377A] >gi|160867439|gb|ABX24062.1| hypothetical protein SARI_04279 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161365725|gb|ABX69493.1| hypothetical protein SPAB_04170 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|169753453|gb|ACA76152.1| ribosomal protein L13 [Escherichia coli ATCC 8739] >gi|169890598|gb|ACB04305.1| 50S ribosomal subunit protein L13 [Escherichia coli str. K12 substr. DH10B] >gi|170124831|gb|EDS93762.1| ribosomal protein L13 [Escherichia albertii TW07627] >gi|170519499|gb|ACB17677.1| ribosomal protein L13 [Escherichia coli SMS-3-5] >gi|187767175|gb|EDU31019.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4196] >gi|188489972|gb|EDU65075.1| ribosomal protein L13 [Escherichia coli 53638] >gi|189001132|gb|EDU70118.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4076] >gi|189358600|gb|EDU77019.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4401] >gi|189361757|gb|EDU80176.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4486] >gi|189366130|gb|EDU84546.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC4501] >gi|189373842|gb|EDU92258.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC869] >gi|189376822|gb|EDU95238.1| ribosomal protein L13 [Escherichia coli O157:H7 str. EC508] >gi|190901777|gb|EDV61530.1| ribosomal protein L13 [Escherichia coli B7A] >gi|192927006|gb|EDV81629.1| ribosomal protein L13 [Escherichia coli E22] >gi|192956384|gb|EDV86844.1| ribosomal protein L13 [Escherichia coli E110019] >gi|194401083|gb|ACF61305.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194409345|gb|ACF69564.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194412832|gb|EDX29124.1| ribosomal protein L13 [Escherichia coli B171] >gi|194421869|gb|EDX37875.1| ribosomal protein L13 [Escherichia coli 101-1] >gi|194456514|gb|EDX45353.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194713202|gb|ACF92423.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195633421|gb|EDX51835.1| ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (142 aa)
Score = 308, Expect = 4.5e-27, Identities = 55/125 (44%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQP 137
>gi|62129486|gb|AAX67189.1| 50S ribosomal protein L13 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (147 aa)
Score = 308, Expect = 4.6e-27, Identities = 59/140 (42%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + KT   K E     + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:     5 LMKTFTAKPETV--KRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQP 142
>gi|88802062|ref|ZP_01117590.1| 50S ribosomal protein L13 [Polaribacter irgensii 23-P] >gi|88782720|gb|EAR13897.1| 50S ribosomal protein L13 [Polaribacter irgensii 23-P] (159 aa)
Score = 308, Expect = 4.6e-27, Identities = 61/140 (43%), Positives = 89/140 (63%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           V   +A  NK+W ++DA    LG+L+   A ++RGK K +FTP+VDCGD +++IN++KIVLS +K   + +  H+GY GG +  +   M EK   +L+  A+KGMLPKN L   L + L++Y    HKQA Q+P  I LN
  S:    17 VSANSATVNKEWVLVDADGQTLGRLSSIIAKLIRGKYKPNFTPHVDCGDNVVVINAEKIVLSGNKWKEKSYIRHTGYPGGQRSLTATEMFEKDPTRLVEKAVKGMLPKNILGAALFRNLYVYAGTEHKQAGQEPKAINLN 156
>gi|50119266|ref|YP_048433.1| 50S ribosomal protein L13 [Pectobacterium atrosepticum SCRI1043] >gi|81693456|sp|Q6DAE7|RL13_ERWCT 50S ribosomal protein L13 >gi|49609792|emb|CAG73226.1| 50S ribosomal subunit protein L13 [Erwinia carotovora subsp. atroseptica SCRI1043] (142 aa)
Score = 308, Expect = 4.7e-27, Identities = 55/125 (44%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDANGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKIYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQP 137
>gi|170717444|ref|YP_001784543.1| ribosomal protein L13 [Haemophilus somnus 2336] >gi|189041006|sp|B0UTU4|RL13_HAES2 50S ribosomal protein L13 >gi|168825573|gb|ACA30944.1| ribosomal protein L13 [Haemophilus somnus 2336] (142 aa)
Score = 308, Expect = 5.0e-27, Identities = 57/136 (41%), Positives = 92/136 (67%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+++IN++K+ ++ +K   + +Y H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y  + H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDATGKTLGRLAAELARRLRGKHKAEYTPHVDTGDYIVVINAEKVAVTGNKETDKLYYWHTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLPKGPLGRAMFRKLKVYAGSEHNHAAQQP 137
>gi|119357804|ref|YP_912448.1| 50S ribosomal protein L13 [Chlorobium phaeobacteroides DSM 266] >gi|166230974|sp|A1BHZ7|RL13_CHLPD 50S ribosomal protein L13 >gi|119355153|gb|ABL66024.1| LSU ribosomal protein L13P [Chlorobium phaeobacteroides DSM 266] (149 aa)
Score = 308, Expect = 5.0e-27, Identities = 57/131 (43%), Positives = 89/131 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           + WYVIDA   +LG++A E A +LRGK+K  FTP++D GD++++ N+ KI LS  K +++ +++HS Y GG+K    + +++K  +K+I  A+ GMLP N L R L KKL +Y    H  A+Q P+E+K+N
  S:    19 RSWYVIDADGQVLGRMAAEIARVLRGKHKPQFTPHIDTGDFIVVTNAAKIGLSGKKTEQKSYFSHSNYPGGVKFDHVKDLLKKKPEKIIEHAVWGMLPHNNLGRQLFKKLKVYAGPEHPHASQNPVEMKVN 149
>gi|28871561|ref|NP_794180.1| 50S ribosomal protein L13 [Pseudomonas syringae pv. tomato str. DC3000] >gi|81729728|sp|Q87WW7|RL13_PSESM 50S ribosomal protein L13 >gi|28854812|gb|AAO57875.1| ribosomal protein L13 [Pseudomonas syringae pv. tomato str. DC3000] (142 aa)
Score = 308, Expect = 5.2e-27, Identities = 56/130 (43%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+++IN+++I ++  K   + +Y+HSG+ GG+K  +   +I K  +++I  A+KGMLPKN L R + +KL +Y  A H   AQ+P+E+K 
  S:    13 RDWFVVDAAGQTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEQIRVTGAKTTDKIYYSHSGFPGGIKSINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYAGAVHPHTAQQPLELKF 142
>gi|78065241|ref|YP_368010.1| 50S ribosomal protein L13 [Burkholderia sp. 383] >gi|115350627|ref|YP_772466.1| 50S ribosomal protein L13 [Burkholderia ambifaria AMMD] >gi|134294757|ref|YP_001118492.1| 50S ribosomal protein L13 [Burkholderia vietnamiensis G4] >gi|162218062|ref|YP_620083.2| 50S ribosomal protein L13 [Burkholderia cenocepacia AU 1054] >gi|162227936|ref|YP_834325.2| 50S ribosomal protein L13 [Burkholderia cenocepacia HI2424] >gi|170731999|ref|YP_001763946.1| ribosomal protein L13 [Burkholderia cenocepacia MC0-3] >gi|122324013|sp|Q0BI91|RL13_BURCM 50S ribosomal protein L13 >gi|166230972|sp|A4JBK4|RL13_BURVG 50S ribosomal protein L13 >gi|118573385|sp|Q1BZ45|RL13_BURCA 50S ribosomal protein L13 >gi|118573387|sp|Q39JK0|RL13_BURS3 50S ribosomal protein L13 >gi|77965986|gb|ABB07366.1| LSU ribosomal protein L13P [Burkholderia sp. 383] >gi|115280615|gb|ABI86132.1| LSU ribosomal protein L13P [Burkholderia ambifaria AMMD] >gi|134137914|gb|ABO53657.1| LSU ribosomal protein L13P [Burkholderia vietnamiensis G4] >gi|169815241|gb|ACA89824.1| ribosomal protein L13 [Burkholderia cenocepacia MC0-3] (142 aa)
Score = 307, Expect = 5.4e-27, Identities = 58/130 (44%), Positives = 92/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GD++IIIN+ K+ ++ +K   +K+Y HSGY GG+ E +   M E++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:    13 REWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIIINASKLKVTGNKTLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEATHPHSAQQPKALEI 142
>gi|94266221|ref|ZP_01289929.1| Ribosomal protein L13 [delta proteobacterium MLMS-1] >gi|93453194|gb|EAT03655.1| Ribosomal protein L13 [delta proteobacterium MLMS-1] (144 aa)
Score = 307, Expect = 5.5e-27, Identities = 56/130 (43%), Positives = 93/130 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KWYV+DA +++LG+LA E A  LRGK+K  ++  +D GD+++++N+DK+ L+  K D + +Y H+GYIGG+++ +   + +K  ++L+Y A+KGMLPKNTL R  +KKL +Y    H  +AQ+P  ++L
  S:    13 RKWYVVDAEDMVLGRLASEIATRLRGKHKPIYSTFMDTGDFVVVLNADKVRLTGKKWDDKIYYRHTGYIGGIRQDTASELRDKKPEQLVYRAVKGMLPKNTLGRKQLKKLKVYAGGEHPHSAQQPETLQL 142
>gi|70732405|ref|YP_262161.1| 50S ribosomal protein L13 [Pseudomonas fluorescens Pf-5] >gi|118573429|sp|Q4K6H2|RL13_PSEF5 50S ribosomal protein L13 >gi|68346704|gb|AAY94310.1| ribosomal protein L13 [Pseudomonas fluorescens Pf-5] (142 aa)
Score = 307, Expect = 5.7e-27, Identities = 55/130 (42%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+++IN++++ ++  K   + +Y+HSG+ GG+K  +   +I K  +++I  A+KGMLPKN L R + +KL +Y  A H   AQ+P E+K+
  S:    13 RDWFVVDAAGQTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEQVRVTGAKTTDKMYYSHSGFPGGIKSINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYAGAAHPHTAQQPQELKI 142
>gi|115518810|gb|ABJ06794.1| LSU ribosomal protein L13P [Rhodopseudomonas palustris BisA53] (163 aa)
Score = 307, Expect = 5.9e-27, Identities = 55/129 (42%), Positives = 89/129 (68%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW VIDA+ L++G+LA   AN LRGK+   +TP+VDCGD++II+N+ K+VL+  K D + +Y H+GYIGG+KE+S + ++E ++ ++++  A++ M+P+  L R  +  L +Y    H   AQ+P
  S:    18 AEVTKKWIVIDATGLVVGRLATLVANRLRGKHLPTYTPHVDCGDHVIIVNAAKVVLTGRKRDNKMYYKHTGYIGGIKERSAKSILEGRFPERVVEKAVERMVPRGPLGRQQMSNLRVYGGPEHPHEAQQP 147
>gi|27468709|ref|NP_765346.1| 50S ribosomal protein L13 [Staphylococcus epidermidis ATCC 12228] >gi|81843480|sp|Q8CRI9|RL13_STAES 50S ribosomal protein L13 >gi|27316257|gb|AAO05432.1|AE016750_37 50S ribosomal protein L13 [Staphylococcus epidermidis ATCC 12228] (145 aa)
Score = 307, Expect = 6.2e-27, Identities = 65/143 (45%), Positives = 90/143 (62%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + TF+ NE+ +  +KWYVIDA    LG+L+ E A ILRGKNKV +TP+VD GDY+IIIN+ KI  + +K   + ++ HS + GGLK  S   +     ++L+  +IKGMLP   L     KKLF+Y  A H  AAQ+P   +L
  S:     2 RQTFMANESNI-ERKWYVIDAEGQTLGRLSSEVAAILRGKNKVTYTPHVDTGDYVIIINASKIEFTGNKEQDKMYHRHSNHPGGLKSISAGELKRTNPERLLETSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYEL 143
>gi|189345965|ref|YP_001942494.1| ribosomal protein L13 [Chlorobium limicola DSM 245] >gi|189340112|gb|ACD89515.1| ribosomal protein L13 [Chlorobium limicola DSM 245] (149 aa)
Score = 307, Expect = 6.4e-27, Identities = 63/146 (43%), Positives = 95/146 (65%)
  Q:     1 MQKTTFVKN---EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K    + A   +KWYVIDA + ILG++A E A +LRGK+K  FTP++D GD++++ N++K+ LS  K + + ++ HS Y GG K    + +++K  +K+I  A+ GMLP N L R L KKL +Y  + H   AQ P+E+K+N
  S:     1 MSKTLSFKTYSAKPAEVERKWYVIDAEDQILGRMAAEIAKVLRGKHKPQFTPHIDTGDFIVVTNAEKVALSGKKIEYKTYFHHSNYPGGGKFDHVKDLLKKKPEKVIEHAVWGMLPHNNLGRQLFKKLKVYAGSEHPHTAQCPVELKVN 149
>gi|56751900|ref|YP_172601.1| 50S ribosomal protein L13 [Synechococcus elongatus PCC 6301] >gi|81301015|ref|YP_401223.1| 50S ribosomal protein L13 [Synechococcus elongatus PCC 7942] >gi|81676829|sp|Q5N0T9|RL13_SYNP6 50S ribosomal protein L13 >gi|118573456|sp|Q31L33|RL13_SYNP7 50S ribosomal protein L13 >gi|56686859|dbj|BAD80081.1| 50S ribosomal protein L13 [Synechococcus elongatus PCC 6301] >gi|81169896|gb|ABB58236.1| LSU ribosomal protein L13P [Synechococcus elongatus PCC 7942] (151 aa)
Score = 307, Expect = 6.9e-27, Identities = 56/136 (41%), Positives = 94/136 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           T++ ++ A+  + WYV+DA++  LG+LA E A +LRGK+K  +TP++D GD++I+IN+DK+ ++  KA ++ +  HSG  GG+K ++   + ++  +++I  A+KGMLPKN L R L  KL +Y+ A H   AQ+P
  S:     4 TYLPSQGAI-ERNWYVVDAADQRLGRLATEIARVLRGKHKPTYTPHMDTGDFVIVINADKVTVTGRKASQKLYRRHSGRPGGMKVETFAHLQQRLPERIIEQAVKGMLPKNALGRQLFTKLKVYRGAEHPHQAQQP 138
>gi|37527870|ref|NP_931215.1| 50S ribosomal protein L13 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81707577|sp|Q7N078|RL13_PHOLL 50S ribosomal protein L13 >gi|36787306|emb|CAE16387.1| 50S ribosomal protein L13 [Photorhabdus luminescens subsp. laumondii TTO1] (142 aa)
Score = 306, Expect = 7.1e-27, Identities = 55/125 (44%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA    LG+LA E A  LRGK+K ++TP+VD GDY+II+N++K+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y  + H  AAQ+P
  S:    13 RDWYVVDADGKTLGRLATEVARRLRGKHKAEYTPHVDTGDYIIIVNAEKVAVTGNKRSDKIYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGSEHNHAAQQP 137
>gi|77977071|ref|ZP_00832531.1| COG0102: Ribosomal protein L13 [Yersinia intermedia ATCC 29909] (142 aa)
Score = 306, Expect = 7.2e-27, Identities = 55/125 (44%), Positives = 88/125 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DAS   LG+LA E A+ LRGK+K ++TP+VD GDY+I++N++K+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDASGKTLGRLATELASRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKIYYRHTGHIGGIKQATFEEMIARSPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|33241135|ref|NP_876077.1| 50S ribosomal protein L13 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|81712770|sp|Q7V9Y8|RL13_PROMA 50S ribosomal protein L13 >gi|33238665|gb|AAQ00730.1| Ribosomal protein L13 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (150 aa)
Score = 306, Expect = 7.3e-27, Identities = 56/126 (44%), Positives = 88/126 (69%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           N++WY++DA N  LG+LA E A++LRGKNK  FTP++D GD++II+N++KI ++  K  ++ +  HSG  GG+K ++   + E+  ++++  AIKGMLP N L R L +KL +YK + H  +AQ P
  S:    13 NRQWYLVDAENQTLGRLATEVASVLRGKNKPSFTPHLDTGDFVIIVNAEKIKVTGKKGMQKLYRRHSGRPGGMKVETFNSLQERIPERIVEKAIKGMLPHNALGRQLFRKLKVYKGSEHPHSAQNP 138
>gi|53720519|ref|YP_109505.1| 50S ribosomal protein L13 [Burkholderia pseudomallei K96243] >gi|126441469|ref|YP_001060389.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 668] >gi|126454397|ref|YP_001067651.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 1106a] >gi|134280078|ref|ZP_01766789.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 305] >gi|161371436|ref|ZP_02111001.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 1710a] >gi|161723140|ref|YP_441780.2| 50S ribosomal protein L13 [Burkholderia thailandensis E264] >gi|162210027|ref|YP_334792.2| 50S ribosomal protein L13 [Burkholderia pseudomallei 1710b] >gi|167564074|ref|ZP_02356990.1| ribosomal protein L13 [Burkholderia oklahomensis EO147] >gi|167571218|ref|ZP_02364092.1| ribosomal protein L13 [Burkholderia oklahomensis C6786] >gi|167580599|ref|ZP_02373473.1| ribosomal protein L13 [Burkholderia thailandensis TXDOH] >gi|167586139|ref|ZP_02378527.1| ribosomal protein L13 [Burkholderia ubonensis Bu] >gi|167618707|ref|ZP_02387338.1| ribosomal protein L13 [Burkholderia thailandensis Bt4] >gi|167721190|ref|ZP_02404426.1| ribosomal protein L13 [Burkholderia pseudomallei DM98] >gi|167740164|ref|ZP_02412938.1| ribosomal protein L13 [Burkholderia pseudomallei 14] >gi|167817378|ref|ZP_02449058.1| ribosomal protein L13 [Burkholderia pseudomallei 91] >gi|167825785|ref|ZP_02457256.1| ribosomal protein L13 [Burkholderia pseudomallei 9] >gi|167847268|ref|ZP_02472776.1| ribosomal protein L13 [Burkholderia pseudomallei B7210] >gi|167895855|ref|ZP_02483257.1| ribosomal protein L13 [Burkholderia pseudomallei 7894] >gi|167904245|ref|ZP_02491450.1| ribosomal protein L13 [Burkholderia pseudomallei NCTC 13177] >gi|167912506|ref|ZP_02499597.1| ribosomal protein L13 [Burkholderia pseudomallei 112] >gi|167920457|ref|ZP_02507548.1| ribosomal protein L13 [Burkholderia pseudomallei BCC215] >gi|189349406|ref|YP_001945034.1| large subunit ribosomal protein L13 [Burkholderia multivorans ATCC 17616] >gi|194505328|ref|YP_002034899.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 1655] >gi|194569535|ref|YP_002104538.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 406e] >gi|166230970|sp|A3NZ80|RL13_BURP0 50S ribosomal protein L13 >gi|166230971|sp|A3NDG8|RL13_BURP6 50S ribosomal protein L13 >gi|81690237|sp|Q63QW3|RL13_BURPS 50S ribosomal protein L13 >gi|118573386|sp|Q3JNR1|RL13_BURP1 50S ribosomal protein L13 >gi|118573388|sp|Q2SZ69|RL13_BURTA 50S ribosomal protein L13 >gi|52210933|emb|CAH36921.1| 50S ribosomal protein L13 [Burkholderia pseudomallei K96243] >gi|126220962|gb|ABN84468.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 668] >gi|126228039|gb|ABN91579.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 1106a] >gi|134248085|gb|EBA48168.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 305] >gi|157809070|gb|EDO86240.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 406e] >gi|184211215|gb|EDU08258.1| 50S ribosomal protein L13 [Burkholderia pseudomallei 1655] >gi|189333428|dbj|BAG42498.1| large subunit ribosomal protein L13 [Burkholderia multivorans ATCC 17616] (142 aa)
Score = 306, Expect = 7.5e-27, Identities = 57/130 (43%), Positives = 92/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GD++I+IN+ K+ ++ +K   +K+Y HSGY GG+ E +   M E++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:    13 REWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIVINASKLKVTGNKTLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEATHPHSAQQPKALEI 142
>gi|15674236|ref|NP_268411.1| 50S ribosomal protein L13 [Lactococcus lactis subsp. lactis Il1403] >gi|116513208|ref|YP_812115.1| 50S ribosomal protein L13 [Lactococcus lactis subsp. cremoris SK11] >gi|12725324|gb|AAK06352.1|AE006454_5 50S ribosomal protein L13 [Lactococcus lactis subsp. lactis Il1403] >gi|116108862|gb|ABJ74002.1| LSU ribosomal protein L13P [Lactococcus lactis subsp. cremoris SK11] (148 aa)
Score = 306, Expect = 7.8e-27, Identities = 63/140 (45%), Positives = 95/140 (67%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+ N A   ++KWYV+DA+++ LG+L+   A++LRGKNK  +TP+ D GD++I++N++KI L+  KA  + +Y+HS + GGLK  +   + EK + +LI  ++KGMLP NTL R    KL ++  A H   AQKP
  S:     1 MMKTTFMAN-AQNVDRKWYVVDATDVPLGRLSAVVASVLRGKNKPTYTPHTDTGDFVIVVNAEKIKLTGKKATDKVYYSHSLHPGGLKSVTAGELREKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGAEHTHTAQKP 139
>gi|67642303|ref|ZP_00441061.1| COG0102: Ribosomal protein L13 [Burkholderia mallei GB8 horse 4] (132 aa)
Score = 306, Expect = 8.1e-27, Identities = 57/130 (43%), Positives = 92/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GD++I+IN+ K+ ++ +K   +K+Y HSGY GG+ E +   M E++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:     3 REWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIVINASKLKVTGNKTLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKCPLGYAMIKKLKVYAEATHPHSAQQPKALEI 132
>gi|16123707|ref|NP_407020.1| 50S ribosomal protein L13 [Yersinia pestis CO92] >gi|51597800|ref|YP_071991.1| 50S ribosomal protein L13 [Yersinia pseudotuberculosis IP 32953] >gi|108809731|ref|YP_653647.1| 50S ribosomal protein L13 [Yersinia pestis Antiqua] >gi|108813605|ref|YP_649372.1| 50S ribosomal protein L13 [Yersinia pestis Nepal516] >gi|145597650|ref|YP_001161726.1| 50S ribosomal protein L13 [Yersinia pestis Pestoides F] >gi|153947849|ref|YP_001399452.1| 50S ribosomal protein L13 [Yersinia pseudotuberculosis IP 31758] >gi|153997338|ref|ZP_02022438.1| 50S ribosomal protein L13 [Yersinia pestis CA88-4125] >gi|161484916|ref|NP_667477.2| 50S ribosomal protein L13 [Yersinia pestis KIM] >gi|161511291|ref|NP_995088.2| 50S ribosomal protein L13 [Yersinia pestis biovar Microtus str. 91001] >gi|162419312|ref|YP_001605680.1| 50S ribosomal protein L13 [Yersinia pestis Angola] >gi|165928144|ref|ZP_02223976.1| ribosomal protein L13 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937404|ref|ZP_02225967.1| ribosomal protein L13 [Yersinia pestis biovar Orientalis str. IP275] >gi|166011414|ref|ZP_02232312.1| ribosomal protein L13 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211934|ref|ZP_02237969.1| ribosomal protein L13 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167400658|ref|ZP_02306167.1| ribosomal protein L13 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420467|ref|ZP_02312220.1| ribosomal protein L13 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426981|ref|ZP_02318734.1| ribosomal protein L13 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170022775|ref|YP_001719280.1| ribosomal protein L13 [Yersinia pseudotuberculosis YPIII] >gi|186896991|ref|YP_001874103.1| ribosomal protein L13 [Yersinia pseudotuberculosis PB1/+] >gi|166199632|sp|A4THJ1|RL13_YERPP 50S ribosomal protein L13 >gi|166983079|sp|A7FDX4|RL13_YERP3 50S ribosomal protein L13 >gi|81691655|sp|Q665K9|RL13_YERPS 50S ribosomal protein L13 >gi|118573467|sp|Q1C1H0|RL13_YERPA 50S ribosomal protein L13 >gi|118573590|sp|Q0WB88|RL13_YERPE 50S ribosomal protein L13 >gi|118573591|sp|Q1CE08|RL13_YERPN 50S ribosomal protein L13 >gi|51591082|emb|CAH22746.1| 50S ribosomal protein L13 [Yersinia pseudotuberculosis IP 32953] >gi|108777253|gb|ABG19772.1| LSU ribosomal protein L13P [Yersinia pestis Nepal516] >gi|108781644|gb|ABG15702.1| LSU ribosomal protein L13P [Yersinia pestis Antiqua] >gi|115349186|emb|CAL22151.1| 50S ribosomal protein L13 [Yersinia pestis CO92] >gi|145209346|gb|ABP38753.1| LSU ribosomal protein L13P [Yersinia pestis Pestoides F] >gi|149288975|gb|EDM39055.1| 50S ribosomal protein L13 [Yersinia pestis CA88-4125] >gi|152959344|gb|ABS46805.1| ribosomal protein L13 [Yersinia pseudotuberculosis IP 31758] >gi|162352127|gb|ABX86075.1| ribosomal protein L13 [Yersinia pestis Angola] >gi|165914509|gb|EDR33123.1| ribosomal protein L13 [Yersinia pestis biovar Orientalis str. IP275] >gi|165919918|gb|EDR37219.1| ribosomal protein L13 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989798|gb|EDR42099.1| ribosomal protein L13 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206680|gb|EDR51160.1| ribosomal protein L13 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961273|gb|EDR57294.1| ribosomal protein L13 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050026|gb|EDR61434.1| ribosomal protein L13 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054021|gb|EDR63849.1| ribosomal protein L13 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749309|gb|ACA66827.1| ribosomal protein L13 [Yersinia pseudotuberculosis YPIII] >gi|186700017|gb|ACC90646.1| ribosomal protein L13 [Yersinia pseudotuberculosis PB1/+] (142 aa)
Score = 306, Expect = 8.1e-27, Identities = 54/125 (43%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DAS   LG+LA E A  LRGK+K ++TP+VD GDY+I++N++K+ ++ +K   + +Y H+G++GG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDASGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKIYYHHTGFVGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|34499152|ref|NP_903367.1| 50S ribosomal protein L13 [Chromobacterium violaceum ATCC 12472] >gi|81711673|sp|Q7NRT3|RL13_CHRVO 50S ribosomal protein L13 >gi|34105003|gb|AAQ61359.1| 50S ribosomal protein L13 [Chromobacterium violaceum ATCC 12472] (142 aa)
Score = 306, Expect = 8.3e-27, Identities = 54/130 (41%), Positives = 93/130 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYV+DA++ +LG+LA E A  LRGK+K +FTP+VD GD+++++N +K+ ++  KA  +K+Y HSGY GG+ E++   +  ++ ++++  A+KGMLPK  L   +IKKL +Y  + H  AAQ+P  +++
  S:    13 REWYVVDAADKVLGRLAAEIARRLRGKHKPEFTPHVDTGDFIVVVNVEKLRVTGTKAQDKKYYRHSGYPGGIYERTFTELQNQFPERVLEKAVKGMLPKGPLGYAMIKKLKVYSGSEHPHAAQQPKVLEI 142
>gi|21956801|gb|AAM83728.1|AE013614_2 50S ribosomal subunit protein L13 [Yersinia pestis KIM] >gi|45438418|gb|AAS63965.1| 50S ribosomal protein L13 [Yersinia pestis biovar Microtus str. 91001] (147 aa)
Score = 306, Expect = 8.3e-27, Identities = 58/140 (41%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + KT   K E     + WYV+DAS   LG+LA E A  LRGK+K ++TP+VD GDY+I++N++K+ ++ +K   + +Y H+G++GG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:     5 LMKTFTAKPETV--KRDWYVVDASGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKIYYHHTGFVGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 142
>gi|77919496|ref|YP_357311.1| 50S ribosomal protein L13 [Pelobacter carbinolicus DSM 2380] >gi|118573425|sp|Q3A3B6|RL13_PELCD 50S ribosomal protein L13 >gi|77545579|gb|ABA89141.1| LSU ribosomal protein L13P [Pelobacter carbinolicus DSM 2380] (142 aa)
Score = 306, Expect = 8.5e-27, Identities = 55/130 (42%), Positives = 91/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           K WY++D    +LG+ A E A +LRGK+K  ++P+VD GD+++++N++K+ L+ +K   + +Y HSGY GGL++ +   M+EK  + LI  A+KGMLPKN L R + +KL +Y  ++H  AAQ+P+E+ +
  S:    13 KNWYIVDLDGKVLGRAATEIARVLRGKHKAIYSPSVDTGDFVVVVNAEKVKLTGNKMSAKMYYRHSGYPGGLRQANAAQMLEKKPEDLIKKAVKGMLPKNKLGRDMFRKLKVYTGSDHPHAAQQPLELNI 142
>gi|27904842|ref|NP_777968.1| 50S ribosomal protein L13 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|38605258|sp|Q89AE6|RL13_BUCBP 50S ribosomal protein L13 >gi|27904240|gb|AAO27073.1| 50S ribosomal protein L13 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (144 aa)
Score = 306, Expect = 8.8e-27, Identities = 62/135 (45%), Positives = 96/135 (71%)
  Q:     6 FVKNEAALAN---KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           ++K+ +A +N   K WY IDA+  ILG+LA   A+ LRGK+KV++TP+VD GDYLI+IN+  I ++  K   + +Y H+GY+GGLK+ + + M+ +Y +++I  A++GMLPK  L R + KKL +Y + NH  +AQ P
  S:     2 YIKSFSAKSNDFKKMWYCIDATGKILGRLATNIASRLRGKHKVEYTPHVDIGDYLIVINAKNIKVTGKKCTDKFYYHHTGYVGGLKKIAFKDMLHRYPERIIEIAVRGMLPKGPLGRSMFKKLKVYANDNHNHSAQNP 139
>gi|23336645|ref|ZP_00121851.1| COG0102: Ribosomal protein L13 [Bifidobacterium longum DJO10A] >gi|23466123|ref|NP_696726.1| 50S ribosomal protein L13 [Bifidobacterium longum NCC2705] >gi|189440555|ref|YP_001955636.1| Ribosomal protein L13 [Bifidobacterium longum DJO10A] >gi|81753587|sp|Q8G424|RL13_BIFLO 50S ribosomal protein L13 >gi|23326858|gb|AAN25362.1| 50S ribosomal protein L13 [Bifidobacterium longum NCC2705] >gi|189428990|gb|ACD99138.1| Ribosomal protein L13 [Bifidobacterium longum DJO10A] (149 aa)
Score = 306, Expect = 8.8e-27, Identities = 62/136 (45%), Positives = 93/136 (68%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF    A L +  WYVIDA++++LG+LA +AA +LRGKNK  + P+ D G+++IIIN+DKI L+ +K  +E  Y+HSG  GGL+  S   ++EK  +++I  A+KGMLPKN L++  + +L I++ A H    QKP
  S:     3 TFTPKPADLTHD-WYVIDATDVVLGRLATQAAILLRGKNKPTYAPHADSGNHVIIINADKIALTGNKMGKE-LYSHSGRPGGLRRDSYAELLEKNPERIIKNAVKGMLPKNRLAKVQLDRLRIFRGAEHPHTPQKP 136
>gi|70725836|ref|YP_252750.1| 50S ribosomal protein L13 [Staphylococcus haemolyticus JCSC1435] >gi|88909108|sp|Q4L881|RL13_STAHJ 50S ribosomal protein L13 >gi|68446560|dbj|BAE04144.1| 50S ribosomal protein L13 [Staphylococcus haemolyticus JCSC1435] (145 aa)
Score = 305, Expect = 9.7e-27, Identities = 65/143 (45%), Positives = 92/143 (64%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + TF+ NE+ +  +KWYVIDA    LG+L+ E A+ILRGKNKV +TP+VD GDY+IIIN+ KI L+  K   + +Y HS + GG+K  +   +     ++L+  +IKGMLP + L     KKLF+Y  A H  AAQ+P   +L
  S:     2 RQTFMANESNI-ERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIIINAAKIELTGKKESDKIYYRHSNHPGGIKSVTAGELKRNNPERLLETSIKGMLPSSRLGEKQGKKLFVYGGAEHPHAAQQPENYEL 143
>gi|49475552|ref|YP_033593.1| 50S ribosomal protein L13 [Bartonella henselae str. Houston-1] >gi|81696165|sp|Q6G3I6|RL13_BARHE 50S ribosomal protein L13 >gi|49238358|emb|CAF27582.1| 50S ribosomal protein l13 [Bartonella henselae str. Houston-1] (154 aa)
Score = 305, Expect = 9.7e-27, Identities = 58/125 (46%), Positives = 90/125 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW +IDA NL+LG+LA   AN LRGK+K  FTP+VD GD +I+IN+DKI L+  K   +K+Y H+GYIGG+K+++ R ++E ++ ++++  A++ M+P+  L R  +K L +Y  + H  AAQ+P
  S:    13 KKWVIIDAENLVLGRLAAFVANRLRGKHKATFTPHVDDGDNVIVINADKISLTGKKYTDKKYYWHTGYIGGIKKRTARQILEGRFPERVVEKAVERMIPRGPLGRRQLKNLRVYAGSQHPHAAQQP 138
>gi|66047347|ref|YP_237188.1| 50S ribosomal protein L13 [Pseudomonas syringae pv. syringae B728a] >gi|71735450|ref|YP_276248.1| 50S ribosomal protein L13 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|81307942|sp|Q4ZNX2|RL13_PSEU2 50S ribosomal protein L13 >gi|118573427|sp|Q48EE0|RL13_PSE14 50S ribosomal protein L13 >gi|63258054|gb|AAY39150.1| Ribosomal protein L13, bacterial and organelle form [Pseudomonas syringae pv. syringae B728a] >gi|71556003|gb|AAZ35214.1| ribosomal protein L13 [Pseudomonas syringae pv. phaseolicola 1448A] (142 aa)
Score = 305, Expect = 1.0e-26, Identities = 56/130 (43%), Positives = 90/130 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+++IN+++I ++  K   + +Y+HSG+ GG+K  +   +I K  +++I  A+KGMLPKN L R + +KL +Y  A H   AQ+P E+K 
  S:    13 RDWFVVDAAGQTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEQIRVTGAKTTDKIYYSHSGFPGGIKSINFEKLIAKAPERVIETAVKGMLPKNPLGRDMYRKLKVYAGAVHPHTAQQPQELKF 142
>gi|90407508|ref|ZP_01215691.1| 50S ribosomal protein L13 [Psychromonas sp. CNPT3] >gi|90311429|gb|EAS39531.1| 50S ribosomal protein L13 [Psychromonas sp. CNPT3] (142 aa)
Score = 305, Expect = 1.0e-26, Identities = 60/136 (44%), Positives = 94/136 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV   A +  ++W+V+DA    LG+LA E A  LRGK+KV++TP+VD GDY+I+IN++KI ++ +KA  + +Y H+G+IGG+K  S   +I +  +++I  A+KGMLPK  L R + +KL +Y    H+ +AQ+P
  S:     3 TFVAKPADV-KREWFVVDAEGKTLGRLATEIALRLRGKHKVEYTPHVDTGDYIIVINAEKITVTGNKAKGKIYYHHTGFIGGIKSISFEDLIIRAPERVIEKAVKGMLPKGPLGRAMYRKLKVYAGTEHQHSAQQP 137
>gi|89100312|ref|ZP_01173177.1| 50S ribosomal protein L13 [Bacillus sp. NRRL B-14911] >gi|89084933|gb|EAR64069.1| 50S ribosomal protein L13 [Bacillus sp. NRRL B-14911] (144 aa)
Score = 305, Expect = 1.1e-26, Identities = 65/136 (47%), Positives = 88/136 (64%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF+ N A    +KWYV+DA    LG+LA E A +LRGKNK  FTP+VD GD +IIIN++KI L+  K   + +Y H+ + GGLK ++   M   Y  K++  AIKGMLPKN+L R + KKL +Y  + H   AQ+P
  S:     3 TFMAN-ANNIERKWYVVDAEGKTLGRLASEVAAVLRGKNKPTFTPHVDTGDNVIIINAEKIELTGKKLTDKIYYRHTMHPGGLKTRTALEMRTNYPVKMLELAIKGMLPKNSLGRQMFKKLHVYAGSEHPHQAQQP 137
>gi|82778539|ref|YP_404888.1| 50S ribosomal protein L13 [Shigella dysenteriae Sd197] >gi|118573450|sp|Q32BA8|RL13_SHIDS 50S ribosomal protein L13 >gi|81242687|gb|ABB63397.1| 50S ribosomal subunit protein L13 [Shigella dysenteriae Sd197] (142 aa)
Score = 305, Expect = 1.1e-26, Identities = 55/125 (44%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I++N+DK+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMSRKLKVYAGNEHNHAAQQP 137
>gi|53726211|ref|YP_103900.1| 50S ribosomal protein L13 [Burkholderia mallei ATCC 23344] >gi|121600882|ref|YP_991604.1| 50S ribosomal protein L13 [Burkholderia mallei SAVP1] >gi|124386301|ref|YP_001027100.1| 50S ribosomal protein L13 [Burkholderia mallei NCTC 10229] >gi|126448689|ref|YP_001082045.1| 50S ribosomal protein L13 [Burkholderia mallei NCTC 10247] >gi|167000490|ref|ZP_02266302.1| 50S ribosomal protein L13 [Burkholderia mallei PRL-20] >gi|194318286|ref|YP_002014149.1| 50S ribosomal protein L13 [Burkholderia mallei ATCC 10399] >gi|194522847|ref|YP_002058380.1| 50S ribosomal protein L13 [Burkholderia mallei FMH] >gi|194577588|ref|YP_002112467.1| 50S ribosomal protein L13 [Burkholderia mallei 2002721280] >gi|166230967|sp|A3MP59|RL13_BURM7 50S ribosomal protein L13 >gi|166230968|sp|A2S581|RL13_BURM9 50S ribosomal protein L13 >gi|166230969|sp|A1V051|RL13_BURMS 50S ribosomal protein L13 >gi|81684996|sp|Q62HC0|RL13_BURMA 50S ribosomal protein L13 >gi|52429634|gb|AAU50227.1| ribosomal protein L13 [Burkholderia mallei ATCC 23344] >gi|121229692|gb|ABM52210.1| 50S ribosomal protein L13 [Burkholderia mallei SAVP1] >gi|124294321|gb|ABN03590.1| 50S ribosomal protein L13 [Burkholderia mallei NCTC 10229] >gi|126241559|gb|ABO04652.1| 50S ribosomal protein L13 [Burkholderia mallei NCTC 10247] >gi|147746857|gb|EDK53934.1| 50S ribosomal protein L13 [Burkholderia mallei FMH] >gi|148024886|gb|EDK83064.1| 50S ribosomal protein L13 [Burkholderia mallei 2002721280] >gi|160694899|gb|EDP84907.1| 50S ribosomal protein L13 [Burkholderia mallei ATCC 10399] (142 aa)
Score = 305, Expect = 1.1e-26, Identities = 57/130 (43%), Positives = 92/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GD++I+IN+ K+ ++ +K   +K+Y HSGY GG+ E +   M E++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:    13 REWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIVINASKLKVTGNKTLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKAVKGMLPKCPLGYAMIKKLKVYAEATHPHSAQQPKALEI 142
>gi|21911200|ref|NP_665468.1| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS315] >gi|28896577|ref|NP_802927.1| 50S ribosomal protein L13 [Streptococcus pyogenes SSI-1] >gi|56808042|ref|ZP_00365842.1| COG0102: Ribosomal protein L13 [Streptococcus pyogenes M49 591] >gi|71911460|ref|YP_283010.1| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS5005] >gi|139474423|ref|YP_001129139.1| 50S ribosomal protein L13 [Streptococcus pyogenes str. Manfredo] >gi|162139074|ref|YP_597379.2| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS9429] >gi|162139098|ref|YP_599324.2| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS10270] >gi|162139123|ref|YP_601266.2| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS2096] >gi|162139175|ref|YP_603235.2| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS10750] >gi|162139392|ref|YP_281100.2| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS6180] >gi|21905412|gb|AAM80271.1| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS315] >gi|28811831|dbj|BAC64760.1| 50S ribosomal protein L13 [Streptococcus pyogenes SSI-1] >gi|71854242|gb|AAZ52265.1| LSU ribosomal protein L13P [Streptococcus pyogenes MGAS5005] >gi|134272670|emb|CAM30941.1| 50S ribosomal protein L13 [Streptococcus pyogenes str. Manfredo] (148 aa)
Score = 305, Expect = 1.1e-26, Identities = 62/140 (44%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK  +   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:     1 MNKTTFMAKPGQV-ERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKVYYTHSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 139
>gi|15675736|ref|NP_269910.1| 50S ribosomal protein L13 [Streptococcus pyogenes M1 GAS] >gi|13622956|gb|AAK34631.1| 50S ribosomal protein L13 [Streptococcus pyogenes M1 GAS] (148 aa)
Score = 305, Expect = 1.2e-26, Identities = 62/140 (44%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTTF+     +  +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK  +   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:     1 MNKTTFMAKPGQV-ERKWYVVDAADVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKVYYTHSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 139
>gi|120325232|gb|ABM19547.1| LSU ribosomal protein L13P [Marinobacter aquaeolei VT8] (200 aa)
Score = 304, Expect = 1.2e-26, Identities = 55/130 (42%), Positives = 90/130 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WYV+DA+   LG+L+ E A  LRGK+K ++TP+VD GDY+I+IN+ ++ ++  KA  + +Y+H+G+ GG+K  +   +++K  +++I  A+KGMLPK  L R + KKL +Y  A H  AAQ+P E+ +
  S:    71 RDWYVVDAAGKTLGRLSTEIALRLRGKHKPEYTPHVDTGDYIIVINASQVKVTGKKASAKMYYSHTGFPGGIKSINFEKLVDKAPEQVIQKAVKGMLPKGPLGRAMFKKLKVYAGAEHAHAAQQPKELDI 200
>gi|196158180|ref|YP_002127669.1| 50S ribosomal protein L13 [Alteromonas macleodii 'Deep ecotype'] >gi|88773656|gb|EAR04919.1| 50S ribosomal protein L13 [Alteromonas macleodii 'Deep ecotype'] >gi|196113959|gb|ACG67675.1| 50S ribosomal protein L13 [Alteromonas macleodii 'Deep ecotype'] (142 aa)
Score = 304, Expect = 1.3e-26, Identities = 60/136 (44%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA++  LG+LA E A  LRGK+K ++TP+VD GDY+I+IN++K+ ++  KA  + +Y HSGY GGLKE +   +I    + ++  A+KGMLPK  L R + +K+ +Y  A H  AAQ+P
  S:     3 TFVAKPETV-QRDWYVVDATDKTLGRLASEIALRLRGKHKPEYTPHVDTGDYIIVINAEKVAVTGRKAQDKMYYAHSGYPGGLKETNFEKLIAHKPEMVLEKAVKGMLPKGPLGRAMFRKMKVYAGAEHSHAAQQP 137
>gi|62424144|ref|ZP_00379294.1| COG0102: Ribosomal protein L13 [Brevibacterium linens BL2] (147 aa)
Score = 304, Expect = 1.4e-26, Identities = 54/131 (41%), Positives = 88/131 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           ++W+VIDA++ +LG+LA + A +LRGK+K  F P++D GD++IIIN+DK+ L+  K D+++ Y HSGY GGLK  +   ++    ++ +  A+ GM+PK  L R  ++KL +Y+   H  AAQ P   +L+
  S:    13 RQWHVIDATDQVLGRLAAQVARLLRGKHKTTFAPHIDTGDFVIIINADKVALTGAKLDQKRAYHHSGYPGGLKSVNYAELLATNPERAVEKAVGGMVPKTRLGRAQMQKLKVYQGGEHPHAAQNPQPYELS 143
>gi|85058194|ref|YP_453896.1| 50S ribosomal protein L13 [Sodalis glossinidius str. 'morsitans'] >gi|118573453|sp|Q2NWI4|RL13_SODGM 50S ribosomal protein L13 >gi|84778714|dbj|BAE73491.1| 50S ribosomal protein L13 [Sodalis glossinidius str. 'morsitans'] (142 aa)
Score = 304, Expect = 1.5e-26, Identities = 54/125 (43%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA    LG+LA E A  LRGK+K ++TP+VD GDYLI++N+DK+ ++ +K + + +Y ++G++GG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDAEGKTLGRLATELARRLRGKHKAEYTPHVDTGDYLIVLNADKVAVTGNKRNDKIYYHYTGHVGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQP 137
>gi|15602385|ref|NP_245457.1| 50S ribosomal protein L13 [Pasteurella multocida subsp. multocida str. Pm70] >gi|81783296|sp|Q9CNB2|RL13_PASMU 50S ribosomal protein L13 >gi|12720781|gb|AAK02604.1| RpL13 [Pasteurella multocida subsp. multocida str. Pm70] (142 aa)
Score = 304, Expect = 1.5e-26, Identities = 57/136 (41%), Positives = 92/136 (67%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA+   LG+LA E A  LRGK+K ++TP+VD GDY+I+IN++K+ ++ +K   + ++ H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y  + H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVINAEKVAVTGNKESDKLYHWHTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLPKGPLGRAMYRKLKVYAGSEHNHAAQQP 137
>gi|42518461|ref|NP_964391.1| 50S ribosomal protein L13 [Lactobacillus johnsonii NCC 533] >gi|81703895|sp|Q74L58|RL13_LACJO 50S ribosomal protein L13 >gi|41582746|gb|AAS08357.1| 50S ribosomal protein L13 [Lactobacillus johnsonii NCC 533] (147 aa)
Score = 303, Expect = 1.6e-26, Identities = 59/131 (45%), Positives = 89/131 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +KWYVIDA+++ LG+L+   A+ILRGKNK  +TPNVD GDY+I++N+ K+ L+  KA  + +Y HS Y GGL+      ++ K   +L+  ++KGMLPKNTL      K+ +Y   +H+ AAQKP ++ +N
  S:    14 RKWYVIDATDVSLGRLSTAVASILRGKNKPQYTPNVDTGDYVIVVNAAKLKLTGKKATDKIYYRHSDYRGGLRATPAGELLAKNPVRLVELSVKGMLPKNTLGHQEFMKMHVYAGEDHEHAAQKPEKLDIN 144
>gi|110596890|ref|ZP_01385180.1| ribosomal protein L13 [Chlorobium ferrooxidans DSM 13031] >gi|110341577|gb|EAT60037.1| ribosomal protein L13 [Chlorobium ferrooxidans DSM 13031] (149 aa)
Score = 303, Expect = 1.6e-26, Identities = 60/145 (41%), Positives = 95/145 (65%)
  Q:     1 MQKTTFVKNEAAL---ANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M KT   K  +A      +KWY+IDA   +LG++A E A +LRGK+K  FTP++D GD++++ N+ K+ L+  K D++ +++HS Y GG+K    + +++K  +K+I  A+ GMLP N L R L +KL +Y    H  AAQ P+E+K+
  S:     1 MSKTLSFKTYSAKPVEVERKWYIIDAEGQVLGRMASEIAKVLRGKHKAQFTPHIDTGDFIVVTNAAKVALTGKKEDQKSYFSHSHYPGGVKIDHVKDVLKKKPEKVIEHAVWGMLPHNNLGRQLFRKLKVYAGPEHPHAAQVPVEMKI 148
>gi|50955535|ref|YP_062823.1| 50S ribosomal protein L13 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50952017|gb|AAT89718.1| 50S ribosomal protein L13 [Leifsonia xyli subsp. xyli str. CTCB07] (148 aa)
Score = 303, Expect = 1.6e-26, Identities = 55/125 (44%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W VIDA+N++LG+LA   A +LRGK+K  F P++D GD++II+N+DK+  +  K  ++K Y HSGY GGLK  +   ++EK   + +  A++GMLPKN++ R   +KL +Y  + H  AAQ+P
  S:    14 RDWVVIDATNVVLGRLASHTAALLRGKHKATFAPHMDTGDFVIIVNADKVAFTGQKVAQKKAYRHSGYPGGLKAVTYAELLEKNPVRAVEKAVRGMLPKNSIGRAQFRKLKVYTGSEHPHAAQQP 138
>gi|114773863|ref|ZP_01450822.1| 50S ribosomal subunit protein L13 [alpha proteobacterium HTCC2255] (142 aa)
Score = 303, Expect = 1.7e-26, Identities = 59/136 (43%), Positives = 92/136 (67%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA++  LG+LA E A  LRGK+K ++TP+VD GDY++++N++KI ++ +KA  + +Y+HSGY GGLK+ +   +I K  + ++  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:     3 TFVAKPETV-QRDWYVVDAADKTLGRLAAEIALRLRGKHKPEYTPHVDTGDYIVVVNAEKIAVTGNKAKDKIYYSHSGYPGGLKDTTFEKLIAKKPEMVLEKAVKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQP 137
>gi|116628994|ref|YP_814166.1| 50S ribosomal protein L13 [Lactobacillus gasseri ATCC 33323] >gi|116094576|gb|ABJ59728.1| LSU ribosomal protein L13P [Lactobacillus gasseri ATCC 33323] (158 aa)
Score = 303, Expect = 1.7e-26, Identities = 59/131 (45%), Positives = 89/131 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +KWYVIDA+++ LG+L+   A+ILRGKNK  +TPNVD GDY+I++N+ K+ L+  KA  + +Y HS Y GGL+      ++ K   +L+  ++KGMLPKNTL      K+ +Y   +H+ AAQKP ++ +N
  S:    25 RKWYVIDATDVSLGRLSTAVASILRGKNKPQYTPNVDTGDYVIVVNAGKLKLTGKKATDKIYYHHSDYRGGLRATPAGELLAKNPVRLVELSVKGMLPKNTLGHQEFMKMHVYAGEDHEHAAQKPEKLDIN 155
>gi|24378684|ref|NP_720639.1| 50S ribosomal protein L13 [Streptococcus mutans UA159] >gi|24376547|gb|AAN57945.1|AE014868_7 50S ribosomal protein L13 [Streptococcus mutans UA159] (148 aa)
Score = 303, Expect = 1.7e-26, Identities = 61/140 (43%), Positives = 94/140 (67%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M KTT++     +  +KWY++DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS Y GGLK+ S   +  K + +LI  ++KGMLP NTL R    KL ++  + H  AAQ+P
  S:     1 MNKTTYMAKPGEV-ERKWYIVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKAANKIYYTHSMYPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGSEHTHAAQQP 139
>gi|77957463|ref|ZP_00821518.1| COG0102: Ribosomal protein L13 [Yersinia bercovieri ATCC 43970] >gi|77963493|ref|ZP_00827302.1| COG0102: Ribosomal protein L13 [Yersinia mollaretii ATCC 43969] (142 aa)
Score = 303, Expect = 1.7e-26, Identities = 55/125 (44%), Positives = 88/125 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+I++N++KI ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDANGKTLGRLATELASRLRGKHKAEYTPHVDTGDYIIVLNAEKIAVTGNKRTDKIYYRHTGHIGGIKQATFEEMIARSPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|42522099|ref|NP_967479.1| 50S ribosomal protein L13 [Bdellovibrio bacteriovorus HD100] >gi|81697912|sp|Q6MQH5|RL13_BDEBA 50S ribosomal protein L13 >gi|39574630|emb|CAE78472.1| 50S ribosomal protein L13 [Bdellovibrio bacteriovorus HD100] (146 aa)
Score = 303, Expect = 2.0e-26, Identities = 59/131 (45%), Positives = 88/131 (67%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +A    +KW+++DA+   +G++A   A ILRGKNK  +TPNVD GD++++IN+DK+ LS  K   +K+Y+H+ + G LKE +     EK S  +I+ A++GMLP N LSR++I K+  Y  A H  AAQKP
  S:     7 KAEEVERKWWIVDAAGQKVGRVATHVATILRGKNKAIYTPNVDTGDFVVVINTDKMELSGTKWQDKKYYSHTRFFGSLKEMTAAQAKEKDSTFIIHEAVRGMLPTNKLSRHVIMKMKAYTGAEHPHAAQKP 137
>gi|33593897|ref|NP_881541.1| 50S ribosomal protein L13 [Bordetella pertussis Tohama I] >gi|161609260|ref|NP_890891.2| 50S ribosomal protein L13 [Bordetella bronchiseptica RB50] >gi|161610378|ref|NP_886036.2| 50S ribosomal protein L13 [Bordetella parapertussis 12822] >gi|81713259|sp|Q7VUV8|RL13_BORPE 50S ribosomal protein L13 >gi|118573382|sp|Q7WFC3|RL13_BORBR 50S ribosomal protein L13 >gi|118573383|sp|Q7W3Z1|RL13_BORPA 50S ribosomal protein L13 >gi|33563971|emb|CAE43234.1| 50s ribosomal protein L13 [Bordetella pertussis Tohama I] (142 aa)
Score = 302, Expect = 2.1e-26, Identities = 56/130 (43%), Positives = 88/130 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+VIDA   +LG++A E A+ LRGK+K +FTP+VD GDY++IIN+  IV++ +KA  +K++ H+ Y GG++E +   M +++  + I  A+KGMLPK  L   +IKKL +Y  A H   AQ+P  ++ 
  S:    13 RDWFVIDAKGKVLGRVASEVAHRLRGKHKPEFTPHVDTGDYIVIINAADIVVTGNKAQDKKYFRHTTYPGGIRETNFEKMQQRFPGRAIQKAVKGMLPKGPLGYAMIKKLKVYAGAEHPHTAQQPKPLEF 142
>gi|77973394|ref|ZP_00828942.1| COG0102: Ribosomal protein L13 [Yersinia frederiksenii ATCC 33641] >gi|123443924|ref|YP_001007895.1| 50S ribosomal protein L13 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166199631|sp|A1JR94|RL13_YERE8 50S ribosomal protein L13 >gi|122090885|emb|CAL13767.1| 50S ribosomal protein L13 [Yersinia enterocolitica subsp. enterocolitica 8081] (142 aa)
Score = 302, Expect = 2.2e-26, Identities = 54/125 (43%), Positives = 88/125 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+   LG+LA E A+ LRGK+K ++TP+VD GDY+I++N++K+ ++ +K   + +Y H+G+IGG+K+ +   MI +  +++I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWYVVDANGKTLGRLATELASRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKIYYRHTGHIGGIKQATFEEMIARSPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|400985|sp|P31781|RL13_HAESO 50S ribosomal protein L13 >gi|7240280|gb|AAB20820.2| ribosomal protein L13 homolog [Haemophilus somnus] (142 aa)
Score = 302, Expect = 2.2e-26, Identities = 56/136 (41%), Positives = 91/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA+   LG+L  E A  LRGK+K ++TP+VD GDY+++IN++K+ ++ +K   + +Y H+GY+GG+K+ + + MI +  + +I  A+KGMLPK  L R + +KL +Y  + H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDATGKTLGRLGHELARRLRGKHKAEYTPHVDTGDYIVVINAEKVAVTGNKETDKLYYWHTGYVGGIKQATFKEMIARRPEAVIEIAVKGMLPKGPLGRAMFRKLKVYAGSEHNHAAQQP 137
>gi|148652607|ref|YP_001279700.1| 50S ribosomal protein L13 [Psychrobacter sp. PRwf-1] >gi|172048512|sp|A5WDK9|RL13_PSYWF 50S ribosomal protein L13 >gi|148571691|gb|ABQ93750.1| LSU ribosomal protein L13P [Psychrobacter sp. PRwf-1] (142 aa)
Score = 302, Expect = 2.4e-26, Identities = 59/128 (46%), Positives = 85/128 (66%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           WY++DA    LG+LA + A  LRGK+K  FTP+VD GDY+++IN+DKI ++  KA  +K+Y HSGY GG+KE +   +I    ++++  A+KGMLPK  L    IKKL +Y    H  AAQ+P E+ +
  S:    15 WYIVDAEGKTLGRLATQIAARLRGKHKPSFTPHVDTGDYIVVINADKIAVTGKKAQDKKYYRHSGYPGGIKETNFTKLIAHKPEEVLLKAVKGMLPKGPLGYATIKKLKLYAGTEHPHAAQQPKELDI 142
>gi|109900004|ref|YP_663259.1| 50S ribosomal protein L13 [Pseudoalteromonas atlantica T6c] >gi|118573428|sp|Q15PI3|RL13_PSEA6 50S ribosomal protein L13 >gi|109702285|gb|ABG42205.1| LSU ribosomal protein L13P [Pseudoalteromonas atlantica T6c] (142 aa)
Score = 301, Expect = 2.7e-26, Identities = 58/136 (42%), Positives = 94/136 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  ++WYV+DA++  LG+LA E A+ LRGK+K ++TP+VD GDY+++IN++K+V++ +KA  + +Y+H+GY GGLKE +   +     + +I  A+KGMLPK  L R + +K+ ++    HK AAQ+P
  S:     3 TFVAKPETV-KREWYVVDAADKTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEKVVVTGNKAKGKMYYSHTGYPGGLKETNFEKLQAFKPEMIIEKAVKGMLPKGPLGRDMFRKMKVFAGPEHKHAAQQP 137
>gi|33574522|emb|CAE39167.1| 50s ribosomal protein L13 [Bordetella parapertussis] >gi|33577455|emb|CAE34720.1| 50s ribosomal protein L13 [Bordetella bronchiseptica RB50] (155 aa)
Score = 301, Expect = 2.7e-26, Identities = 56/130 (43%), Positives = 88/130 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+VIDA   +LG++A E A+ LRGK+K +FTP+VD GDY++IIN+  IV++ +KA  +K++ H+ Y GG++E +   M +++  + I  A+KGMLPK  L   +IKKL +Y  A H   AQ+P  ++ 
  S:    26 RDWFVIDAKGKVLGRVASEVAHRLRGKHKPEFTPHVDTGDYIVIINAADIVVTGNKAQDKKYFRHTTYPGGIRETNFEKMQQRFPGRAIQKAVKGMLPKGPLGYAMIKKLKVYAGAEHPHTAQQPKPLEF 155
>gi|72382941|ref|YP_292296.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. NATL2A] >gi|124026683|ref|YP_001015798.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. NATL1A] >gi|123620756|sp|Q46IT5|RL13_PROMT 50S ribosomal protein L13 >gi|166231010|sp|A2C4X4|RL13_PROM1 50S ribosomal protein L13 >gi|72002791|gb|AAZ58593.1| LSU ribosomal protein L13P [Prochlorococcus marinus str. NATL2A] >gi|123961751|gb|ABM76534.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. NATL1A] (150 aa)
Score = 301, Expect = 2.7e-26, Identities = 53/132 (40%), Positives = 93/132 (70%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +++W+++DA N  LG+LA E A++LRGK K +FTP++D GD++I++N++KI ++  K+D++ +  HSG  GG+K ++ + +  +  ++++  AIKGMLP   L R L  KL +YK ++H  +AQ+P  + LN
  S:    13 DRQWFLVDAENQTLGRLATEVASVLRGKTKPNFTPHLDTGDFVIVVNAEKIKVTGKKSDQKLYRRHSGRPGGMKVETFKALQSRIPERIVEKAIKGMLPHTRLGRQLFTKLKVYKGSDHPHSAQEPKILSLN 144
>gi|52078643|ref|YP_077434.1| 50S ribosomal protein L13 [Bacillus licheniformis ATCC 14580] >gi|52784005|ref|YP_089834.1| 50S ribosomal protein L13 [Bacillus licheniformis ATCC 14580] >gi|81691242|sp|Q65P73|RL13_BACLD 50S ribosomal protein L13 >gi|52001854|gb|AAU21796.1| ribosomal protein L13 [Bacillus licheniformis ATCC 14580] >gi|52346507|gb|AAU39141.1| RplM [Bacillus licheniformis DSM 13] (145 aa)
Score = 301, Expect = 2.8e-26, Identities = 62/138 (44%), Positives = 93/138 (67%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT + N A+   +KW V+DA+   LG+L+ E A+ILRGK+K  +TP+VD GD++IIIN++KI L+  K   + +Y H+ + GGLK ++   M   Y +K++  AIKGMLPK +L R + KKL +Y+ + H   AQKP
  S:     2 RTTPMAN-ASNIERKWLVVDAAGKTLGRLSTEVASILRGKHKPTYTPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLELAIKGMLPKGSLGRQMFKKLNVYRGSEHPHQAQKP 138
>gi|39997967|ref|NP_953918.1| 50S ribosomal protein L13 [Geobacter sulfurreducens PCA] >gi|81701317|sp|Q748X4|RL13_GEOSL 50S ribosomal protein L13 >gi|39984912|gb|AAR36268.1| ribosomal protein L13 [Geobacter sulfurreducens PCA] (143 aa)
Score = 301, Expect = 2.9e-26, Identities = 60/145 (41%), Positives = 95/145 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M+ T   K E     + WY++DA N +LG++A E ANILRGK K  +TP+VD GD+++++N+ K+ L+ +K   + +Y H+G+ GG+K  +   +IEK  + LI  A+KGMLPKN L+R+++KKL +Y    H   AQ+P  + +
  S:     1 MKTTKVAKKEEV--TRDWYLVDADNKVLGRMATEIANILRGKKKPIYTPSVDTGDFVVVVNAAKLQLTGNKLADKMYYHHTGFPGGIKSITAGKLIEKKPEDLIRKAVKGMLPKNKLARHMLKKLKVYAGPEHPHEAQQPKTLDI 143
>gi|148655307|ref|YP_001275512.1| 50S ribosomal protein L13 [Roseiflexus sp. RS-1] >gi|166199613|sp|A5USF9|RL13_ROSS1 50S ribosomal protein L13 >gi|148567417|gb|ABQ89562.1| LSU ribosomal protein L13P [Roseiflexus sp. RS-1] (146 aa)
Score = 301, Expect = 2.9e-26, Identities = 55/131 (41%), Positives = 89/131 (67%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +A+   ++WYVIDA+N  LG+LA + A +LRGK+K  F+P +D GD++I++N+++I L+  K +++ +Y HS Y GG K  S + ++ K+ ++++  A+KGMLPK  L R  + KL IY    H  AAQ+P
  S:     7 KASEVQREWYVIDATNQTLGRLATQIATLLRGKHKPTFSPYIDGGDFVIVVNAERIRLTGRKPEQKMYYRHSNYPGGFKAVSFKQLMAKHPERVLRFAVKGMLPKTRLGRQQLTKLKIYAGPKHPHAAQQP 137
>gi|73540174|ref|YP_294694.1| 50S ribosomal protein L13 [Ralstonia eutropha JMP134] >gi|118573434|sp|Q475T3|RL13_RALEJ 50S ribosomal protein L13 >gi|72117587|gb|AAZ59850.1| LSU ribosomal protein L13P [Ralstonia eutropha JMP134] (142 aa)
Score = 301, Expect = 2.9e-26, Identities = 58/134 (43%), Positives = 90/134 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   + WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GDY+II+N+ K+ ++  K   +K+Y HSGY GG+ E +   M +++  + +  A+KGMLPK  L   +IKKL +Y +A H   AQ+P  +++
  S:     9 AEVKRDWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDYIIIVNAAKLRVTGTKETDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEAEHPHEAQQPKALEI 142
>gi|119946500|ref|YP_944180.1| 50S ribosomal protein L13 [Psychromonas ingrahamii 37] >gi|166199605|sp|A1SYL6|RL13_PSYIN 50S ribosomal protein L13 >gi|119865104|gb|ABM04581.1| LSU ribosomal protein L13P [Psychromonas ingrahamii 37] (142 aa)
Score = 301, Expect = 2.9e-26, Identities = 58/136 (42%), Positives = 93/136 (68%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV   A +  + W+V+DA    LG+LA E A  LRGK+K ++TP+VD GDY+I+IN++KI ++ +KA  + +Y H+G+IGG+K  S   +I++  +++I  A+KGMLP+  L R + +KL +Y    H+ +AQ+P
  S:     3 TFVAKPAEV-KRDWFVVDAEGKTLGRLATEIALRLRGKHKAEYTPHVDTGDYIIVINAEKITVTGNKAKGKIYYHHTGFIGGIKAISFEDLIKRAPERVIEKAVKGMLPRGPLGRAMYRKLKVYAGTEHQHSAQQP 137
>gi|74316471|ref|YP_314211.1| 50S ribosomal protein L13 [Thiobacillus denitrificans ATCC 25259] >gi|118573463|sp|Q3SLK1|RL13_THIDA 50S ribosomal protein L13 >gi|74055966|gb|AAZ96406.1| ribosomal protein L13 [Thiobacillus denitrificans ATCC 25259] (148 aa)
Score = 301, Expect = 3.0e-26, Identities = 57/131 (43%), Positives = 89/131 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           + W+V+DA N +LG+LA E A  LRGK+K +FTP+VD GDY++++N+ K+V++ +K   +K+Y HSGY GG+ E +   M  ++  + +  A+KGMLPK  L   +IKK+ IY  A+H   AQ+P  + +N
  S:    13 RDWFVVDADNKVLGRLASEIARRLRGKHKPEFTPHVDTGDYIVVVNASKMVVTGNKGLDKKYYRHSGYPGGIYETNFDKMQARFPGRALEKAVKGMLPKGPLGYAMIKKMKIYAGADHPHEAQQPKPLDIN 143
>gi|71278721|ref|YP_271091.1| 50S ribosomal protein L13 [Colwellia psychrerythraea 34H] >gi|118573396|sp|Q47VT1|RL13_COLP3 50S ribosomal protein L13 >gi|71144461|gb|AAZ24934.1| ribosomal protein L13 [Colwellia psychrerythraea 34H] (142 aa)
Score = 301, Expect = 3.1e-26, Identities = 56/141 (39%), Positives = 96/141 (68%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TFV   A++  ++W+++DA +  LG++A E A  LRGK+K ++TP+VD GDY+++IN++K+ ++ +KA  + +Y+H+ + GGLK+ S   +IEK   +++  A+KGMLPK  L R + +KL +Y    H   AQ+P  ++L
  S:     3 TFVAKPASV-QREWFLVDAEDKTLGRIATEIATRLRGKHKAEYTPHVDTGDYIVVINAEKVRVTGNKAKGKIYYSHTEFPGGLKQISFEKLIEKAPTRVLEFAVKGMLPKGPLGREMFRKLKVYAGPEHAHTAQQPQLLEL 142
>gi|78780009|ref|YP_398121.1| 50S ribosomal protein L13 [Prochlorococcus marinus str. MIT 9312] >gi|123553722|sp|Q318L0|RL13_PROM9 50S ribosomal protein L13 >gi|78713508|gb|ABB50685.1| LSU ribosomal protein L13P [Prochlorococcus marinus str. MIT 9312] (143 aa)
Score = 301, Expect = 3.2e-26, Identities = 56/126 (44%), Positives = 87/126 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM 141
           + W+++DA +  LG+LA E A +LRGKNK  FTP++D GD++I++N++KI +S  KA ++ +  HSG  GG+K +    + E+  +++I  A+KGMLP N+L R   KKL +YK A+H  AAQ P+
  S:    14 RNWFLVDAKDKTLGRLATEIATVLRGKNKPTFTPHLDTGDFVIVVNAEKIEVSGKKASQKLYRRHSGRPGGMKTEKFESLQERIPERIIEQAVKGMLPHNSLGRQQFKKLKVYKGADHPHAAQNPV 139
>gi|187479440|ref|YP_787465.1| 50S ribosomal protein L13 [Bordetella avium 197N] >gi|118573381|sp|Q2KV01|RL13_BORA1 50S ribosomal protein L13 >gi|115424027|emb|CAJ50580.1| 50S ribosomal protein L13 [Bordetella avium 197N] (142 aa)
Score = 301, Expect = 3.3e-26, Identities = 57/130 (43%), Positives = 86/130 (66%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+VIDA   +LG++A E A  LRGK+K +FTP+VD GDY++IIN+  IV++  K+  +K++ H+ Y GG++E +   M E++  + I  A+KGMLPK  L   +IKKL +Y  A H   AQ+P  + L
  S:    13 RDWFVIDAKGKVLGRVASEVARRLRGKHKPEFTPHVDTGDYIVIINAADIVVTGKKSQDKKYFRHTTYPGGIRETNFEKMQERFPGRAIQKAVKGMLPKGPLGYAMIKKLKVYAGAEHPHTAQQPKPLDL 142
>gi|113866511|ref|YP_725000.1| 50S ribosomal protein L13 [Ralstonia eutropha H16] >gi|188591226|ref|YP_001795826.1| 50S ribosomal subunit protein L13 [Cupriavidus taiwanensis] >gi|123329572|sp|Q0KED9|RL13_RALEH 50S ribosomal protein L13 >gi|113525287|emb|CAJ91632.1| LSU ribosomal protein L13 [Ralstonia eutropha H16] >gi|170938120|emb|CAP63106.1| 50S ribosomal subunit protein L13 [Cupriavidus taiwanensis] (142 aa)
Score = 301, Expect = 3.3e-26, Identities = 57/130 (43%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GDY+II+N+ K+ ++  K   +K+Y HSGY GG+ E +   M +++  + +  A+KGMLPK  L   +IKKL +Y +A H   AQ+P  +++
  S:    13 RDWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDYIIIVNAAKLRVTGTKETDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEAEHPHEAQQPKALEI 142
>gi|117923562|ref|YP_864179.1| 50S ribosomal protein L13 [Magnetococcus sp. MC-1] >gi|166230995|sp|A0L480|RL13_MAGSM 50S ribosomal protein L13 >gi|117607318|gb|ABK42773.1| LSU ribosomal protein L13P [Magnetococcus sp. MC-1] (144 aa)
Score = 300, Expect = 3.5e-26, Identities = 57/130 (43%), Positives = 92/130 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKE-KSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KWYVIDA+++++G+LA E A  LRGK+K  +TP +DCGD +II+N++K+  + +K + + +Y HS + GGLK   + + +   + ++++  AIKGMLPKN L R + +KL +YK + H   AQ+P E+KL
  S:    13 RKWYVIDATDMVVGRLASEVAKRLRGKHKPTYTPFMDCGDNIIIVNAEKVRFTGNKRNDKVYYWHSRFPGGLKSITADKELSGNHPERVLEKAIKGMLPKNVLGRQMFRKLNVYKGSEHPHTAQQPEELKL 143
>gi|114327629|ref|YP_744786.1| 50S ribosomal protein L13 [Granulibacter bethesdensis CGDNIH1] >gi|114315803|gb|ABI61863.1| LSU ribosomal protein L13P [Granulibacter bethesdensis CGDNIH1] (154 aa)
Score = 300, Expect = 3.7e-26, Identities = 61/143 (42%), Positives = 95/143 (66%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KTT     A + NK W +IDA  L+LG+LAV  AN LRGK+K  FTP+VDCGD +++IN+DKI ++ +KAD+  +Y H+GY GG+K +S R  +E K+ + ++  A++ M+ +  L R  +K L++Y  A+H    Q+P  + +
  S:     2 KTTLSLKPAEV-NKDWVLIDAEGLVLGRLAVIIANRLRGKHKPQFTPHVDCGDNVVVINADKIRVTGNKADQSVFYYHTGYAGGIKGRSIRQRLEGKHPESVVEKAVERMITRGPLQRQQMKHLYVYAGASHPHDGQQPKSLDV 144
>gi|21229953|ref|NP_635870.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|21241260|ref|NP_640842.1| 50S ribosomal protein L13 [Xanthomonas axonopodis pv. citri str. 306] >gi|66766829|ref|YP_241591.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. campestris str. 8004] >gi|78046079|ref|YP_362254.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|166713797|ref|ZP_02245004.1| 50S ribosomal protein L13 [Xanthomonas oryzae pv. oryzicola BLS256] >gi|188989902|ref|YP_001901912.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. campestris] >gi|81307182|sp|Q4UZF2|RL13_XANC8 50S ribosomal protein L13 >gi|81754763|sp|Q7CLV7|RL13_XANCP 50S ribosomal protein L13 >gi|81792145|sp|Q8NL21|RL13_XANAC 50S ribosomal protein L13 >gi|118573465|sp|Q3BYA9|RL13_XANC5 50S ribosomal protein L13 >gi|21106576|gb|AAM35378.1| 50S ribosomal protein L13 [Xanthomonas axonopodis pv. citri str. 306] >gi|21111465|gb|AAM39794.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66572161|gb|AAY47571.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. campestris str. 8004] >gi|78034509|emb|CAJ22154.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|167731662|emb|CAP49840.1| 50S ribosomal protein L13 [Xanthomonas campestris pv. campestris] (142 aa)
Score = 300, Expect = 3.7e-26, Identities = 58/137 (42%), Positives = 93/137 (67%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TTF   ++    + WY++DA+   LG+L+ E A  LRGK+K  +TP+VD GDYL++IN++KIV++ +K   +K++  +GYIG LK +S    ++++ +++I  A+KGMLPK  L R + +KL +Y  A H  AAQ+P
  S:     2 TTFTA-KSETVQRDWYLVDAAGKTLGRLSTELARRLRGKHKPVYTPHVDTGDYLVVINAEKIVVTGNKLKDKKYHRFTGYIGNLKTESLEQALQRHPERVIEIAVKGMLPKGPLGRTMYRKLKVYSGAEHPHAAQQP 137
>gi|77166287|ref|YP_344812.1| 50S ribosomal protein L13 [Nitrosococcus oceani ATCC 19707] >gi|118573424|sp|Q3J7B4|RL13_NITOC 50S ribosomal protein L13 >gi|76884601|gb|ABA59282.1| LSU ribosomal protein L13P [Nitrosococcus oceani ATCC 19707] (142 aa)
Score = 300, Expect = 3.8e-26, Identities = 54/130 (41%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WY++DA+ + LG+LA E A  LRGK+K  +TP++D GDY++++N++KI  +  K  ++ +Y HSGY GG+K  +   ++E+  ++ I  A+KGMLPKN L R + +KL +Y  +NH   AQ+P  +K+
  S:    13 RDWYLVDANGVTLGRLASEIARRLRGKHKAIYTPHIDTGDYIVVVNAEKIRATGKKMAQKHYYRHSGYPGGIKSLTLEKLLERAPERAIELAVKGMLPKNPLGRAMFRKLNVYGGSNHPHIAQQPQPLKI 142
>gi|32265997|ref|NP_860029.1| 50S ribosomal protein L13 [Helicobacter hepaticus ATCC 51449] >gi|81712943|sp|Q7VIV6|RL13_HELHP 50S ribosomal protein L13 >gi|32262046|gb|AAP77095.1| ribosomal protein L13 [Helicobacter hepaticus ATCC 51449] (142 aa)
Score = 300, Expect = 3.8e-26, Identities = 54/124 (43%), Positives = 88/124 (70%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           N++W V+DA + + G+L  E A +LRGK+K  FTP++DCGD+++IIN+ ++  +  K   ++++THSGY G  K K+ + M+EK  +KL + A++GMLPKN L R ++KKL +Y+ + H  +AQ
  S:    13 NRQWIVLDAKDKVFGRLITEIATLLRGKHKPCFTPHIDCGDFVVIINATEVKFTGMKLKDKEYFTHSGYFGSTKSKTLQEMLEKTPEKLYHLAVRGMLPKNKLGRAMLKKLKVYRGSEHPHSAQ 136
>gi|94309355|ref|YP_582565.1| 50S ribosomal protein L13 [Ralstonia metallidurans CH34] >gi|118573435|sp|Q1LRD0|RL13_RALME 50S ribosomal protein L13 >gi|93353207|gb|ABF07296.1| LSU ribosomal protein L13P [Ralstonia metallidurans CH34] (142 aa)
Score = 300, Expect = 4.4e-26, Identities = 57/134 (42%), Positives = 91/134 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   + WYVIDA++ +LG++A E A  LRGK+K +FTP+VD GD++II+N+ K+ ++  K   +K+Y HSGY GG+ E +   M +++  + +  A+KGMLPK  L   +IKKL +Y +A H  +AQ+P  +++
  S:     9 AEVKRDWYVIDATDKVLGRVASEVARRLRGKHKPEFTPHVDTGDFIIIVNAAKLRVTGTKEQDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEAEHPHSAQQPKVLEI 142
>gi|88803941|ref|ZP_01119461.1| 50S ribosomal protein L13 [Robiginitalea biformata HTCC2501] >gi|88784820|gb|EAR15989.1| 50S ribosomal protein L13 [Robiginitalea biformata HTCC2501] (151 aa)
Score = 300, Expect = 4.4e-26, Identities = 60/131 (45%), Positives = 86/131 (65%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           K+W ++DA    LG+LA + A ILRGK K DFTP+VDCGD +++IN++K+ LS +K D +++  ++GY GG + ++ R + EK    L+  A+KGMLPKN L   L + L +Y    H Q AQKP  I LN
  S:    18 KEWLLVDAEGQTLGRLASKVAKILRGKYKPDFTPHVDCGDNVVVINAEKVSLSGNKWDAKEYIRYTGYPGGQRVQTARTLHEKNPTALVEKAVKGMLPKNRLGADLFRNLRVYAGEQHDQEAQKPRAINLN 148
>gi|48374279|gb|AAT41968.1| 50S ribosomal subunit L13 [Fremyella diplosiphon] (158 aa)
Score = 300, Expect = 4.5e-26, Identities = 57/142 (40%), Positives = 98/142 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           T++  + AL  ++WY++DA++  LG+LA E A +LRGK K ++TP++D GD++I+IN++KI ++  K  ++ +  HSG  GG+K ++   + ++  ++++  A+KGMLPKN+L + L  KL +Y    H  AAQKP E+K+N
  S:    11 TYLPPQDAL-EREWYIVDATDQRLGRLASEIAMVLRGKKKAEYTPHLDTGDFVIVINAEKIAVTGKKRTQKLYRRHSGRPGGMKTETFAKLQQRIPERIVEHAVKGMLPKNSLGKQLFTKLKVYAGPTHPHAAQKPKELKVN 151
>gi|116617363|ref|YP_817734.1| 50S ribosomal protein L13 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272436|sp|Q03ZL1|RL13_LEUMM 50S ribosomal protein L13 >gi|116096210|gb|ABJ61361.1| LSU ribosomal protein L13P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (147 aa)
Score = 299, Expect = 5.1e-26, Identities = 65/144 (45%), Positives = 92/144 (63%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +TTF+     +  KKWY+IDA +++LG+L+   A+ILRGKNK  FTPNVD GD +IIIN+ ++ L+  KA  + +Y HS + GGLK ++     E   +KL+  +I GMLPKNTL R     L +Y  + H  AAQKP  + +N
  S:     2 RTTFLAKPGEI-EKKWYIIDAKDVVLGRLSTVVASILRGKNKPTFTPNVDMGDNVIIINASEVKLTGKKATDKVYYHHSNHPGGLKARTAGNYREFNPEKLLELSIHGMLPKNTLGRKQGLNLHVYAGSEHDHAAQKPEALDIN 144
>gi|90106208|gb|ABD88245.1| LSU ribosomal protein L13P [Rhodopseudomonas palustris BisB18] (163 aa)
Score = 299, Expect = 5.3e-26, Identities = 53/129 (41%), Positives = 90/129 (69%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW VIDA+ L++G+LA   AN LRGK+   +TP+VDCGD++II+N+ K+VL+  K + + +Y H+G+IGG+KE++ + ++E ++ ++++  AI+ M+P+  L R  +  L +Y   +H   AQ+P
  S:    18 AEVTKKWIVIDATGLVVGRLATLVANRLRGKHLPTYTPHVDCGDHVIIVNAAKVVLTGRKRENKVYYHHTGFIGGIKERTAKSILEGRFPERVVEKAIERMIPRGPLGRMQMGNLRVYGGPDHPHEAQQP 147
>gi|20808626|ref|NP_623797.1| 50S ribosomal protein L13 [Thermoanaerobacter tengcongensis MB4] >gi|81763383|sp|Q8R7Y8|RL13_THETN 50S ribosomal protein L13 >gi|20517259|gb|AAM25401.1| Ribosomal protein L13 [Thermoanaerobacter tengcongensis MB4] (143 aa)
Score = 299, Expect = 5.5e-26, Identities = 58/130 (44%), Positives = 93/130 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KW+VIDA   +LG+LA + A IL GK+K  +TP+VD GD++++IN+DK+VL+  K + + +  ++GY GGLK+   + +++   + +IY A+KGMLPKN L R +IK+L +Y+ A HK  AQKP ++ +
  S:    13 RKWFVIDAEGKVLGRLASQIAKILMGKHKPTYTPHVDTGDFVVVINADKVVLTGKKLEDKYYKYYTGYPGGLKQIQYKKLMQTKPEFVIYHAVKGMLPKNRLGRRMIKRLKVYRGAEHKHQAQKPEKLDI 142
>gi|88711079|ref|ZP_01105167.1| 50S ribosomal protein L13 [Flavobacteriales bacterium HTCC2170] >gi|88710020|gb|EAR02252.1| 50S ribosomal protein L13 [Flavobacteriales bacterium HTCC2170] (161 aa)
Score = 298, Expect = 6.0e-26, Identities = 60/135 (44%), Positives = 89/135 (65%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           A  NK+W ++DA    LG+LA + A +LRGK+K  FTP+VDCGD ++IIN++KI LS +K D + +  ++GY GG +  + + M++K   +++  A+KGMLPKN L   L + L +Y   +H Q AQKP  I LN
  S:    24 ATVNKQWLLVDAEGETLGRLASKVAKLLRGKHKPSFTPHVDCGDNVVIINAEKITLSGNKWDSKSYSRYTGYPGGQRTTTVKQMLDKNPGRIVEKAVKGMLPKNRLGADLFRNLKVYVGPDHNQEAQKPTAINLN 158
>gi|58583776|ref|YP_202792.1| 50S ribosomal protein L13 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84625586|ref|YP_452958.1| 50S ribosomal protein L13 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188574889|ref|YP_001911818.1| ribosomal protein L13 [Xanthomonas oryzae pv. oryzae PXO99A] >gi|75508056|sp|Q5GV66|RL13_XANOR 50S ribosomal protein L13 >gi|118573466|sp|Q2NYE3|RL13_XANOM 50S ribosomal protein L13 >gi|58428370|gb|AAW77407.1| 50S ribosomal protein L13 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84369526|dbj|BAE70684.1| 50S ribosomal protein L13 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188519341|gb|ACD57286.1| ribosomal protein L13 [Xanthomonas oryzae pv. oryzae PXO99A] (142 aa)
Score = 298, Expect = 6.1e-26, Identities = 57/137 (41%), Positives = 93/137 (67%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TTF   ++    + WY++DA+   LG+L+ E A  LRGK+K  +TP+VD GDYL++IN++KIV++ +K   +K++  +GYIG LK +S    ++++ +++I  A+KGMLPK  + R + +KL +Y  A H  AAQ+P
  S:     2 TTFTA-KSETVQRDWYLVDAAGKTLGRLSTELARRLRGKHKPVYTPHVDTGDYLVVINAEKIVVTGNKLKDKKYHRFTGYIGNLKTESLEQALQRHPERVIEIAVKGMLPKGPMGRTMYRKLKVYSGAEHPHAAQQP 137
>gi|73662004|ref|YP_300785.1| 50S ribosomal protein L13 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|88909109|sp|Q49ZD6|RL13_STAS1 50S ribosomal protein L13 >gi|72494519|dbj|BAE17840.1| 50S ribosomal protein L13 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (145 aa)
Score = 298, Expect = 6.2e-26, Identities = 63/143 (44%), Positives = 89/143 (62%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + TF+ NE+ +  +KWYVIDA    LG+L+ E A ILRGKNKV +TP+VD GDY+I+IN+ KI  + +K   + +Y HS + GG+K  S   +     ++L+  +IKGMLP   L     KKLF+Y  A H   AQ+P   +L
  S:     2 RQTFMANESNI-ERKWYVIDAEGKTLGRLSSEVAAILRGKNKVTYTPHVDTGDYVIVINASKIHFTGNKERDKMYYRHSNHPGGIKSISAGELKANNPERLLENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHTAQQPENYEL 143
>gi|71066120|ref|YP_264847.1| 50S ribosomal protein L13 [Psychrobacter arcticus 273-4] >gi|118573432|sp|Q4FRE5|RL13_PSYA2 50S ribosomal protein L13 >gi|71039105|gb|AAZ19413.1| LSU ribosomal protein L13P [Psychrobacter arcticus 273-4] (142 aa)
Score = 298, Expect = 6.2e-26, Identities = 57/128 (44%), Positives = 85/128 (66%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           WYV+DA    LG+LA + A  LRGK+K  FTP+VD GD++++IN++KI ++  KA  +K+Y HSGY GG+KE +   +I    + +++ A+KGMLPK  L   +IKKL +Y    H   AQ+P E+ +
  S:    15 WYVVDADGKTLGRLATQIATRLRGKHKTCFTPHVDTGDFIVVINAEKIAVTGKKAQDKKYYRHSGYPGGIKETNFTKLIAHKPEDVLHKAVKGMLPKGPLGYAMIKKLKLYAGTEHPHEAQQPKELDI 142
>gi|104773574|ref|YP_618554.1| 50S ribosomal protein L13 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|122397378|sp|Q1GBI6|RL13_LACDA 50S ribosomal protein L13 >gi|103422655|emb|CAI97263.1| 50S ribosomal protein L13 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (147 aa)
Score = 298, Expect = 6.4e-26, Identities = 62/131 (47%), Positives = 86/131 (65%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +KWY+IDA+++ LG+L+   A ILRGKNK  FTPNVD GD +II+N+ K+ L+  KA  + +Y HS Y GGLK  S   ++ K   KL+  ++KGMLPKNTL      K+ +Y    HK  AQKP ++ +N
  S:    14 RKWYLIDATDVSLGRLSTAVATILRGKNKPQFTPNVDTGDNVIIVNASKLKLTGKKATDKIYYHHSEYRGGLKSVSAGELLAKNPVKLVELSVKGMLPKNTLGHQEFLKMHVYAGEEHKHEAQKPEKLDIN 144
>gi|111656948|ref|ZP_01407764.1| hypothetical protein SpneT_02001812 [Streptococcus pneumoniae TIGR4] (142 aa)
Score = 298, Expect = 6.4e-26, Identities = 58/125 (46%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++K+ L+  KA  + +YTHS + GGLK+ S   +  K + +LI  ++KGMLP NTL R    KL ++  A H  AAQ+P
  S:     9 RKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQP 133
>gi|22297652|ref|NP_680899.1| 50S ribosomal protein L13 [Thermosynechococcus elongatus BP-1] >gi|81743999|sp|Q8DMK8|RL13_SYNEL 50S ribosomal protein L13 >gi|22293829|dbj|BAC07661.1| 50S ribosomal protein L13 [Thermosynechococcus elongatus BP-1] (152 aa)
Score = 298, Expect = 6.5e-26, Identities = 56/130 (43%), Positives = 87/130 (66%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +WYVIDA++  LG+LA E A ILRGKNK  +TP++D GD++I+IN++K+ ++  K  ++ +  HSG  GG+K ++   +  +  +++I  A+KGMLPKN+L R L  KL +Y    H   AQKP  + +N
  S:    18 QWYVIDAADQRLGRLAAEIARILRGKNKAIYTPHMDTGDFVIVINAEKVTVTGKKRSQKLYRRHSGRPGGMKIETFDQLQARIPERIIEHAVKGMLPKNSLGRKLFTKLKVYAGPEHPHQAQKPQPLTIN 147
>gi|116490691|ref|YP_810235.1| 50S ribosomal protein L13 [Oenococcus oeni PSU-1] >gi|122277125|sp|Q04G52|RL13_OENOB 50S ribosomal protein L13 >gi|116091416|gb|ABJ56570.1| LSU ribosomal protein L13P [Oenococcus oeni PSU-1] (148 aa)
Score = 298, Expect = 6.6e-26, Identities = 62/143 (43%), Positives = 93/143 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH-KQAAQKPMEIKL 145
           ++TF+     +  + WY++DA+++ LG+L+   A +LRGKNK  FTP+VD GD++I+IN+DK+ L+  KA  + +Y HSGY GGLK +    + EK   KLI  +++GMLPKNTL R    KL +Y       Q+AQKP  + +
  S:     2 RSTFLAKPHEI-QRNWYIVDATDVPLGRLSSVVATVLRGKNKPTFTPSVDTGDFVIVINADKVQLTGKKATDKTYYHHSGYPGGLKARKAGTLREKNPKKLIELSVQGMLPKNTLGRAQGLKLHVYASGEEVGQSAQKPQVLNI 144
>gi|110639413|ref|YP_679622.1| 50S ribosomal protein L13 [Cytophaga hutchinsonii ATCC 33406] >gi|110282094|gb|ABG60280.1| LSU ribosomal protein L13P [Cytophaga hutchinsonii ATCC 33406] (147 aa)
Score = 298, Expect = 6.7e-26, Identities = 58/143 (40%), Positives = 93/143 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KTTF     A   K W ++DA+   LG+ A + A ILRGK+K  +TP+VDCGD +IIIN++KI L+ +K + + + +H+G+ GG + ++ +  + KY +K++  AIKGMLPKN + R L + + +++   H   AQ+P  I+L
  S:     7 KTTFANK--ATVQKDWVIVDAAGKTLGRFASQVAMILRGKHKPSYTPHVDCGDNVIIINAEKIRLTGNKMNDKVYTSHTGHPGGQRFQTPKETLAKYPEKVLERAIKGMLPKNRIGRELFRHVHVFEGTQHPHEAQQPKVIQL 147
>gi|78357649|ref|YP_389098.1| 50S ribosomal protein L13 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|118573398|sp|Q30Y43|RL13_DESDG 50S ribosomal protein L13 >gi|78220054|gb|ABB39403.1| LSU ribosomal protein L13P [Desulfovibrio desulfuricans G20] (144 aa)
Score = 298, Expect = 7.2e-26, Identities = 53/130 (40%), Positives = 90/130 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WYV+DA + ILG+LA + A+ LRGK+K +F P+VD GD+++++N +KI ++  K   +K+Y +SGY+GGL+E++   ++    ++ +  A+KGMLP+N L R ++KKL +Y  + H   AQ P  ++L
  S:    13 RDWYVVDAEDKILGRLAAQIAHRLRGKHKPEFAPHVDNGDFIVVVNCEKIAVTGKKLSDKKYYRYSGYVGGLREQTLANVLATKPERALINAVKGMLPRNRLGRAMLKKLKVYAGSEHPHQAQNPQALEL 142
>gi|81429335|ref|YP_396336.1| 50S ribosomal protein L13 [Lactobacillus sakei subsp. sakei 23K] >gi|118573409|sp|Q38UV4|RL13_LACSS 50S ribosomal protein L13 >gi|78610978|emb|CAI56030.1| 50S ribosomal protein L13 [Lactobacillus sakei subsp. sakei 23K] (147 aa)
Score = 298, Expect = 7.2e-26, Identities = 61/138 (44%), Positives = 90/138 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT++     +  +KWYVIDA+++ LG+L+   A+ILRGKNK  FTPNVD GD +I+IN++KI L+  KA  + ++ HS + GGLK ++   + E   ++LI  ++KGMLPKN+L      KL +Y    HK  AQ P
  S:     2 RTTYMAKPGEV-ERKWYVIDATDIALGRLSTVVASILRGKNKPTFTPNVDTGDNIIVINAEKIKLTGRKATDKLYHHHSNHPGGLKTRTAGEIRENNPERLIEMSVKGMLPKNSLGHNQFLKLHVYAGGEHKHQAQNP 138
>gi|114564521|ref|YP_752035.1| 50S ribosomal protein L13 [Shewanella frigidimarina NCIMB 400] >gi|118573446|sp|Q07XR8|RL13_SHEFN 50S ribosomal protein L13 >gi|114335814|gb|ABI73196.1| ribosomal protein L13 [Shewanella frigidimarina NCIMB 400] (142 aa)
Score = 298, Expect = 7.5e-26, Identities = 54/125 (43%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+V+DA    LG++A E A  LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y+HSG+IGG+K+ S   +     + +I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWFVVDAEGKTLGRIATEIATRLRGKHKPEYTPHVDTGDYIIVINAEKVTVTGNKAAGKIYYSHSGFIGGIKQISFEKLQAHKPEMIIEKAVKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQP 137
>gi|34540204|ref|NP_904683.1| 50S ribosomal protein L13 [Porphyromonas gingivalis W83] >gi|34396516|gb|AAQ65582.1| ribosomal protein L13 [Porphyromonas gingivalis W83] (151 aa)
Score = 298, Expect = 7.6e-26, Identities = 57/135 (42%), Positives = 85/135 (62%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           A   K+W ++DA    LG++  + A +LRGK K +FTP+VDCGD +I+IN+DKIVLS +K D   +  H+GY GG ++ + R  + K  + L    +KGMLPKN L   +I  L++Y    HK  AQ+P ++ +N
  S:    14 ATVTKEWVIVDAEGQTLGRMCAKVAKLLRGKYKPNFTPHVDCGDNVIVINADKIVLSGNKWDGRIYLRHTGYPGGQRQFTPRDFMNKGPEYLFRKVVKGMLPKNRLGAKIIGNLYVYAGTEHKHEAQQPRQLDIN 148
>gi|120600223|ref|YP_964797.1| 50S ribosomal protein L13 [Shewanella sp. W3-18-1] >gi|124547918|ref|ZP_01706725.1| ribosomal protein L13 [Shewanella putrefaciens 200] >gi|146291849|ref|YP_001182273.1| 50S ribosomal protein L13 [Shewanella putrefaciens CN-32] >gi|166199619|sp|A4Y3E1|RL13_SHEPC 50S ribosomal protein L13 >gi|166199621|sp|A1RNJ8|RL13_SHESW 50S ribosomal protein L13 >gi|120560316|gb|ABM26243.1| ribosomal protein L13 [Shewanella sp. W3-18-1] >gi|124508894|gb|EAY52982.1| ribosomal protein L13 [Shewanella putrefaciens 200] >gi|145563539|gb|ABP74474.1| ribosomal protein L13 [Shewanella putrefaciens CN-32] (142 aa)
Score = 297, Expect = 8.4e-26, Identities = 54/125 (43%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+V+DA    LG++A E A  LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y+HSG+ GG+K+ S   +     + +I  A+KGMLPK  L R + +KL +Y  A H  AAQ+P
  S:    13 RDWFVVDADGKTLGRIATEIATRLRGKHKPEYTPHVDTGDYIIVINAEKVTVTGNKAKGKTYYSHSGFPGGIKQISFEKLQAHKPEMIIEKAVKGMLPKGPLGRAMFRKLKVYAGAEHNHAAQQP 137
>gi|78484806|ref|YP_390731.1| 50S ribosomal protein L13 [Thiomicrospira crunogena XCL-2] >gi|118573462|sp|Q31IG6|RL13_THICR 50S ribosomal protein L13 >gi|78363092|gb|ABB41057.1| LSU ribosomal protein L13P [Thiomicrospira crunogena XCL-2] (142 aa)
Score = 297, Expect = 8.5e-26, Identities = 57/141 (40%), Positives = 91/141 (64%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TFV   A +  + WY++DA    LG++A E A  LRGK+K ++TP+VDCGDY+++IN++KI ++ +K   + ++  +GY+G LK  +   ++     + +  AIKGMLP+  L R ++KKL +Y  A H  AAQ+P E+ L
  S:     3 TFVAKPAEV-KRDWYIVDAEGKTLGRMAAEIAARLRGKHKPEYTPHVDCGDYIVVINAEKIAVTGNKRTDKMYHHVTGYVGNLKSTNFETLVGSKPTRPVEFAIKGMLPRGPLGRAMLKKLKVYAGAEHPHAAQQPKELDL 142
>gi|90580207|ref|ZP_01236014.1| 50S ribosomal protein L13 [Vibrio angustum S14] >gi|90438509|gb|EAS63693.1| 50S ribosomal protein L13 [Vibrio angustum S14] (142 aa)
Score = 297, Expect = 9.1e-26, Identities = 59/136 (43%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG+LA E A+ LRGK+K ++TP+VD GDY+++IN++K+ ++ +K   + ++ H+GYIGGLK  S   +I+K  + +I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEKVAVTGNKRTDKMYHHHTGYIGGLKSISFDKLIDKKPEMVIETAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|114330775|ref|YP_746997.1| 50S ribosomal protein L13 [Nitrosomonas eutropha C91] >gi|122314284|sp|Q0AI00|RL13_NITEC 50S ribosomal protein L13 >gi|114307789|gb|ABI59032.1| LSU ribosomal protein L13P [Nitrosomonas eutropha C91] (144 aa)
Score = 296, Expect = 1.0e-25, Identities = 57/130 (43%), Positives = 90/130 (69%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +W+V+DA++ +LG+LA   A+ LRGK+K  +TP+VD GDY+++IN DK+ ++ +KA+ + +Y HSGY GGL E + + M  ++  + +  A+KGMLPK  L   +IKKL IY    H  AAQ+P  +++N
  S:    14 EWFVVDATDKVLGRLAAAIAHRLRGKHKPIYTPHVDTGDYIVVINVDKLRVTGNKAEDKIYYRHSGYPGGLYETTFKKMHARFPARPLEKAVKGMLPKGPLGYAMIKKLKIYAGDIHPHAAQQPQSLEIN 143
>gi|23501678|ref|NP_697805.1| 50S ribosomal protein L13 [Brucella suis 1330] >gi|148558921|ref|YP_001258772.1| 50S ribosomal protein L13 [Brucella ovis ATCC 25840] >gi|163843064|ref|YP_001627468.1| 50S ribosomal protein L13 [Brucella suis ATCC 23445] >gi|166230966|sp|A5VPX5|RL13_BRUO2 50S ribosomal protein L13 >gi|189040994|sp|B0CLB8|RL13_BRUSI 50S ribosomal protein L13 >gi|81752817|sp|Q8G1C8|RL13_BRUSU 50S ribosomal protein L13 >gi|23347599|gb|AAN29720.1| ribosomal protein L13 [Brucella suis 1330] >gi|148370178|gb|ABQ60157.1| ribosomal protein L13 [Brucella ovis ATCC 25840] >gi|163673787|gb|ABY37898.1| ribosomal protein L13 [Brucella suis ATCC 23445] (154 aa)
Score = 296, Expect = 1.1e-25, Identities = 60/136 (44%), Positives = 94/136 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF +  A +  KKW +IDA  L++G+LA   AN LRGK+K  FTP+VD GD +IIIN+DK+VL+  K   +K+Y H+G+ GG+KE++ R ++E ++ ++++  AI+ M+P+  L R  +K L +Y   NH+  AQ+P
  S:     3 TFSQKPAEVV-KKWVLIDAEGLVVGRLASLVANRLRGKHKATFTPHVDDGDNVIIINADKVVLTGKKYTDKKYYWHTGHPGGIKERTARQILEGRFPERVLEKAIERMIPRGPLGRRQMKNLRVYAGPNHQHEAQQP 138
>gi|39935834|ref|NP_948110.1| 50S ribosomal protein L13 [Rhodopseudomonas palustris CGA009] >gi|167365196|ref|ZP_02299340.1| ribosomal protein L13 [Rhodopseudomonas palustris TIE-1] >gi|192291482|ref|YP_001992087.1| ribosomal protein L13 [Rhodopseudomonas palustris TIE-1] >gi|81698179|sp|Q6N651|RL13_RHOPA 50S ribosomal protein L13 (RRP-L13) >gi|39649687|emb|CAE28209.1| ribosomal protein L13 [Rhodopseudomonas palustris CGA009] >gi|192285231|gb|ACF01612.1| ribosomal protein L13 [Rhodopseudomonas palustris TIE-1] (154 aa)
Score = 296, Expect = 1.1e-25, Identities = 55/134 (41%), Positives = 91/134 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   KKW +IDA+ L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+ K+VL+  K D + +Y H+G+IGG+KE+S + ++E ++ ++++  AI+ M+P+  L R  +  L +Y  A H   AQ+P ++ +
  S:     9 AEVTKKWVIIDATGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNVIIINASKVVLTGRKRDNKVYYHHTGFIGGIKERSAKAILEGRFPERVVEKAIERMIPRGPLGRVQMGNLRVYPGAEHPHEAQQPEKLDI 143
>gi|58336661|ref|YP_193246.1| 50S ribosomal protein L13 [Lactobacillus acidophilus NCFM] >gi|75507652|sp|Q5FM59|RL13_LACAC 50S ribosomal protein L13 >gi|58253978|gb|AAV42215.1| 50S ribosomal protein L13 [Lactobacillus acidophilus NCFM] (147 aa)
Score = 296, Expect = 1.2e-25, Identities = 59/131 (45%), Positives = 87/131 (66%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +KWY+IDA+++ LG+L+   A ILRGKNK  +TPNVDCGD +I++N+ KI L+  KA  + +Y HS + GGLK  S   ++     K++  ++KGMLPKNTL      K+ +Y   +HK  AQKP ++ +N
  S:    14 RKWYIIDATDVSLGRLSAAVATILRGKNKPQYTPNVDCGDNVIVVNASKIKLTGKKASDKFYYHHSSWRGGLKAVSYGELLANNPVKMVEISVKGMLPKNTLGHQEFLKMHVYAGEDHKHEAQKPEKLDIN 144
>gi|89256508|ref|YP_513870.1| 50S ribosomal protein L13 [Francisella tularensis subsp. holarctica] >gi|115314940|ref|YP_763663.1| 50S ribosomal protein L13 [Francisella tularensis subsp. holarctica OSU18] >gi|118497873|ref|YP_898923.1| 50S ribosomal protein L13 [Francisella tularensis subsp. novicida U112] >gi|134301628|ref|YP_001121596.1| 50S ribosomal protein L13 [Francisella tularensis subsp. tularensis WY96-3418] >gi|161484593|ref|YP_170229.2| 50S ribosomal protein L13 [Francisella tularensis subsp. tularensis SCHU S4] >gi|162139941|ref|YP_667361.2| 50S ribosomal protein L13 [Francisella tularensis subsp. tularensis FSC198] >gi|167010474|ref|ZP_02275405.1| 50S ribosomal protein L13 [Francisella tularensis subsp. holarctica FSC200] >gi|187931764|ref|YP_001891749.1| 50S ribosomal protein L13 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194323846|ref|ZP_03057622.1| ribosomal protein L13 [Francisella tularensis subsp. novicida FTE] >gi|122325046|sp|Q0BLK8|RL13_FRATO 50S ribosomal protein L13 >gi|122500625|sp|Q2A332|RL13_FRATH 50S ribosomal protein L13 >gi|166230985|sp|A0Q7F4|RL13_FRATN 50S ribosomal protein L13 >gi|166230986|sp|A4IX24|RL13_FRATW 50S ribosomal protein L13 >gi|89144339|emb|CAJ79626.1| 50S ribosomal subunit protein L13 [Francisella tularensis subsp. holarctica LVS] >gi|115129839|gb|ABI83026.1| ribosomal protein L13 [Francisella tularensis subsp. holarctica OSU18] >gi|118423779|gb|ABK90169.1| 50S ribosomal protein L13 [Francisella tularensis subsp. novicida U112] >gi|134049405|gb|ABO46476.1| ribosomal protein L13 [Francisella tularensis subsp. tularensis WY96-3418] >gi|134253650|gb|EBA52744.1| 50S ribosomal protein L13 [Francisella tularensis subsp. holarctica 257] >gi|187712673|gb|ACD30970.1| 50S ribosomal protein L13 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194322210|gb|EDX19692.1| ribosomal protein L13 [Francisella tularensis subsp. novicida FTE] (142 aa)
Score = 296, Expect = 1.2e-25, Identities = 53/125 (42%), Positives = 86/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           ++W +IDA++  LG+LA E A ILRGKNK ++TP++D GDY++I+N++K+ ++ +K   + +Y H+GYIGG+K  S   +I  + ++ I  A++GMLP+  L R + KKL +Y    H   AQ+P
  S:    13 REWLLIDATDKTLGRLATEVAMILRGKNKPEYTPHMDTGDYVVIVNAEKVAVTGNKRKAKTYYHHTGYIGGIKSVSFEKLIATHPERAIEKAVRGMLPRTPLGRTMFKKLKVYAGEAHPHTAQQP 137
>gi|24375428|ref|NP_719471.1| 50S ribosomal protein L13 [Shewanella oneidensis MR-1] >gi|113971601|ref|YP_735394.1| 50S ribosomal protein L13 [Shewanella sp. MR-4] >gi|114046187|ref|YP_736737.1| 50S ribosomal protein L13 [Shewanella sp. MR-7] >gi|117919144|ref|YP_868336.1| 50S ribosomal protein L13 [Shewanella sp. ANA-3] >gi|166199620|sp|A0KT11|RL13_SHESA 50S ribosomal protein L13 >gi|81744665|sp|Q8EAG2|RL13_SHEON 50S ribosomal protein L13 >gi|118573447|sp|Q0HF30|RL13_SHESM 50S ribosomal protein L13 >gi|118573448|sp|Q0HYX5|RL13_SHESR 50S ribosomal protein L13 >gi|24350269|gb|AAN56915.1|AE015825_14 ribosomal protein L13 [Shewanella oneidensis MR-1] >gi|113886285|gb|ABI40337.1| ribosomal protein L13 [Shewanella sp. MR-4] >gi|113887629|gb|ABI41680.1| ribosomal protein L13 [Shewanella sp. MR-7] >gi|117611476|gb|ABK46930.1| ribosomal protein L13 [Shewanella sp. ANA-3] (142 aa)
Score = 295, Expect = 1.4e-25, Identities = 54/125 (43%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+V+DA    LG++A E A  LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y+HSG+ GG+K+ S   +     + +I  A+KGMLPK  L R + +KL +Y  A H  AAQ+P
  S:    13 RDWFVVDADGKTLGRIATEIALRLRGKHKPEYTPHVDTGDYIIVINAEKVTVTGNKAQGKTYYSHSGFPGGIKQISFEKLQAHKPEMIIEKAVKGMLPKGPLGRAMFRKLKVYAGAEHNHAAQQP 137
>gi|47459064|ref|YP_015926.1| 50S ribosomal protein L13 [Mycoplasma mobile 163K] >gi|81697067|sp|Q6KI61|RL13_MYCMO 50S ribosomal protein L13 >gi|47458393|gb|AAT27715.1| 50S ribosomal protein l13 [Mycoplasma mobile 163K] (144 aa)
Score = 295, Expect = 1.4e-25, Identities = 64/144 (44%), Positives = 94/144 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP--MEIK 144
           M++TT ++++    +KKW+V+DA   +LG+LA   A+ LRGKNK  FTPNVD GD +I+IN+DK+VL++ K D + +Y+ SGY GGLK  + R +  K    L+  A+KGM+P   L R     L++Y    H   AQKP  +E+K
  S:     1 MRQTTIIRHKET--DKKWFVVDAEGQVLGRLASVVASYLRGKNKPTFTPNVDMGDNIIVINADKVVLTAKKEDDKIYYSSSGYNGGLKAINARDLRAKKPFALVEKAVKGMIPHTKLGRKQFGNLYVYAGREHNHEAQKPEVLEVK 144
>gi|75906941|ref|YP_321237.1| 50S ribosomal protein L13 [Anabaena variabilis ATCC 29413] >gi|118573379|sp|Q3MF94|RL13_ANAVT 50S ribosomal protein L13 >gi|75700666|gb|ABA20342.1| LSU ribosomal protein L13P [Anabaena variabilis ATCC 29413] (151 aa)
Score = 295, Expect = 1.5e-25, Identities = 57/146 (39%), Positives = 94/146 (64%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT     E+    + WYV+DA++  LG+LA E A ILRGKNK  +TP++D GD++I++N++K+ ++  K  ++ +  HSG  GG+K ++   + ++  ++++  A+KGMLPKN+L + L  KL +Y    H   AQKP E+ +N
  S:     1 MSKTYLPPQESL--ERDWYVVDATDKRLGRLASEIAMILRGKNKAHYTPHLDTGDFVIVVNAEKVAVTGKKRTQKLYRRHSGRPGGMKTETFAKLQQRLPERIVEHAVKGMLPKNSLGKQLFTKLKVYAGPTHPHDAQKPKELNIN 144
>gi|54020651|ref|YP_116180.1| 50S ribosomal protein L13 [Mycoplasma hyopneumoniae 232] >gi|81680584|sp|Q5ZZN5|RL13_MYCH2 50S ribosomal protein L13 >gi|53987824|gb|AAV28025.1| 50s ribosomal protein L13 [Mycoplasma hyopneumoniae 232] (144 aa)
Score = 295, Expect = 1.6e-25, Identities = 63/145 (43%), Positives = 94/145 (64%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M++TTFVK++     +KW+VIDA + ILG+LA   A+ LRGK+   FTPNVD GD +IIIN++KI+L++ K D++ +Y HSGY GGL+ ++ R M  K    L+  AI GM+P   L     K L++Y  + H    Q P ++++
  S:     1 MRQTTFVKHQEV--KQKWFVIDAESKILGRLAAFVASRLRGKHYPHFTPNVDMGDKIIIINAEKILLTAKKEDQKLYYNHSGYPGGLRVRTAREMRAKKPIALLERAIYGMIPHTKLGDKQRKNLYVYSGSEHPHLGQNPEKLEV 143
>gi|15896349|ref|NP_349698.1| 50S ribosomal protein L13 [Clostridium acetobutylicum ATCC 824] >gi|81775431|sp|Q97EL2|RL13_CLOAB 50S ribosomal protein L13 >gi|15026163|gb|AAK81038.1|AE007806_11 Ribosomal protein L13 [Clostridium acetobutylicum ATCC 824] (144 aa)
Score = 295, Expect = 1.6e-25, Identities = 62/130 (47%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KWYVID +   LG+ A + A+ILRGKNK  +TPNVD GDY+I++N++K++L+  KAD++ +  H+ Y GGLKE S +  I K +D + Y A++ MLP   L R +IKKL +YK   H   AQKP  ++L
  S:    13 RKWYVIDVAGKPLGRAASQIASILRGKNKPIYTPNVDTGDYVIVLNAEKVLLTGKKADQKMFRHHTLYPGGLKEMSYKDAIAKKADFVFYEAVRRMLPSGVLGRKMIKKLKVYKGEEHNNEAQKPEVLEL 142
>gi|56459525|ref|YP_154806.1| 50S ribosomal protein L13 [Idiomarina loihiensis L2TR] >gi|81678467|sp|Q5R0K6|RL13_IDILO 50S ribosomal protein L13 >gi|56178535|gb|AAV81257.1| Ribosomal protein L13 [Idiomarina loihiensis L2TR] (142 aa)
Score = 295, Expect = 1.7e-25, Identities = 56/141 (39%), Positives = 91/141 (64%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TFV     +  + WYV+DA    LG+LA E A  LRGK+K ++TP+VD GDY+++IN++K+ ++ +KA  + +Y+H+G+ GG+K  S   +I K  + +I  A+KGMLP+  L R + +KL +Y    H   AQ+P ++ +
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLATEIARRLRGKHKPEYTPHVDTGDYIVVINAEKVAVTGNKAQGKMYYSHTGFPGGIKSISFEKLIAKKPEMVIQKAVKGMLPRGPLGRAMFRKLKVYAGTEHNHIAQQPKQLDI 142
>gi|19749086|gb|AAL98481.1| 50S ribosomal protein L13 [Streptococcus pyogenes MGAS8232] (142 aa)
Score = 295, Expect = 1.7e-25, Identities = 58/125 (46%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYV+DA+++ LG+L+   A++LRGKNK  FTP+ D GD++I+IN++KI L+  KA  + +YTHS Y GGLK  +   +  K + +LI  ++KGMLP NTL R    KL ++    H  AAQ+P
  S:     9 RKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKIKLTGKKATDKVYYTHSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFVGGEHTHAAQQP 133
>gi|93006571|ref|YP_581008.1| 50S ribosomal protein L13 [Psychrobacter cryohalolentis K5] >gi|118573433|sp|Q1Q9X9|RL13_PSYCK 50S ribosomal protein L13 >gi|92394249|gb|ABE75524.1| LSU ribosomal protein L13P [Psychrobacter cryohalolentis K5] (142 aa)
Score = 294, Expect = 1.8e-25, Identities = 56/128 (43%), Positives = 84/128 (65%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           WYV+DA    LG+LA + A  LRGK+K  FTP+VD GD++++IN+DKI ++  KA  +K+Y HSGY GG+KE +   ++    + +++ A+KGMLPK  L   +IKKL +Y    H   AQ+P  + +
  S:    15 WYVVDADGKTLGRLATQIATRLRGKHKPSFTPHVDTGDFIVVINADKITVTGKKAQDKKYYRHSGYPGGIKETNFSKLLAHKPEDVLHKAVKGMLPKGPLGYAMIKKLKLYAGTEHPHEAQQPKALDI 142
>gi|58617543|ref|YP_196742.1| 50S ribosomal protein L13 [Ehrlichia ruminantium str. Gardel] >gi|58417155|emb|CAI28268.1| 50S ribosomal protein L13 [Ehrlichia ruminantium str. Gardel] (156 aa)
Score = 294, Expect = 1.8e-25, Identities = 54/137 (39%), Positives = 92/137 (67%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKE-KSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +A+  NK+W VIDAS  ++G+LA   A +LRGKNK ++TP++DCGD +IIIN++K+  + +K  R+ +Y H+GY GG+K      L + K+ +++I  A++ ML    ++R  +K L++Y    HK  AQ+P+++  +
  S:     9 KASQINKRWVVIDASGAVVGRLAACVATVLRGKNKPEYTPHMDCGDNVIIINAEKVQFTGNKLKRKVYYRHTGYPGGIKSCTPADLFLNKHPERIIKMAVRRMLSTGPMARCRLKNLYVYSGPEHKHNAQQPVQLDFS 146
>gi|86739327|ref|YP_479727.1| 50S ribosomal protein L13 [Frankia sp. CcI3] >gi|118573402|sp|Q2JFE4|RL13_FRASC 50S ribosomal protein L13 >gi|86566189|gb|ABD09998.1| LSU ribosomal protein L13P [Frankia sp. CcI3] (147 aa)
Score = 294, Expect = 1.9e-25, Identities = 52/128 (40%), Positives = 86/128 (67%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           W+VIDA++++LG+LA +AA +LRGK+K  F P++D GD++++IN+ K+ LS +K ++ +++ HSG+ GGL+  S   +++     ++  AIKGMLPKN L R    KL +Y    H   AQ+P   ++
  S:    15 WHVIDATDVVLGRLATQAATLLRGKHKPYFAPHIDTGDFVVVINAGKVALSGNKREQAQYHRHSGFPGGLRSTSYGELLDTRPQIIVEKAIKGMLPKNKLGRAQGTKLKVYAGPTHPHQAQQPTPFEI 142
>gi|57239508|ref|YP_180644.1| 50S ribosomal protein L13 [Ehrlichia ruminantium str. Welgevonden] >gi|58579490|ref|YP_197702.1| 50S ribosomal protein L13 [Ehrlichia ruminantium str. Welgevonden] >gi|57161587|emb|CAH58515.1| 50S ribosomal protein L13 [Ehrlichia ruminantium str. Welgevonden] >gi|58418116|emb|CAI27320.1| 50S ribosomal protein L13 [Ehrlichia ruminantium str. Welgevonden] (156 aa)
Score = 294, Expect = 2.0e-25, Identities = 54/137 (39%), Positives = 92/137 (67%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKE-KSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +A+  NK+W VIDAS  ++G+LA   A +LRGKNK ++TP++DCGD +IIIN++K+  + +K  R+ +Y H+GY GG+K      L + K+ +++I  A++ ML    ++R  +K L++Y    HK  AQ+P+++  +
  S:     9 KASQINKRWVVIDASGAVVGRLAAFVATVLRGKNKPEYTPHMDCGDNVIIINAEKVQFTGNKLKRKVYYRHTGYPGGIKSCTPADLFLNKHPERIIKMAVRRMLSTGPMARCRLKNLYVYSGPEHKHNAQQPVQLDFS 146
>gi|28572316|ref|NP_789096.1| 50S ribosomal protein L13 [Tropheryma whipplei TW08/27] >gi|28410447|emb|CAD66833.1| 50S ribosomal protein L13 [Tropheryma whipplei TW08/27] (141 aa)
Score = 294, Expect = 2.1e-25, Identities = 51/128 (39%), Positives = 91/128 (71%)
  Q:    13 LANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +++K+W ++DA +++LG+LA + A +LRGK++  + P++D GD +I++N+  I ++S+K  ++ +YTHSGY GGLK++    + +K  ++++  A+KGMLPKN L R + + L +Y   +H  AAQKP
  S:     1 MSSKQWVLVDAKDMVLGRLATQVAVLLRGKHRPTYEPHLDTGDCVIVVNAALIRVTSNKHAKKVFYTHSGYPGGLKKRGFSDVFQKSPERVLEKAVKGMLPKNKLGRSVFRNLRVYPGQDHPHAAQKP 128
>gi|15616995|ref|NP_240208.1| 50S ribosomal protein L13 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11134561|sp|P57471|RL13_BUCAI 50S ribosomal protein L13 >gi|25295168|pir||F84975 50S ribosomal protein L13 [imported] - Buchnera sp. (strain APS) >gi|7799379|emb|CAB90995.1| 50S ribosomal protein L13 [Buchnera aphidicola] >gi|10039060|dbj|BAB13094.1| 50S ribosomal protein L13 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (142 aa)
Score = 294, Expect = 2.1e-25, Identities = 54/125 (43%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WY +DA+N ILG+LA   +  LRGK+K ++TP++D GDY+I+IN+ KI+++ +K   + +Y H+GY+GG+K+     MI  + +++I  A+KGMLPK  L R + KKL ++ + NH+  AQ P
  S:    13 RHWYYVDATNKILGRLASALSFHLRGKHKTEYTPHLDTGDYIIVINASKILVTGNKRINKIYYHHTGYVGGIKQSRFEEMISSHPERVIEIAVKGMLPKGALGRSMFKKLKVFSNENHEHIAQCP 137
>gi|28493111|ref|NP_787272.1| 50S ribosomal protein L13 [Tropheryma whipplei str. Twist] >gi|28476151|gb|AAO44241.1| 50S ribosomal protein L13 [Tropheryma whipplei str. Twist] (142 aa)
Score = 294, Expect = 2.1e-25, Identities = 51/128 (39%), Positives = 91/128 (71%)
  Q:    13 LANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +++K+W ++DA +++LG+LA + A +LRGK++  + P++D GD +I++N+  I ++S+K  ++ +YTHSGY GGLK++    + +K  ++++  A+KGMLPKN L R + + L +Y   +H  AAQKP
  S:     2 MSSKQWVLVDAKDMVLGRLATQVAVLLRGKHRPTYEPHLDTGDCVIVVNAALIRVTSNKHAKKVFYTHSGYPGGLKKRGFSDVFQKSPERVLEKAVKGMLPKNKLGRSVFRNLRVYPGQDHPHAAQKP 129
>gi|59712829|ref|YP_205605.1| 50S ribosomal protein L13 [Vibrio fischeri ES114] >gi|163730337|ref|ZP_02137812.1| 50S ribosomal protein L13 [Vibrio fischeri MJ11] >gi|75506924|sp|Q5E2M9|RL13_VIBF1 50S ribosomal protein L13 >gi|59480930|gb|AAW86717.1| 50S ribosomal subunit protein L13 [Vibrio fischeri ES114] >gi|161396489|gb|EDQ20783.1| 50S ribosomal protein L13 [Vibrio fischeri MJ11] (142 aa)
Score = 294, Expect = 2.2e-25, Identities = 59/136 (43%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV   AA+  + WYV+DA    LG++A E A+ LRGK+K ++TP+VD GDY+I+IN++K+ ++  KA  + +Y HS + GGLK  S   +I++  + +I  A+KGMLP+  L R + +KL +Y  A H   AQ+P
  S:     3 TFVAKPAAV-KRDWYVVDAEGKTLGRIATEIASRLRGKHKAEYTPHVDTGDYIIVINAEKVRVTGKKASDKIYYRHSEFPGGLKSISFEKLIDRKPEMVIELAVKGMLPRGPLGRAMYRKLKVYAGAEHNHTAQQP 137
>gi|159184682|ref|NP_354259.2| 50S ribosomal protein L13 [Agrobacterium tumefaciens str. C58] >gi|81764059|sp|Q8UFZ7|RL13_AGRT5 50S ribosomal protein L13 >gi|159139975|gb|AAK87044.2| 50S ribosomal protein L13 [Agrobacterium tumefaciens str. C58] (154 aa)
Score = 294, Expect = 2.2e-25, Identities = 57/137 (41%), Positives = 93/137 (67%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TFV+  A +  KKW +IDA  L++G+LA   A  LRGK+K  FTP+VD GD +I+IN++K+  +  K   +K+Y H+G+ GG+KE++ R +IE ++ ++++  AI+ M+P+  L R  +K L +Y  +NH   AQ+P
  S:     2 STFVQKPAEV-EKKWIIIDAEGLVVGRLATIVATRLRGKHKATFTPHVDDGDNVIVINAEKVAFTGKKYSDKKYYWHTGHPGGIKERTARQIIEGRFPERVVEKAIERMIPRGPLGRRQMKNLRVYAGSNHPHEAQQP 138
>gi|126175847|ref|YP_001051996.1| ribosomal protein L13 [Shewanella baltica OS155] >gi|149115213|ref|ZP_01841959.1| ribosomal protein L13 [Shewanella baltica OS223] >gi|160873854|ref|YP_001553170.1| 50S ribosomal protein L13 [Shewanella baltica OS195] >gi|166199617|sp|A3D8R4|RL13_SHEB5 50S ribosomal protein L13 >gi|189041023|sp|A9L111|RL13_SHEB9 50S ribosomal protein L13 >gi|125999052|gb|ABN63127.1| LSU ribosomal protein L13P [Shewanella baltica OS155] >gi|146865026|gb|EDK50385.1| ribosomal protein L13 [Shewanella baltica OS223] >gi|160859376|gb|ABX47910.1| ribosomal protein L13 [Shewanella baltica OS195] (142 aa)
Score = 294, Expect = 2.2e-25, Identities = 52/125 (41%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+V+DA    LG++A E A  LRGK+K ++TP+VD GDY+I++N++K+ ++ +KA  + +Y+HSG+ GG+K+ S   +  +  + +I  A+KGMLPK  L R + +KL +Y  A H   AQ+P
  S:    13 RDWFVVDADGKTLGRIATEIATRLRGKHKPEYTPHVDTGDYIIVVNAEKVTVTGNKAKGKTYYSHSGFPGGIKQISFEKLQAQKPEMIIEKAVKGMLPKGPLGRAMFRKLKVYAGAEHNHTAQQP 137
>gi|90413018|ref|ZP_01221016.1| 50S ribosomal protein L13 [Photobacterium profundum 3TCK] >gi|90326033|gb|EAS42472.1| 50S ribosomal protein L13 [Photobacterium profundum 3TCK] (142 aa)
Score = 293, Expect = 2.3e-25, Identities = 58/136 (42%), Positives = 89/136 (65%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG+LA E A+ LRGK+K ++TP+VD GDY+++IN++K+ ++  K   + ++ H+G+IGGLK  S   +I+K  + +I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLATEIASRLRGKHKPEYTPHVDTGDYIVVINAEKVAVTGAKRTDKMYHHHTGFIGGLKSISFEKLIDKKPEMVIETAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|50843261|ref|YP_056488.1| 50S ribosomal protein L13 [Propionibacterium acnes KPA171202] >gi|81692397|sp|Q6A6T3|RL13_PROAC 50S ribosomal protein L13 >gi|50840863|gb|AAT83530.1| 50S ribosomal protein L13 [Propionibacterium acnes KPA171202] (147 aa)
Score = 293, Expect = 2.5e-25, Identities = 56/125 (44%), Positives = 81/125 (64%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYVIDA +++LG+LA  AAN+LRGK+K  + P++D GD+++++N+ KI L+  KA     Y HSG  GGL+  S   M+ K   + +  A+ GM+PKN LSR  +KKL +Y    H  AAQ P
  S:    13 RNWYVIDAEDIVLGRLATTAANLLRGKHKPQYAPHIDTGDFVVVVNASKIALTGKKATDSLRYDHSGRPGGLRVTSIGEMLAKNPRRAVERAVWGMMPKNKLSRQQLKKLKVYGGPEHPHAAQNP 137
>gi|125974287|ref|YP_001038197.1| 50S ribosomal protein L13 [Clostridium thermocellum ATCC 27405] >gi|125714512|gb|ABN53004.1| LSU ribosomal protein L13P [Clostridium thermocellum ATCC 27405] (145 aa)
Score = 293, Expect = 2.5e-25, Identities = 64/146 (43%), Positives = 97/146 (66%)
  Q:     1 MQKTTFVK-NEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT   K NE     +KWYV+DA    LG+LA E A ILRGK+K  +TP+VD GDY+I++N++K+VL+  K +++ +  HS + GGLKE   +  + +  +K +  A+K MLPKN+L R + +KL +Y+   HK  AQKP ++++N
  S:     1 MNKTYMAKPNEV---QRKWYVVDAEGKPLGRLASEVAKILRGKHKPQYTPHVDTGDYVIVLNAEKVVLTGKKLEQKLYRHHSLHPGGLKEIKYKHFLAEKPEKAVEIAVKRMLPKNSLGRAMFRKLKVYRGTEHKHEAQKPEKLEIN 144
>gi|71894100|ref|YP_278208.1| 50S ribosomal protein L13 [Mycoplasma synoviae 53] >gi|123644510|sp|Q4A6X4|RL13_MYCS5 50S ribosomal protein L13 >gi|71850888|gb|AAZ43497.1| 50S ribosomal protein L13 [Mycoplasma synoviae 53] (144 aa)
Score = 293, Expect = 2.5e-25, Identities = 62/145 (42%), Positives = 90/145 (62%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M++TT V  E +  NKKW+V+DA N +LG+LA   A++LRGK K  FTPN D GD +IIIN++K+ L+  K   + +Y+HSGY GGLK ++   + E+    L+  AI GM+P   L     K L++Y    HK  AQ P  +++
  S:     1 MRQTTIVNKENS--NKKWFVVDAENQVLGRLASLVASVLRGKTKPTFTPNADMGDNVIIINAEKVKLTGKKEKNKVYYSHSGYPGGLKARTAEKLREEKPTALLEKAISGMIPHTKLGNQQRKNLYVYAGPEHKHQAQNPERLEV 143
>gi|15964996|ref|NP_385349.1| 50S ribosomal protein L13 [Sinorhizobium meliloti 1021] >gi|81774619|sp|Q92QR4|RL13_RHIME 50S ribosomal protein L13 >gi|15074175|emb|CAC45822.1| Probable 50S ribosomal protein L13 [Sinorhizobium meliloti 1021] (154 aa)
Score = 293, Expect = 2.6e-25, Identities = 60/136 (44%), Positives = 94/136 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV+  A +  KKW +IDA  L++G+LA   AN LRGK+K  +TP+VD GD +I+IN++K VL+  K   +K+Y H+GY GG+KE++ R +IE ++ +++I  A++ M+P+  L R  +K L +Y  +NH   AQ+P
  S:     3 TFVQKPAEV-EKKWILIDAEGLVVGRLASLIANRLRGKHKATYTPHVDDGDNVIVINAEKAVLTGKKYTDKKYYWHTGYPGGIKERTARQIIEGRFPERVIEKAVERMVPRGPLGRRQMKNLRVYAGSNHPHEAQQP 138
>gi|150396085|ref|YP_001326552.1| 50S ribosomal protein L13 [Sinorhizobium medicae WSM419] >gi|166199622|sp|A6U7T7|RL13_SINMW 50S ribosomal protein L13 >gi|150027600|gb|ABR59717.1| ribosomal protein L13 [Sinorhizobium medicae WSM419] (154 aa)
Score = 293, Expect = 2.6e-25, Identities = 60/136 (44%), Positives = 94/136 (69%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV+  A +  KKW +IDA  L++G+LA   AN LRGK+K  +TP+VD GD +I+IN++K VL+  K   +K+Y H+GY GG+KE++ R +IE ++ +++I  A++ M+P+  L R  +K L +Y  +NH   AQ+P
  S:     3 TFVQKPAEV-EKKWILIDAEGLVVGRLASLIANRLRGKHKATYTPHVDDGDNVIVINAEKAVLTGKKYTDKKYYWHTGYPGGIKERTARQIIEGRFPERVIEKAVERMVPRGPLGRRQMKNLRVYAGSNHPHEAQQP 138
>gi|111220578|ref|YP_711372.1| 50S ribosomal protein L13 [Frankia alni ACN14a] >gi|111148110|emb|CAJ59778.1| 50S ribosomal subunit protein L13 [Frankia alni ACN14a] (134 aa)
Score = 292, Expect = 3.0e-25, Identities = 53/128 (41%), Positives = 85/128 (66%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           W+VIDA++++LG+LA +AA +LRGK+K  F P++D GD++I++N+ K+ LS +K  + +++ HSG+ GGL+  S   +++     +I  AIKGMLPKN L R    KL +Y    H   AQ+P   ++
  S:     2 WHVIDATDVVLGRLATQAATLLRGKHKPYFAPHIDTGDFVIVVNAGKVALSGNKRQQAQYHRHSGFPGGLRSTSYGELLDTRPQIIIEKAIKGMLPKNKLGRAQGTKLKVYAGPTHPHDAQQPTPFEI 129
>gi|56604825|emb|CAG45906.1| 50S ribosomal subunit protein L13 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321137|emb|CAL09289.1| 50S ribosomal subunit protein L13 [Francisella tularensis subsp. tularensis FSC 198] >gi|151569197|gb|EDN34851.1| 50S ribosomal protein L13 [Francisella tularensis subsp. tularensis FSC033] >gi|151570954|gb|EDN36608.1| 50S ribosomal protein L13 [Francisella tularensis subsp. novicida GA99-3549] >gi|151572402|gb|EDN38056.1| 50S ribosomal subunit protein L13 [Francisella tularensis subsp. novicida GA99-3548] (151 aa)
Score = 292, Expect = 3.0e-25, Identities = 53/125 (42%), Positives = 86/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           ++W +IDA++  LG+LA E A ILRGKNK ++TP++D GDY++I+N++K+ ++ +K   + +Y H+GYIGG+K  S   +I  + ++ I  A++GMLP+  L R + KKL +Y    H   AQ+P
  S:    22 REWLLIDATDKTLGRLATEVAMILRGKNKPEYTPHMDTGDYVVIVNAEKVAVTGNKRKAKTYYHHTGYIGGIKSVSFEKLIATHPERAIEKAVRGMLPRTPLGRTMFKKLKVYAGEAHPHTAQQP 146
>gi|54298698|ref|YP_125067.1| 50S ribosomal protein L13 [Legionella pneumophila str. Paris] >gi|148358556|ref|YP_001249763.1| 50S ribosomal protein L13 [Legionella pneumophila str. Corby] >gi|166230994|sp|A5IAL7|RL13_LEGPC 50S ribosomal protein L13 >gi|81679386|sp|Q5X1I1|RL13_LEGPA 50S ribosomal protein L13 >gi|53752483|emb|CAH13915.1| 50S ribosomal subunit protein L13 [Legionella pneumophila str. Paris] >gi|148280329|gb|ABQ54417.1| 50S ribosomal protein L13 [Legionella pneumophila str. Corby] (144 aa)
Score = 292, Expect = 3.0e-25, Identities = 54/130 (41%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DAS  +LG+LA E A  LRGK+K ++TP+VD GDY+I+ N++K+V++  K   + ++ H+G+ GG+K  S   + +K   K+I  A+KGMLPKN L R + +KL +Y  + H   AQ+P ++++
  S:    13 RDWFVVDASEKVLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVTNAEKVVVTGRKFKNKMYHHHTGFPGGIKSASFEKLQDKNPTKIIELAVKGMLPKNPLGREMYRKLKVYAGSEHPHTAQQPKQLEI 142
>gi|83593487|ref|YP_427239.1| 50S ribosomal protein L13 [Rhodospirillum rubrum ATCC 11170] >gi|123526342|sp|Q2RSE3|RL13_RHORT 50S ribosomal protein L13 >gi|83576401|gb|ABC22952.1| LSU ribosomal protein L13P [Rhodospirillum rubrum ATCC 11170] (154 aa)
Score = 292, Expect = 3.0e-25, Identities = 53/127 (41%), Positives = 92/127 (72%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM 141
           ++KWYVIDA  ++LG+LAV  A++LRGKNK  +TP++D GD++++IN++K+ L+ +KA  E+++ H+G+ GG+K +S G++    + ++LI  A++ M+P+  L+R   KKL +Y    H   AQ+P+
  S:    12 DRKWYVIDAEGVVLGRLAVIIADLLRGKNKTIYTPHIDTGDHVVVINAEKVHLTGNKAANERFFWHTGHPGGIKSRSLGQIRDGAHPERLIEKAVERMMPRGPLARAQFKKLRVYGGEAHPHDAQQPV 139
>gi|91774411|ref|YP_544167.1| 50S ribosomal protein L13 [Methylobacillus flagellatus KT] >gi|118573417|sp|Q1GXB2|RL13_METFK 50S ribosomal protein L13 >gi|91708398|gb|ABE48326.1| LSU ribosomal protein L13P [Methylobacillus flagellatus KT] (146 aa)
Score = 292, Expect = 3.1e-25, Identities = 54/125 (43%), Positives = 86/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+V+DA++L+LG+LA E A+ LRGK+K  +TP+VD GDY+++IN+DKI ++ +KA  +K++ HSGY GG+   +   M E++  + +  A+KGMLPK  L   + +KL +Y    H   AQ+P
  S:    13 RDWFVVDATDLVLGRLASEIAHRLRGKHKTIYTPHVDTGDYIVVINADKIKVTGNKALDKKYHRHSGYPGGISTTTFGKMQERFPGRALEKAVKGMLPKGPLGYAMFRKLKVYAGDKHDHVAQQP 137
>gi|52630024|gb|AAU28765.1| 50S ribosomal protein L13 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (152 aa)
Score = 292, Expect = 3.2e-25, Identities = 53/130 (40%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DAS  +LG+LA E A  LRGK+K ++TP+VD GDY+I+ N++K++++  K   + ++ H+G+ GG+K  S   + +K   K+I  A+KGMLPKN L R + +KL +Y  + H   AQ+P ++++
  S:    21 RDWFVVDASEKVLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVTNAEKVIVTGRKFKNKMYHHHTGFPGGIKSASFEKLQDKNPTKIIELAVKGMLPKNPLGREMYRKLKVYAGSEHPHTAQQPKQLEI 150
>gi|71906289|ref|YP_283876.1| 50S ribosomal protein L13 [Dechloromonas aromatica RCB] >gi|118573397|sp|Q47IC5|RL13_DECAR 50S ribosomal protein L13 >gi|71845910|gb|AAZ45406.1| LSU ribosomal protein L13P [Dechloromonas aromatica RCB] (142 aa)
Score = 292, Expect = 3.6e-25, Identities = 51/130 (39%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           ++W+V+DA++ +LG+LA E A  LRGK+K  +TP++D GD++++ N DKI ++ +KA+ +K++ HSGY GG+ E + + M +++  + +  A+KGMLPK  L   ++KKL  Y    H   AQ+P  +++
  S:    13 REWFVVDATDKVLGRLATEIARRLRGKHKAIYTPHIDTGDFVVVTNVDKITVTGNKAEDKKYFRHSGYPGGIYETNFKKMQQRFPGRALETAVKGMLPKGPLGYAMLKKLKCYAGEQHPHTAQQPKALEI 142
>gi|56961965|ref|YP_173687.1| 50S ribosomal protein L13 [Bacillus clausii KSM-K16] >gi|81679080|sp|Q5WLM9|RL13_BACSK 50S ribosomal protein L13 >gi|56908199|dbj|BAD62726.1| 50S ribosomal protein L13 [Bacillus clausii KSM-K16] (145 aa)
Score = 292, Expect = 3.6e-25, Identities = 59/130 (45%), Positives = 85/130 (65%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KWYV+DA    LG+LA E A+ILRGK+K  FTP+VD GD++I++N+ KI L+ +K   + +Y H+ + GGLK+   + M     ++++  AIKGMLPKNTL R    KL +Y  + H   AQKP   +L
  S:    14 RKWYVVDAEGQTLGRLASEVASILRGKHKPTFTPHVDTGDHVIVLNASKIQLTGNKLQDKIYYRHTNHPGGLKQTKAQDMRANKPERMLELAIKGMLPKNTLGRKQGMKLHVYAGSEHNHHAQKPEAYEL 143
>gi|86749788|ref|YP_486284.1| 50S ribosomal protein L13 [Rhodopseudomonas palustris HaA2] >gi|123408051|sp|Q2IWN7|RL13_RHOP2 50S ribosomal protein L13 >gi|86572816|gb|ABD07373.1| LSU ribosomal protein L13P [Rhodopseudomonas palustris HaA2] (154 aa)
Score = 292, Expect = 3.6e-25, Identities = 54/129 (41%), Positives = 88/129 (68%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW VIDA+ L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+ K+VL+  K D + +Y H+G+IGG+KE++ + ++E ++ ++++  A++ M+P+  L R  +  L +Y  A H   AQ+P
  S:     9 AEVTKKWVVIDATGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNIIIINAAKVVLTGRKRDNKVYYHHTGFIGGIKERTAKSILEGRFPERVVEKAVERMIPRGPLGRVQMGNLRVYPGAEHPHEAQQP 138
>gi|17545209|ref|NP_518611.1| 50S ribosomal protein L13 [Ralstonia solanacearum GMI1000] >gi|83749313|ref|ZP_00946310.1| LSU ribosomal protein L13P [Ralstonia solanacearum UW551] >gi|81768683|sp|Q8Y246|RL13_RALSO 50S ribosomal protein L13 >gi|17427500|emb|CAD14018.1| probable 50s ribosomal protein l13 [Ralstonia solanacearum] >gi|83723991|gb|EAP71172.1| LSU ribosomal protein L13P [Ralstonia solanacearum UW551] (142 aa)
Score = 291, Expect = 3.9e-25, Identities = 54/130 (41%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+VIDA++ +LG++A E A  LRGK+K +FTP+VD GD++I+IN+ K+ ++  K   +K+Y HSGY GG+ E +   M +++  + +  A+KGMLPK  L   +IKKL +Y + +H   AQ+P  +++
  S:    13 RNWFVIDATDKVLGRVASEVALRLRGKHKPEFTPHVDTGDFIIVINAAKLRVTGAKTTDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKAVKGMLPKGPLGYAMIKKLKVYAEGSHPHEAQQPQVLEI 142
>gi|15640592|ref|NP_230221.1| 50S ribosomal protein L13 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|147674448|ref|YP_001216068.1| 50S ribosomal protein L13 [Vibrio cholerae O395] >gi|153224140|ref|ZP_01954245.1| ribosomal protein L13 [Vibrio cholerae MAK 757] >gi|153824144|ref|ZP_01976811.1| ribosomal protein L13 [Vibrio cholerae B33] >gi|153830228|ref|ZP_01982895.1| ribosomal protein L13 [Vibrio cholerae 623-39] >gi|172047724|sp|A5F997|RL13_VIBC3 50S ribosomal protein L13 >gi|81788520|sp|Q9KUF1|RL13_VIBCH 50S ribosomal protein L13 >gi|9655000|gb|AAF93738.1| ribosomal protein L13 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|124117838|gb|EAY36581.1| ribosomal protein L13 [Vibrio cholerae MAK 757] >gi|126518338|gb|EAZ75561.1| ribosomal protein L13 [Vibrio cholerae B33] >gi|146316331|gb|ABQ20870.1| ribosomal protein L13 [Vibrio cholerae O395] >gi|148874288|gb|EDL72423.1| ribosomal protein L13 [Vibrio cholerae 623-39] (142 aa)
Score = 291, Expect = 4.2e-25, Identities = 58/136 (42%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG+LA E A+ LRGK+K ++TP+VD GDY+I++N++K+ ++ +KA  + ++ HS + GGLK  S   +IE+  + ++  A+KGMLPK  L R + +KL +Y  A H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLASEIASRLRGKHKAEYTPHVDTGDYIIVVNAEKVTVTGNKAKNKMYHRHSEFPGGLKSFSFEKLIERKPEMVLELAVKGMLPKGPLGRAMYRKLKVYAGAEHNHAAQQP 137
>gi|91800870|gb|ABE63245.1| LSU ribosomal protein L13P [Nitrobacter hamburgensis X14] (177 aa)
Score = 291, Expect = 4.2e-25, Identities = 54/129 (41%), Positives = 87/129 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW +IDAS L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+ K+V +  K + + +Y H+GYIGG+KE++ + ++E ++ +++I  A++ M+P+  L R  +  L +Y  A H   AQ+P
  S:    32 AEVTKKWVLIDASGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNVIIINAAKVVFTGRKREDKVYYNHTGYIGGIKERTAKSILEGRFPERVIEKAVERMIPRGPLGRVQLGNLRVYGGAEHPHEAQQP 161
>gi|54295548|ref|YP_127963.1| 50S ribosomal protein L13 [Legionella pneumophila str. Lens] >gi|161723241|ref|YP_096712.2| 50S ribosomal protein L13 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|81679132|sp|Q5WT90|RL13_LEGPL 50S ribosomal protein L13 >gi|118573411|sp|Q5ZS12|RL13_LEGPH 50S ribosomal protein L13 >gi|53755380|emb|CAH16876.1| 50S ribosomal subunit protein L13 [Legionella pneumophila str. Lens] (144 aa)
Score = 291, Expect = 4.3e-25, Identities = 53/130 (40%), Positives = 89/130 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DAS  +LG+LA E A  LRGK+K ++TP+VD GDY+I+ N++K++++  K   + ++ H+G+ GG+K  S   + +K   K+I  A+KGMLPKN L R + +KL +Y  + H   AQ+P ++++
  S:    13 RDWFVVDASEKVLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVTNAEKVIVTGRKFKNKMYHHHTGFPGGIKSASFEKLQDKNPTKIIELAVKGMLPKNPLGREMYRKLKVYAGSEHPHTAQQPKQLEI 142
>gi|73667435|ref|YP_303451.1| 50S ribosomal protein L13 [Ehrlichia canis str. Jake] >gi|72394576|gb|AAZ68853.1| LSU ribosomal protein L13P [Ehrlichia canis str. Jake] (156 aa)
Score = 291, Expect = 4.5e-25, Identities = 60/143 (41%), Positives = 95/143 (66%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKE-KSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           MQ  TF   +A+   K+W VIDAS +++G+LA   ANILRGK+K ++TP++DCGD +IIIN++K+  +  K   + +Y H+GY GGLK      L++ K+ +++I  AI+ ML    ++R  +K L+IY    HK  AQ+P+++
  S:     1 MQMETF-SLKASQIKKRWVVIDASGVVVGRLAAFVANILRGKDKPEYTPHMDCGDNVIIINAEKVQFTGSKLKGKVYYRHTGYPGGLKSCTPADLLLNKHPERIINMAIRRMLSTGPMARRRLKNLYIYSGPEHKHNAQQPVKL 143
>gi|71893999|ref|YP_279445.1| 50S ribosomal protein L13 [Mycoplasma hyopneumoniae J] >gi|72080978|ref|YP_288036.1| 50S ribosomal protein L13 [Mycoplasma hyopneumoniae 7448] >gi|123644622|sp|Q4A776|RL13_MYCH7 50S ribosomal protein L13 >gi|123645397|sp|Q4A937|RL13_MYCHJ 50S ribosomal protein L13 >gi|71852126|gb|AAZ44734.1| 50S ribosomal protein L13 [Mycoplasma hyopneumoniae J] >gi|71914102|gb|AAZ54013.1| 50S ribosomal protein L13 [Mycoplasma hyopneumoniae 7448] (144 aa)
Score = 291, Expect = 5.0e-25, Identities = 62/145 (42%), Positives = 94/145 (64%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M++TTFVK++     +KW+VIDA + ILG+LA   A+ LRGK+   FTPNVD GD +IIIN++KI+L++ K +++ +Y HSGY GGL+ ++ R M  K    L+  AI GM+P   L     K L++Y  + H    Q P ++++
  S:     1 MRQTTFVKHQEV--KQKWFVIDAESKILGRLAAFVASRLRGKHYPHFTPNVDMGDKIIIINAEKILLTAKKEEQKLYYNHSGYPGGLRVRTAREMRAKKPIALLERAIYGMIPHTKLGDKQRKNLYVYSGSEHPHLGQNPEKLEV 143
>gi|91977178|ref|YP_569837.1| 50S ribosomal protein L13 [Rhodopseudomonas palustris BisB5] >gi|118573439|sp|Q136Q3|RL13_RHOPS 50S ribosomal protein L13 >gi|91683634|gb|ABE39936.1| LSU ribosomal protein L13P [Rhodopseudomonas palustris BisB5] (154 aa)
Score = 291, Expect = 5.0e-25, Identities = 53/129 (41%), Positives = 88/129 (68%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW +IDA+ L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+ K+VL+  K D + +Y H+G+IGG+KE++ + ++E ++ ++++  A++ M+P+  L R  +  L +Y  A H   AQ+P
  S:     9 AEVTKKWVIIDATGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNIIIINAAKVVLTGRKRDNKVYYHHTGFIGGIKERTAKSILEGRFPERVVEKAVERMIPRGPLGRVQMGNLRVYGGAEHPHEAQQP 138
>gi|54310325|ref|YP_131345.1| 50S ribosomal protein L13 [Photobacterium profundum SS9] >gi|81697279|sp|Q6LMD4|RL13_PHOPR 50S ribosomal protein L13 >gi|46914766|emb|CAG21543.1| putative 50S ribosomal protein L13 [Photobacterium profundum SS9] (142 aa)
Score = 290, Expect = 5.3e-25, Identities = 57/136 (41%), Positives = 89/136 (65%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG+LA + A+ LRGK+K ++TP+VD GDY+++IN++K+ ++  K   + ++ H+G+IGGLK  S   +I+K  + +I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLATQIASRLRGKHKPEYTPHVDTGDYIVVINAEKVAVTGAKRTDKMYHHHTGFIGGLKSISFEKLIDKKPEMVIETAVKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|34558418|ref|NP_908233.1| 50S ribosomal protein L13 [Wolinella succinogenes DSM 1740] >gi|81707332|sp|Q7M7R0|RL13_WOLSU 50S ribosomal protein L13 >gi|34484137|emb|CAE11133.1| 50S RIBOSOMAL PROTEIN L13 [Wolinella succinogenes] (139 aa)
Score = 290, Expect = 5.6e-25, Identities = 52/123 (42%), Positives = 83/123 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           ++W V+DA     G+L  + A +LRGK++ D+TP+VDCGD+++I+N+ K+V S  K + ++++THSGY G  K ++ + ++EK  +KL   A +GMLPK  L R ++KKL +Y  A H   AQ
  S:    14 REWVVLDAEGKTFGRLMTQVATLLRGKHRPDYTPHVDCGDFVVIVNASKVVFSGLKLEAKEYFTHSGYFGSTKSQTLQELLEKNPEKLFRLAARGMLPKTKLGRAMLKKLKVYAGAEHPHTAQ 136
>gi|78043632|ref|YP_361083.1| 50S ribosomal protein L13 [Carboxydothermus hydrogenoformans Z-2901] >gi|118573390|sp|Q3A9V1|RL13_CARHZ 50S ribosomal protein L13 >gi|77995747|gb|ABB14646.1| ribosomal protein L13 [Carboxydothermus hydrogenoformans Z-2901] (143 aa)
Score = 290, Expect = 5.7e-25, Identities = 60/125 (48%), Positives = 84/125 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYVIDA+   LG++A EAA +LRGK+K +FTP+VD GD++IIIN++K VL+  K +++ +Y HS Y GGLK     ++++         A+KGMLP N L R L KKL +Y   +H   AQKP
  S:    14 RKWYVIDAAGKPLGRVASEAAKLLRGKHKPEFTPHVDTGDFVIIINAEKAVLTGKKLEKKMFYRHSRYPGGLKAIPYGILMKTNPVLAFEKAVKGMLPHNRLGRKLFKKLKVYAGESHPHQAQKP 138
>gi|90418052|ref|ZP_01225964.1| ribosomal protein L13 [Aurantimonas sp. SI85-9A1] >gi|90337724|gb|EAS51375.1| ribosomal protein L13 [Aurantimonas sp. SI85-9A1] (186 aa)
Score = 290, Expect = 6.4e-25, Identities = 58/125 (46%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW +IDA  L++G+LA   A  LRGK+K  FTP+VD GD +IIIN+DKIVL+  K + + +Y H+GY GG+KE+  R ++E ++ ++++  AI+ MLP+  L R  +K L +Y  A H   AQ P
  S:    45 KKWILIDAEGLVVGRLASIVALRLRGKHKPTFTPHVDDGDNIIIINADKIVLTGKKYENKTYYWHTGYAGGIKERKARHILEGRFPERVVEKAIERMLPRGPLGRRQLKNLRVYAGAEHPHEAQSP 170
>gi|71891841|ref|YP_277570.1| 50S ribosomal protein L13 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|123641197|sp|Q493Y6|RL13_BLOPB 50S ribosomal protein L13 >gi|71795947|gb|AAZ40698.1| 50S ribosomal subunitprotein L13 [Candidatus Blochmannia pennsylvanicus str. BPEN] (144 aa)
Score = 290, Expect = 6.5e-25, Identities = 55/131 (41%), Positives = 89/131 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           K WY+IDA + ILG+L+   +  L GK+K+++ P+VD GDY+I++N+ ++ +S  K D + +Y H+GYIGG+K+ + + MI +Y +K+I  A+KGMLPK  L R +  +L +Y    H  AAQ+P  I ++
  S:    13 KTWYIIDAKHKILGRLSTVISRYLIGKHKIEYAPHVDIGDYVIVLNAKEVSVSGHKRDDKIYYHHTGYIGGIKQLNFKRMINRYPEKVIEIAVKGMLPKGPLGRMMYCRLRVYSGNVHAHAAQEPQFIDID 143
>gi|119025327|ref|YP_909172.1| 50S ribosomal protein L13 [Bifidobacterium adolescentis ATCC 15703] >gi|154486733|ref|ZP_02028140.1| hypothetical protein BIFADO_00558 [Bifidobacterium adolescentis L2-32] >gi|166230963|sp|A1A057|RL13_BIFAA 50S ribosomal protein L13 >gi|118764911|dbj|BAF39090.1| 50S ribosomal protein L13 [Bifidobacterium adolescentis ATCC 15703] >gi|154084596|gb|EDN83641.1| hypothetical protein BIFADO_00558 [Bifidobacterium adolescentis L2-32] (149 aa)
Score = 289, Expect = 6.5e-25, Identities = 60/136 (44%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF    A L +  WYVIDA++++LG+LA +AA +LRGKNK  + P+ D G+++II+N+DKI L+ +K  +E  Y HSG  GGL+  S   +++   +++I  AIKGMLPKN L++  + +L I + A H  A  KP
  S:     3 TFTPKPADLTHD-WYVIDATDVVLGRLATQAATLLRGKNKPTYAPHADSGNHVIILNADKIALTGNKLGKE-LYMHSGRPGGLRRDSYAQLLKTNPERIIKSAIKGMLPKNRLAKVQLDRLHIVRGAEHPYAGMKP 136
>gi|91791870|ref|YP_561521.1| 50S ribosomal protein L13 [Shewanella denitrificans OS217] >gi|118573445|sp|Q12RX8|RL13_SHEDO 50S ribosomal protein L13 >gi|91713872|gb|ABE53798.1| ribosomal protein L13 [Shewanella denitrificans OS217] (142 aa)
Score = 289, Expect = 7.3e-25, Identities = 53/125 (42%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+V+DA    LG++A E A  LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y+HSG+ GG+K+ S   +  +  + +I  A+KGMLPK  L R + +KL +Y    H  AAQ+P
  S:    13 RDWFVVDAEGKTLGRIATEIAIRLRGKHKPEYTPHVDTGDYIIVINAEKVTVTGNKAAGKIYYSHSGFPGGIKQISFEKLQAQKPEMIIEKAVKGMLPKGPLGRAMFRKLKVYAGVEHNHAAQQP 137
>gi|86609048|ref|YP_477810.1| 50S ribosomal protein L13 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123502212|sp|Q2JL71|RL13_SYNJB 50S ribosomal protein L13 >gi|86557590|gb|ABD02547.1| ribosomal protein L13 [Synechococcus sp. JA-2-3B'a(2-13)] (151 aa)
Score = 289, Expect = 7.3e-25, Identities = 59/146 (40%), Positives = 91/146 (62%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT  + N   LA  +WY++DA+N  LG+LA   A +LRGK+K DFTP++D GDY+I+IN++K+V++  K  ++ +  HSG  GG+K ++   +  +  ++++  A+KGMLP   L R    KL +Y   NH   AQ+P    LN
  S:     1 MNKTP-LPNPETLA-PRWYLVDAANQRLGRLAAAVATLLRGKHKPDFTPHLDTGDYVIVINAEKVVVTGKKRTQKLYRRHSGRPGGMKVETFAQLQARLPERVVEKAVKGMLPHTRLGRRQFTKLKVYVGPNHPHEAQQPQVYPLN 144
>gi|109948012|ref|YP_665240.1| 50S ribosomal protein L13 [Helicobacter acinonychis str. Sheeba] >gi|123173231|sp|Q17VT5|RL13_HELAH 50S ribosomal protein L13 >gi|109715233|emb|CAK00241.1| 50S ribosomal protein L13 [Helicobacter acinonychis str. Sheeba] (141 aa)
Score = 289, Expect = 7.4e-25, Identities = 54/123 (43%), Positives = 86/123 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           + W V+DA + + G+L  E A +LRGK++  +TPNVDCGD++++IN++K+  S  K + ++++THSGY G  K K+ + M+EK  +KL + A++GMLPK  L + +IKKL +Y+D  H   AQ
  S:    12 RDWVVLDAKDKVFGRLITEIAVLLRGKHRPFYTPNVDCGDFVVVINANKVKFSGMKLEDKEYFTHSGYFGSTKSKTLQEMLEKTPEKLYHLAVRGMLPKTKLGKAMIKKLKVYRDDKHPHTAQ 134
>gi|11465758|ref|NP_053902.1| ribosomal protein L13 [Porphyra purpurea] >gi|1710410|sp|P51292|RK13_PORPU Chloroplast 50S ribosomal protein L13 >gi|1276758|gb|AAC08178.1| 50S ribosomal protein L13 [Porphyra purpurea] (142 aa)
Score = 289, Expect = 7.6e-25, Identities = 55/130 (42%), Positives = 85/130 (65%)
  Q:    13 LANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPME 142
           + ++ WYVIDA N  LG+++   +NILRGKNK  +TP +D GDY+I+INS ++ +S +K  ++ +  HSG  GGLK ++   +  +  ++++  ++KGMLPK  L R L  KL +Y   +H  AAQKP E
  S:    10 ITSQSWYVIDAKNQKLGRMSTHISNILRGKNKPSYTPYLDTGDYVIVINSSEVSVSGNKTTQKLYRRHSGQPGGLKVETFEQLQTRLPNRIVEKSVKGMLPKGPLGRKLFTKLKVYPGPSHPHAAQKPQE 139
>gi|110633517|ref|YP_673725.1| 50S ribosomal protein L13 [Mesorhizobium sp. BNC1] >gi|118573414|sp|Q11J65|RL13_MESSB 50S ribosomal protein L13 >gi|110284501|gb|ABG62560.1| LSU ribosomal protein L13P [Mesorhizobium sp. BNC1] (153 aa)
Score = 289, Expect = 7.9e-25, Identities = 57/141 (40%), Positives = 94/141 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TF +  A +  KKW +IDA  L++G+LA   AN LRGK+K  FTP+VD GD +IIIN+DK+V +  K   + +Y H+GY GG+KE++ R ++E ++ ++++  A++ M+P+  L R  +K L +Y  + H  +AQ P ++ +
  S:     3 TFSQKPAEVT-KKWVLIDAEGLVVGRLATIVANRLRGKHKPTFTPHVDDGDNVIIINADKVVFTGKKYQDKTYYWHTGYAGGIKERTARQILEGRFPERVVEKAVERMIPRGPLGRRQMKNLRVYAGSEHPHSAQNPEKVDI 143
>gi|42526364|ref|NP_971462.1| 50S ribosomal protein L13 [Treponema denticola ATCC 35405] >gi|81700207|sp|Q73PE7|RL13_TREDE 50S ribosomal protein L13 >gi|41816476|gb|AAS11343.1| ribosomal protein L13 [Treponema denticola ATCC 35405] (142 aa)
Score = 289, Expect = 8.0e-25, Identities = 59/143 (41%), Positives = 91/143 (63%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KT F K   A   + WY+IDA+   LG++A + A +LRGK+KV F P+ + GDY++IIN++K+ ++ +KA  + +YTHSGY+GGLK  +   +I K   + +  AIKGMLPK  L R L+  + +Y    H   AQ P+ +++
  S:     2 KTIFFKEHEA--PRSWYLIDAAGKPLGRVAAKTAAMLRGKHKVSFAPHQEIGDYVVIINAEKVAVTGNKAKDKMYYTHSGYVGGLKSINFNGLIAKKPAEPLMIAIKGMLPKGPLGRKLLTNVKVYAGPEHPHQAQNPIAVEV 142
>gi|103485739|ref|YP_615300.1| 50S ribosomal protein L13 [Sphingopyxis alaskensis RB2256] >gi|98975816|gb|ABF51967.1| LSU ribosomal protein L13P [Sphingopyxis alaskensis RB2256] (159 aa)
Score = 289, Expect = 8.0e-25, Identities = 56/140 (40%), Positives = 91/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + KTT   N AA   KKW +IDA  L++G++A   ANILRGK+K  FTP+VDCGD +I+IN++K+  +  K   +++Y H+GY GG+KE S   ++E ++ ++++  A++ M+P+  L R  ++ L I+  + H    Q P
  S:     4 LTKTTVSAN-AATVEKKWVLIDAEGLVVGRVASIIANILRGKHKPSFTPHVDCGDNVIVINAEKVAFTGKKMQDKRYYKHTGYAGGIKETSPAKILEGRFPERVLEKAVERMIPRGPLGRQQMRNLRIFAGSEHPHEGQNP 143
>gi|16077217|ref|NP_388030.1| 50S ribosomal protein L13 [Bacillus subtilis subsp. subtilis str. 168] >gi|2500252|sp|P70974|RL13_BACSU 50S ribosomal protein L13 >gi|1644207|dbj|BAA10988.1| ribosomal protein L13 [Bacillus subtilis] >gi|2632416|emb|CAB11925.1| ribosomal protein L13 [Bacillus subtilis subsp. subtilis str. 168] (145 aa)
Score = 289, Expect = 8.3e-25, Identities = 61/138 (44%), Positives = 91/138 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TT + N A+   +K  V+DA+   LG+L+ E A ILRGK+K  +TP+VD GD++IIIN++KI L+  K   + +Y H+ + GGLK ++   M   Y +K++  AIKGMLPK +L R + KKL +Y+ + H   AQKP
  S:     2 RTTPMAN-ASTIERKCLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLELAIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKP 138
>gi|94676989|ref|YP_588510.1| 50S ribosomal protein L13 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|118573380|sp|Q1LU54|RL13_BAUCH 50S ribosomal protein L13 >gi|94220139|gb|ABF14298.1| ribosomal protein L13 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (142 aa)
Score = 288, Expect = 8.8e-25, Identities = 54/130 (41%), Positives = 93/130 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + WY++DASN ILG+ A   A  LRGK+KV +TP++D GDY+I++N+ KI ++ +K   +K+Y ++G++GG+KE++ + ++ K  + +I  A+KGMLPK  L + ++KKL +Y    H+ AAQ+P  +++
  S:    13 RNWYIMDASNKILGRFASNIALRLRGKHKVIYTPHIDTGDYIIVLNAKKITVTGNKLSDKKYYHYTGFVGGIKEQNLKDLMTKRPEYVIERAVKGMLPKGALGKAMLKKLKVYAGTEHQHAAQQPQVLEI 142
>gi|15611148|ref|NP_222799.1| 50S ribosomal protein L13 [Helicobacter pylori J99] >gi|108562510|ref|YP_626826.1| 50S ribosomal protein L13 [Helicobacter pylori HPAG1] >gi|122386831|sp|Q1CV70|RL13_HELPH 50S ribosomal protein L13 >gi|7674193|sp|Q9ZMY6|RL13_HELPJ 50S ribosomal protein L13 >gi|4154587|gb|AAD05661.1| 50S RIBOSOMAL PROTEIN L13 [Helicobacter pylori J99] >gi|107836283|gb|ABF84152.1| ribosomal protein L13 [Helicobacter pylori HPAG1] (141 aa)
Score = 288, Expect = 8.9e-25, Identities = 54/123 (43%), Positives = 86/123 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           + W V+DA + + G+L  E A +LRGK++  +TPNVDCGD++++IN++K+  S  K + ++++THSGY G  K K+ + M+EK  +KL + A++GMLPK  L + +IKKL +Y+D  H   AQ
  S:    12 RDWVVLDAKDKVFGRLITEIAVLLRGKHRPFYTPNVDCGDFVVVINANKVKFSGMKLEDKEYFTHSGYFGSTKSKTLQEMLEKTPEKLYHLAVRGMLPKTKLGKAMIKKLKVYRDDKHPHTAQ 134
>gi|85716236|ref|ZP_01047210.1| 50S ribosomal protein L13 [Nitrobacter sp. Nb-311A] >gi|85696908|gb|EAQ34792.1| 50S ribosomal protein L13 [Nitrobacter sp. Nb-311A] (154 aa)
Score = 288, Expect = 9.2e-25, Identities = 55/134 (41%), Positives = 89/134 (66%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   KKW +IDAS L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+ K+V +  K D + +Y H+GYIGG+K+++ + ++E ++ +++I  A++ M+P+  L R  +  L +Y  A H   AQ+P  I +
  S:     9 AEVTKKWVLIDASGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNVIIINAAKVVFTGRKRDDKVYYNHTGYIGGIKQRTAKSILEGRFPERVIEKAVERMIPRGPLGRVQLGNLRVYAGAEHPHEAQQPEVINV 143
>gi|86131448|ref|ZP_01050046.1| 50S ribosomal protein L13 [Cellulophaga sp. MED134] >gi|85817893|gb|EAQ39061.1| 50S ribosomal protein L13 [Dokdonia donghaensis MED134] (151 aa)
Score = 288, Expect = 9.3e-25, Identities = 59/140 (42%), Positives = 84/140 (60%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           V    A  NK+W +IDA    LG+++   A  LRGK K  FTP+VDCGD ++IIN+ K+ LS +K   + +  H+GY GG +  + R + +K   +++  A+KGMLPKN L   + + L +Y  A H Q AQKP  I LN
  S:     9 VSANKATVNKEWVLIDAEGQTLGRMSSIVAKFLRGKYKPSFTPHVDCGDNVVIINAAKVQLSGNKWTEKSYIRHTGYPGGQRSLTARELYDKDPTRVVEAAVKGMLPKNKLGSAIFRNLKVYAGAEHDQEAQKPRAINLN 148
>gi|33862088|ref|NP_893649.1| 50S ribosomal protein L13 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|81712580|sp|Q7UZW8|RL13_PROMP 50S ribosomal protein L13 >gi|33634306|emb|CAE19991.1| 50S ribosomal protein L13 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (143 aa)
Score = 288, Expect = 1.0e-24, Identities = 52/126 (41%), Positives = 87/126 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM 141
           + W+++DA +  LG+L+ E A +LRGKNK  FTP++D GD++I++N++K+ ++  KA ++ +  HSG  GG+K +    + E+  +++I  A+KGMLP N+L R   KKL +YK ++H  AAQ P+
  S:    14 RNWFLVDAKDKTLGRLSTEIAAVLRGKNKPTFTPHLDTGDFVIVVNAEKVEVTGKKASQKLYRRHSGRPGGMKVEKFESLQERIPERIIEQAVKGMLPHNSLGRQQFKKLKVYKGSDHPHAAQNPV 139
>gi|15644714|ref|NP_206884.1| 50S ribosomal protein L13 [Helicobacter pylori 26695] >gi|2500253|sp|P56038|RL13_HELPY 50S ribosomal protein L13 >gi|2313165|gb|AAD07154.1| ribosomal protein L13 (rpl13) [Helicobacter pylori 26695] (141 aa)
Score = 288, Expect = 1.0e-24, Identities = 54/123 (43%), Positives = 86/123 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           + W V+DA + + G+L  E A +LRGK++  +TPNVDCGD++++IN++K+  S  K + ++++THSGY G  K K+ + M+EK  +KL + A++GMLPK  L + +IKKL +Y+D  H   AQ
  S:    12 RDWVVLDAKDKVFGRLITEIAVLLRGKHRPFYTPNVDCGDFVVVINANKVKFSGMKLEDKEYFTHSGYFGSTKSKTLQEMLEKAPEKLYHLAVRGMLPKTKLGKAMIKKLKVYRDDKHPHTAQ 134
>gi|88858772|ref|ZP_01133413.1| 50S ribosomal subunit protein L13 [Pseudoalteromonas tunicata D2] >gi|88818998|gb|EAR28812.1| 50S ribosomal subunit protein L13 [Pseudoalteromonas tunicata D2] (142 aa)
Score = 288, Expect = 1.1e-24, Identities = 55/136 (40%), Positives = 87/136 (63%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG++A E A+ LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y H+G+ GGLK  +   +     + +I  A+KGMLP+  L R + +KL +Y    H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRIATEIASRLRGKHKAEYTPHVDTGDYIIVINAEKVTVTGNKAAAKMYYAHTGFPGGLKSTTFEKLQAHKPEMIIEKAVKGMLPRGPLGRAMYRKLKVYAGTEHNHAAQQP 137
>gi|13476982|ref|NP_108552.1| 50S ribosomal protein L13 [Mesorhizobium loti MAFF303099] >gi|81776097|sp|Q982W8|RL13_RHILO 50S ribosomal protein L13 >gi|14027745|dbj|BAB54338.1| ribosomal protein L13 [Mesorhizobium loti MAFF303099] (154 aa)
Score = 287, Expect = 1.1e-24, Identities = 57/137 (41%), Positives = 92/137 (67%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TTF +  A +  KKW +IDA  L++G+LA   AN LRGK+K  FTP+VD GD +I+IN+DK+V +  K   + +Y H+G+ GG+KE++ R ++E ++ ++++  A++ M+P+  L R  +K L +Y  A H   AQ+P
  S:     2 TTFSQKPADVV-KKWILIDAEGLVVGRLATVIANHLRGKHKPTFTPHVDDGDNVIVINADKVVFTGKKFTDKVYYWHTGHPGGIKERTARQLLEGRFPERVVEKAVERMVPRGPLGRRQMKNLRVYAGAEHPHVAQQP 138
>gi|17987451|ref|NP_540085.1| 50S ribosomal protein L13 [Brucella melitensis 16M] >gi|62289741|ref|YP_221534.1| 50S ribosomal protein L13 [Brucella abortus bv. 1 str. 9-941] >gi|82699670|ref|YP_414244.1| 50S ribosomal protein L13 [Brucella melitensis biovar Abortus 2308] >gi|189023989|ref|YP_001934757.1| Ribosomal protein L13 [Brucella abortus S19] >gi|75505306|sp|Q57DW1|RL13_BRUAB 50S ribosomal protein L13 >gi|81851714|sp|Q8YGJ1|RL13_BRUME 50S ribosomal protein L13 >gi|118573384|sp|Q2YND8|RL13_BRUA2 50S ribosomal protein L13 >gi|17983145|gb|AAL52349.1| LSU ribosomal protein L13P [Brucella melitensis 16M] >gi|62195873|gb|AAX74173.1| RplM, ribosomal protein L13 [Brucella abortus biovar 1 str. 9-941] >gi|82615771|emb|CAJ10767.1| Ribosomal protein L13:Ribosomal protein L13, bacterial and organelle form [Brucella melitensis biovar Abortus 2308] >gi|189019561|gb|ACD72283.1| Ribosomal protein L13 [Brucella abortus S19] (154 aa)
Score = 287, Expect = 1.2e-24, Identities = 59/136 (43%), Positives = 93/136 (68%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF +  A +  KKW +IDA  L++G+LA   AN LRGK+K  FTP+VD GD +IIIN+DK+VL+  K   +K+Y H+G+ GG+KE++ R ++E ++ ++++  AI+ M+P+  L R  +K L +    NH+  AQ+P
  S:     3 TFSQKPAEVV-KKWVLIDAEGLVVGRLASLVANRLRGKHKATFTPHVDDGDNVIIINADKVVLTGKKYTDKKYYWHTGHPGGIKERTARQILEGRFPERVLEKAIERMIPRGPLGRRQMKNLRVNAGPNHQHEAQQP 138
>gi|89889404|ref|ZP_01200915.1| RplM, large ribosomal subunit protein L13 [Flavobacteria bacterium BBFL7] >gi|89517677|gb|EAS20333.1| RplM, large ribosomal subunit protein L13 [Flavobacteria bacterium BBFL7] (151 aa)
Score = 287, Expect = 1.2e-24, Identities = 56/140 (40%), Positives = 89/140 (63%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           V   +A  NK+W ++DA++  LG+++   A +LRGK K +FTP+VDCGD +I+IN+DK+ LS +K   + +  H+GY GG +  + + + +K   +++  A+KGMLPKN L   + + L +Y  A H   AQ+P  I LN
  S:     9 VSANSATVNKEWVLVDAADQPLGRMSSIVAKLLRGKYKTNFTPHVDCGDNVIVINADKVKLSGNKWSEKTYIRHTGYPGGQRSLTAQELYDKDPTRVVEKAVKGMLPKNKLGSAIFRNLKVYSGAEHGHDAQQPTTINLN 148
>gi|17231680|ref|NP_488228.1| 50S ribosomal protein L13 [Nostoc sp. PCC 7120] >gi|81770186|sp|Q8YPK6|RL13_ANASP 50S ribosomal protein L13 >gi|17133323|dbj|BAB75887.1| 50S ribosomal protein L13 [Nostoc sp. PCC 7120] (151 aa)
Score = 287, Expect = 1.2e-24, Identities = 56/146 (38%), Positives = 93/146 (63%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           M KT     E+    + WYV+DA++  LG+LA E A ILRGKNK  +TP++D GD++I++N+ K+ ++  K  ++ +  HSG  GG+K ++   + ++  ++++  A+KGMLPKN+L + L  KL +Y    H   AQKP E+ ++
  S:     1 MSKTYLPPQESL--ERDWYVVDATDKRLGRLASEIAMILRGKNKAHYTPHLDTGDFVIVVNAKKVAVTGKKRTQKLYRRHSGRPGGMKTETFAKLQQRLPERIVEHAVKGMLPKNSLGKQLFTKLKVYAGPTHPHDAQKPKELNIH 144
>gi|162211270|ref|YP_577705.2| 50S ribosomal protein L13 [Nitrobacter hamburgensis X14] (154 aa)
Score = 287, Expect = 1.4e-24, Identities = 54/129 (41%), Positives = 87/129 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW +IDAS L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+ K+V +  K + + +Y H+GYIGG+KE++ + ++E ++ +++I  A++ M+P+  L R  +  L +Y  A H   AQ+P
  S:     9 AEVTKKWVLIDASGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNVIIINAAKVVFTGRKREDKVYYNHTGYIGGIKERTAKSILEGRFPERVIEKAVERMIPRGPLGRVQLGNLRVYGGAEHPHEAQQP 138
>gi|56475936|ref|YP_157525.1| 50S ribosomal protein L13 [Azoarcus sp. EbN1] >gi|81677571|sp|Q5P7T7|RL13_AZOSE 50S ribosomal protein L13 >gi|56311979|emb|CAI06624.1| 50S ribosomal protein L13 [Azoarcus sp. EbN1] (142 aa)
Score = 286, Expect = 1.7e-24, Identities = 50/130 (38%), Positives = 90/130 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W+V+DAS+ +LG+LA E A  LRGK+K  +TP+VD GD+++++N +K+ ++ +KA  +K+Y H+GY GG+ E +   + +++ ++++  A+KGMLPK  L   ++KKL  Y    H  +AQ+P  +++
  S:    13 RDWFVVDASDKVLGRLAAEVARRLRGKHKAIYTPHVDTGDFIVVVNVEKLRVTGNKALDKKYYRHTGYPGGIYETNFTKLQQRFPERVLEKAVKGMLPKGPLGYAMLKKLKCYAGGEHPHSAQQPQVLEI 142
>gi|87201298|ref|YP_498555.1| 50S ribosomal protein L13 [Novosphingobium aromaticivorans DSM 12444] >gi|87136979|gb|ABD27721.1| LSU ribosomal protein L13P [Novosphingobium aromaticivorans DSM 12444] (159 aa)
Score = 286, Expect = 1.8e-24, Identities = 51/134 (38%), Positives = 91/134 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSG-RLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   KKW++IDA  L++G+LAV  AN LRGK+K  FTP+VDCGD++++IN+DK+ L+ +K   + +Y H+GY GG+KE +  +++  ++ ++++  A++ M+P+  L R  ++ L +Y  A H     +P+ + +
  S:    14 AEVEKKWHLIDAEGLVVGRLAVIIANHLRGKHKPSFTPHVDCGDHVVVINADKVRLTGNKLKNKTYYKHTGYAGGIKEVTADKVLGGRFPERVLEKAVERMIPRGPLGRAQMRALHLYAGAEHPHGGTQPVALDV 148
>gi|74420483|gb|ABA04682.1| LSU ribosomal protein L13P [Nitrobacter winogradskyi Nb-255] (157 aa)
Score = 286, Expect = 1.9e-24, Identities = 54/134 (40%), Positives = 89/134 (66%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   KKW +IDAS L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+ K+V +  K D + +Y H+GYIGG+K+++ + ++E ++ ++++  A++ M+P+  L R  +  L +Y  A H   AQ+P  I +
  S:    12 AEVTKKWVLIDASGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDNVIIINAAKVVFTGRKRDDKIYYNHTGYIGGIKQRTAKSILEGRFPERVLEKAVERMIPRGPLGRVQLGNLRVYAGAEHPHEAQQPEVINV 146
>gi|86357208|ref|YP_469100.1| 50S ribosomal protein L13 [Rhizobium etli CFN 42] >gi|118573436|sp|Q2K9W3|RL13_RHIEC 50S ribosomal protein L13 >gi|86281310|gb|ABC90373.1| 50S ribosomal protein L13 [Rhizobium etli CFN 42] (154 aa)
Score = 286, Expect = 1.9e-24, Identities = 57/141 (40%), Positives = 93/141 (65%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TF +  A +  KKW +IDA  L++G+LA   A  LRGK+K  FTP+VD GD +I+IN+DK+V +  K   + +Y H+GY GG+KE++ R +IE ++ ++++  A++ M+P+  L R  +K L +Y   NH   AQ+P+ + +
  S:     3 TFSQKPAEV-EKKWVIIDAEGLVVGRLASIIAMRLRGKHKATFTPHVDDGDNVIVINADKVVFTGKKYSDKVYYWHTGYAGGIKERTARQIIEGRFPERVLEKAVERMVPRGPLGRRQMKNLRVYAGPNHPHEAQQPVALDV 143
>gi|28897212|ref|NP_796817.1| 50S ribosomal protein L13 [Vibrio parahaemolyticus RIMD 2210633] >gi|153842051|ref|ZP_01993465.1| ribosomal protein L13 [Vibrio parahaemolyticus AQ3810] >gi|81728526|sp|Q87SI5|RL13_VIBPA 50S ribosomal protein L13 >gi|28805421|dbj|BAC58701.1| ribosomal protein L13 [Vibrio parahaemolyticus RIMD 2210633] >gi|149745417|gb|EDM56668.1| ribosomal protein L13 [Vibrio parahaemolyticus AQ3810] (142 aa)
Score = 285, Expect = 2.2e-24, Identities = 56/136 (41%), Positives = 89/136 (65%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG+LA E A+ LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y HS + GGLK  +   +I++  + ++  A+KGMLP+  L R + +KL +Y  A H   AQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLASEIASRLRGKHKAEYTPHVDAGDYIIVINAEKVAVTGNKAKDKVYYRHSEFPGGLKSITFEKLIDRKPEMVLELAVKGMLPRGPLGRAMYRKLKVYAGAEHNHVAQQP 137
>gi|15640009|ref|NP_219462.1| 50S ribosomal protein L13 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026248|ref|YP_001934020.1| ribosomal protein L13 [Treponema pallidum subsp. pallidum SS14] >gi|6094009|sp|O83988|RL13_TREPA 50S ribosomal protein L13 >gi|3323353|gb|AAC65975.1| ribosomal protein L13 (rplM) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018823|gb|ACD71441.1| ribosomal protein L13 [Treponema pallidum subsp. pallidum SS14] (142 aa)
Score = 285, Expect = 2.2e-24, Identities = 56/141 (39%), Positives = 88/141 (62%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           +T FV    A+  + W++IDA+   LG++A   A +LRGK+K  +TPN + GDY+++IN++K+ LS  K   + +Y HSGY GGLK  S   ++++   + +  A+KGMLPK  L R LIK + IY  + H   +Q P+ +
  S:     2 RTIFVNEREAV--RAWHLIDAAGRPLGRVAARVACLLRGKHKASYTPNQEMGDYVVVINAEKVFLSGTKPKDKMYYRHSGYPGGLKSVSFSALVKRRPVEPLRHAVKGMLPKGPLGRKLIKNVKIYAGSVHPHESQNPVPL 140
>gi|42561239|ref|NP_975690.1| 50S ribosomal protein L13 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81697973|sp|Q6MSQ6|RL13_MYCMS 50S ribosomal protein L13 >gi|42492737|emb|CAE77332.1| 50S RIBOSOMAL PROTEIN L13 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (151 aa)
Score = 285, Expect = 2.3e-24, Identities = 61/140 (43%), Positives = 93/140 (66%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M++TT +   A   NKKWY++DA N  +G+LA + A +LRGK+KVDFTP+++ GD++IIIN++K + S  K   + +Y HS + GGLK++S  +  E  + K++  AI+ MLPKN       + L ++K +NH  AAQKP
  S:     1 MKQTTMI--SAKDTNKKWYIVDAENKTVGRLATQVALVLRGKHKVDFTPHINNGDHVIIINAEKAIFSGKKESNKFYYHHSMHPGGLKKRSVEVQRELDATKILERAIRLMLPKNVQGSNQYRALHVFKGSNHPFAAQKP 138
>gi|85375399|ref|YP_459461.1| 50S ribosomal protein L13 [Erythrobacter litoralis HTCC2594] >gi|84788482|gb|ABC64664.1| ribosomal protein L13 [Erythrobacter litoralis HTCC2594] (159 aa)
Score = 285, Expect = 2.4e-24, Identities = 54/129 (41%), Positives = 87/129 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW++IDA  L++G+LA   A+ILRGK+K  FTP+VDCGD++II+N+DK+  + +K   + +Y H+G+ GG+KE +   ++E ++ +++I  AI+ M+P+  L R  ++ L IY    H    QKP
  S:    14 AEVEKKWHLIDAEGLVVGRLAAIVASILRGKHKPSFTPHVDCGDHVIILNADKVKFTGNKMTDKVYYKHTGHPGGIKETTPAKVLEGRFPERVIEKAIQRMIPRGPLGRDQMRALHIYAGTEHPHDGQKP 143
>gi|116251439|ref|YP_767277.1| 50S ribosomal protein L13 [Rhizobium leguminosarum bv. viciae 3841] >gi|167362897|ref|ZP_02297386.1| ribosomal protein L13 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|118573437|sp|Q1MIP2|RL13_RHIL3 50S ribosomal protein L13 >gi|115256087|emb|CAK07168.1| putative 50S ribosomal protein L13 [Rhizobium leguminosarum bv. viciae 3841] >gi|167070248|gb|EDR74235.1| ribosomal protein L13 [Rhizobium leguminosarum bv. trifolii WSM1325] (154 aa)
Score = 284, Expect = 2.5e-24, Identities = 57/141 (40%), Positives = 94/141 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           TF +  A +  KKW +IDA  L++G+LA   A  LRGK+K  FTP+VD GD +I+IN++K+V +  K   + +Y H+GY GG+KE+S R +IE ++ ++++  A++ M+P+  L R  +K L +Y  +NH   AQ+P+ + +
  S:     3 TFSQKPAEV-EKKWVIIDAEGLVVGRLASIIAMRLRGKHKATFTPHVDDGDNVIVINAEKVVFTGKKYSDKVYYWHTGYAGGIKERSARQIIEGRFPERVLEKAVERMVPRGPLGRRQMKNLRVYAGSNHPHEAQQPVALDV 143
>gi|50086029|ref|YP_047539.1| 50S ribosomal protein L13 [Acinetobacter sp. ADP1] >gi|81695766|sp|Q6F898|RL13_ACIAD 50S ribosomal protein L13 >gi|49532005|emb|CAG69717.1| 50S ribosomal protein L13 [Acinetobacter sp. ADP1] (142 aa)
Score = 284, Expect = 2.6e-24, Identities = 52/123 (42%), Positives = 83/123 (67%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           WYV+DAS   LG+LA E A  LRGK+K  +TP+VD GDY+++IN++++ ++  K+  +K+Y H+G+ GG++E +   +I    + ++  A+KGMLPK  L   +IKK+ +Y    H  AAQ+P
  S:    15 WYVVDASGKTLGRLATEIARRLRGKHKTSYTPHVDTGDYIVVINAEQVQVTGKKSLDKKYYRHTGFPGGIRETNFEKLIAHKPEAVLEKAVKGMLPKGPLGYAMIKKMKVYAGTEHPHAAQQP 137
>gi|68171378|ref|ZP_00544772.1| Ribosomal protein L13, bacterial and organelle form [Ehrlichia chaffeensis str. Sapulpa] >gi|88658299|ref|YP_507805.1| 50S ribosomal protein L13 [Ehrlichia chaffeensis str. Arkansas] >gi|67999203|gb|EAM85859.1| Ribosomal protein L13, bacterial and organelle form [Ehrlichia chaffeensis str. Sapulpa] >gi|88599756|gb|ABD45225.1| ribosomal protein L13 [Ehrlichia chaffeensis str. Arkansas] (156 aa)
Score = 284, Expect = 3.1e-24, Identities = 57/143 (39%), Positives = 93/143 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKE-KSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           MQ  TF   +A+   K+W VIDA  +++G+LA   ANILRGK+K ++TP++DCGD +IIIN++K+  +  K   + +Y H+GY GGLK      L + K+ +++I  A++ ML    ++R  +K L++Y    HK  AQ+P+++
  S:     1 MQMETF-SLKASQIKKRWVVIDADGVVVGRLAAFVANILRGKDKPEYTPHMDCGDNVIIINAEKVHFTGSKLKNKVYYRHTGYPGGLKSCTPADLFLNKHPERIINMAVRRMLSTGPMARRRLKNLYVYSGPEHKHNAQQPVKL 143
>gi|53804800|ref|YP_113389.1| 50S ribosomal protein L13 [Methylococcus capsulatus str. Bath] >gi|81682548|sp|Q60AF8|RL13_METCA 50S ribosomal protein L13 >gi|53758561|gb|AAU92852.1| ribosomal protein L13 [Methylococcus capsulatus str. Bath] (142 aa)
Score = 284, Expect = 3.2e-24, Identities = 55/132 (41%), Positives = 89/132 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ--KPMEI 143
           A   + WYV+DA    LG+L+ E A  LRGK+K ++TP+VD GDY++++N++K+ ++ +K   + +Y H+GYIG +K  S   + ++  + +I  A+KGMLPKN L R + +KL +Y   +H+  AQ  KP+EI
  S:     9 AEVKRDWYVVDAEGKTLGRLSTEIARRLRGKHKPEYTPHVDTGDYIVVVNAEKVRVTGNKEQDKIYYKHTGYIGNMKSISLGKLRDRRPELIIETAVKGMLPKNPLGRAMFRKLKVYAGPSHQHQAQQPKPLEI 142
>gi|83858245|ref|ZP_00951767.1| ribosomal protein L13 [Oceanicaulis alexandrii HTCC2633] >gi|83853068|gb|EAP90920.1| ribosomal protein L13 [Oceanicaulis alexandrii HTCC2633] (154 aa)
Score = 283, Expect = 3.2e-24, Identities = 58/136 (42%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNT-LSRYLIKKLFIYKDANHKQAAQKP 140
           TF    A +  KKW VIDA   I+G+LA   A  LRGK++ D+TP+VD GD++++IN+DK+V +  K   +++Y H+G+ GG+KE S R ++E ++ ++++  A+K MLPK + L+R    KL +Y  A H   AQ P
  S:     3 TFTAKPADV-EKKWVVIDAEGAIVGRLAAYIATRLRGKHRPDYTPHVDTGDHVVVINADKVVFTGRKFQDKRYYRHTGHPGGIKETSPRKVLEGRFPERVVEMAVKRMLPKESPLARSQFSKLRVYAGAEHPHEAQNP 139
>gi|91228493|ref|ZP_01262415.1| 50S ribosomal protein L13 [Vibrio alginolyticus 12G01] >gi|156973201|ref|YP_001444108.1| 50S ribosomal protein L13 [Vibrio harveyi ATCC BAA-1116] >gi|166199630|sp|A7MWM9|RL13_VIBHB 50S ribosomal protein L13 >gi|91187927|gb|EAS74237.1| 50S ribosomal protein L13 [Vibrio alginolyticus 12G01] >gi|156524795|gb|ABU69881.1| hypothetical protein VIBHAR_00881 [Vibrio harveyi ATCC BAA-1116] (142 aa)
Score = 283, Expect = 3.5e-24, Identities = 56/136 (41%), Positives = 88/136 (64%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG+LA E A+ LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y HS + GGLK  +   +I++  +  +  A+KGMLP+  L R + +KL +Y  A H   AQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLASEIASRLRGKHKAEYTPHVDTGDYIIVINAEKVAVTGNKAKNKVYYRHSEFPGGLKSITFEKLIDRKPEMALELAVKGMLPRGPLGRAMYRKLKVYAGAEHNHVAQQP 137
>gi|77361447|ref|YP_341022.1| 50S ribosomal protein L13 [Pseudoalteromonas haloplanktis TAC125] >gi|118573430|sp|Q3IG26|RL13_PSEHT 50S ribosomal protein L13 >gi|76876358|emb|CAI87580.1| 50S ribosomal subunit protein L13 [Pseudoalteromonas haloplanktis TAC125] (142 aa)
Score = 283, Expect = 3.6e-24, Identities = 56/136 (41%), Positives = 87/136 (63%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG++A E A  LRGK+KV++TP+VD GDY+I+IN++K+ ++ +K   + +Y+HSG+ GGLK  +   +     + +I  A+KGMLP+  L R + +KL +Y    H  AAQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRIATEIALRLRGKHKVEYTPHVDTGDYIIVINAEKVTVTGNKFKNKVYYSHSGFPGGLKSTTFDKLQAAKPEMIIEKAVKGMLPRGPLGRAMYRKLKVYTGTEHNHAAQQP 137
>gi|67459386|ref|YP_247010.1| 50S ribosomal protein L13 [Rickettsia felis URRWXCal2] >gi|75536193|sp|Q4UKS8|RL13_RICFE 50S ribosomal protein L13 >gi|67004919|gb|AAY61845.1| 50S ribosomal protein L13 [Rickettsia felis URRWXCal2] (155 aa)
Score = 283, Expect = 3.8e-24, Identities = 56/125 (44%), Positives = 91/125 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKA---DREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW+VIDA N++LG+LA   AN+LRGK+K  FTP++DCGD +IIIN++ + L+  KA   D + +Y H+G+ GGLK+ + G+++  K+ +++I  A+K M+ +NTL    +  L++Y + +H   AQ+P
  S:    13 KKWWVIDAKNIVLGRLASRVANMLRGKHKPSFTPHLDCGDNIIIINAEHVKLTGKKANPKDGKIYYRHTGFPGGLKDTTAGKILSSKHPERVIKMAVKRMITRNTLGAKQMSNLYVYANGDHPHMAQQP 141
>gi|94967592|ref|YP_589640.1| 50S ribosomal protein L13 [Acidobacteria bacterium Ellin345] >gi|118573376|sp|Q1IU84|RL13_ACIBL 50S ribosomal protein L13 >gi|94549642|gb|ABF39566.1| LSU ribosomal protein L13P [Acidobacteria bacterium Ellin345] (142 aa)
Score = 283, Expect = 3.9e-24, Identities = 59/137 (43%), Positives = 90/137 (65%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           T F K E A   +KW+V+DA    LG+LA   A IL GK+   +TP +D GD++++IN++KI ++  KAD +K+Y +SGY GG+KE+     +E+  + ++  AIKGMLPK+ L + +  KL +Y+ A+H   AQKP
  S:     3 TYFPKGEVA---RKWFVVDADGQTLGRLASRVARILSGKDNPKYTPFIDTGDHVVVINAEKIKITGLKADNKKYYHYSGYPGGMKEEEFLKRLERRPELILETAIKGMLPKSKLGKAMGGKLKVYRGADHPHIAQKP 136
>gi|90994482|ref|YP_536972.1| 50S ribosomal protein L13 [Porphyra yezoensis] >gi|118573374|sp|Q1XDJ6|RK13_PORYE Chloroplast 50S ribosomal protein L13 >gi|90819046|dbj|BAE92415.1| 50S ribosomal protein L13 [Porphyra yezoensis] >gi|116266156|gb|ABJ91316.1| 50S ribosomal protein L13 [Porphyra yezoensis] (142 aa)
Score = 283, Expect = 4.2e-24, Identities = 56/128 (43%), Positives = 81/128 (63%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPME 142
           N  WYVIDA N  LG+++   +NILRGKNK  +TP +D GDY+I+INS  + +S +K +++ +  HSG  GGLK ++   +  +  +++I  ++KGMLPK  L R L  KL +Y    H   AQKP E
  S:    12 NSHWYVIDAKNQTLGRISTHISNILRGKNKPSYTPYLDTGDYVIVINSAHVSVSGNKTNQKLYRRHSGQPGGLKVETFDQLQTRLPNRIIEKSVKGMLPKGPLGRKLFTKLKVYSGPIHPHVAQKPQE 139
>gi|115439933|ref|NP_001044246.1| Os01g0749200 [Oryza sativa (japonica cultivar-group)] >gi|14209550|dbj|BAB56046.1| putative ribosomal protein L13 precursor [Oryza sativa Japonica Group] >gi|113533777|dbj|BAF06160.1| Os01g0749200 [Oryza sativa (japonica cultivar-group)] >gi|125527707|gb|EAY75821.1| hypothetical protein OsI_003668 [Oryza sativa (indica cultivar-group)] >gi|125572024|gb|EAZ13539.1| hypothetical protein OsJ_003364 [Oryza sativa (japonica cultivar-group)] (233 aa)
Score = 281, Expect = 6.5e-24, Identities = 51/130 (39%), Positives = 86/130 (66%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           K WYV+DA++ ILG+LA   A  +RGKN+  +TP+VD G +++++N++K+ +S  K  ++ +  HSG  GG+KE++   + ++  +++I  A++GMLPK  L R L   L +YK A H   AQKP+ + +
  S:    94 KTWYVVDATDKILGRLASTIAVHIRGKNEATYTPSVDMGAFVVVVNAEKVAVSGKKRSQKLYRRHSGRPGGMKEETFDQLQKRIPERIIEHAVRGMLPKGRLGRRLFTHLKVYKGAEHPHEAQKPVPLPI 223
>gi|94497424|ref|ZP_01303994.1| 50S ribosomal protein L13 [Sphingomonas sp. SKA58] >gi|94423055|gb|EAT08086.1| 50S ribosomal protein L13 [Sphingomonas sp. SKA58] (159 aa)
Score = 281, Expect = 6.7e-24, Identities = 54/129 (41%), Positives = 84/129 (65%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW +IDA  L++G+LA   ANILRGK+K  FTP+VDCGD +IIIN+ K+  +  K   + +Y H+GY GG+KE +   ++E ++ ++++  A++ M+P+  L R  ++ L I+  A H   AQ P
  S:    14 ATVEKKWILIDAEGLVVGRLASTVANILRGKHKPSFTPHVDCGDNVIIINAGKVKFTGRKMTDKVYYKHTGYAGGIKETTPAKILEGRFPERVLEKAVERMIPRGPLGRQQMRNLRIFAGAEHNHEAQNP 143
>gi|32490889|ref|NP_871143.1| 50S ribosomal protein L13 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|81741814|sp|Q8D361|RL13_WIGBR 50S ribosomal protein L13 >gi|25166095|dbj|BAC24286.1| rplM [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (142 aa)
Score = 281, Expect = 6.8e-24, Identities = 58/131 (44%), Positives = 91/131 (69%)
  Q:    13 LANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           +A + W++ DA N ILG+ + + A+IL+GKN + +TP+VD G+Y+I+INS KI ++  K   + +Y H+GY GG+K+ S   MI+  S+ +IY ++KGMLPK +L R +IKKL I+   +H   AQKP ++
  S:    10 IARQNWHIFDAKNKILGRFSTKLASILKGKNDITYTPHVDSGNYVIVINSKKIKITGKKLKNKFYYHHTGYSGGIKKISLENMIKNNSELVIYKSVKGMLPKGSLGRVMIKKLKIFSGESHNHEAQKPKKL 140
>gi|84500846|ref|ZP_00999081.1| ribosomal protein L13 [Oceanicola batsensis HTCC2597] >gi|84390913|gb|EAQ03331.1| ribosomal protein L13 [Oceanicola batsensis HTCC2597] (153 aa)
Score = 281, Expect = 7.1e-24, Identities = 55/126 (43%), Positives = 84/126 (66%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW VIDA  ++LG+LA   A  LRGK+K  FTPN D GD +I+IN+DK+ ++  K   +K+Y H+G+ GG+K ++ G+++   Y ++++  A+K MLP N LSR  +  L +Y  A+H   AQ P
  S:    12 DKKWIVIDAEGVVLGRLAAIVATRLRGKHKATFTPNQDMGDNVIVINADKVQMTGKKRSDKKYYWHTGHPGGIKHRTAGQILEGAYPERVVTAAVKRMLPGNRLSRKQMTNLRVYAGADHPHEAQSP 138
>gi|89899531|ref|YP_522002.1| 50S ribosomal protein L13 [Rhodoferax ferrireducens T118] >gi|122479959|sp|Q220T2|RL13_RHOFD 50S ribosomal protein L13 >gi|89344268|gb|ABD68471.1| LSU ribosomal protein L13P [Rhodoferax ferrireducens T118] (143 aa)
Score = 280, Expect = 7.3e-24, Identities = 60/145 (41%), Positives = 93/145 (64%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M KT   K  AA    +W+VIDA++ +LG++A E A  LRGK+K  +TP+VD GD+++IIN+ ++ ++  K+  + +Y+HSGY GG+   + R M  K+  + +  A+KGMLPK  L   +IKKL +Y  A H   AQ+P  ++L
  S:     1 MTKTFSAK--AADVVHEWFVIDATDKVLGRVASEVALRLRGKHKAIYTPHVDTGDFIVIINAAQLRVTGAKSTDKIYYSHSGYPGGISSVNFRDMQAKFPGRALEKAVKGMLPKGPLGYAMIKKLKVYGGAEHPHTAQQPKVLEL 143
>gi|91205039|ref|YP_537394.1| 50S ribosomal protein L13 [Rickettsia bellii RML369-C] >gi|157827610|ref|YP_001496674.1| 50S ribosomal protein L13 [Rickettsia bellii OSU 85-389] >gi|166199610|sp|A8GXN7|RL13_RICB8 50S ribosomal protein L13 >gi|122426002|sp|Q1RK09|RL13_RICBR 50S ribosomal protein L13 >gi|91068583|gb|ABE04305.1| 50S ribosomal protein L13 [Rickettsia bellii RML369-C] >gi|157802914|gb|ABV79637.1| 50S ribosomal protein L13 [Rickettsia bellii OSU 85-389] (155 aa)
Score = 280, Expect = 7.5e-24, Identities = 55/126 (43%), Positives = 91/126 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKA---DREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM 141
           KKW+VIDA N++LG+LA   AN+LRGK+K  FTP++DCGD +IIIN++ + L+  KA   D + +Y H+G+ GG+K+ + G+++  K+ +++I  A+K M+ +N L    +  L+IY ++ H  A Q+P+
  S:    13 KKWWVIDAKNVVLGRLASRVANMLRGKHKPSFTPHMDCGDNIIIINAEHVTLTGKKANPKDGKIYYRHTGFPGGIKDTTAGKILSGKHPERVIKMAVKRMITRNALGAKQMSNLYIYANSEHPHAGQQPV 142
>gi|56551780|ref|YP_162619.1| 50S ribosomal protein L13 [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543354|gb|AAV89508.1| ribosomal protein L13 [Zymomonas mobilis subsp. mobilis ZM4] (159 aa)
Score = 280, Expect = 9.2e-24, Identities = 49/129 (37%), Positives = 86/129 (66%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   KKW++IDA  L++G++A   AN+LRGK+K  FTP +DCGD +++IN+DK+  +  K  ++ +Y H+GY GG+KE +  +++  ++ ++++  A++ M+P+  L R  ++ L I+  A H   AQ P
  S:    14 ATVEKKWHLIDAEGLVVGRVATIIANLLRGKHKPSFTPYIDCGDNVVVINADKVRFTGRKMQKKVYYKHTGYAGGIKETTPAKVLGGRFPERVLEKAVERMIPRGPLGRQQMRNLRIFAGAEHSHTAQNP 143
>gi|53715297|ref|YP_101289.1| 50S ribosomal protein L13 [Bacteroides fragilis YCH46] >gi|60683232|ref|YP_213376.1| 50S ribosomal protein L13 [Bacteroides fragilis NCTC 9343] >gi|52218162|dbj|BAD50755.1| 50S ribosomal protein L13 [Bacteroides fragilis YCH46] >gi|60494666|emb|CAH09467.1| putative 50S ribosomal protein L13 [Bacteroides fragilis NCTC 9343] (153 aa)
Score = 279, Expect = 1.0e-23, Identities = 57/135 (42%), Positives = 89/135 (65%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYS--DKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           A   K+W ++DA++  LG+L  + A +LRGK K +FTP+VDCGD +IIIN+DK+ LS +K +   + +++GY GG +E +   +I K +  D+L+   +KGMLPKN L   L+  +++Y  + HK  AQ P  I +N
  S:    14 ATVTKEWVIVDATDQTLGRLGAKVAKLLRGKYKPNFTPHVDCGDNVIIINADKVKLSGNKWNDRVYLSYTGYPGGQREMTPARLIAKPNGEDRLLRKVVKGMLPKNRLGAKLLSNMYVYAGSEHKHDAQNPKAIDIN 150
>gi|86606116|ref|YP_474879.1| 50S ribosomal protein L13 [Synechococcus sp. JA-3-3Ab] >gi|123506461|sp|Q2JUJ8|RL13_SYNJA 50S ribosomal protein L13 >gi|86554658|gb|ABC99616.1| ribosomal protein L13 [Synechococcus sp. JA-3-3Ab] (151 aa)
Score = 279, Expect = 1.1e-23, Identities = 51/124 (41%), Positives = 83/124 (66%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +WY++DA+N  LG+LAV  A +LRGK+K +FTP++D GDY+I+IN++K+V++  K  ++ +  HSG  GG+K ++   +  +  +++I  A+KGMLP   L R    KL +Y   +H   AQ+P
  S:    15 RWYLVDAANQRLGRLAVVVAKLLRGKHKPNFTPHLDTGDYVIVINAEKVVVTGKKRTQKLYRRHSGRPGGMKVETFAQLQARLPERVIEKAVKGMLPHTRLGRRQFTKLKVYAGPHHPHEAQQP 138
>gi|24216108|ref|NP_713589.1| 50S ribosomal protein L13 [Leptospira interrogans serovar Lai str. 56601] >gi|45656655|ref|YP_000741.1| 50S ribosomal protein L13 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24197350|gb|AAN50607.1|AE011499_6 Ribosomal protein L13 [Leptospira interrogans serovar Lai str. 56601] >gi|45599891|gb|AAS69378.1| 50S ribosomal protein L13 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (149 aa)
Score = 279, Expect = 1.1e-23, Identities = 60/145 (41%), Positives = 91/145 (62%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + KT  +  E A+  K W+V+DA    LG+LA   A  LRGK+K  FTPN DCGD +I+IN+ K+ ++ +K  ++K+Y HS Y GG+ E   + +I K  +K+IY A+KGMLPK+ L   ++    I+  A H   AQKP+++ +
  S:     7 VHKTPSLTKENAV--KGWFVVDAEGKTLGRLASGIAARLRGKHKATFTPNQDCGDNIIVINASKVKVTGNKETQKKYYHHSRYPGGMTETVFKDLIAKQPEKVIYEAVKGMLPKSKLGDKMLTHCKIFSGAEHNLQAQKPVKLDI 149
>gi|113476552|ref|YP_722613.1| 50S ribosomal protein L13 [Trichodesmium erythraeum IMS101] >gi|118573464|sp|Q110D4|RL13_TRIEI 50S ribosomal protein L13 >gi|110167600|gb|ABG52140.1| LSU ribosomal protein L13P [Trichodesmium erythraeum IMS101] (151 aa)
Score = 279, Expect = 1.2e-23, Identities = 54/133 (40%), Positives = 86/133 (64%)
  Q:    13 LANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +  KKWYVIDA    LG+LA   A I+RGKNK  +TP++D GD++I++N++K+ ++  K+ ++ +  HSG  GG+K +    +  +   ++I  A+ GMLPKN+L R L  KL +Y  +NH   AQKP ++ +
  S:    11 IEGKKWYVIDAEGQRLGRLATAIAMIIRGKNKPTYTPHMDTGDFVIVVNAEKVTVTGKKSSQKLYRRHSGRPGGMKTEVFSKLQARLPQRIIEEAVFGMLPKNSLGRKLHNKLKVYPGSNHPHEAQKPEKLTI 143
>gi|27364060|ref|NP_759588.1| 50S ribosomal protein L13 [Vibrio vulnificus CMCP6] >gi|37678778|ref|NP_933387.1| 50S ribosomal protein L13 [Vibrio vulnificus YJ016] >gi|81742198|sp|Q8DEI9|RL13_VIBVU 50S ribosomal protein L13 >gi|81758362|sp|Q7MNX1|RL13_VIBVY 50S ribosomal protein L13 >gi|27360178|gb|AAO09115.1|AE016799_13 Ribosomal protein L13 [Vibrio vulnificus CMCP6] >gi|37197519|dbj|BAC93358.1| ribosomal protein L13 [Vibrio vulnificus YJ016] (142 aa)
Score = 278, Expect = 1.2e-23, Identities = 55/136 (40%), Positives = 88/136 (64%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TFV     +  + WYV+DA    LG+LA E A+ LRGK+K ++TP+VD GDY+I+IN++K+ ++ +KA  + +Y H+ + GG+K  +   +I +  + +I  A+KGMLP+  L R + +KL +Y  A H   AQ+P
  S:     3 TFVAKPETV-KRDWYVVDAEGKTLGRLASEIASRLRGKHKAEYTPHVDTGDYIIVINAEKVTVTGNKAAAKTYYRHTEFPGGIKSITFDKLIVRKPEMVIELAVKGMLPRGPLGRAMYRKLKVYAGAEHNHVAQQP 137
>gi|33519531|ref|NP_878363.1| 50S ribosomal protein L13 [Candidatus Blochmannia floridanus] >gi|33517194|emb|CAD83576.1| 50S ribosomal subunit protein L13 [Candidatus Blochmannia floridanus] (139 aa)
Score = 278, Expect = 1.3e-23, Identities = 52/123 (42%), Positives = 83/123 (67%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           WY++DA N +LG+L+   A  L GK+KV++ P VD GDY+I+INS  + ++  K   + +Y H+GY+GG+K+ + + MI  Y +K+I  +++GMLPKN+L R + K+L +Y  + H   AQ P
  S:    11 WYIVDAKNKVLGRLSSNIAKYLIGKHKVEYAPYVDVGDYIIVINSKDVCVTGRKYKDKIYYRHTGYVGGIKKLTFKQMIMSYPNKVIESSVRGMLPKNSLGRMMFKRLKVYSGSIHSHNAQSP 133
>gi|16125625|ref|NP_420189.1| 50S ribosomal protein L13 [Caulobacter crescentus CB15] >gi|13422729|gb|AAK23357.1| ribosomal protein L13 [Caulobacter crescentus CB15] (157 aa)
Score = 278, Expect = 1.4e-23, Identities = 56/140 (40%), Positives = 92/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMI-EKYSDKLIYGAIKGMLPKNT-LSRYLIKKLFIYKDANHKQAAQKP 140
           MQK T    + A   KKW V+DA N ++G+LA   A  LRGK++ D+TP+VDCGD++++IN+DK+  +  K D + +Y H+G+ GG+KE + R ++  ++ ++++  A++ MLPK + L+R  +  L IY +  H   AQ P
  S:     1 MQKIT-ASLKPAEVEKKWIVVDAENAVVGRLASFIAMRLRGKHRPDYTPHVDCGDFVVVINADKVKFTGKKLDDKVYYRHTGHPGGIKETTPRKVLGGRFPERVLEKAVERMLPKESPLARKQLTHLLIYNNGEHPHQAQNP 141
>gi|121593052|ref|YP_984948.1| 50S ribosomal protein L13 [Acidovorax sp. JS42] >gi|166230952|sp|A1W3P7|RL13_ACISJ 50S ribosomal protein L13 >gi|120605132|gb|ABM40872.1| LSU ribosomal protein L13P [Acidovorax sp. JS42] (142 aa)
Score = 278, Expect = 1.6e-23, Identities = 57/142 (40%), Positives = 92/142 (64%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +TF    A + ++ W+VIDA++ +LG++A E A  LRGK+K  +TP+VD GDY++IIN+ K+ ++  K+  + +Y HSGY GG+   + R +  K+  + +  A+KGMLPK  L   +IKKL +Y  A H   AQ+P  +++
  S:     2 STFSAKPAEVVHE-WFVIDATDKVLGRVASEVALRLRGKHKAIYTPHVDTGDYIVIINASKLKVTGTKSLDKVYYRHSGYPGGITATNFRDLQAKHPGRALEKAVKGMLPKGPLGYAMIKKLKVYGGAEHPHTAQQPKALEI 142
>gi|149240893|pdb|1VSA|H Chain H, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2ow8 >gi|46197028|gb|AAS81443.1| LSU ribosomal protein L13P [Thermus thermophilus HB27] (163 aa)
Score = 277, Expect = 1.7e-23, Identities = 50/129 (38%), Positives = 87/129 (67%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +W +IDA    LG+LA + A +LRGK++ D+TPNV  GD+++++N+DKI ++  K +++ +  +SGY GGLK+     M+  + ++++  A+KGMLPK  L R L K+L +Y   +H   AQ+P ++++
  S:    35 RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 163
>gi|15792795|ref|NP_282618.1| 50S ribosomal protein L13 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57169062|ref|ZP_00368189.1| ribosomal protein L13 [Campylobacter coli RM2228] >gi|57238503|ref|YP_179634.1| 50S ribosomal protein L13 [Campylobacter jejuni RM1221] >gi|86149462|ref|ZP_01067693.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151890|ref|ZP_01070103.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni 260.94] >gi|88596624|ref|ZP_01099861.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni 84-25] >gi|157415704|ref|YP_001482960.1| 50S ribosomal protein L13 [Campylobacter jejuni subsp. jejuni 81116] >gi|167006022|ref|ZP_02271780.1| 50S ribosomal protein L13 [Campylobacter jejuni subsp. jejuni 81-176] >gi|57019520|gb|EAL56211.1| ribosomal protein L13 [Campylobacter coli RM2228] >gi|57167307|gb|AAW36086.1| ribosomal protein L13 [Campylobacter jejuni RM1221] >gi|85840244|gb|EAQ57502.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85840998|gb|EAQ58247.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni 260.94] >gi|88191465|gb|EAQ95437.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360787|emb|CAL35587.1| 50S ribosomal protein L13 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|157386668|gb|ABV52983.1| 50S ribosomal protein L13 [Campylobacter jejuni subsp. jejuni 81116] (141 aa)
Score = 277, Expect = 1.9e-23, Identities = 61/129 (47%), Positives = 83/129 (64%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLS-SDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIK 144
           ++W V+DA     G+L  E A ILRGKNK  FTPNVDCGDY+IIIN+ K V + ++KA+ + ++ HSGY G +K +    ++EK   KL   A++GMLPK  L R ++KKL IY  + H   AQ   E K
  S:    12 REWIVLDAEGKRFGRLLTEVATILRGKNKPCFTPNVDCGDYVIIINASKAVFTGANKAEDKLYHRHSGYFGSVKSEKFGDLLEKNPAKLYKLAVRGMLPKTNLGRAMLKKLKIYAGSEHPHTAQIAKEGK 141
>gi|86159791|ref|YP_466576.1| 50S ribosomal protein L13 [Anaeromyxobacter dehalogenans 2CP-C] >gi|163767197|ref|ZP_02174213.1| ribosomal protein L13 [Anaeromyxobacter sp. K] >gi|167457065|ref|ZP_02323281.1| ribosomal protein L13 [Anaeromyxobacter dehalogenans 2CP-1] >gi|85776302|gb|ABC83139.1| LSU ribosomal protein L13P [Anaeromyxobacter dehalogenans 2CP-C] >gi|167416888|gb|EDR83599.1| ribosomal protein L13 [Anaeromyxobacter dehalogenans 2CP-1] >gi|196173694|gb|ACG74667.1| ribosomal protein L13 [Anaeromyxobacter sp. K] (149 aa)
Score = 276, Expect = 2.1e-23, Identities = 48/134 (35%), Positives = 89/134 (66%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           AL  +KW+V+DA++L +G+ A   A+IL+GK+K  +TP++D GD+++++N+ K+  + +K   + ++TH+ + GG K+     + E++ +++I  A++ MLP+N L R ++ KL +Y    H  AAQKP  + L
  S:    14 ALNGRKWWVVDATDLTVGRAATRIASILKGKHKPAYTPSMDTGDFVVVVNAGKVRFTGNKETDKVFFTHTMHPGGAKQTPMNKLRERHPEQIIENAVRRMLPRNNLGRQMLAKLKVYAGDTHPHAAQKPEALSL 147
>gi|116327490|ref|YP_797210.1| 50S ribosomal protein L13 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331896|ref|YP_801614.1| 50S ribosomal protein L13 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116120234|gb|ABJ78277.1| 50S Ribosomal protein L13 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125585|gb|ABJ76856.1| 50S Ribosomal protein L13 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (150 aa)
Score = 276, Expect = 2.3e-23, Identities = 58/141 (41%), Positives = 89/141 (63%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +  K  AA+  K W+V+DA    LG+LA   A  LRGK+K  FTPN DCGD +I+IN+ K+ ++ +K  ++ +Y HS Y GG+ E   + +I K  +K+IY A+KGMLPK+ L   ++    I+  A H   AQKP+++++
  S:    12 SLTKENAAV--KSWFVVDAEGKTLGRLASGIAARLRGKHKATFTPNQDCGDNIIVINASKVKVTGNKETQKMYYHHSRYPGGMTEIVFKDLIAKQPEKVIYEAVKGMLPKSKLGDKMLTHCKIFSGAEHNLQAQKPVKLEI 150
>gi|83319647|ref|YP_424627.1| 50S ribosomal protein L13 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123535565|sp|Q2SRI6|RL13_MYCCT 50S ribosomal protein L13 >gi|83283533|gb|ABC01465.1| 50S ribosomal protein L13 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (151 aa)
Score = 276, Expect = 2.6e-23, Identities = 59/140 (42%), Positives = 91/140 (65%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M++TT +   A   NKKWY++DA N  +G+LA + A +LRGK+KVDFTP+++ GD++I+IN++K + S  K   + +Y HS + GGLK++S  +  E    K++  AI+ MLPKN       + L ++K + H  AAQKP
  S:     1 MKQTTMI--SAKNINKKWYIVDAENKTVGRLATQVALVLRGKHKVDFTPHINNGDHVIVINAEKAIFSGKKESNKFYYHHSMHPGGLKKRSVSVQRELDPTKILERAIRLMLPKNVQGSNQYRALHVFKGSEHPYAAQKP 138
>gi|83856238|ref|ZP_00949767.1| 50S ribosomal protein L13 [Croceibacter atlanticus HTCC2559] >gi|83850038|gb|EAP87906.1| 50S ribosomal protein L13 [Croceibacter atlanticus HTCC2559] (151 aa)
Score = 275, Expect = 2.9e-23, Identities = 56/140 (40%), Positives = 84/140 (60%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           V    A   K W ++DA    LG+L+   A +LRGK+KVDFTP+VDCGD +I+IN++KI L+  K   +++  ++GY GG +  +   + EK   +L+  A+KGMLPKN L   L + + ++    H   AQKP  I +N
  S:     9 VSANKATVTKNWVLVDAEGQSLGRLSSVVARMLRGKHKVDFTPHVDCGDNVIVINAEKINLTGKKWTSKEYQRYTGYPGGQRSLTATQLFEKDPTRLVENAVKGMLPKNKLGAALFRNMRVFVGGEHSLDAQKPEVININ 148
>gi|27380074|ref|NP_771603.1| 50S ribosomal protein L13 [Bradyrhizobium japonicum USDA 110] >gi|81736737|sp|Q89KE4|RL13_BRAJA 50S ribosomal protein L13 >gi|27353228|dbj|BAC50228.1| 50S ribosomal protein L13 [Bradyrhizobium japonicum USDA 110] (154 aa)
Score = 275, Expect = 3.0e-23, Identities = 53/134 (39%), Positives = 89/134 (66%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   KKW +IDA  L++G+LA   A  LRGK+   +TP+VDCGD +IIIN+   VL+  K +++ +Y H+GY+G +KE++ R ++E K+ ++++  A++ M+P+  L R  +  L +Y  A+H   AQ+P +I +
  S:     9 AEVTKKWVLIDAKGLVVGRLATIVAMRLRGKHLPTYTPHVDCGDNVIIINAQHAVLTGRKREQKTYYKHTGYVGHVKERTARQILEGKHPERVLEKAVERMIPRGPLGRVQMGNLRVYGGADHPHEAQQPEKIDI 143
>gi|28212148|ref|NP_783092.1| 50S ribosomal protein L13 [Clostridium tetani E88] >gi|81733792|sp|Q890R6|RL13_CLOTE 50S ribosomal protein L13 >gi|28204592|gb|AAO37029.1| LSU ribosomal protein L13P [Clostridium tetani E88] (144 aa)
Score = 275, Expect = 3.0e-23, Identities = 57/130 (43%), Positives = 85/130 (65%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +KWYV+DA    LG++A + A ILRGKNK  +TP+VD GDY++IIN++K+VL+  K D++    HS Y GGLKE   +  + K  + +   A++ MLPK  L R ++KKL +Y+ + H   AQ P  ++L
  S:    13 RKWYVVDAEGKPLGRVASQVALILRGKNKPTYTPHVDTGDYVVIINAEKVVLTGKKLDQKMLRHHSLYPGGLKEVPYKEALAKKPEFVFEEAVRRMLPKGPLGRKMLKKLKVYRGSEHNNEAQNPEVLEL 142
>gi|116620036|ref|YP_822192.1| 50S ribosomal protein L13 [Solibacter usitatus Ellin6076] >gi|122255563|sp|Q02AK9|RL13_SOLUE 50S ribosomal protein L13 >gi|116223198|gb|ABJ81907.1| LSU ribosomal protein L13P [Solibacter usitatus Ellin6076] (143 aa)
Score = 275, Expect = 3.0e-23, Identities = 56/131 (42%), Positives = 91/131 (69%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTH-SGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           N++W+VIDA N++LGKLA  AA IL GK+K  +TP +D GD++++IN++K+ ++  K + +K Y H +GY GGL EKS + +  +   +++  AI GMLPKN L + + +KL +Y  + H  AAQ+P+ + +
  S:    12 NREWHVIDAENVVLGKLASRAAMILMGKHKPTYTPFIDAGDHVVVINAEKVKVTGRK-EEDKLYRHFTGYPGGLVEKSLKRVRAEKPTRIVEDAIAGMLPKNKLGKQMYRKLNVYAGSKHPHAAQQPVALTV 142
>gi|84686849|ref|ZP_01014733.1| 50S ribosomal protein L13 [Rhodobacterales bacterium HTCC2654] >gi|84665046|gb|EAQ11526.1| 50S ribosomal protein L13 [Rhodobacterales bacterium HTCC2654] (154 aa)
Score = 275, Expect = 3.3e-23, Identities = 56/126 (44%), Positives = 84/126 (66%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW VIDA  ++LG+LA   A  LRGK+K  FTP++DCGD +I+IN+DK+ L+  K   +  Y H+G+ GG+K ++ G+++  +Y ++L+  A+K MLP N LSR  +  L +Y  A H   AQ P
  S:    12 DKKWVVIDAEGVVLGRLASIIAMRLRGKHKPSFTPHMDCGDNVIVINADKVQLTGKKRADKIHYWHTGFPGGIKNRTAGQILEGEYPERLLTLAVKRMLPGNRLSRQQMTNLRVYAGAEHPHEAQSP 138
>gi|86152993|ref|ZP_01071198.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843878|gb|EAQ61088.1| ribosomal protein L13 [Campylobacter jejuni subsp. jejuni HB93-13] (141 aa)
Score = 275, Expect = 3.4e-23, Identities = 59/123 (47%), Positives = 81/123 (65%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLS-SDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           ++W V+DA     G+L  E A ILRGKNK  FTPNVDCGDY+IIIN+ K V + ++KA+ + ++ HSGY G +K +    ++EK   KL   A++GMLPK  L R ++KKL IY  + H   AQ
  S:    12 REWIVLDAEGKRFGRLLTEVATILRGKNKPCFTPNVDCGDYVIIINASKAVFTGANKAEDKLYHRHSGYFGSVKSEKFGDLLEKNPAKLYKLAVRGMLPKTNLGRAMLKKLKIYAGSEHPHTAQ 135
>gi|91789952|ref|YP_550904.1| 50S ribosomal protein L13 [Polaromonas sp. JS666] >gi|122967363|sp|Q124N6|RL13_POLSJ 50S ribosomal protein L13 >gi|91699177|gb|ABE46006.1| LSU ribosomal protein L13P [Polaromonas sp. JS666] (142 aa)
Score = 275, Expect = 3.5e-23, Identities = 54/124 (43%), Positives = 83/124 (66%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +W+VIDA++ +LG++A E A  LRGK+K  +TP+VD GD+++IIN+ ++ ++  KA  + +Y HSGY GG+   + R M  K+  + +  A+KGMLPK  L   +IKKL +Y  A H   AQ+P
  S:    14 EWFVIDATDKVLGRVASEVALRLRGKHKAIYTPHVDTGDFIVIINAAQLRVTGAKALDKMYYRHSGYPGGITATNFRDMQAKHPGRALEKAVKGMLPKGPLGYAMIKKLKVYGGAEHPHTAQQP 137
>gi|15218435|ref|NP_177984.1| EMB1473 (EMBRYO DEFECTIVE 1473); structural constituent of ribosome [Arabidopsis thaliana] >gi|75314103|sp|Q9SYL9|RK13_ARATH 50S ribosomal protein L13, chloroplast precursor (CL13) (Protein EMBRYO DEFECTIVE 1473) >gi|4836870|gb|AAD30573.1|AC007260_4 50S Ribosomal protein L13 [Arabidopsis thaliana] >gi|13878111|gb|AAK44133.1|AF370318_1 putative ribosomal protein L13 [Arabidopsis thaliana] >gi|7572938|emb|CAA60775.1| ribosomal protein L13 [Arabidopsis thaliana] >gi|17104781|gb|AAL34279.1| putative ribosomal protein L13 [Arabidopsis thaliana] (241 aa)
Score = 274, Expect = 3.7e-23, Identities = 48/131 (36%), Positives = 87/131 (66%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +K W+V+DA++ ILG+LA   AN +RGKN   +TP+VD G ++I++N++K+ +S  K +++ +  HSG  GG+  ++   + ++  ++++  A++GMLPK  L R L   L +YK  +H   AQKP+++ +
  S:   102 DKPWFVVDATDKILGRLASTIANHIRGKNLASYTPSVDMGAFVIVVNAEKVAVSGKKRNQKLYRRHSGRPGGMTVETFDQLQQRIPERIVEHAVRGMLPKGRLGRALFNHLKVYKGPDHPHEAQKPLDLPI 232
>gi|108804940|ref|YP_644877.1| 50S ribosomal protein L13 [Rubrobacter xylanophilus DSM 9941] >gi|108766183|gb|ABG05065.1| ribosomal protein L13 [Rubrobacter xylanophilus DSM 9941] (167 aa)
Score = 274, Expect = 3.8e-23, Identities = 56/125 (44%), Positives = 88/125 (70%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KWYVIDA    LG+LA E + +LRGKNK  +TP+VD GD+++++N+DK+ ++  KA+++ +  H+GY GGL+E+S R M+ K  ++++  A++GM+PK  L+R  +KKL IY    H  A Q P
  S:    37 RKWYVIDAEGKTLGRLAAEISRLLRGKNKPQYTPHVDVGDFVVVVNADKVEVTGRKAEQKVYRWHTGYPGGLRERSYRQMLRKRPEEILRQAVRGMMPKTRLARRQLKKLRIYAGPEHPHAGQTP 161
>gi|121603413|ref|YP_980742.1| 50S ribosomal protein L13 [Polaromonas naphthalenivorans CJ2] >gi|166231008|sp|A1VJJ3|RL13_POLNA 50S ribosomal protein L13 >gi|120592382|gb|ABM35821.1| LSU ribosomal protein L13P [Polaromonas naphthalenivorans CJ2] (147 aa)
Score = 274, Expect = 4.1e-23, Identities = 53/124 (42%), Positives = 83/124 (66%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +W+VIDA++ +LG++A E A  LRGK+K  +TP+VD GD+++IIN+ ++ ++  K+  + +Y HSGY GG+   + R M  K+  + +  A+KGMLPK  L   +IKKL +Y  A H   AQ+P
  S:    14 EWFVIDATDKVLGRVASEVALRLRGKHKAIYTPHVDTGDFIVIINAAQLRVTGAKSTDKIYYRHSGYPGGITATNFRDMQTKFPGRALEKAVKGMLPKGPLGYAMIKKLKVYGGAEHPHTAQQP 137
>gi|86140804|ref|ZP_01059363.1| 50S ribosomal protein L13 [Flavobacterium sp. MED217] >gi|85832746|gb|EAQ51195.1| 50S ribosomal protein L13 [Leeuwenhoekiella blandensis MED217] (151 aa)
Score = 274, Expect = 4.2e-23, Identities = 55/132 (41%), Positives = 83/132 (62%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           NK+W V+DA    LG+++   A +LRGK K ++TP+VDCGD +++IN+ KI L+  K D + +  H+GY GG +  + + +  K   +L+  A+KGMLPKN L   + + L +Y  A H Q AQKP  I +N
  S:    17 NKEWVVVDAEGQTLGRMSTIVAKLLRGKYKPNYTPHVDCGDNVVVINASKINLTGKKWDAKSYIRHTGYPGGQRSLTAKELYSKDPARLVENAVKGMLPKNKLGSAIYRNLKVYAGAEHGQEAQKPKAININ 148
>gi|28198658|ref|NP_778972.1| 50S ribosomal protein L13 [Xylella fastidiosa Temecula1] >gi|71274700|ref|ZP_00650988.1| Ribosomal protein L13, bacterial and organelle form [Xylella fastidiosa Dixon] >gi|71900672|ref|ZP_00682796.1| Ribosomal protein L13, bacterial and organelle form [Xylella fastidiosa Ann-1] >gi|170730059|ref|YP_001775492.1| 50S ribosomal protein L13 [Xylella fastidiosa M12] >gi|182681342|ref|YP_001829502.1| ribosomal protein L13 [Xylella fastidiosa M23] >gi|81725020|sp|Q87DD3|RL13_XYLFT 50S ribosomal protein L13 >gi|28056749|gb|AAO28621.1| 50S ribosomal protein L13 [Xylella fastidiosa Temecula1] >gi|71164432|gb|EAO14146.1| Ribosomal protein L13, bacterial and organelle form [Xylella fastidiosa Dixon] >gi|71729551|gb|EAO31658.1| Ribosomal protein L13, bacterial and organelle form [Xylella fastidiosa Ann-1] >gi|167964852|gb|ACA11862.1| 50S ribosomal protein L13 [Xylella fastidiosa M12] >gi|182631452|gb|ACB92228.1| ribosomal protein L13 [Xylella fastidiosa M23] (142 aa)
Score = 274, Expect = 4.4e-23, Identities = 55/137 (40%), Positives = 88/137 (64%)
  Q:     4 TTFV-KNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TTF  KNE     + WY++DA    LG+LA E A  L GK K  +TP+VD GDYL++IN++K+V++  K   + ++  +GY+G LK +S    ++++ ++++  A+KGMLPK  L R + +KL +Y  + H   AQ+P
  S:     2 TTFTAKNETV--QRDWYLVDAEGKTLGRLATELARRLLGKTKPVYTPHVDTGDYLVVINAEKVVVTGKKLTDKYYHRFTGYVGNLKSESLGQALQRHPERVLEIAVKGMLPKGPLGRAMYRKLKVYTGSKHPHTAQQP 137
>gi|39938624|ref|NP_950390.1| 50S ribosomal protein L13 [Onion yellows phytoplasma OY-M] >gi|39721733|dbj|BAD04223.1| ribosomal protein L13 [Onion yellows phytoplasma OY-M] (152 aa)
Score = 273, Expect = 4.7e-23, Identities = 55/133 (41%), Positives = 88/133 (66%)
  Q:    13 LANK-----KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +ANK     KW+++DA    LG+LA + A+IL+GK+K  +TP+VD GDY+I++N+  I L+  K  ++ +Y HSGY GGL +     M+ K+  +++  AI GM+P   L   + KKLF+Y + NH   AQ+P  +++
  S:    15 MANKTTVKPKWHLVDAKGKTLGRLATKVASILKGKHKTHYTPHVDNGDYVIVVNAAYIHLTGKKWQQKTYYKHSGYPGGLTKVVASEMMRKFPTRMVEKAILGMVPHTKLGSQIGKKLFVYAEQNHNHQAQQPESLEV 152
>gi|55981434|ref|YP_144731.1| 50S ribosomal protein L13 [Thermus thermophilus HB8] >gi|161611243|ref|YP_005070.2| 50S ribosomal protein L13 [Thermus thermophilus HB27] >gi|62297581|sp|P60488|RL13_THET8 50S ribosomal protein L13 >gi|118573461|sp|Q72IN1|RL13_THET2 50S ribosomal protein L13 >gi|116668245|pdb|2J01|N Chain N, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. >gi|116668306|pdb|2J03|N Chain N, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4). This File Contains The 50s Subunit From Molecule Ii. >gi|119389743|pdb|2HGJ|M Chain M, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. >gi|119389800|pdb|2HGQ|M Chain M, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgp. >gi|119389856|pdb|2HGU|M Chain M, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgr. >gi|157836528|pdb|2V47|N Chain N, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 2 Of 4). This File Contains The 50s Subunit For Molecule 1. >gi|157836584|pdb|2V49|N Chain N, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 4 Of 4). This File Contains The 50s Subunit Of Molecule 2. >gi|55772847|dbj|BAD71288.1| 50S ribosomal protein L13 [Thermus thermophilus HB8] (140 aa)
Score = 273, Expect = 5.0e-23, Identities = 50/129 (38%), Positives = 87/129 (67%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +W +IDA    LG+LA + A +LRGK++ D+TPNV  GD+++++N+DKI ++  K +++ +  +SGY GGLK+     M+  + ++++  A+KGMLPK  L R L K+L +Y   +H   AQ+P ++++
  S:    12 RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
>gi|116513571|ref|YP_812477.1| 50S ribosomal protein L13 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092886|gb|ABJ58039.1| LSU ribosomal protein L13P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (130 aa)
Score = 273, Expect = 5.0e-23, Identities = 59/127 (46%), Positives = 82/127 (64%)
  Q:    20 VIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           +IDA+++ LG+L+   A ILRGKNK  FTPNVD GD +II+N+ K+ L+  KA  + +Y HS Y GGLK  S   ++ K   KL+  ++KGMLPKNTL      K+ +Y    HK  AQKP ++ +N
  S:     1 MIDATDVSLGRLSTAVATILRGKNKPQFTPNVDTGDNVIIVNASKLKLTGKKATDKIYYHHSEYRGGLKSVSAGELLAKNPVKLVELSVKGMLPKNTLGHQEFLKMHVYAGEEHKHEAQKPEKLDIN 127
>gi|154175256|ref|YP_001407582.1| 50S ribosomal protein L13 [Campylobacter curvus 525.92] >gi|112803841|gb|EAU01185.1| ribosomal protein L13 [Campylobacter curvus 525.92] (142 aa)
Score = 273, Expect = 5.0e-23, Identities = 62/123 (50%), Positives = 84/123 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLS-SDKADREKWYTHSGYIGGLK-EKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           ++W V+DAS    G+L  E A ILRGKNK  FTPNVDCGDY+IIIN+ K+  + ++KA+ + ++ HSGY G +K EK G L+  K  +KL   A++GMLPK  L R +IKKL +Y  + H   AQ
  S:    12 REWIVLDASGKRFGRLLTEVATILRGKNKPCFTPNVDCGDYVIIINASKVEFTGNNKAEDKLYHRHSGYFGSVKSEKFGDLIANK-PEKLFKLAVRGMLPKTKLGREMIKKLKVYAGSEHPHTAQ 135
>gi|29349283|ref|NP_812786.1| 50S ribosomal protein L13 [Bacteroides thetaiotaomicron VPI-5482] >gi|29341191|gb|AAO78980.1| 50S ribosomal protein L13 [Bacteroides thetaiotaomicron VPI-5482] (153 aa)
Score = 273, Expect = 5.4e-23, Identities = 56/135 (41%), Positives = 89/135 (65%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYS--DKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           A   K+W ++DA++  LG+L  + A +LRGK K +FTP+VDCGD +IIIN+DK+ L+ +K +   + +++GY GG +E +   +I K +  ++L+   +KGMLPKN L   L+  L++Y  + HK  AQ P  I +N
  S:    14 ATVTKEWVIVDATDQTLGRLGAKVAKLLRGKYKPNFTPHVDCGDNVIIINADKVKLTGNKWNDRVYLSYTGYPGGQREMTPARLITKPNGEERLLKKVVKGMLPKNILGAKLLGNLYVYAGSEHKHEAQSPKMIDIN 150
>gi|110679842|ref|YP_682849.1| 50S ribosomal protein L13 [Roseobacter denitrificans OCh 114] >gi|118573440|sp|Q166D0|RL13_ROSDO 50S ribosomal protein L13 >gi|109455958|gb|ABG32163.1| ribosomal protein L13 [Roseobacter denitrificans OCh 114] (153 aa)
Score = 273, Expect = 5.4e-23, Identities = 54/126 (42%), Positives = 85/126 (67%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++DCGD ++IIN+DK+ L+  K + E  Y H+G+ GG+K ++   ++E K+ ++++  A+K MLP N LSR ++  L +Y  + H   AQ P
  S:    12 DKKWILIDAEGVVLGRLASIVATRLRGKHKPSFTPHMDCGDNVVIINADKVQLTGKKRE-ESHYWHTGHPGGIKSRTKAQILEGKHPERIVTLAVKRMLPGNRLSRQIMTNLRVYAGSEHPHEAQSP 137
>gi|83814640|ref|YP_444193.1| 50S ribosomal protein L13 [Salinibacter ruber DSM 13855] >gi|83756034|gb|ABC44147.1| ribosomal protein L13 [Salinibacter ruber DSM 13855] (156 aa)
Score = 273, Expect = 5.7e-23, Identities = 51/125 (40%), Positives = 78/125 (62%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + WYV+DA+N ++G+LA + A +LRGK+K  FTP+VD GDY+I++N+DK   +  K  +++++ +SGY GG    S   M       +I  A++GMLP   L R   KKL +Y   +H   AQ+P
  S:    26 RDWYVVDATNQVVGRLASQIARVLRGKHKPTFTPHVDTGDYVIVVNADKARFTGKKEKQKEYHEYSGYPGGDHSHSPEEMRADKPTYIIREAVEGMLPTGPLGRDTFKKLKVYAGPDHPHEAQQP 150
>gi|77463587|ref|YP_353091.1| 50S ribosomal protein L13 [Rhodobacter sphaeroides 2.4.1] >gi|126462419|ref|YP_001043533.1| 50S ribosomal protein L13 [Rhodobacter sphaeroides ATCC 17029] >gi|123591791|sp|Q3J1Z4|RL13_RHOS4 50S ribosomal protein L13 >gi|166199607|sp|A3PK95|RL13_RHOS1 50S ribosomal protein L13 >gi|77388005|gb|ABA79190.1| LSU ribosomal protein L13P [Rhodobacter sphaeroides 2.4.1] >gi|126104083|gb|ABN76761.1| LSU ribosomal protein L13P [Rhodobacter sphaeroides ATCC 17029] (154 aa)
Score = 272, Expect = 6.4e-23, Identities = 53/136 (38%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF    A +  KKW +IDA  ++LG+LA   ANILRGKNK  FTP++D GD +I+IN+DK+ ++ +K   +++Y H+G+ GG+K ++   ++E  + ++++  A++ M+ +N+L R  +  L +Y  A H   AQ+P
  S:     3 TFTATPADI-EKKWILIDAEGVVLGRLATIVANILRGKNKPTFTPHMDMGDNVIVINADKVQMTGNKRADKRYYWHTGHPGGVKFRTAEQVLEGAHPERVVLKAVERMISRNSLGRQQMTNLRVYAGAEHPHEAQQP 138
>gi|32476450|ref|NP_869444.1| 50S ribosomal protein L13 [Rhodopirellula baltica SH 1] >gi|32446995|emb|CAD78901.1| 50S ribosomal protein L13 [Rhodopirellula baltica SH 1] (151 aa)
Score = 272, Expect = 6.4e-23, Identities = 56/128 (43%), Positives = 91/128 (71%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYT-HSGYIGGLKEKSGRLMIEKYSDK-------LIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           K+W+V+DAS+ +LG+LA + A +L GK++ ++TP+VDCGD++I+ N+DKI ++ +K  R++ YT ++GY G        L +E Y D+       L+Y A++ MLPKN L+R ++ KL IY    H   AQ+P+E+
  S:    16 KQWHVVDASDEVLGRLASDIAVVLMGKHRPEYTPHVDCGDFVIVTNADKIGMTGNKM-RDRHYTWYTGYPG--------LRLESYQDRHDRKPEYLLYHAVRRMLPKNKLARQMLSKLKIYAGPEHPHTAQQPVEL 142
>gi|77024211|gb|ABA55576.1| chloroplast 50S ribosomal protein L13 [Pavlova lutheri] (225 aa)
Score = 272, Expect = 6.4e-23, Identities = 52/129 (40%), Positives = 83/129 (64%)
  Q:    14 ANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPME 142
           ANK+W+VIDA  + LG++A E A  L GK+KV F P  + GDY+I+IN+DK+V+S  K  +++++ HSG  GG+  +S   +  +  ++++  A+KGMLPK  L R   + L ++    H  AAQ P++
  S:    67 ANKQWWVIDAEGMRLGRMATEIAKRLMGKHKVTFFPGSNMGDYVIVINADKVVISGAKFYQKEYFRHSGRPGGVTVESFEQLQARIPERIVEKAVKGMLPKGPLGREQFRHLKVFAGPEHDHAAQAPIK 195
>gi|91214953|ref|ZP_01251925.1| 50S ribosomal protein L13 [Psychroflexus torquis ATCC 700755] >gi|91186558|gb|EAS72929.1| 50S ribosomal protein L13 [Psychroflexus torquis ATCC 700755] (151 aa)
Score = 272, Expect = 6.5e-23, Identities = 52/140 (37%), Positives = 88/140 (62%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           V    + A+K+W V+DA+   LG+++   A  LRGK K  F+P+VDCGD +I++N++K+ L+  K D + +  ++GY GG +  + + + +K  ++L+  ++KGMLPKN L   L + L ++    H  +AQKP EI +N
  S:     9 VSTNKSTADKQWVVVDAAGQSLGRVSSIVAKFLRGKYKPSFSPHVDCGDNVIVVNAEKVNLTGKKWDSKNYIRYTGYPGGQRSLTAQEVFDKSPERLVEKSVKGMLPKNKLGSALFRNLRVFTGEEHSLSAQKPKEININ 148
>gi|114706904|ref|ZP_01439804.1| 50S ribosomal protein L13 [Fulvimarina pelagi HTCC2506] >gi|114537852|gb|EAU40976.1| 50S ribosomal protein L13 [Fulvimarina pelagi HTCC2506] (154 aa)
Score = 272, Expect = 7.1e-23, Identities = 57/130 (43%), Positives = 87/130 (66%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KKW +IDA  LI+G+LA   A  LRGK+K  FTP+VD GD +IIIN+DK VL+  K   + +Y H+G+ GG+KE+  R ++E ++ ++++  A++ MLP+  L R  +K L +Y  + H  AAQ+P  I +
  S:    13 KKWILIDAEGLIVGRLASLVALRLRGKHKATFTPHVDDGDNVIIINADKAVLTGKKYWNKTYYWHTGHPGGIKERKARDILEGRFPERVLEKAVERMLPRGPLGRQQLKNLRVYAGSEHPHAAQQPETIDV 143
>gi|162330299|ref|YP_001022345.2| 50S ribosomal protein L13 [Methylibium petroleiphilum PM1] (142 aa)
Score = 272, Expect = 7.4e-23, Identities = 53/134 (39%), Positives = 87/134 (64%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A    +W+VIDA++ +LG++A E A  LRGK+K  +TP+VD GD+++I+N++K+ ++ +KA  + +Y HSG+ GG+     + M  K+  + +  A+KGMLPK  L   +IKKL +Y  A H   AQ P  +++
  S:     9 AEVTHEWFVIDATDKVLGRVASEVALRLRGKHKPIYTPHVDTGDFIVIVNAEKLRVTGNKATDKVYYRHSGFPGGIYATKFKDMQAKHPGRALEKAVKGMLPKGPLGYAMIKKLKVYAGATHPHTAQSPKALEV 142
>gi|19703672|ref|NP_603234.1| 50S ribosomal protein L13 [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713792|gb|AAL94533.1| LSU ribosomal protein L13P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (144 aa)
Score = 271, Expect = 8.8e-23, Identities = 56/145 (38%), Positives = 93/145 (64%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           M+K TF++ +  +  ++W+  DA   ILG+LAVE A  L GK K+ FTP++D GDY+++ N +KIV++  K   + +Y HSG+ GG++ +    ++ K  ++L+  A+K MLPKN L R  + +L ++  A H   AQKP +++L
  S:     1 MKKYTFMQRKEDVV-REWHHYDAEGQILGRLAVEIAKKLMGKEKLTFTPHIDGGDYVVVTNVEKIVVTGKKLTDKVYYNHSGFPGGIRARKLGEILAKKPEELLMLAVKRMLPKNKLGRQQLTRLRVFAGAEHSHVAQKPNKVEL 144
>gi|116495907|ref|YP_807641.1| 50S ribosomal protein L13 [Lactobacillus casei ATCC 334] >gi|191639391|ref|YP_001988557.1| 50S ribosomal protein L13 [Lactobacillus casei] >gi|122262693|sp|Q035C3|RL13_LACC3 50S ribosomal protein L13 >gi|116106057|gb|ABJ71199.1| LSU ribosomal protein L13P [Lactobacillus casei ATCC 334] >gi|190713693|emb|CAQ67699.1| 50S ribosomal protein L13 [Lactobacillus casei BL23] (148 aa)
Score = 271, Expect = 9.5e-23, Identities = 60/138 (43%), Positives = 86/138 (62%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLP-KNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TTF+     +  +KWYV+DA+++ LG+L+   A+ILRGKNK  FTPNVD GD +IIIN+ K+ L+  KA  + +Y HS + GGLK +    ++     +L+  ++K MLP KNTL      KL +Y    H   AQKP
  S:     2 RTTFLAKPGEI-ERKWYVVDATDIPLGRLSSVVASILRGKNKPQFTPNVDTGDNVIIINASKLKLTGKKASDKIYYHHSQHPGGLKHEIAGDLLRDNPARLVEYSVKKMLPTKNTLGHQQFLKLHVYAGEEHPHLAQKP 139
>gi|29655037|ref|NP_820729.1| ribosomal protein L13 [Coxiella burnetii RSA 493] >gi|153208211|ref|ZP_01946621.1| ribosomal protein L13 [Coxiella burnetii 'MSU Goat Q177'] >gi|154705880|ref|YP_001423675.1| 50S ribosomal protein L13 [Coxiella burnetii Dugway 5J108-111] >gi|161831137|ref|YP_001597570.1| 50S ribosomal protein L13 [Coxiella burnetii RSA 331] >gi|81722509|sp|Q83AX8|RL13_COXBU 50S ribosomal protein L13 >gi|189040999|sp|A9KBY0|RL13_COXBN 50S ribosomal protein L13 >gi|189041000|sp|A9NAB1|RL13_COXBR 50S ribosomal protein L13 >gi|29542306|gb|AAO91243.1| ribosomal protein L13 [Coxiella burnetii RSA 493] >gi|120576116|gb|EAX32740.1| ribosomal protein L13 [Coxiella burnetii 'MSU Goat Q177'] >gi|154355166|gb|ABS76628.1| ribosomal protein L13 [Coxiella burnetii Dugway 5J108-111] >gi|161763004|gb|ABX78646.1| ribosomal protein L13 [Coxiella burnetii RSA 331] (142 aa)
Score = 271, Expect = 9.5e-23, Identities = 58/141 (41%), Positives = 88/141 (62%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           T++ N A   + +W +++A    LG+LA   A ILRGK+K +FTP+VD GD++++IN DK+ ++ +K   ++++ HSGY GGLK  +   +  K   +++  AIKGMLPK  L R L +KL IY    H   AQ+P  I L
  S:     3 TYMAN-AKTVSPRWLLVNAEGKTLGRLASRIAAILRGKHKAEFTPHVDAGDFVVVINVDKLKVTGNKTQDKQYHHHSGYPGGLKTINFADLQAKKPQRILELAIKGMLPKGPLGRQLYRKLKIYAGDQHPHQAQQPELIDL 142
>gi|154248264|ref|YP_001419222.1| 50S ribosomal protein L13 [Xanthobacter autotrophicus Py2] >gi|154162349|gb|ABS69565.1| ribosomal protein L13 [Xanthobacter autotrophicus Py2] (153 aa)
Score = 271, Expect = 1.0e-22, Identities = 49/130 (37%), Positives = 90/130 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KKW VIDAS L++G+LA   A  L+GK+   +TP+VDCGD ++++N++K V +  K D++ +Y H+G+ GG+KE++ + ++E ++ +++I  A++ ML +  L R ++  L +YK  +H   AQ+P+ + +
  S:    13 KKWVVIDASGLVVGRLATIIAMRLKGKHLPIYTPHVDCGDNIVVVNAEKAVFTGRKKDQKVYYHHTGFPGGIKERTAKFVLEGRFPERVIEKAVERMLARGPLGRKIMGNLRVYKGPSHPHEAQQPVALDV 143
>gi|25054991|sp|Q8K9F9|RL13_BUCAP 50S ribosomal protein L13 >gi|21623288|gb|AAM67930.1| 50S ribosomal protein L13 [Buchnera aphidicola str. Sg (Schizaphis graminum)] (142 aa)
Score = 270, Expect = 1.1e-22, Identities = 52/125 (41%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+ +DA+N ILG+ A   +  LRGK+K+++TP++D GDY+I++N+ KI+++  K   + +Y H+GYIGG+K+     ++ K   K+I  A+KGMLPK +L R + KKL ++ + NH   AQ P
  S:    13 RNWFYVDATNKILGRFASAISIRLRGKHKIEYTPHLDTGDYIIVLNASKILVTGQKKINKVYYHHTGYIGGIKQLRFEEIMLKNPAKVIEIAVKGMLPKGSLGRSMFKKLKVFSNENHDHIAQCP 137
>gi|147669127|ref|YP_001213945.1| 50S ribosomal protein L13 [Dehalococcoides sp. BAV1] >gi|189041001|sp|A5FRV8|RL13_DEHSB 50S ribosomal protein L13 >gi|146270075|gb|ABQ17067.1| LSU ribosomal protein L13P [Dehalococcoides sp. BAV1] (143 aa)
Score = 270, Expect = 1.1e-22, Identities = 52/129 (40%), Positives = 87/129 (67%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           +A+   + W+VIDAS  +LG++A EAA  L GK+K  F  N+DCGDY++I+N+ KI ++ +K D++ +Y HSG+ GG +++    +++     +I  A+KGM+P+NTL   ++ KL +Y+ A H  A+Q
  S:     7 KASDIKRDWHVIDASGRVLGEVAAEAAKYLMGKHKPMFCRNLDCGDYVVIVNAKKITVTGNKLDQKMYYRHSGFPGGFRQEKLGDLLKTKPLFVIEHAVKGMIPRNTLGAQILAKLKVYEGAEHPHASQ 135
>gi|157165604|ref|YP_001466193.1| 50S ribosomal protein L13 [Campylobacter concisus 13826] >gi|112801507|gb|EAT98851.1| ribosomal protein L13 [Campylobacter concisus 13826] (142 aa)
Score = 270, Expect = 1.2e-22, Identities = 61/123 (49%), Positives = 83/123 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLS-SDKADREKWYTHSGYIGGLK-EKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           + W V+DA+    G+L  E A ILRGKNK  FTPNVDCGDY+IIIN+ K+  + ++KA+ + ++ HSGY G +K EK G L+  K  +KL   A++GMLPK  L R +IKKL +Y  + H   AQ
  S:    12 RDWIVVDAAGKRFGRLLTEVATILRGKNKPCFTPNVDCGDYVIIINASKVEFTGNNKAEDKLYHRHSGYFGSVKSEKFGDLIANK-PEKLFKLAVRGMLPKTKLGREMIKKLKVYAGSEHPHTAQ 135
>gi|157825442|ref|YP_001493162.1| 50S ribosomal protein L13 [Rickettsia akari str. Hartford] >gi|166199609|sp|A8GMM9|RL13_RICAH 50S ribosomal protein L13 >gi|157799400|gb|ABV74654.1| 50S ribosomal protein L13 [Rickettsia akari str. Hartford] (155 aa)
Score = 270, Expect = 1.2e-22, Identities = 53/125 (42%), Positives = 91/125 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKA---DREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW+VIDA N++LG+LA   AN+LRGK+K  FTP++DCGD +IIIN++ + L+  KA   D + +Y ++G+ GG+K+ + G+++  K+ +++I  A+K M+ +N L    +  L++Y +++H   AQ+P
  S:    13 KKWWVIDAKNIVLGRLASRVANMLRGKHKPSFTPHLDCGDNIIIINAEHVKLTGKKANPRDGKIYYRYTGFPGGIKDTTAGKILSGKHPERVIKMAVKRMITRNALGAKQMSNLYVYANSDHPHMAQQP 141
>gi|99034836|ref|ZP_01314750.1| hypothetical protein Wendoof_01000426 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (152 aa)
Score = 270, Expect = 1.3e-22, Identities = 56/141 (39%), Positives = 93/141 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           KT F+K +    NKKW+VIDA  L++G+LA   A +LRGK+K ++TP++DCGD +IIIN++K+  +  K   + +Y H+GY GGLK+ +   ++  K+ +++I  A+K ML    ++R   + L++Y  + HK   Q+P +I
  S:     2 KTFFLKEKQI--NKKWFVIDAEGLVVGRLAAFVATLLRGKHKPEYTPHMDCGDNVIIINAEKVHFTGKKLKDKIYYKHTGYSGGLKKTTPDNILNGKFPERVIEMAVKRMLDDGPMARRRFENLYVYSGSEHKHQGQQPEKI 141
>gi|146278212|ref|YP_001168371.1| 50S ribosomal protein L13 [Rhodobacter sphaeroides ATCC 17025] >gi|166199608|sp|A4WUK2|RL13_RHOS5 50S ribosomal protein L13 >gi|145556453|gb|ABP71066.1| LSU ribosomal protein L13P [Rhodobacter sphaeroides ATCC 17025] (154 aa)
Score = 270, Expect = 1.3e-22, Identities = 53/136 (38%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF    A +  KKW +IDA  ++LG+LA   ANILRGKNK  FTP++D GD +IIIN+DK+ ++ +K   +++Y H+G+ GG+K ++   +++  + ++++  A++ M+ +N+L R  +  L +Y  A H   AQ+P
  S:     3 TFTATPADI-EKKWILIDAEGVVLGRLATIVANILRGKNKPTFTPHMDMGDNVIIINADKVQMTGNKRADKRYYWHTGHPGGIKFRTAAQVLDGAHPERVVIKAVERMISRNSLGRQQMTNLRVYAGAEHPHEAQQP 138
>gi|57240917|ref|ZP_00368865.1| ribosomal protein L13 [Campylobacter lari RM2100] >gi|57018536|gb|EAL55310.1| ribosomal protein L13 [Campylobacter lari RM2100] (141 aa)
Score = 270, Expect = 1.3e-22, Identities = 58/123 (47%), Positives = 81/123 (65%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLS-SDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           ++W V+DA     G+L  E A ILRGKNK  +TPNVDCGDY+IIIN+ K V + ++KA+ + ++ HSGY G +K +    ++EK   KL   A++GMLPK  L R ++KKL IY  + H   AQ
  S:    12 REWIVLDAEGKRFGRLLTEVATILRGKNKPCYTPNVDCGDYVIIINASKAVFTGANKAEDKLYHRHSGYFGSVKSEKFGDLLEKNPVKLYKLAVRGMLPKTNLGRAMLKKLKIYAGSEHPHTAQ 135
>gi|30410821|ref|NP_660719.2| 50S ribosomal protein L13 [Buchnera aphidicola str. Sg (Schizaphis graminum)] (146 aa)
Score = 270, Expect = 1.3e-22, Identities = 52/125 (41%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           + W+ +DA+N ILG+ A   +  LRGK+K+++TP++D GDY+I++N+ KI+++  K   + +Y H+GYIGG+K+     ++ K   K+I  A+KGMLPK +L R + KKL ++ + NH   AQ P
  S:    17 RNWFYVDATNKILGRFASAISIRLRGKHKIEYTPHLDTGDYIIVLNASKILVTGQKKINKVYYHHTGYIGGIKQLRFEEIMLKNPAKVIEIAVKGMLPKGSLGRSMFKKLKVFSNENHDHIAQCP 141
>gi|148261237|ref|YP_001235364.1| 50S ribosomal protein L13 [Acidiphilium cryptum JF-5] >gi|146402918|gb|ABQ31445.1| LSU ribosomal protein L13P [Acidiphilium cryptum JF-5] (158 aa)
Score = 270, Expect = 1.4e-22, Identities = 56/141 (39%), Positives = 87/141 (61%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           T V  + A   K W +IDA  L+LG+LA   AN LRGK+K  FTP+VDCGD++I++N++K+ ++  K D   +Y H+GY GG+K +S R  +E K  + +I  A++ M+ +  L R  +K L IY   +H    Q+P  + +
  S:     3 TTVSLKPADVQKDWVLIDADGLVLGRLAALIANRLRGKHKPQFTPHVDCGDHIIVVNAEKVKVTGKKMDDSVFYYHTGYPGGIKGRSIRQRLEGKNPESVIEKAVERMITRGPLQRQQMKNLHIYAGPSHPHHGQQPQALDV 144
>gi|73748347|ref|YP_307586.1| 50S ribosomal protein L13 [Dehalococcoides sp. CBDB1] >gi|123620210|sp|Q3ZZP3|RL13_DEHSC 50S ribosomal protein L13 >gi|73660063|emb|CAI82670.1| ribosomal protein L13 [Dehalococcoides sp. CBDB1] (143 aa)
Score = 269, Expect = 1.4e-22, Identities = 51/123 (41%), Positives = 84/123 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           + W+VIDAS  +LG++A EAA  L GK+K  F  N+DCGDY++I+N+ KI ++ +K D++ +Y HSG+ GG +++    +++     +I  A+KGM+P+NTL   ++ KL +Y+ A H  A+Q
  S:    13 RDWHVIDASGRVLGEVAAEAAKYLMGKHKPMFCRNLDCGDYVVIVNAKKITVTGNKLDQKMYYRHSGFPGGFRQEKLGDLLKTKPLFVIEHAVKGMIPRNTLGAQILAKLKVYEGAEHPHASQ 135
>gi|126697675|ref|YP_001086572.1| 50S ribosomal protein L13 [Clostridium difficile 630] >gi|145956422|ref|ZP_01805418.1| hypothetical protein CdifQ_04000119 [Clostridium difficile QCD-32g58] >gi|168695378|ref|ZP_02727655.1| 50S ribosomal protein L13 [Clostridium difficile QCD-37x79] >gi|168707196|ref|ZP_02739473.1| 50S ribosomal protein L13 [Clostridium difficile QCD-63q42] >gi|168724500|ref|ZP_02756777.1| 50S ribosomal protein L13 [Clostridium difficile QCD-76w55] >gi|168730369|ref|ZP_02762646.1| 50S ribosomal protein L13 [Clostridium difficile QCD-97b34] >gi|196125933|ref|ZP_03117682.1| 50S ribosomal protein L13 [Clostridium difficile ATCC 43255] >gi|196162628|ref|ZP_03123189.1| 50S ribosomal protein L13 [Clostridium difficile CIP 107932] >gi|196163367|ref|ZP_03123898.1| 50S ribosomal protein L13 [Clostridium difficile QCD-23m63] >gi|118573393|sp|Q18CJ1|RL13_CLOD6 50S ribosomal protein L13 >gi|115249112|emb|CAJ66923.1| 50S ribosomal protein L13 [Clostridium difficile 630] (143 aa)
Score = 269, Expect = 1.5e-22, Identities = 60/129 (46%), Positives = 90/129 (69%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           A   +KWY++DA    LG+LA E A +LRGK+K  FTP+VD GD+++++N++KIVLS  K D++ +  H+GY+GGLKE S R M++K  +++I  A+ GMLPKN L   ++ +L ++  A H  AAQ P
  S:     9 ADVQRKWYLVDAEGKTLGRLATEIATVLRGKHKPTFTPHVDGGDFVVVVNAEKIVLSGKKLDQKYYRYHTGYVGGLKEISYRDMMDKKPEEVISHAVSGMLPKNKLRSRMMTRLRVFAGAEHTHAAQNP 137
>gi|42519980|ref|NP_965895.1| 50S ribosomal protein L13 [Wolbachia endosymbiont of Drosophila melanogaster] >gi|81700116|sp|Q73IT2|RL13_WOLPM 50S ribosomal protein L13 >gi|42409717|gb|AAS13829.1| ribosomal protein L13 [Wolbachia endosymbiont of Drosophila melanogaster] (152 aa)
Score = 269, Expect = 1.7e-22, Identities = 55/141 (39%), Positives = 93/141 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           KT F+K +    NKKW+VIDA  L++G+LA   A +LRGK+K ++TP++DCGD +IIIN++++  +  K   + +Y H+GY GGLK+ +   ++  K+ +++I  A+K ML    ++R   + L++Y  + HK   Q+P +I
  S:     2 KTFFLKEKQI--NKKWFVIDAEGLVVGRLAAFVATLLRGKHKPEYTPHMDCGDNVIIINAERVHFTGKKLKDKIYYKHTGYSGGLKKTTPDNILNGKFPERVIEMAVKRMLDDGPMARRRFENLYVYSGSEHKHQGQQPEKI 141
>gi|114570064|ref|YP_756744.1| 50S ribosomal protein L13 [Maricaulis maris MCS10] >gi|122316000|sp|Q0API1|RL13_MARMM 50S ribosomal protein L13 >gi|114340526|gb|ABI65806.1| LSU ribosomal protein L13P [Maricaulis maris MCS10] (154 aa)
Score = 268, Expect = 1.9e-22, Identities = 57/138 (41%), Positives = 91/138 (65%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNT-LSRYLIKKLFIYKDANHKQAAQKP 140
           KT  VK   A   KKW VIDA   ++G+LA   A  LRGK++ D+TP+VD GD +II+N+DK+V +  K D +++Y H+G+ GG+KE S  +++  ++ ++++  A+  MLPK++ L+R     L +Y   +HK  AQ+P
  S:     2 KTISVK--PADVEKKWVVIDAEGAVVGRLAAYVATRLRGKHRPDYTPHVDMGDNIIIVNADKVVFTGKKRDDKRYYHHTGHPGGIKETSPAKILDGRFPERVVEKAVLRMLPKDSPLARQQYSNLRVYAGPDHKHEAQQP 139
>gi|45477211|sp|Q9RXY1|RL13_DEIRA 50S ribosomal protein L13 >gi|28948927|pdb|1NKW|H Chain H, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans >gi|29726795|pdb|1NWX|H Chain H, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 >gi|29726826|pdb|1NWY|H Chain H, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Azithromycin >gi|51247380|pdb|1SM1|H Chain H, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Quinupristin And Dalfopristin >gi|61680343|pdb|1XBP|H Chain H, Inhibition Of Peptide Bond Formation By Pleuromutilins: The Structure Of The 50s Ribosomal Subunit From Deinococcus Radiodurans In Complex With Tiamulin >gi|190613496|pdb|2ZJP|G Chain G, Thiopeptide Antibiotic Nosiheptide Bound To The Large Ribosomal Subunit Of Deinococcus Radiodurans >gi|190613526|pdb|2ZJQ|G Chain G, Interaction Of L7 With L11 Induced By Microccocin Binding To The Deinococcus Radiodurans 50s Subunit >gi|190613557|pdb|2ZJR|G Chain G, Refined Native Structure Of The Large Ribosomal Subunit (50s) From Deinococcus Radiodurans >gi|190613664|pdb|3CF5|G Chain G, Thiopeptide Antibiotic Thiostrepton Bound To The Large Ribosomal Subunit Of Deinococcus Radiodurans >gi|6457840|gb|AAF09760.1|AE001879_8 ribosomal protein L13 [Deinococcus radiodurans R1] (174 aa)
Score = 268, Expect = 2.0e-22, Identities = 53/142 (37%), Positives = 88/142 (61%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIK 144
           KT   KN+     + W V+DAS + LG+LA   A+ +RGK++ DFTPN+  GD++++IN+ ++ L+  K D + +  ++GY GGLK ++ R  + K+ +++I  A+ GMLPK    R +  +L +Y    H  +AQKP  +K
  S:    30 KTYIPKND----EQNWVVVDASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDFVVVINAAQVALTGKKLDDKVYTRYTGYQGGLKTETAREALSKHPERVIEHAVFGMLPKGRQGRAMHTRLKVYAGETHPHSAQKPQVLK 167
>gi|15838138|ref|NP_298826.1| 50S ribosomal protein L13 [Xylella fastidiosa 9a5c] >gi|81788811|sp|Q9PD42|RL13_XYLFA 50S ribosomal protein L13 >gi|9106575|gb|AAF84346.1|AE003983_8 50S ribosomal protein L13 [Xylella fastidiosa 9a5c] (142 aa)
Score = 268, Expect = 2.1e-22, Identities = 55/137 (40%), Positives = 88/137 (64%)
  Q:     4 TTFV-KNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TTF  KNE     + WY++DA    LG+LA E A  L GK K  +T +VD GDYL++IN++K+V++  K   + ++  +GY+G LK +S    ++++ ++++  A+KGMLPK  L R + +KL +Y  + H  AAQ+P
  S:     2 TTFTAKNETV--QRDWYLVDAEGKTLGRLATELARRLLGKTKPVYTTHVDTGDYLVVINAEKVVVTGKKLTDKYYHRFTGYVGNLKSESLGQALQRHPERVLEIAVKGMLPKGPLGRAMYRKLKVYTGSKHPHAAQQP 137
>gi|15892238|ref|NP_359952.1| 50S ribosomal protein L13 [Rickettsia conorii str. Malish 7] >gi|34580742|ref|ZP_00142222.1| 50S ribosomal protein L13 [Rickettsia sibirica 246] >gi|81774420|sp|Q92IV5|RL13_RICCN 50S ribosomal protein L13 >gi|15619375|gb|AAL02853.1| 50S ribosomal protein L13 [Rickettsia conorii str. Malish 7] >gi|28262127|gb|EAA25631.1| 50S ribosomal protein L13 [Rickettsia sibirica 246] (155 aa)
Score = 267, Expect = 2.4e-22, Identities = 53/125 (42%), Positives = 90/125 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKA---DREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW+VIDA N++LG+LA   AN+LRGK+K  FTP++DCGD +IIIN++ + L+  KA   D + +Y ++G+ GG+K+ + G+++  K+ +++I  A+K M+ +N L    +  L++Y + +H   AQ+P
  S:    13 KKWWVIDAKNIVLGRLASRVANMLRGKHKPSFTPHLDCGDNIIIINAEHVKLTGKKANPKDGKIYYRYTGFPGGIKDTTAGKILSGKHPERVIKMAVKRMITRNALGAKQMSNLYVYANGDHPHMAQQP 141
>gi|157828191|ref|YP_001494433.1| 50S ribosomal protein L13 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932893|ref|YP_001649682.1| 50S ribosomal protein L13 [Rickettsia rickettsii str. Iowa] >gi|166199612|sp|A8GRA0|RL13_RICRS 50S ribosomal protein L13 >gi|189041017|sp|B0BWQ0|RL13_RICRO 50S ribosomal protein L13 >gi|157800672|gb|ABV75925.1| 50S ribosomal protein L13 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165907980|gb|ABY72276.1| LSU ribosomal protein L13P [Rickettsia rickettsii str. Iowa] (155 aa)
Score = 267, Expect = 2.4e-22, Identities = 53/125 (42%), Positives = 90/125 (72%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKA---DREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW+VIDA N++LG+LA   AN+LRGK+K  FTP++DCGD +IIIN++ + L+  KA   D + +Y ++G+ GG+K+ + G+++  K+ +++I  A+K M+ +N L    +  L++Y + +H   AQ+P
  S:    13 KKWWVIDAKNIVLGRLASRVANMLRGKHKPSFTPHLDCGDNIIIINAEHVNLTGKKANPKDGKIYYRYTGFPGGIKDTTAGKILSGKHPERVIKMAVKRMITRNALGAKQMSNLYVYANGDHPHMAQQP 141
>gi|50365310|ref|YP_053735.1| 50S ribosomal protein L13 [Mesoplasma florum L1] >gi|81695662|sp|Q6F0X2|RL13_MESFL 50S ribosomal protein L13 >gi|50363866|gb|AAT75851.1| 50S ribosomal protein L13 [Mesoplasma florum L1] (150 aa)
Score = 267, Expect = 2.5e-22, Identities = 55/140 (39%), Positives = 90/140 (64%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           M++TT +   A    K WY++DA+   +G+L+ E A ILRGK+KVDFTP+++ GD++IIIN++K++ +  K   + +Y HS + GGL+ ++  +  E  + K++  +I+ MLPKN   R   + L ++   NH  AAQKP
  S:     1 MKQTTLIA--AKDIKKNWYIVDAAGQNVGRLSTEVARILRGKHKVDFTPHMNNGDHVIIINAEKVLFTGKKESDKTYYHHSMHPGGLRRRTVAVQRELDATKILERSIRLMLPKNVQGRNQFRALHVFVGENHPYAAQKP 138
>gi|111115163|ref|YP_709781.1| 50S ribosomal protein L13 [Borrelia afzelii PKo] >gi|167942669|ref|ZP_02529743.1| 50S ribosomal protein L13 [Borrelia afzelii ACA-1] >gi|123341360|sp|Q0SNH3|RL13_BORAP 50S ribosomal protein L13 >gi|110890437|gb|ABH01605.1| ribosomal protein L13 [Borrelia afzelii PKo] (152 aa)
Score = 267, Expect = 2.6e-22, Identities = 56/131 (42%), Positives = 84/131 (64%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           KKWYVIDA++ +LGK+AV+   ILRGK+K  +TP+ D GD +I+IN+ K+ L+  K  ++ +Y HS Y GGL   + R + E+     +  AIKGMLPK  L R L + L ++  + H   AQ P++++ N
  S:    19 KKWYVIDAADRVLGKVAVDVVRILRGKHKAYYTPHQDLGDNVIVINASKVRLTGKKYQQKLYYRHSRYPGGLYSDTFRTLSERKPCAPLEIAIKGMLPKGPLGRGLFRNLKVFSGSEHTLKAQNPVKLEAN 149
>gi|85057862|ref|YP_456778.1| 50S ribosomal protein L13 [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789967|gb|ABC65699.1| LSU ribosomal protein L13P [Aster yellows witches'-broom phytoplasma AYWB] (152 aa)
Score = 267, Expect = 2.8e-22, Identities = 56/133 (42%), Positives = 88/133 (66%)
  Q:    13 LANKK-----WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           +ANKK     W+++DA   ILG+LA + A+IL+GK+K  +TP+VD GDY+I+IN+  I L+  K  ++ +Y HSGY GGL +     M+ K+  +++  AI GM+P   L   + KKLF+Y +  H   AQ+P  +++
  S:    15 MANKKTVKPKWHLVDAKGKILGRLATKVASILKGKHKTHYTPHVDNGDYVIVINAAYINLTGKKWQQKTYYKHSGYPGGLTKVVASEMMLKFPTRMVEKAILGMVPHTKLGSQIGKKLFVYAEQKHNHQAQQPESLEV 152
>gi|58001341|gb|AAW60235.1| LSU ribosomal protein L13P [Gluconobacter oxydans 621H] (202 aa)
Score = 267, Expect = 2.9e-22, Identities = 49/134 (36%), Positives = 88/134 (65%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A   K W +IDA  L+LG+LA   A  LRGK+K  FTP+VDCGD +++IN++K+VL+ +K  ++ ++ H+G+ GG+KE++  + +  K   +++  A++ M+ +  L R  +K L++Y  + H    QKP+++ +
  S:    55 AEVTKNWVLIDAEGLVLGRLATIIATRLRGKHKPQFTPHVDCGDNIVVINAEKVVLTGNKVGQKLFHYHTGHPGGIKERTITQRLTGKNPGEVVEKAVERMITRGPLQRAQMKHLYVYAGSEHPHDGQKPVKLDV 189
>gi|15604104|ref|NP_220619.1| 50S ribosomal protein L13 [Rickettsia prowazekii str. Madrid E] >gi|6225959|sp|Q9ZDU1|RL13_RICPR 50S ribosomal protein L13 >gi|3860796|emb|CAA14696.1| 50S RIBOSOMAL PROTEIN L13 (rplM) [Rickettsia prowazekii] (155 aa)
Score = 266, Expect = 3.5e-22, Identities = 54/125 (43%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDK---ADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW+VIDA N++LG+LA   A +LRGK+K  FTP++DCGD +IIIN++ I L+  K    D + +Y H+G+ GG+K+ + G+++  KY +++I  A+K M+ +N L    +  L++Y +  H   AQ+P
  S:    13 KKWWVIDAKNVVLGRLASRVAIMLRGKHKPSFTPHLDCGDNIIIINAEHIKLTGKKLNPKDGKVYYRHTGFPGGIKDTTAGKILSGKYPERVIKMAVKRMITRNVLGAKQMSNLYVYANCEHPHMAQQP 141
>gi|146299372|ref|YP_001193963.1| 50S ribosomal protein L13 [Flavobacterium johnsoniae UW101] >gi|146153790|gb|ABQ04644.1| LSU ribosomal protein L13P [Flavobacterium johnsoniae UW101] (151 aa)
Score = 266, Expect = 3.9e-22, Identities = 57/135 (42%), Positives = 82/135 (60%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           A   K+W V+DA    LG+LA + A ILRGK K  +TP+VDCGD +I+INS+KI L+  K + + +  H+GY GG +  + +++  K    L+  A+KGMLPKN L   L + L +   + H   AQKP  + LN
  S:    14 ATVTKEWIVVDAEGHNLGRLASKVAMILRGKYKPSYTPHVDCGDNVIVINSEKINLTGTKLNDKIYMRHTGYPGGQRTLTAKVLQSKNPALLVEKAVKGMLPKNKLGAELFRNLNVVVGSEHTHGAQKPRTVNLN 148
>gi|46447391|ref|YP_008756.1| 50S ribosomal protein L13 [Candidatus Protochlamydia amoebophila UWE25] >gi|46401032|emb|CAF24481.1| probable large subunit ribosomal protein L13 [Candidatus Protochlamydia amoebophila UWE25] (143 aa)
Score = 265, Expect = 4.4e-22, Identities = 59/145 (40%), Positives = 93/145 (64%)
  Q:     1 MQKT-TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           MQKT T  KNE  L   KW+V+DA+   LG+L  E A ILRGK+K  +T  +DCGD +I++N+DK+ ++  K  ++ ++ ++G + GL+E   R M  +  + +I  A+KGM+PK  L+R  IKKL ++    H  AAQ+P+ + +
  S:     1 MQKTFTPNKNEIKL---KWFVLDATGKTLGRLTSEIAKILRGKHKPTYTTYMDCGDGVIVVNADKVEVTGSKEAQKIYHYYTGSMSGLREIPYRTMKARKPEYIIEHAVKGMMPKTRLARQQIKKLRVFAGKEHDLAAQQPIHVNI 143
>gi|34811561|pdb|1PNU|H Chain H, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. >gi|34811614|pdb|1PNY|H Chain H, Crystal Structure Of The Wild Type Ribosome From E. Coli, 50s Subunit Of 70s Ribosome. This File, 1pny, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit Is In The Pdb File 1pnx. >gi|56966353|pdb|1VOR|K Chain K, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966406|pdb|1VOU|K Chain K, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966459|pdb|1VOW|K Chain K, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966512|pdb|1VOY|K Chain K, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966565|pdb|1VP0|K Chain K, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. (143 aa)
Score = 265, Expect = 4.5e-22, Identities = 53/142 (37%), Positives = 88/142 (61%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIK 144
           KT   KN+     + W V+DAS + LG+LA   A+ +RGK++ DFTPN+  GD++++IN+ ++ L+  K D + +  ++GY GGLK ++ R  + K+ +++I  A+ GMLPK    R +  +L +Y    H  +AQKP  +K
  S:     2 KTYIPKND----EQNWVVVDASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDFVVVINAAQVALTGKKLDDKVYTRYTGYQGGLKTETAREALSKHPERVIEHAVFGMLPKGRQGRAMHTRLKVYAGETHPHSAQKPQVLK 139
>gi|51473432|ref|YP_067189.1| 50S ribosomal protein L13 [Rickettsia typhi str. Wilmington] >gi|81692312|sp|Q68XD5|RL13_RICTY 50S ribosomal protein L13 >gi|51459744|gb|AAU03707.1| 50S ribosomal protein L13 [Rickettsia typhi str. Wilmington] (155 aa)
Score = 265, Expect = 4.9e-22, Identities = 54/125 (43%), Positives = 87/125 (69%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDK---ADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW+VIDA N++LG+LA   A +LRGK+K  FTP++DCGD +IIIN++ I L+  K    D + +Y H+G+ GG+K+ + G+++  KY +++I  A+K M+ +N L    +  L++Y +  H   AQ+P
  S:    13 KKWWVIDAKNIVLGRLASRVAIMLRGKHKPSFTPHLDCGDNIIIINAEHIKLTGKKLNHKDGKVYYRHTGFPGGIKDTTAGKILSGKYPERVIKMAVKRMITRNVLGAKQMSNLYVYANCEHPHMAQQP 141
>gi|84704914|ref|ZP_01018414.1| 50S ribosomal protein L13 [Parvularcula bermudensis HTCC2503] >gi|84689750|gb|EAQ15592.1| 50S ribosomal protein L13 [Parvularcula bermudensis HTCC2503] (160 aa)
Score = 265, Expect = 5.1e-22, Identities = 49/133 (36%), Positives = 91/133 (68%)
  Q:     8 KNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNT-LSRYLIKKLFIYKDANHKQAAQKP 140
           + + A  +KKW VIDA NL++G+LA   A  LRGK+   +TP+VD GD++I++N++K+  +  K  ++ +Y H+GY GG+K ++   ++E ++ ++++Y A++ M+PK++ L+R  +  L +Y   +H   AQ+P
  S:    10 QTKPADVDKKWVVIDAENLVVGRLASLIAMRLRGKHLPTYTPHVDDGDHVIVVNAEKVAFTGRKRTQQTYYWHTGYPGGIKSRTADKVLEGRFPERVLYKAVERMMPKDSPLARRQMTHLHVYAGPDHPHDAQQP 144
>gi|83942336|ref|ZP_00954797.1| 50S ribosomal protein L13 [Sulfitobacter sp. EE-36] >gi|83953555|ref|ZP_00962276.1| 50S ribosomal protein L13 [Sulfitobacter sp. NAS-14.1] >gi|83841500|gb|EAP80669.1| 50S ribosomal protein L13 [Sulfitobacter sp. NAS-14.1] >gi|83846429|gb|EAP84305.1| 50S ribosomal protein L13 [Sulfitobacter sp. EE-36] (153 aa)
Score = 264, Expect = 5.5e-22, Identities = 51/126 (40%), Positives = 86/126 (68%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW ++DA  ++LG+LA   A  LRGK+K  +TP++DCGD +I+IN++KI ++  K + E +Y H+G+ GG+KE++   ++E  + ++++  A+K MLP N LSR ++  L +Y  + H   AQ P
  S:    12 DKKWIIVDAEGVVLGRLASIIAMRLRGKHKPSYTPHMDCGDNVIVINAEKIQMTGKKRE-ENFYWHTGHPGGIKERTKAQILEGAHPERVVTQAVKRMLPGNRLSRQIMTNLRVYAGSEHPHEAQSP 137
>gi|57234741|ref|YP_181249.1| 50S ribosomal protein L13 [Dehalococcoides ethenogenes 195] >gi|123618892|sp|Q3Z950|RL13_DEHE1 50S ribosomal protein L13 >gi|57225189|gb|AAW40246.1| ribosomal protein L13 [Dehalococcoides ethenogenes 195] (143 aa)
Score = 264, Expect = 6.2e-22, Identities = 51/129 (39%), Positives = 86/129 (66%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           +A+   + W+VIDAS  +LG++A EAA  L GK+K  F  N+DCGDY++IIN+ K+ ++ +K D++ +Y HSG+ GG +++    +++     +I  A+KGM+P+NTL   ++ KL +Y+   H  A+Q
  S:     7 KASDIKRDWHVIDASGRVLGEVAAEAAKYLMGKHKPMFCRNLDCGDYVVIINAKKVTVTGNKLDQKIYYRHSGFPGGFRQEKLGDLLKTKPLFVIEHAVKGMIPRNTLGAQILAKLKVYEGEEHPHASQ 135
>gi|89069540|ref|ZP_01156884.1| 50S ribosomal protein L13 [Oceanicola granulosus HTCC2516] >gi|89044875|gb|EAR50965.1| 50S ribosomal protein L13 [Oceanicola granulosus HTCC2516] (153 aa)
Score = 263, Expect = 6.8e-22, Identities = 56/136 (41%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEK-SGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF    A + +KKW VIDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN+DK+ L+ +K ++  ++ H+GY GG+K + +G+++   + ++++  A+K MLP N LSR  +  L ++  A H   AQKP
  S:     3 TFTATPADI-DKKWIVIDAEGVVLGRLASIVATRLRGKHKPSFTPHMDMGDNVIVINADKVQLTGNKRNKPNYW-HTGYPGGIKSRTTGQILEGAHPERVVMQAVKRMLPGNRLSRKQMTHLRVFAGAEHGMEAQKP 137
>gi|69938736|ref|ZP_00633137.1| Ribosomal protein L13, bacterial and organelle form [Paracoccus denitrificans PD1222] >gi|119385694|ref|YP_916749.1| 50S ribosomal protein L13 [Paracoccus denitrificans PD1222] >gi|166231007|sp|A1B6A9|RL13_PARDP 50S ribosomal protein L13 >gi|119376289|gb|ABL71053.1| LSU ribosomal protein L13P [Paracoccus denitrificans PD1222] (154 aa)
Score = 263, Expect = 8.6e-22, Identities = 51/125 (40%), Positives = 85/125 (68%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW +IDA  ++LG+LA   A  LRGK+K  FTP++D GD +IIIN+DK+ ++ DK D +K+Y H+G+ GG+K ++ R ++E  + ++++  A++ M+ +N L +  +  L +Y  A H   AQ+P
  S:    13 KKWILIDAEGVVLGRLASIVAMRLRGKHKPTFTPHMDMGDNVIIINADKVQMTGDKRDAKKYYWHTGHPGGIKHRTARQVLEGAHPERVVIKAVERMISRNKLGKQQMTNLRVYAGAEHPHEAQQP 138
>gi|88864466|gb|ABD55343.1| LSU ribosomal protein L13P [Jannaschia sp. CCS1] (183 aa)
Score = 263, Expect = 8.7e-22, Identities = 52/127 (40%), Positives = 86/127 (67%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEK-SGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPM 141
           +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN+DK+ ++ +K D+  ++ H+GY GG+K + +G+++  K+ ++++  A+K MLP   LSR  +  L +Y  A H   AQ P+
  S:    31 DKKWILIDAEGVVLGRLASIIAMRLRGKHKPSFTPSMDMGDNVIVINADKVQVTGNKRDKPNYW-HTGYPGGIKSRTTGQILEGKFPERVLMQAVKRMLPGGKLSRQQMTNLRVYAGAEHPHEAQDPI 157
>gi|15594684|ref|NP_212473.1| 50S ribosomal protein L13 [Borrelia burgdorferi B31] >gi|167931664|ref|ZP_02518751.1| 50S ribosomal protein L13 [Borrelia burgdorferi 156a] >gi|167933317|ref|ZP_02520392.1| 50S ribosomal protein L13 [Borrelia burgdorferi ZS7] >gi|167944215|ref|ZP_02531289.1| 50S ribosomal protein L13 [Borrelia burgdorferi Bol26] >gi|168525941|ref|ZP_02719580.1| 50S ribosomal protein L13 [Borrelia burgdorferi 118a] >gi|168579349|ref|ZP_02723377.1| 50S ribosomal protein L13 [Borrelia burgdorferi 72a] >gi|195960235|ref|ZP_03096440.1| 50S ribosomal protein L13 [Borrelia burgdorferi 64b] >gi|3914686|sp|O51314|RL13_BORBU 50S ribosomal protein L13 >gi|2688238|gb|AAC66717.1| ribosomal protein L13 (rplM) [Borrelia burgdorferi B31] (146 aa)
Score = 262, Expect = 9.8e-22, Identities = 57/128 (44%), Positives = 82/128 (64%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           KKWYVIDA++ ILGK+AV+   ILRGK+K  +TP+ D GD +IIIN+ K+ L+  K  ++ +Y HS Y GGL   + R + E+     +  AIKGMLPK  L R L + L ++  + H   AQ P+++
  S:    19 KKWYVIDAADRILGKVAVDVVKILRGKHKAYYTPHQDLGDNVIIINASKVKLTGKKYQQKLYYRHSRYPGGLYSDTFRTLSERKPCAPLEIAIKGMLPKGPLGRNLFRNLKVFSGSEHTLKAQNPIKL 146
>gi|114766411|ref|ZP_01445380.1| 50S ribosomal protein L13 [Roseovarius sp. HTCC2601] >gi|114541352|gb|EAU44400.1| 50S ribosomal protein L13 [Roseovarius sp. HTCC2601] (152 aa)
Score = 262, Expect = 1.0e-21, Identities = 54/125 (43%), Positives = 83/125 (66%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW VIDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN+DK+ ++  K + E +Y H+G+ GG+K ++   ++E  + +++++ A+K MLP N LSR  +  L IY  A H   AQ P
  S:    13 KKWIVIDAEGVVLGRLASIVAMRLRGKHKATFTPHMDMGDNVIVINADKVQMTGKKRE-ENFYWHTGHPGGIKSRTKAQILEGAHPERVVFQAVKRMLPGNRLSRAQLTNLRIYAGAEHPHEAQAP 137
>gi|114797444|ref|YP_761011.1| 50S ribosomal protein L13 [Hyphomonas neptunium ATCC 15444] >gi|114737618|gb|ABI75743.1| ribosomal protein L13 [Hyphomonas neptunium ATCC 15444] (154 aa)
Score = 262, Expect = 1.1e-21, Identities = 50/123 (40%), Positives = 84/123 (68%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPK-NTLSRYLIKKLFIYKDANHKQAAQKP 140
           W VIDA+ +++G+LA   A  LRGK++ DFTP+VD GD++++IN++K V + +K + + +Y H+GY GG+K  + G+++  ++ ++ I  A+K M+P+ +TLSR    KL +Y    H   AQ P
  S:    14 WVVIDATGVVVGRLASYVAKRLRGKHRPDFTPHVDTGDHIVVINAEKAVFTGNKLEDKVYYRHTGYPGGIKSTTAGKILSGRFPERAIEMAVKRMMPRESTLSRKQFGKLRVYAGTEHPHTAQAP 138
>gi|146341146|ref|YP_001206194.1| 50S ribosomal protein L13 [Bradyrhizobium sp. ORS278] >gi|148255942|ref|YP_001240527.1| 50S ribosomal protein L13 [Bradyrhizobium sp. BTAi1] >gi|166230964|sp|A5EKC7|RL13_BRASB 50S ribosomal protein L13 >gi|166230965|sp|A4YVP3|RL13_BRASO 50S ribosomal protein L13 >gi|146193952|emb|CAL77969.1| 50S ribosomal subunit protein L13 [Bradyrhizobium sp. ORS278] >gi|146408115|gb|ABQ36621.1| LSU ribosomal protein L13P [Bradyrhizobium sp. BTAi1] (154 aa)
Score = 262, Expect = 1.1e-21, Identities = 52/135 (38%), Positives = 88/135 (65%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI---KLN 146
           A   KKW VIDA  L++G+LA   A  LRGK+   +TP+VDCGD +II+N+   V +  K +++ +Y H+G++G +KE++ R ++E ++ ++++  A++ M+P+  L R  +  L +Y   +H   AQ P +I   KLN
  S:     9 AEVQKKWVVIDAKGLVVGRLATLVAMRLRGKHLPIYTPHVDCGDNVIIVNAKHAVFTGRKREQKTYYKHTGFVGHVKERTARQILEGRFPERVLEKAVERMIPRGPLGRVQMGNLRVYGGPDHPHEAQNPEKIDIAKLN 147
>gi|56696573|ref|YP_166930.1| 50S ribosomal protein L13 [Silicibacter pomeroyi DSS-3] >gi|81676289|sp|Q5LSS5|RL13_SILPO 50S ribosomal protein L13 >gi|56678310|gb|AAV94976.1| ribosomal protein L13 [Silicibacter pomeroyi DSS-3] (152 aa)
Score = 261, Expect = 1.2e-21, Identities = 53/126 (42%), Positives = 84/126 (66%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN+DK+ ++  K + E +Y H+G+ GG+K ++ + ++E  + ++++Y A+K MLP N LSR  +  L IY    H   AQ P
  S:    12 DKKWILIDAEGVVLGRLASIVAMRLRGKHKASFTPHMDMGDNVIVINADKVQITGKKRE-EHFYWHTGHPGGIKSRTKQQILEGAHPERVVYQAVKRMLPGNRLSRQQMTNLRIYAGTEHPHEAQAP 137
>gi|83952140|ref|ZP_00960872.1| 50S ribosomal protein L13 [Roseovarius nubinhibens ISM] >gi|83837146|gb|EAP76443.1| 50S ribosomal protein L13 [Roseovarius nubinhibens ISM] (153 aa)
Score = 261, Expect = 1.4e-21, Identities = 51/126 (40%), Positives = 84/126 (66%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEK-SGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++DCGD +I+IN+DK+ L+ +K ++  ++ H+G+ GG+K + +G ++   + ++++  A+K MLP N LSR  +  L +Y    H   AQ P
  S:    12 DKKWILIDAEGVVLGRLASIIAMRLRGKHKATFTPHMDCGDNVIVINADKVQLTGNKREKPNYW-HTGHPGGIKSRTTGEILEGAHPERVVMQAVKRMLPGNRLSRQQMTNLRVYAGTEHPHEAQSP 137
>gi|86138382|ref|ZP_01056956.1| 50S ribosomal protein L13 [Roseobacter sp. MED193] >gi|85824907|gb|EAQ45108.1| 50S ribosomal protein L13 [Roseobacter sp. MED193] (152 aa)
Score = 261, Expect = 1.4e-21, Identities = 54/126 (42%), Positives = 85/126 (67%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN++KI ++  K + E +Y H+G+ GG+K ++ + ++E K+ ++++Y A+K MLP N LSR  +  L IY    H   AQ P
  S:    12 DKKWIIIDAEGVVLGRLASIIAMRLRGKHKATFTPHMDMGDNVIVINAEKIQMTGKKRE-EHFYWHTGHPGGIKSRTKQEILEGKHPERVVYQAVKRMLPGNRLSRQQMTNLRIYAGTEHGHEAQAP 137
>gi|85709837|ref|ZP_01040902.1| ribosomal protein L13 [Erythrobacter sp. NAP1] >gi|85688547|gb|EAQ28551.1| ribosomal protein L13 [Erythrobacter sp. NAP1] (149 aa)
Score = 260, Expect = 1.6e-21, Identities = 49/122 (40%), Positives = 82/122 (67%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           A   KKW++IDA  L++G+LA   AN LRGK+K  +TP+VDCGD++I+IN DK+  +  KA  + +Y H+G+ GG+KE +   ++E ++ ++++  A++ M+P+  L R  +K L +Y    H
  S:    14 AEVEKKWHLIDADGLVVGRLASIIANHLRGKHKPSYTPHVDCGDHVIVINVDKVKFTGKKATDKVYYKHTGHPGGIKETTPAKVLEGRFPERVLEKAVERMIPRGPLGRAQMKALHLYTGTEH 136
>gi|114771077|ref|ZP_01448517.1| 50S ribosomal protein L13 [alpha proteobacterium HTCC2255] >gi|114548359|gb|EAU51245.1| 50S ribosomal protein L13 [alpha proteobacterium HTCC2255] (155 aa)
Score = 260, Expect = 1.9e-21, Identities = 52/126 (41%), Positives = 85/126 (67%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW++IDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN++K+ L+  K   +  Y H+G+ GG+K+++ G+++  K+ ++L+  A++ MLP   LSR  ++ L IY  A H   AQ P
  S:    12 DKKWFIIDAEGVVLGRLASIIAMRLRGKHKPTFTPSMDMGDNVIVINAEKVQLTGKKRSDKIHYWHTGHPGGIKQRTAGQILEGKFPERLLEKAVQRMLPGGPLSREQMRNLRIYAGAEHPHEAQNP 138
>gi|51598597|ref|YP_072785.1| 50S ribosomal protein L13 [Borrelia garinii PBi] >gi|81691568|sp|Q661S8|RL13_BORGA 50S ribosomal protein L13 >gi|51573168|gb|AAU07193.1| ribosomal protein L13 [Borrelia garinii PBi] (154 aa)
Score = 260, Expect = 1.9e-21, Identities = 55/131 (41%), Positives = 84/131 (64%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKLN 146
           KKWY+IDA++ +LGK+AV+   ILRGK+K  +TP+ D GD +IIIN+ K+ L+  K  ++ +Y HS Y GGL   + + + E+     +  AIKGMLPK  L R L + L ++  + H   AQ P++++ N
  S:    19 KKWYLIDAADRVLGKVAVDVVRILRGKHKAYYTPHQDLGDNVIIINASKVRLTGKKHQQKLYYRHSRYPGGLYSDTFKTLSERKPCAPLEIAIKGMLPKGPLGRDLFRNLKVFSGSEHTLKAQNPIKLEAN 149
>gi|66880496|ref|ZP_00405477.1| COG0102: Ribosomal protein L13 [Mycoplasma genitalium G-37] (94 aa)
Score = 258, Expect = 2.7e-21, Identities = 49/77 (63%), Positives = 65/77 (84%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKW 77
           MQKT+ +  E A+ N+KWY++DAS L+LGKLAV+AAN++RGKNK +FTPN DCGD+LIIINSD++VL+ +K D E W
  S:    18 MQKTSMLTKEEAIKNRKWYLVDASGLVLGKLAVKAANLIRGKNKANFTPNQDCGDHLIIINSDQVVLTGNKKDNEFW 94
>gi|99081226|ref|YP_613380.1| 50S ribosomal protein L13 [Silicibacter sp. TM1040] >gi|118573452|sp|Q1GGU8|RL13_SILST 50S ribosomal protein L13 >gi|99037506|gb|ABF64118.1| LSU ribosomal protein L13P [Silicibacter sp. TM1040] (152 aa)
Score = 258, Expect = 2.8e-21, Identities = 53/126 (42%), Positives = 84/126 (66%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN++KI ++  K + E +Y H+G+ GG+K ++ + ++E  + ++++  A+K MLP N LSR  +  L IY  A H   AQ P
  S:    12 DKKWIIIDAEGVVLGRLASIVATRLRGKHKPSFTPHMDMGDNVIVINAEKIQMTGKKRE-ENFYWHTGHPGGIKSRTKQQILEGAHPERVVMQAVKRMLPGNRLSRQQMTNLRIYAGAEHPHEAQSP 137
>gi|84516153|ref|ZP_01003513.1| 50S ribosomal protein L13 [Loktanella vestfoldensis SKA53] >gi|84509849|gb|EAQ06306.1| 50S ribosomal protein L13 [Loktanella vestfoldensis SKA53] (153 aa)
Score = 258, Expect = 3.0e-21, Identities = 58/136 (42%), Positives = 90/136 (66%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           TF    A + +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN++KI ++ +K D E++Y H+G+ GG+K K+   ++E K+ +++I  A++ MLP   LSR  +  L I+  A H   AQKP
  S:     3 TFTATPADI-DKKWILIDAEGVVLGRLASIIAMRLRGKHKPSFTPHMDMGDNVIVINAEKIQMTGNKRD-ERYYWHTGHPGGIKSKTKAEILEGKHPERVIEKAVQRMLPGGKLSRQQMTHLRIFAGAEHGMEAQKP 137
>gi|58584831|ref|YP_198404.1| 50S ribosomal protein L13 [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75507958|sp|Q5GS62|RL13_WOLTR 50S ribosomal protein L13 >gi|58419147|gb|AAW71162.1| Ribosomal protein L13 [Wolbachia endosymbiont strain TRS of Brugia malayi] (152 aa)
Score = 257, Expect = 3.4e-21, Identities = 54/141 (38%), Positives = 90/141 (63%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           KT F+K      +KKW+VI+A  L++G+LA   A +LRGK+K ++TP++DCGD +IIIN++K+  +  K   + +Y H+GY GGLK+ +   ++  K+ +++I  A+K ML    ++R     L++Y    HK   Q+P +I
  S:     2 KTFFLKE--GQIDKKWFVINAEGLVVGRLAAFVATLLRGKHKPEYTPHMDCGDNIIIINAEKVHFTGKKFKEKVYYKHTGYPGGLKKTTPNNVLNGKFPERVIKMAVKRMLDDGPMARKRFGNLYVYSGPEHKHQGQQPKKI 141
>gi|118475549|ref|YP_891589.1| 50S ribosomal protein L13 [Campylobacter fetus subsp. fetus 82-40] >gi|118414775|gb|ABK83195.1| ribosomal protein L13 [Campylobacter fetus subsp. fetus 82-40] (141 aa)
Score = 257, Expect = 4.2e-21, Identities = 60/129 (46%), Positives = 84/129 (65%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLS-SDKADREKWYTHSGYIGGLK-EKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIK 144
           + W V+DA+    G+L  EAA  LRGK+K  FTPNVDCGDY+IIIN+ K   + ++KA+ + ++ HSGY G +K EK G L++ K  +KL   A++GMLPK  L + ++KKL +Y    H   AQ   E K
  S:    12 RDWIVLDAAGKRFGRLLTEAATYLRGKHKPGFTPNVDCGDYVIIINASKAEFTGANKAEAKLYHRHSGYFGSVKSEKFGDLLVNK-PEKLYKLAVRGMLPKTKLGKEMLKKLKVYAGNEHPHTAQIAKEGK 141
>gi|85702779|ref|ZP_01033883.1| 50S ribosomal protein L13 [Roseovarius sp. 217] >gi|85671707|gb|EAQ26564.1| 50S ribosomal protein L13 [Roseovarius sp. 217] (154 aa)
Score = 255, Expect = 7.2e-21, Identities = 51/126 (40%), Positives = 83/126 (65%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEK-SGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +KKW +IDA  ++LG+LA   A  LRGK+K  FTP++D GD +I+IN++K+ L+ +K  +  ++ H+G+ GG+K + +G ++  KY ++++  A+K MLP N LSR  +  L +Y    H   AQ P
  S:    12 DKKWILIDAEGVVLGRLASIIAMRLRGKHKASFTPHMDMGDNVIVINAEKVQLTGNKRSKPNYW-HTGHPGGIKSRTTGEILEGKYPERVVMQAVKRMLPGNRLSRTQMTNLRVYAGGEHPHEAQSP 137
>gi|37523987|ref|NP_927364.1| 50S ribosomal protein L13 [Gloeobacter violaceus PCC 7421] >gi|35214993|dbj|BAC92359.1| 50S ribosomal protein L13 [Gloeobacter violaceus PCC 7421] (152 aa)
Score = 252, Expect = 1.5e-20, Identities = 46/125 (36%), Positives = 81/125 (64%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           ++W V+DA+   LG+LA   AN++RGK++ +FTP++D GD++I++N++K+ ++  K+ ++ +   SG  GG+K ++   +  +  ++++  AI GMLP   L R    KL +YK   H  AAQKP
  S:    15 RRWLVVDAAGQHLGRLASVVANLIRGKHRPNFTPHLDTGDFVIVVNAEKVEVTGKKSSQKLYRRSSGRPGGMKVETFSHLQARLPERIVEKAIWGMLPHTRLGRQQFTKLKVYKGPAHPHAAQKP 139
>gi|78776293|ref|YP_392608.1| 50S ribosomal protein L13 [Sulfurimonas denitrificans DSM 1251] >gi|78496833|gb|ABB43373.1| LSU ribosomal protein L13P [Sulfurimonas denitrificans DSM 1251] (140 aa)
Score = 251, Expect = 1.7e-20, Identities = 52/124 (41%), Positives = 78/124 (62%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSS-DKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQ 138
           ++KW +IDA     G++  E A +LRGKNK  FTPN+DCGDY++++N+ K   +   K   ++++++SGY G +K      ++EK  +KL   A +GMLPK  L   +IKKL IY  A H  +AQ
  S:    13 DQKWVLIDAEGKTFGRIITEVATLLRGKNKPCFTPNIDCGDYVVVVNASKAKFNGLGKIANKEYFSYSGYFGSVKSTKMTELLEKNPEKLYKLATRGMLPKTKLGAKMIKKLKIYASAEHPHSAQ 137
>gi|88608735|ref|YP_506708.1| 50S ribosomal protein L13 [Neorickettsia sennetsu str. Miyayama] >gi|123491450|sp|Q2GCT8|RL13_NEOSM 50S ribosomal protein L13 >gi|88600904|gb|ABD46372.1| ribosomal protein L13 [Neorickettsia sennetsu str. Miyayama] (152 aa)
Score = 250, Expect = 2.3e-20, Identities = 49/137 (35%), Positives = 86/137 (62%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +TF   +A +  K+W V+DA++ ++G+LA   + ILRGK K  +TP++DCGD +I++N+ K+  S  K   + +Y H+GY GG+K  +  +++  K   +++  A+K ML    ++R  +K L++Y    H+  AQKP
  S:     2 STFFLKQAQI-EKQWIVVDATDAVVGRLAAFVSTILRGKTKPTYTPHMDCGDNVIVVNASKVKFSGSKMSDKVYYRHTGYPGGIKSTTPAKILRGKKPCEVVKLAVKRMLDDGPMARRRLKNLYVYAGPEHRHEAQKP 138
>gi|62185144|ref|YP_219929.1| 50S ribosomal protein L13 [Chlamydophila abortus S26/3] >gi|81312692|sp|Q5L5W3|RL13_CHLAB 50S ribosomal protein L13 >gi|62148211|emb|CAH63969.1| 50s ribosomal protein l13 [Chlamydophila abortus S26/3] (150 aa)
Score = 246, Expect = 8.2e-20, Identities = 61/139 (43%), Positives = 88/139 (63%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYK-DANHKQAAQKPM 141
           KTT  K   A  NK WYVIDA+   LG+L+ E A ILRGK+KV +TP+V  GD +I+IN++K+ L+  K  ++ +  ++GYI G++E +   MI K    +I  AIKGM+PK  L +  +K L I K D   +  +QKP+
  S:     8 KTTIAKASEA-QNKSWYVIDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVHLTGAKKGQKIYRYYTGYISGMREVAFENMIAKKPSYIIEHAIKGMMPKTRLGKRQVKSLRILKGDYYQEFKSQKPI 146
>gi|82947497|dbj|BAE52361.1| Ribosomal protein L13 [Magnetospirillum magneticum AMB-1] (183 aa)
Score = 245, Expect = 8.3e-20, Identities = 47/125 (37%), Positives = 83/125 (66%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW VIDA  ++LG+LA   +  LRGK+   +TP+VD GD +II+N++K+ L+ +K   +++Y H+G+ GG+K+++ G+L+  ++ +++I  A++ M+ +  L R  +K L +Y    H   AQ P
  S:    44 KKWVVIDADGVVLGRLASIVSMRLRGKHLPTYTPHVDMGDNVIIVNAEKVKLTGNKLADKRFYWHTGHPGGIKDRTMGQLLSGRFPERVIEKAVERMITRGPLGRQQMKNLRVYAGPAHPHEAQAP 169
>gi|91204594|emb|CAJ70822.1| strongly similar to 50S ribosomal protein L13 [Candidatus Kuenenia stuttgartiensis] (144 aa)
Score = 245, Expect = 1.0e-19, Identities = 51/143 (35%), Positives = 89/143 (62%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           KT   K E     + WY++DA + +LG++    + +L+GK+K ++TP +D GD++II N+ K+ L+  K   +  Y  +GY GGL+++     ++   +K++  +I+ MLPK  L + ++KK+ IYKDANH   AQ+P E+ +
  S:     2 KTYMAKKEEV--KRDWYIVDAEDKVLGRILTTISRVLQGKHKPEYTPYIDVGDFVIITNASKVKLTGKKMQEKIHYYVTGYQGGLRKRMVGNTLKTTPEKILNRSIRLMLPKTRLGKSMLKKVKIYKDANHPHQAQQPKELTI 142
>gi|108760943|ref|YP_630228.1| 50S ribosomal protein L13 [Myxococcus xanthus DK 1622] >gi|108464823|gb|ABF90008.1| ribosomal protein L13 [Myxococcus xanthus DK 1622] (151 aa)
Score = 244, Expect = 1.2e-19, Identities = 49/139 (35%), Positives = 89/139 (64%)
  Q:     2 QKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTH--SGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           QKT   K  A    ++W+V+D S+ +LG+ A + A +L+GK+K  +TP++D GD++++IN++K+ ++  K   + +Y H  +G+ G LK  +   + +++ + +I  A++ MLP+N L R ++ KL +Y    H  AAQKP
  S:     6 QKTYSAK--AGDIKRQWHVVDVSDKVLGRAASQIATLLKGKHKAIYTPSIDTGDHVVVINAEKVKVTGTKEQDKMYYRHPNAGFPGALKITNLEKLRQRHPEDIIINAVRRMLPRNALGRQMMTKLKVYAGDTHPHAAQKP 144
>gi|56417085|ref|YP_154159.1| 50S ribosomal protein L13 [Anaplasma marginale str. St. Maries] >gi|56388317|gb|AAV86904.1| 50S ribosomal protein L13 [Anaplasma marginale str. St. Maries] (170 aa)
Score = 244, Expect = 1.3e-19, Identities = 51/134 (38%), Positives = 84/134 (62%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLK-------EKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           +A+  +K+W +IDA   ++G+LA   A++LRGKNK ++TP++DCGD +IIIN+ +   + +K   + +Y H+GY GGLK       E++GR       ++++  A+  ML    L+R   K L +Y    H   AQKP+ +
  S:    19 KASQVDKRWVLIDADGAVVGRLAAFVASVLRGKNKPEYTPHMDCGDNVIIINAGRARFTGNKRKDKIYYRHTGYPGGLKSCTPMDIERAGR------PERIVKMAVWRMLGDGPLARRRFKNLRVYAGPVHGHDAQKPVPL 153
>gi|29840291|ref|NP_829397.1| 50S ribosomal protein L13 [Chlamydophila caviae GPIC] >gi|81715859|sp|Q822Z4|RL13_CHLCV 50S ribosomal protein L13 >gi|29834639|gb|AAP05275.1| ribosomal protein L13 [Chlamydophila caviae GPIC] (150 aa)
Score = 243, Expect = 1.8e-19, Identities = 60/139 (43%), Positives = 87/139 (62%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQ-AAQKPM 141
           KTT  K   A  NK WYVIDA+   LG+L+ E A ILRGK+KV +TP++  GD +I+IN++K+ L+  K  ++ +  ++GYI G++E     M+ K    +I  AIKGM+PK  L +  +K L I K   +K   AQKP+
  S:     8 KTTIAKASDA-QNKSWYVIDATGKTLGRLSSEVAKILRGKHKVTYTPHIAMGDGVIVINAEKVHLTGAKKGQKIYRYYTGYISGMREIPFENMLAKKPSYIIEHAIKGMMPKTRLGKRQLKSLRILKGDCYKTFEAQKPI 146
>gi|115377516|ref|ZP_01464716.1| ribosomal protein L13 [Stigmatella aurantiaca DW4/3-1] >gi|115365456|gb|EAU64491.1| ribosomal protein L13 [Stigmatella aurantiaca DW4/3-1] (148 aa)
Score = 241, Expect = 2.4e-19, Identities = 45/131 (34%), Positives = 87/131 (66%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTH--SGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +A+   ++W+V+D S+ +LG+ A + A +L+GK+K  +TP++D GD++++IN++K+ ++  K   + +Y H  +G+ G LK  +   + +++ + +I  A++ MLP+N L R ++ KL +Y    H  AAQKP
  S:     9 KASDIKRQWHVVDVSDKVLGRAASQIATLLKGKHKAIYTPSIDTGDHVVVINAEKVKVTGTKEQAKMYYRHPRAGFPGALKITNLAKLRQRHPEDVIINAVRRMLPRNALGRQMMTKLKVYAGDAHPHAAQKP 141
>gi|46200997|ref|ZP_00056008.2| COG0102: Ribosomal protein L13 [Magnetospirillum magnetotacticum MS-1] (155 aa)
Score = 241, Expect = 2.6e-19, Identities = 47/125 (37%), Positives = 83/125 (66%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           KKW VIDA  ++LG+LA   +  LRGK+   +TP+VD GD +II+N++K+ L+ +K   +++Y H+G+ GG+K+++ G+L+  ++ +++I  A++ M+ +  L R  +K L +Y    H   AQ P
  S:    16 KKWVVIDADGVVLGRLASIVSMRLRGKHMPTYTPHVDMGDNVIIVNAEKVKLTGNKLADKRFYWHTGHPGGIKDRTMGQLLSGRFPERVIEKAVERMITRGPLGRQQMKNLRVYAGPAHPHEAQAP 141
>gi|94985834|ref|YP_605198.1| 50S ribosomal protein L13 [Deinococcus geothermalis DSM 11300] >gi|166230979|sp|Q1IXK5|RL13_DEIGD 50S ribosomal protein L13 >gi|94556115|gb|ABF46029.1| ribosomal protein L13 [Deinococcus geothermalis DSM 11300] (147 aa)
Score = 241, Expect = 2.7e-19, Identities = 50/130 (38%), Positives = 88/130 (67%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           + W V+DA+ + LG+LA   A+ +RGK++ DFTPN+  GD+++++N++K+VL+ +K D + +  ++GY GGLK ++ R  + K+ +++I  A+ GMLPK    R L  +L +Y    H  AAQKP ++++
  S:    11 QNWVVVDAAGVPLGRLATLVASRIRGKHRPDFTPNIIQGDFVVVVNAEKVVLTGNKLDGKVYTRYTGYQGGLKTETARQALAKHPERVIEHAVFGMLPKGRQGRALHSRLKVYAGTTHPHAAQKPQQLEV 140
>gi|87310789|ref|ZP_01092916.1| 50S ribosomal protein L13 [Blastopirellula marina DSM 3645] >gi|87286546|gb|EAQ78453.1| 50S ribosomal protein L13 [Blastopirellula marina DSM 3645] (147 aa)
Score = 240, Expect = 3.9e-19, Identities = 43/126 (34%), Positives = 87/126 (69%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +++W+++DA + I+G+LA + A IL GK++  +TP+VD GD+++++N++K+  +  K D++++  ++GY G   E +G+  +E++ D ++  A++ MLPKN L+  ++ KL I+    H+  AQ+P
  S:     8 DQQWWLVDAEDQIVGRLASDLAMILMGKHRPTYTPHVDTGDFVVVVNAEKVKFTGGKWDKKEYTWYTGYPGLRTETAGK-RLERHPDWILRDAVRRMLPKNKLATKMLDKLKIFVGPEHEHQAQQP 132
>gi|15835020|ref|NP_296779.1| 50S ribosomal protein L13 [Chlamydia muridarum Nigg] >gi|13633857|sp|Q9PKR3|RL13_CHLMU 50S ribosomal protein L13 >gi|7190443|gb|AAF39258.1| ribosomal protein L13 [Chlamydia muridarum Nigg] (150 aa)
Score = 239, Expect = 4.9e-19, Identities = 58/139 (41%), Positives = 88/139 (63%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQ-AAQKPM 141
           KTT  K  +   NK WYVI+A    LG+L+ E A ILRGK+KV FTP+V  GD +I+IN++K+ L+  K  ++ ++ ++G+I G++E     MI +    +I  A+KGMLPK  L R  +K L + K +++ Q  A KP+
  S:     8 KTTLAK-ASDDQNKAWYVINAEGKTLGRLSSEVAKILRGKHKVTFTPHVAMGDGVIVINAEKVRLTGAKRAQKVYHYYTGFISGMREVPFENMIARKPAYVIEHAVKGMLPKTKLGRRQMKSLRVVKGSSYAQYEAIKPI 146
>gi|94270470|ref|ZP_01291751.1| Ribosomal protein L13 [delta proteobacterium MLMS-1] >gi|93450782|gb|EAT01832.1| Ribosomal protein L13 [delta proteobacterium MLMS-1] (113 aa)
Score = 238, Expect = 5.8e-19, Identities = 45/110 (40%), Positives = 76/110 (69%)
  Q:    36 ANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           A  LRGK+K  ++  +D GD+++++N+DK+ L+  K D + +Y H+GYIGG+++ +   + +K  ++L+Y A+KGMLPKNTL R  +KKL +Y    H  +AQ+P  ++L
  S:     2 ATRLRGKHKPIYSTFMDTGDFVVVLNADKVRLTGKKWDDKIYYRHTGYIGGIRQDTASELRDKKPEQLVYRAVKGMLPKNTLGRKQLKKLKVYAGGEHPHSAQQPETLQL 111
>gi|89898284|ref|YP_515394.1| 50S ribosomal protein L13 [Chlamydophila felis Fe/C-56] >gi|123483384|sp|Q254N9|RL13_CHLFF 50S ribosomal protein L13 >gi|89331656|dbj|BAE81249.1| 50S ribosomal protein L13 [Chlamydophila felis Fe/C-56] (150 aa)
Score = 238, Expect = 6.7e-19, Identities = 58/139 (41%), Positives = 86/139 (61%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQ-AAQKPM 141
           KTT  K   +  NK WYVIDA+   LG+L+ E   ILRGK+KV +TP+V  GD ++IIN++K+ L+  K +++ +  ++GYI G++E     M+ K    +I  AIKGM+PK  L +   K L I K   +K   +QKP+
  S:     8 KTTIAKASES-QNKSWYVIDATGKTLGRLSSEVVKILRGKHKVTYTPHVAMGDGVVIINAEKVHLTGAKKNQKIYRYYTGYISGMREVPFENMLAKKPSYIIEHAIKGMMPKTRLGKRQFKSLRILKGDCYKTFESQKPI 146
>gi|15604844|ref|NP_219628.1| 50S ribosomal protein L13 [Chlamydia trachomatis D/UW-3/CX] >gi|76788840|ref|YP_327926.1| 50S ribosomal protein L13 [Chlamydia trachomatis A/HAR-13] >gi|166154346|ref|YP_001654464.1| 50S ribosomal protein L13 [Chlamydia trachomatis 434/Bu] >gi|166155221|ref|YP_001653476.1| 50S ribosomal protein L13 [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|123607145|sp|Q3KMP4|RL13_CHLTA 50S ribosomal protein L13 >gi|7674165|sp|O84127|RL13_CHLTR 50S ribosomal protein L13 >gi|3328524|gb|AAC67716.1| L13 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX] >gi|76167370|gb|AAX50378.1| LSU ribosomal protein L13P [Chlamydia trachomatis A/HAR-13] >gi|165930334|emb|CAP03820.1| LSU ribosomal protein L13P [Chlamydia trachomatis 434/Bu] >gi|165931209|emb|CAP06774.1| LSU ribosomal protein L13P [Chlamydia trachomatis L2b/UCH-1/proctitis] (150 aa)
Score = 237, Expect = 7.9e-19, Identities = 53/127 (41%), Positives = 83/127 (65%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQ-AAQKPM 141
           NK WYV++A    LG+L+ E A ILRGK+KV FTP+V  GD +I+IN++K+ L+  K  ++ ++ ++G+I G++E     MI +    +I  A+KGMLPK  L R  +K L + K +++ Q  A KP+
  S:    19 NKAWYVVNAEGKTLGRLSSEVAKILRGKHKVTFTPHVAMGDGVIVINAEKVRLTGAKRAQKVYHYYTGFISGMREVPFENMIARKPAYVIEHAVKGMLPKTKLGRRQMKSLRVLKGSSYAQYEAIKPI 146
>gi|51209921|ref|YP_063585.1| 50S ribosomal protein L13 [Gracilaria tenuistipitata var. liui] >gi|75120502|sp|Q6B8X5|RK13_GRATL Chloroplast 50S ribosomal protein L13 >gi|50657675|gb|AAT79660.1| 50S ribosomal protein L13 [Gracilaria tenuistipitata var. liui] (143 aa)
Score = 237, Expect = 8.9e-19, Identities = 51/123 (41%), Positives = 78/123 (63%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           WY+IDA N  LG+L+ + A +LRGKN + FTP V+   Y+I+INS  I ++  K  ++ +  HSGY GGLK +    ++ +  ++++  +IKGMLPK  L R L ++L IY D  H   +Q+P
  S:    15 WYIIDAKNKNLGRLSSKIAKLLRGKNSISFTPYVNNKIYIILINSRSINVTGKKFVQKTYKRHSGYPGGLKVQKFNEILNQRPNRILEKSIKGMLPKGILGRQLFRQLKIYPDNIHPHESQQP 137
>gi|15618171|ref|NP_224456.1| 50S ribosomal protein L13 [Chlamydophila pneumoniae CWL029] >gi|15835782|ref|NP_300306.1| 50S ribosomal protein L13 [Chlamydophila pneumoniae J138] >gi|16752791|ref|NP_445059.1| 50S ribosomal protein L13 [Chlamydophila pneumoniae AR39] >gi|33241589|ref|NP_876530.1| 50S ribosomal protein L13 [Chlamydophila pneumoniae TW-183] >gi|7674175|sp|Q9Z8T7|RL13_CHLPN 50S ribosomal protein L13 >gi|4376522|gb|AAD18400.1| L13 Ribosomal Protein [Chlamydophila pneumoniae CWL029] >gi|7189432|gb|AAF38342.1| ribosomal protein L13 [Chlamydophila pneumoniae AR39] >gi|8978620|dbj|BAA98457.1| L13 ribosomal protein [Chlamydophila pneumoniae J138] >gi|33236097|gb|AAP98187.1| ribosomal protein L13 [Chlamydophila pneumoniae TW-183] (149 aa)
Score = 236, Expect = 9.9e-19, Identities = 56/139 (40%), Positives = 88/139 (63%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYK-DANHKQAAQKPM 141
           KTT VK+      K WYV+DA+   LG+L+ E A ILRGK+KV +TP+V  GD +I+IN++K+ L+  K  ++ +  ++GYI G++E     M+ +  + +I  AIKGM+P+  L +  +K L I K D+     +QKP+
  S:     8 KTTIVKSSET--TKSWYVVDAAGKTLGRLSSEVAKILRGKHKVTYTPHVAMGDGVIVINAEKVRLTGAKKGQKIYRYYTGYISGMREIPFENMMARKPNYIIEHAIKGMMPRTRLGKKQLKSLRIVKGDSYETFESQKPI 145
>gi|71003778|ref|XP_756555.1| hypothetical protein UM00408.1 [Ustilago maydis 521] >gi|46095557|gb|EAK80790.1| hypothetical protein UM00408.1 [Ustilago maydis 521] (183 aa)
Score = 234, Expect = 1.7e-18, Identities = 47/130 (36%), Positives = 79/130 (60%)
  Q:     4 TTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           + FV N +    + W+ + A N +LG LAV  A +L GK+K  +  + D GDY+++ ++ ++V++  KAD+  +  H+ Y GGLKE   + M+EK  +++I  A+ GMLPKNTL    +++L I+    H
  S:     2 SQFVGNSSLAFARTWHAVSAKNRVLGPLAVNIAKLLMGKHKPIYDQSKDVGDYVVVTDAKQVVVTGRKADQRVYRHHTMYPGGLKEIKYKEMMEKKPEEIIRKAVSGMLPKNTLRDRRLERLKIFDGEKH 131
>gi|116058185|emb|CAL53374.1| RK13_SPIOL 50S ribosomal protein L13, chloroplast precursor (ISS) [Ostreococcus tauri] (201 aa)
Score = 225, Expect = 1.8e-17, Identities = 46/131 (35%), Positives = 78/131 (59%)
  Q:    13 LANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHS--GYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           ++ K W VIDA+ + LG+++  AA  LRG N   +TP  + G  +I+IN+DK+ ++  KA ++ +Y     G  G +KE++   +  +   +++  AI+GMLPKN L R     L +Y  ++H  AAQ P ++
  S:    49 MSRKPWVVIDAAGMRLGRMSTAAAKYLRGGNSGSYTPAFNMGVNVIVINADKVEVTGQKAQQKMYYKLGVRGKPGSMKEETYESLFARQPARVVEKAIRGMLPKNRLGRETFTHLKVYAGSDHPHAAQNPTDV 181
>gi|94501756|ref|ZP_01308270.1| 50S ribosomal protein L13 [Oceanobacter sp. RED65] >gi|94426156|gb|EAT11150.1| 50S ribosomal protein L13 [Oceanobacter sp. RED65] (89 aa)
Score = 223, Expect = 3.2e-17, Identities = 38/74 (51%), Positives = 58/74 (78%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKE 89
           ++W+VIDA  + LG+LA E A+ LRGK+K ++TPNVD GDY+++IN+DK+ ++  KA  + +Y H+GY GGL+E
  S:    13 REWFVIDAEGVALGRLATEVASRLRGKHKPEYTPNVDTGDYIVVINADKVAVTGKKAQDKMYYRHTGYPGGLRE 86
>gi|71083719|ref|YP_266439.1| 50S ribosomal protein L13 [Candidatus Pelagibacter ubique HTCC1062] >gi|91763245|ref|ZP_01265209.1| ribosomal protein L13 [Candidatus Pelagibacter ubique HTCC1002] >gi|71062832|gb|AAZ21835.1| ribosomal protein L13 [Candidatus Pelagibacter ubique HTCC1062] >gi|91717658|gb|EAS84309.1| ribosomal protein L13 [Candidatus Pelagibacter ubique HTCC1002] (153 aa)
Score = 223, Expect = 3.5e-17, Identities = 51/131 (38%), Positives = 78/131 (59%)
  Q:    15 NKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYS-DKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           N  W+ IDA N ++G+LA   A I+RGKNK  FTP++D GD++++ N ++   +  K   +K+Y H+G+ GG+KE +   ++EK    + +  AIK MLP   L R  + K+ IY    H  AAQ P  + L
  S:    11 NSNWFEIDAKNAVVGRLASIIAMIVRGKNKTTFTPHMDDGDFVVVKNVEQAKFTGKKFKDKKYYRHTGHPGGIKEITPEKLLEKNKPGETLKLAIKRMLPGGVLGRKQLTKVKIYAGEEHPHAAQNPKLLDL 142
>gi|88607021|ref|YP_505656.1| 50S ribosomal protein L13 [Anaplasma phagocytophilum HZ] >gi|123494458|sp|Q2GIZ5|RL13_ANAPZ 50S ribosomal protein L13 >gi|88598084|gb|ABD43554.1| ribosomal protein L13 [Anaplasma phagocytophilum HZ] (158 aa)
Score = 222, Expect = 4.5e-17, Identities = 49/134 (36%), Positives = 85/134 (63%)
  Q:    10 EAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEK-YSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           +A   +K+W +IDAS++++G+LA   A ILRGK+K ++TP++DCGD ++++N+  +  + +K   + +Y H+GY GGLK  +   M+   Y++++I  A+  ML    L+R   K L +Y    H   AQKP+ +
  S:     7 KAGEIDKRWVLIDASDMVVGRLAAYIATILRGKHKPEYTPHMDCGDNVVVVNASSVKFTRNKMRDKVYYRHTGYPGGLKSCTPNDMLRAGYAERIIKVAVWRMLGDGPLARRRFKNLKVYSGPEHGHHAQKPVAL 141
>gi|66821519|ref|XP_644226.1| hypothetical protein DDBDRAFT_0217569 [Dictyostelium discoideum AX4] >gi|60472419|gb|EAL70372.1| hypothetical protein DDBDRAFT_0217569 [Dictyostelium discoideum AX4] (227 aa)
Score = 221, Expect = 5.3e-17, Identities = 46/111 (41%), Positives = 74/111 (66%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNK--VDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIY 128
           W+VIDAS   +G+LA + + +LRGK+K   D +  ++CGDY++++N+ K+  +  K D++ +  HSGY GGLKE   + M+ +  + +I  A+ GM+PKN    YL K+L IY
  S:    16 WHVIDASGHRVGRLATKISELLRGKHKPIYDRSVPLECGDYVVVLNAHKVEFTGKKWDQKMYRKHSGYPGGLKETLAKDMLVENPEHIIRHAVMGMIPKNNSKFYLGKRLKIY 128
>gi|11467739|ref|NP_050791.1| ribosomal protein L13 [Guillardia theta] >gi|3914650|sp|O46915|RK13_GUITH Chloroplast 50S ribosomal protein L13 >gi|3603064|gb|AAC35725.1| ribosomal protein L13 [Guillardia theta] (143 aa)
Score = 220, Expect = 8.2e-17, Identities = 50/143 (34%), Positives = 83/143 (58%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           M KT   + +  L   KW++IDA++  LG+LA E A  L GK    + PNV+  + ++IIN+DKI ++ +K   + +Y HSG +GGL  ++   +  +   +++  A+KG+LPK  L R L   L +Y  ++H   AQ P+ +
  S:     1 MNKTIIREGKINLG--KWFIIDATDKNLGRLASETAKTLVGKYDPLYAPNVNPKNIIVIINADKIRVTGNKKFDKFYYRHSGQVGGLTIETFNELQSRLPGRILEKAVKGILPKGPLGRELFNNLKVYAGSSHPHEAQNPVAL 141
>gi|58698155|ref|ZP_00373077.1| ribosomal protein L13 [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535305|gb|EAL59382.1| ribosomal protein L13 [Wolbachia endosymbiont of Drosophila ananassae] (129 aa)
Score = 217, Expect = 1.7e-16, Identities = 43/117 (36%), Positives = 77/117 (65%)
  Q:    27 ILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           ++G+LA   A +LRGK+K ++TP++DCGD +IIIN++K+  +  K   + +Y H+GY GGLK+ +   ++  K+ +++I  A+K ML    ++R   + L++Y  + HK   Q+P +I
  S:     1 MVGRLAAFVATLLRGKHKPEYTPHMDCGDNVIIINAEKVHFTGKKLKDKIYYKHTGYSGGLKKTTPDNILNGKFPERVIEMAVKRMLDDGPMARRRFENLYVYSGSEHKHQGQQPEKI 118
>gi|19113545|ref|NP_596753.1| mitochondrial ribosomal protein subunit L13 [Schizosaccharomyces pombe] >gi|74654669|sp|O60118|RM23_SCHPO 60S ribosomal protein L23, mitochondrial precursor >gi|3133098|emb|CAA19024.1| mitochondrial ribosomal protein subunit L13 [Schizosaccharomyces pombe] (157 aa)
Score = 214, Expect = 3.5e-16, Identities = 51/131 (38%), Positives = 76/131 (58%)
  Q:     7 VKNEAALANKK-WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDK-LIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAA 137
           +  + ALA  K W+ + A N+ LG+LA + A  L GK+K  + P  DCGD +++ +  +I +S  K +  K+Y+HSG  G LKE +   M  K   K L+  A+ GMLP+N L    +K+L+IY  A H   A
  S:     4 LNGQTALAYAKVWHHVSAKNVPLGRLASQIATTLMGKHKPIYHPAADCGDVVVVTDCSEIGISGRKLENHKYYSHSGQPGHLKEWTMEEMAAKRGHKDLLRRAVGGMLPRNKLWDRRMKRLYIYDGAEHPYKA 136
>gi|34765016|ref|ZP_00145324.1| LSU ribosomal protein L13P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27885645|gb|EAA23077.1| LSU ribosomal protein L13P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (106 aa)
Score = 209, Expect = 1.4e-15, Identities = 39/105 (37%), Positives = 68/105 (64%)
  Q:    41 GKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           GK K+ FTP++D GDY+++ N+ K+V++  K   + +Y HSG+ GG++ +    ++ K  ++L+  A+K MLPKN L R  + +L ++  A H   AQKP +++L
  S:     2 GKEKLTFTPHIDGGDYVVVTNASKLVVTGKKLTDKVYYNHSGFPGGIRARKLGEILAKKPEELLMLAVKRMLPKNKLGRQQLTRLRVFAGAEHSHVAQKPNKVEL 106
>gi|58262940|ref|XP_568880.1| mitochondrial ribosomal protein L23 [Cryptococcus neoformans var. neoformans JEC21] >gi|134108172|ref|XP_777284.1| hypothetical protein CNBB2690 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50259971|gb|EAL22637.1| hypothetical protein CNBB2690 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57223530|gb|AAW41573.1| mitochondrial ribosomal protein L23, putative [Cryptococcus neoformans var. neoformans JEC21] (163 aa)
Score = 205, Expect = 4.7e-15, Identities = 43/123 (34%), Positives = 73/123 (59%)
  Q:     9 NEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDA 131
           N A    + W+   A N +LG LA   A +L GK+K  + P VD GDY+I+ ++ ++ L+  KA  + ++ H+G++GGLK+     + E+  +++I  A+ GMLPKNT     +++L I+  A
  S:     7 NTALALTRVWHHTSAQNRVLGTLASRIAWVLMGKHKPTYDPAVDAGDYVIVSDALQVRLTGKKATDKVYHHHTGFMGGLKKVPITRLRERRPEEIIRKAVSGMLPKNTFRDRRLERLKIFPGA 129
>gi|33585876|gb|AAH55470.1| Mrpl13 protein [Mus musculus] (175 aa)
Score = 204, Expect = 5.2e-15, Identities = 41/117 (35%), Positives = 71/117 (60%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           + WY++D      GKLAV A+N L+G NK  +    DCGD+++IIN+  I  S +K +++ + +H+GY GG ++ +   +  K    ++  AI GMLPKN   R ++++L ++ D +
  S:    13 RMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDED 129
>gi|21312936|ref|NP_081035.1| mitochondrial ribosomal protein L13 [Mus musculus] >gi|22257024|sp|Q9D1P0|RM13_MOUSE 39S ribosomal protein L13, mitochondrial (L13mt) (MRP-L13) >gi|12833853|dbj|BAB22688.1| unnamed protein product [Mus musculus] >gi|13559373|dbj|BAB40846.1| mitochondrial ribosomal protein L13 (L13mt) [Mus musculus] >gi|38511998|gb|AAH60968.1| Mitochondrial ribosomal protein L13 [Mus musculus] >gi|148697329|gb|EDL29276.1| mitochondrial ribosomal protein L13, isoform CRA_a [Mus musculus] (178 aa)
Score = 204, Expect = 5.2e-15, Identities = 41/117 (35%), Positives = 71/117 (60%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           + WY++D      GKLAV A+N L+G NK  +    DCGD+++IIN+  I  S +K +++ + +H+GY GG ++ +   +  K    ++  AI GMLPKN   R ++++L ++ D +
  S:    16 RMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDED 132
>gi|85713426|ref|ZP_01044419.1| Ribosomal protein L13 [Idiomarina baltica OS145] >gi|85692751|gb|EAQ30756.1| Ribosomal protein L13 [Idiomarina baltica OS145] (84 aa)
Score = 204, Expect = 5.9e-15, Identities = 37/83 (44%), Positives = 59/83 (71%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGL 87
           TFV     +  + WYVIDA    LG+LA E A  LRGK+K ++TP+VD GDY++I+N++K+ ++ +KA  + +Y+H+G+ GG+
  S:     3 TFVAKPETV-KRDWYVIDAEGKTLGRLATEVARRLRGKHKPEYTPHVDTGDYIVIVNAEKVAVTGNKAQDKMYYSHTGFPGGI 84
>gi|11465444|ref|NP_045165.1| ribosomal protein L13 [Cyanidium caldarium] >gi|6466347|gb|AAF12929.1|AF022186_51 unknown; 50S ribosomal protein L13 [Cyanidium caldarium] (143 aa)
Score = 202, Expect = 9.6e-15, Identities = 42/128 (32%), Positives = 80/128 (62%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEIKL 145
           WY+IDA + ILGK+A +AA IL GKN+  ++ N    +++IIINS ++ ++ +K  ++ +  +S   G  K +S   + ++  ++++  A+KGMLPK+ L + +   L +Y   +H   AQ+P+++ +
  S:    16 WYLIDAQDQILGKIATKAAIILMGKNRSTYSYNSMSANFVIIINSRQVAITGNKNTQKVYKRYSAKPGATKTESFYHLKKRIPNRILEQAVKGMLPKSVLGKKMFSHLKVYAGDSHPHLAQQPIQLSI 143
>gi|75764615|ref|ZP_00744059.1| LSU ribosomal protein L13P [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487895|gb|EAO51667.1| LSU ribosomal protein L13P [Bacillus thuringiensis serovar israelensis ATCC 35646] (84 aa)
Score = 201, Expect = 1.3e-14, Identities = 40/83 (48%), Positives = 60/83 (72%)
  Q:     3 KTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIG 85
           +TTF+  +A    +KWYV+DA    LG+L+ E A+ILRGKNK  FTP+VD GD++IIIN++KI L+ +K + + +Y H+ + G
  S:     2 RTTFMA-KANEVERKWYVVDAEGQTLGRLSTEVASILRGKNKPTFTPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPG 83
>gi|62857577|ref|NP_001016796.1| mitochondrial ribosomal protein L13 [Xenopus tropicalis] >gi|89273926|emb|CAJ83836.1| mitochondrial ribosomal protein L13 [Xenopus tropicalis] (151 aa)
Score = 196, Expect = 5.0e-14, Identities = 41/131 (31%), Positives = 77/131 (58%)
  Q:    12 ALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPME 142
           A  ++ WY+IDA     GK+A   A  L+GK+K  +    DCGD+++++N+  I  S +K +++ + +HSGY GG ++ +   + ++    ++  A+ GMLPKN   R ++++L ++ +     A + PME
  S:    12 ATFSRMWYLIDARMQPPGKVASLCAVHLKGKHKPMYHALSDCGDHVVVVNTRHIAFSGNKWEQKVYSSHSGYAGGFQQVTAAQLHQRDPTAIMKLAVYGMLPKNLHRRTMMQRLHLFPE----DATEFPME 138
>gi|32307500|gb|AAP79155.1| ribosomal protein rpL13 [Bigelowiella natans] (273 aa)
Score = 194, Expect = 8.7e-14, Identities = 43/130 (33%), Positives = 78/130 (60%)
  Q:    14 ANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTH-SGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           + + W V+DA + ILG+LA  AA ++ GK    + P ++ G +++IIN+DK+ ++  K   + +  H +G  G +K ++ R +  +  ++++  AIKGMLPK  L R   K+L IY    +   +QKP+++
  S:   122 SKETWIVLDAQDQILGRLASLAATLVMGKWHPLYHPAMNMGAHVVIINADKVRVTGRKYTDKLYKRHVTGRPGSMKSEAFRDLQARIPERIVEVAIKGMLPKTRLGREQFKQLHIYAGDENPHTSQKPVDL 252
>gi|115924098|ref|XP_001177894.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] (131 aa)
Score = 191, Expect = 1.9e-13, Identities = 37/109 (33%), Positives = 65/109 (59%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKN 115
           +  + A  ++ WY+IDA     G++AV  + +L+GK+K  + P  D GD++++IN+ ++  + DK + + +Y H+GY GG  E       +K   K+I  A+ GMLPK+
  S:     5 ITQQWATFSRIWYLIDAYRQPPGRVAVAISKVLQGKHKPIYHPLSDVGDHVVVINTSQVAYAKDKWEEKIYYHHTGYPGGFSETPAHEFHQKDPTKVIKKAVYGMLPKD 113
>gi|6650751|gb|AAF21997.1| ribosomal protein I [Ceratopteris richardii] (141 aa)
Score = 190, Expect = 2.2e-13, Identities = 41/117 (35%), Positives = 68/117 (58%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           +W V DA   ILG+LA + + +L+GK+K  + P+++ GD  ++IN+  +  +  K   + +  H+GYIG LKE+S +  + K   ++I  A+  MLPKN L     +KL I+    H
  S:    21 RWRVFDAKGQILGRLASQISVVLQGKDKPTYAPHLEKGDICVVINAKHVCFTGRKLTDKFYRWHTGYIGHLKERSLKEQMXKDPTEVIRKAVVRMLPKNRLRDDRARKLRIFVXDQH 137
>gi|73974567|ref|XP_539150.2| PREDICTED: similar to mitochondrial ribosomal protein L13 [Canis familiaris] (178 aa)
Score = 189, Expect = 3.2e-13, Identities = 40/122 (32%), Positives = 72/122 (59%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQK 139
           WY++D      GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG K+ +   + +K    ++  AI GMLPKN   R L+++L ++ D +  +  +K
  S:    18 WYLLDGKMQPPGKLAAMASIKLQGLHKPVYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFKQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTLMQRLHLFPDEDIPEDIRK 139
>gi|30678423|ref|NP_186828.2| ribosomal protein L13 family protein [Arabidopsis thaliana] >gi|30678425|ref|NP_850494.1| ribosomal protein L13 family protein [Arabidopsis thaliana] >gi|33589790|gb|AAQ22661.1| At1g01640 [Arabidopsis thaliana] >gi|110742779|dbj|BAE99294.1| hypothetical protein [Arabidopsis thaliana] (205 aa)
Score = 188, Expect = 4.4e-13, Identities = 44/126 (34%), Positives = 71/126 (56%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPME 142
           +W V DA   +LG+LA + + +L+ K+K  + PN D GD  I++N+ +I  +  K   + +  H+GYIG LKE+S +  + K   ++I  A+  MLP N L     +KL I++   H     KP+E
  S:    31 RWRVFDARGQVLGRLASQISTVLQAKDKPTYCPNRDDGDICIVLNAKEIGFTGRKLTDKFYRWHTGYIGHLKERSLKDQMAKDPTEVIRKAVWRMLPSNNLRDDRDRKLRIFEGGEHP-FGDKPLE 155
>gi|147906356|ref|NP_001088908.1| hypothetical protein LOC496258 [Xenopus laevis] >gi|56788748|gb|AAH88795.1| LOC496258 protein [Xenopus laevis] (179 aa)
Score = 187, Expect = 5.1e-13, Identities = 35/115 (30%), Positives = 69/115 (60%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKD 130
           + WY+IDA     GK+A   A  L+GK+K  +    DCGD+++++N+  I  S +K + + + +H+GY GG ++ +   + ++    ++   + GMLPKN L R ++++L ++ +
  S:    16 RMWYLIDARMQPPGKVASLCAVHLKGKHKPMYHALSDCGDHVVVVNTRHIAFSGNKWEEKVYSSHTGYAGGFRQVTAAQLHQRDPTAIMKLTVYGMLPKNLLRRTMMQRLHLFPE 130
>gi|55741549|ref|NP_001006986.1| mitochondrial ribosomal protein L13 [Rattus norvegicus] >gi|54261554|gb|AAH84710.1| Mitochondrial ribosomal protein L13 [Rattus norvegicus] >gi|149066373|gb|EDM16246.1| mitochondrial ribosomal protein L13, isoform CRA_a [Rattus norvegicus] (178 aa)
Score = 186, Expect = 6.3e-13, Identities = 38/117 (32%), Positives = 69/117 (58%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           + WY++D      GKLA  A+N L+G +K  +    DCGD+++IIN+  I  S +K +++ + +H+GY GG ++ +   +  K    ++  A  GMLPKN   R ++++L ++ D +
  S:    16 RMWYLLDGKMQPPGKLAAIASNKLQGLHKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLKDPVAIVKLATYGMLPKNLHRRTMMQRLHLFPDED 132
>gi|77736592|ref|NP_001029977.1| mitochondrial ribosomal protein L13 [Bos taurus] >gi|91207746|sp|Q3SYS1|RM13_BOVIN 39S ribosomal protein L13, mitochondrial (L13mt) (MRP-L13) >gi|74268205|gb|AAI03424.1| Mitochondrial ribosomal protein L13 [Bos taurus] (178 aa)
Score = 186, Expect = 7.2e-13, Identities = 39/115 (33%), Positives = 68/115 (59%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           WY++D      GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG K+ +   +  K    ++  AI GMLPKN   R L+++L ++ D +
  S:    18 WYLLDGKMQPPGKLAALASVRLQGLHKPVYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFKQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTLMQRLHLFPDED 132
>gi|66472680|ref|NP_001018370.1| mitochondrial ribosomal protein L13 [Danio rerio] >gi|63102346|gb|AAH95074.1| Mitochondrial ribosomal protein L13 [Danio rerio] (179 aa)
Score = 183, Expect = 1.4e-12, Identities = 36/115 (31%), Positives = 69/115 (60%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKD 130
           + W++IDA     GK+A   A  L+GK+K  + P  D GD+++++N+  I  S +K +++ + +H+G+ G  K+ +   +  K S  +I  A+ GMLP+N   R ++++L ++ D
  S:    16 RSWFLIDARMQPPGKIASMCAVRLQGKHKPIYHPLSDIGDHVVVMNTKHIAFSGNKWEQKVYSSHTGHPGSFKQVTAAQLHRKDSTAIIKLAVYGMLPRNLTRRTMMQRLHLFPD 130
>gi|37806271|dbj|BAC99787.1| putative ribosomal protein I [Oryza sativa Japonica Group] (229 aa)
Score = 182, Expect = 1.9e-12, Identities = 42/117 (35%), Positives = 71/117 (60%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           +W V DA   +LG+LA + A +L+GK+K  + P+V+ GD  +++N+  I ++  K   + +Y H+GYIG LKE+  +  +EK   ++I  A+  MLP+N L     +KL I+  + H
  S:    28 RWRVFDAKGQVLGRLASQIAVVLQGKDKPTYAPHVENGDMCVVLNAKDISVTGRKMTDKIYYWHTGYIGHLKERRLKDQMEKDPTEVIRKAVMRMLPRNRLRDDRDRKLRIFSGSEH 144
>gi|11467448|ref|NP_043594.1| ribosomal protein L13 [Odontella sinensis] >gi|1350608|sp|P49551|RK13_ODOSI Chloroplast 50S ribosomal protein L13 >gi|1185143|emb|CAA91626.1| 50S ribosomal protein L13 [Odontella sinensis] (139 aa)
Score = 179, Expect = 4.4e-12, Identities = 41/128 (32%), Positives = 70/128 (54%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLM---IEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKPMEI 143
           K W +ID  +  LG++AV  + +L GK K+ + P  D GDY+++IN+  ++  S +           +   +  + GRL+   I     +L+  AI GMLP+ +  + L K+L IY   +H  AAQ P+++
  S:    14 KNWCLIDCKDQKLGRIAVVISRLLSGKQKLHYHPAFDVGDYVVVINAQDMIFDSQQPR---------FSVNVPGRPGRLLKQVINALPSQLLMTAIYGMLPEGSAKKSLPKRLKIYNGPDHPHAAQNPIKL 135
>gi|75859022|ref|XP_868851.1| hypothetical protein AN9469.2 [Aspergillus nidulans FGSC A4] >gi|40738397|gb|EAA57587.1| hypothetical protein AN9469.2 [Aspergillus nidulans FGSC A4] (166 aa)
Score = 177, Expect = 7.7e-12, Identities = 39/119 (32%), Positives = 70/119 (58%)
  Q:    15 NKKWYVID--ASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKY-SDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           ++ W+++D  +    LG+LA   A IL GKNK  + P+ DCGDY++ +    +  +  K  ++K+YTH+   G L+  +   M EK+   +++  A++GMLPKN L    + +L  ++  +H
  S:    13 SRAWHLVDVGSDGRSLGRLASSIALILMGKNKPIYDPSTDCGDYVVAVGCHDLHTTGKKRFQKKYYTHTTRPGSLRSMTMDKMFEKWGGGEVLRRAVRGMLPKNRLRDKRLARLKTFEGVDH 134
>gi|114621492|ref|XP_519928.2| PREDICTED: mitochondrial ribosomal protein L13 isoform 3 [Pan troglodytes] (178 aa)
Score = 176, Expect = 9.4e-12, Identities = 36/115 (31%), Positives = 68/115 (59%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           WY++D      GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG ++ +   +  +    ++  AI GMLPKN   R ++++L ++ D +
  S:    18 WYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDED 132
>gi|109087347|ref|XP_001097952.1| PREDICTED: similar to mitochondrial ribosomal protein L13 [Macaca mulatta] (178 aa)
Score = 176, Expect = 9.4e-12, Identities = 36/115 (31%), Positives = 68/115 (59%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           WY++D      GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG ++ +   +  +    ++  AI GMLPKN   R ++++L ++ D +
  S:    18 WYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDED 132
>gi|99032314|pdb|2FTC|H Chain H, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome (148 aa)
Score = 176, Expect = 1.1e-11, Identities = 36/113 (31%), Positives = 67/113 (59%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKD 130
           WY++D      GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG ++ +   +  +    ++  AI GMLPKN   R ++++L ++ D
  S:    18 WYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPD 130
>gi|45198921|ref|NP_985950.1| AFR403Wp [Ashbya gossypii ATCC 10895] >gi|44984950|gb|AAS53774.1| AFR403Wp [Ashbya gossypii ATCC 10895] (156 aa)
Score = 176, Expect = 1.1e-11, Identities = 37/116 (31%), Positives = 70/116 (60%)
  Q:    18 WYVIDAS--NLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGR-LMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W+ +D +     LG+LA   A  L GK+K  + P++DCGDY+++ N+  + ++  K +++ +++HSG  G LK ++   +   K   +L+  A+ GMLPKN L +  + +L ++  + H
  S:    16 WHHVDVAREQRTLGRLASSIAITLMGKHKPVYHPSMDCGDYVVVTNAQDLQVTGKKWEQKTYWSHSGRPGHLKLRTMETIATNKGHSELLRKAVSGMLPKNRLRKVRLARLKVFDGSEH 134
>gi|14165270|ref|NP_054797.2| mitochondrial ribosomal protein L13 [Homo sapiens] >gi|22257023|sp|Q9BYD1|RM13_HUMAN 39S ribosomal protein L13, mitochondrial (L13mt) (MRP-L13) >gi|13559371|dbj|BAB40845.1| mitochondrial ribosomal protein L13 (L13mt) [Homo sapiens] >gi|14327932|gb|AAH09190.1| Mitochondrial ribosomal protein L13 [Homo sapiens] >gi|18204991|gb|AAH21744.1| Mitochondrial ribosomal protein L13 [Homo sapiens] >gi|119612410|gb|EAW92004.1| mitochondrial ribosomal protein L13, isoform CRA_b [Homo sapiens] >gi|123992882|gb|ABM84043.1| mitochondrial ribosomal protein L13 [synthetic construct] >gi|123993623|gb|ABM84413.1| mitochondrial ribosomal protein L13 [synthetic construct] >gi|123999768|gb|ABM87394.1| mitochondrial ribosomal protein L13 [synthetic construct] >gi|189065142|dbj|BAG34865.1| unnamed protein product [Homo sapiens] (178 aa)
Score = 176, Expect = 1.1e-11, Identities = 36/113 (31%), Positives = 67/113 (59%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKD 130
           WY++D      GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG ++ +   +  +    ++  AI GMLPKN   R ++++L ++ D
  S:    18 WYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPD 130
>gi|115462819|ref|NP_001055009.1| Os05g0243300 [Oryza sativa (japonica cultivar-group)] >gi|53981181|gb|AAV24821.1| putative ribosomal protein I [Oryza sativa (japonica cultivar-group)] >gi|113578560|dbj|BAF16923.1| Os05g0243300 [Oryza sativa (japonica cultivar-group)] (191 aa)
Score = 175, Expect = 1.1e-11, Identities = 36/97 (37%), Positives = 60/97 (61%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLP 113
           +W V DA   +LG+LA + A +L+GK+K  + P+V+ GD  +++N+  I ++  K   + +Y H+GYIG LKE+  +  +EK   + I  A+  MLP
  S:    16 RWRVFDAKGQVLGRLASQIAVVLQGKDKPTYAPHVENGDMCVVLNAKDISVTGRKMTDKIYYWHTGYIGHLKERRLKDQMEKDPTEAIRKAVMRMLP 112
>gi|6563216|gb|AAF17202.1|AF112214_1 ribosomal protein L13 [Homo sapiens] (172 aa)
Score = 175, Expect = 1.4e-11, Identities = 36/113 (31%), Positives = 67/113 (59%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKD 130
           WY++D      GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG ++ +   +  +    ++  AI GMLPKN   R ++++L ++ D
  S:    18 WYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPD 130
>gi|118377465|ref|XP_001021911.1| Ribosomal protein L13 containing protein [Tetrahymena thermophila SB210] >gi|89303678|gb|EAS01666.1| Ribosomal protein L13 containing protein [Tetrahymena thermophila SB210] (779 aa)
Score = 172, Expect = 3.0e-11, Identities = 47/129 (36%), Positives = 81/129 (62%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVD--CGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKL----------IYGAIKGMLPKNTLSRYLIKKLFIYKDANH-KQAAQKPMEIKLN 146
           +++ DAS + LG++  + A  L+GK++  F  N D    D +I++N+  I+L+  KA  +    H+G++GGLKEKS +  + +  ++L          ++  I  MLPKN   R L+KK+ IY+D  H KQ     +++K+N
  S:   453 YHIFDASKMPLGRMCQKIAFFLQGKHRPTFK-NCDQVTYDNIIVVNAANIMLTGKKALLKTVKYHTGFVGGLKEKSYKFFLTEKPEQLVNIYIQLVSKVFYCISKMLPKNLKRRDLLKKVEIYRDFQHEKQGLPNVIQVKIN 593
>gi|21702569|gb|AAM75966.1|AF481102_2 ribosomal protein L13 [Candidatus Tremblaya princeps] (124 aa)
Score = 171, Expect = 3.4e-11, Identities = 34/112 (30%), Positives = 63/112 (56%)
  Q:    19 YVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKD 130
           +V+DA  ++LG+LAV  A +LRGK K  +  N    + + ++N + + +S  KA  + +Y HSG+ GGL+      ++ +    ++  A+ GMLP+N L    +  L ++ +
  S:     7 HVLDARGMVLGRLAVTVAGLLRGKYKASYAHNAAPHNAVTVLNCEHVRISGSKAVGKVYYRHSGHPGGLRRTKLHDLMLRSPATVLRAAVHGMLPRNRLRDRFMSMLMVHAN 118
>gi|6091722|gb|AAF03434.1|AC010797_10 putative ribosomal protein L13 [Arabidopsis thaliana] (137 aa)
Score = 171, Expect = 3.9e-11, Identities = 37/101 (36%), Positives = 60/101 (59%)
  Q:    17 KWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTL 117
           +W V DA   +LG+LA + + +L+ K+K  + PN D GD  I++N+ +I  +  K   + +  H+GYIG LKE+S +  + K   ++I  A+  MLP N L
  S:    31 RWRVFDARGQVLGRLASQISTVLQAKDKPTYCPNRDDGDICIVLNAKEIGFTGRKLTDKFYRWHTGYIGHLKERSLKDQMAKDPTEVIRKAVWRMLPSNNL 131
>gi|50293057|ref|XP_448958.1| unnamed protein product [Candida glabrata] >gi|49528271|emb|CAG61928.1| unnamed protein product [Candida glabrata] (167 aa)
Score = 168, Expect = 8.1e-11, Identities = 39/116 (33%), Positives = 69/116 (59%)
  Q:    18 WYVIDASN--LILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W+ +D +     LG++A   A  L GK+K  + P+ DCGDY+++ N  K+ ++  K +++ +++HS   G LK  + + M E K   +L+  A+ GMLPKN L +  + +L ++  A H
  S:    16 WHHVDLAKDKRTLGRVASSIAVTLIGKHKPVYHPSQDCGDYVVVTNCQKVRITGKKFEQKTYWSHSTKPGNLKLTTMKTMAENKGYGELLKKAVSGMLPKNRLRKVRLARLKVFDGAEH 134
>gi|88800979|ref|ZP_01116530.1| 50S ribosomal protein L13 [Reinekea sp. MED297] >gi|88776301|gb|EAR07525.1| 50S ribosomal protein L13 [Reinekea sp. MED297] (76 aa)
Score = 167, Expect = 9.4e-11, Identities = 33/74 (44%), Positives = 51/74 (68%)
  Q:     5 TFVKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWY 78
           TFV   A +  + WYV+DA    LG+LA E A  LRGK+K ++TP+VD GDY+++IN++K+ ++  KA  + +Y
  S:     3 TFVAKPAEV-KRDWYVVDAEGQTLGRLATEIARRLRGKHKAEYTPHVDTGDYIVVINAEKVRVTGRKAADKMYY 75
>gi|50550341|ref|XP_502643.1| hypothetical protein [Yarrowia lipolytica] >gi|49648511|emb|CAG80831.1| unnamed protein product [Yarrowia lipolytica CLIB122] (147 aa)
Score = 167, Expect = 1.1e-10, Identities = 35/119 (29%), Positives = 67/119 (56%)
  Q:    15 NKKWYVIDAS--NLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYS-DKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           ++ W+ +D +     LG+LA   A  L+GK+K  +    DCGDY++++N+DK+  S  K  +++++  S   G     + + +IE     +++   + GMLP+N L R  I +L +++   H
  S:     6 SRTWHFVDVAKEQRTLGRLATSIAQTLQGKHKPVYNTGHDCGDYVVVVNADKLRFSGSKLQQKEYFVQSSQPGHSHHVAVKRVIENQGVSEVLRRTVAGMLPRNKLKRGRIARLKVFEGTEH 127
>gi|119188595|ref|XP_001244904.1| hypothetical protein CIMG_04345 [Coccidioides immitis RS] >gi|90303690|gb|EAS33321.1| hypothetical protein CIMG_04345 [Coccidioides immitis RS] (169 aa)
Score = 164, Expect = 2.3e-10, Identities = 41/123 (33%), Positives = 67/123 (54%)
  Q:    15 NKKWYVIDASN--LILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSD-KLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAA 137
           ++ W+ ID  +    LG++A   A  L GKNK  + P+ DCGDY++ +    I  +  K  ++ +Y+HS   G LK  S   M EK+   +++  A++GMLPKN L    + +L  ++   H   A
  S:    13 SRTWHYIDVGSDPRSLGRVASSIALFLMGKNKPIYDPSTDCGDYVVAVGCKNIHTTGKKRFQKLYYSHSTRPGSLKSMSMDKMFEKWGGAEVLKRAVRGMLPKNKLREKRMARLKAFEGHAHPYKA 138
>gi|6324724|ref|NP_014793.1| Mitochondrial ribosomal protein of the large subunit; Mrpl23p [Saccharomyces cerevisiae] >gi|23822049|sp|Q12487|RM23_YEAST 54S ribosomal protein L23, mitochondrial precursor (YmL23) >gi|1293710|gb|AAC49636.1| O3530p >gi|1420377|emb|CAA99356.1| unnamed protein product [Saccharomyces cerevisiae] >gi|45270156|gb|AAS56459.1| YOR150W [Saccharomyces cerevisiae] (163 aa)
Score = 163, Expect = 2.7e-10, Identities = 36/111 (32%), Positives = 70/111 (63%)
  Q:    18 WYVIDAS--NLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKS-GRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIY 128
           W+ +D +     LG+LA   A  L G++K  + P+ DCGDY+++ N  KI ++  K +++ +++HSG  G LK ++  +++ +K   +++  A+ GMLPKN L +  + +L ++
  S:    16 WHHVDVARDKRTLGRLASAIAITLIGRHKPVYHPSQDCGDYVVVTNCQKIRVTGKKFEQKTYWSHSGRPGQLKLQTMNKVVADKGFGEILKKAVSGMLPKNKLRKQRLDRLKVF 129
>gi|71001406|ref|XP_755384.1| 50S ribosomal protein L13 [Aspergillus fumigatus Af293] >gi|66853022|gb|EAL93346.1| 50S ribosomal protein L13 [Aspergillus fumigatus Af293] >gi|159129457|gb|EDP54571.1| 50S ribosomal protein L13 [Aspergillus fumigatus A1163] (170 aa)
Score = 163, Expect = 3.3e-10, Identities = 38/119 (31%), Positives = 67/119 (56%)
  Q:    15 NKKWYVIDASN--LILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKY-SDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           ++ W+ ID  +    LG+LA   A  L GK+K  + P+ DCGDY++ +    +  +  K  ++K+YTH+   G L+  +   M EK+   +++  A++GMLPKN L    + +L  ++   H
  S:    13 SRTWHYIDVGSDPRSLGRLASSIALFLMGKHKPIYDPSTDCGDYVVAVGCSDLRTTGKKRFQKKYYTHTTRPGSLRSMTMDQMFEKWGGGEVLRRAVRGMLPKNRLRDKRLARLKTFEGLAH 134
>gi|50306413|ref|XP_453180.1| unnamed protein product [Kluyveromyces lactis] >gi|5679594|emb|CAB51776.1| mitochondrial ribosomal protein L23 [Kluyveromyces lactis] >gi|49642314|emb|CAH00276.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] (155 aa)
Score = 162, Expect = 3.6e-10, Identities = 37/118 (31%), Positives = 69/118 (58%)
  Q:    16 KKWYVIDASN--LILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           + W+ +D S     LG++A + A  L GK+K  + P+ DCGDY+++ N   + ++ +K  ++ +++H+   G LK  +   MI  K   +++  A+ GMLPKN L +  + +L I+  + H
  S:    14 RMWHHVDISKDKRTLGRVASQVALALMGKHKPVYHPSADCGDYVVVTNCQALRVTGNKMTQKTYWSHTSRPGSLKLTTMEDMISNKGYSEVLKKAVSGMLPKNKLRKIRLARLKIFDGSEH 134
>gi|116191663|ref|XP_001221644.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] >gi|88181462|gb|EAQ88930.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] (183 aa)
Score = 162, Expect = 3.9e-10, Identities = 34/106 (32%), Positives = 61/106 (57%)
  Q:    28 LGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKY-SDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           LG+LA   A IL GK+K  + P+ DCGDY+++ N   +  +  K  R+ +Y H+   G L+  +  ++++K+   +++  A+ GMLPKN L    + +L  ++   H
  S:    43 LGRLASRIATILMGKHKPIWDPSTDCGDYVVVTNCAALYTTGQKKYRKTYYRHNTRPGSLRTVTMDVLMDKFGGSEVLRKAVSGMLPKNRLRDKRLARLKAFEGDAH 149
>gi|39939916|ref|XP_359495.1| hypothetical protein MGG_05282 [Magnaporthe grisea 70-15] >gi|145010435|gb|EDJ95091.1| hypothetical protein MGG_05282 [Magnaporthe grisea 70-15] (183 aa)
Score = 162, Expect = 3.9e-10, Identities = 35/106 (33%), Positives = 61/106 (57%)
  Q:    28 LGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKY-SDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           LG+LA   A IL GK+K  + P+ DCGDY+++ N   +  +  K  R+ +Y H+   G LK  +  ++++K+   +++  A+ GMLPKN L    + +L  ++   H
  S:    43 LGRLASRIATILMGKHKPIWDPSTDCGDYVVVTNCAALYTTGMKKYRKTYYRHNTRPGSLKSVTMDVLMDKFGGSEVLRKAVSGMLPKNRLRDKRLARLKAFEGEAH 149
>gi|169783474|ref|XP_001826199.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83774943|dbj|BAE65066.1| unnamed protein product [Aspergillus oryzae] (166 aa)
Score = 161, Expect = 4.7e-10, Identities = 38/119 (31%), Positives = 66/119 (55%)
  Q:    15 NKKWYVIDASN--LILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKY-SDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           ++ W+ +D       LG+LA   A  L GK+K  + P+ DCGDY++ +    +  +  K  ++K+YTH+   G L+  +   M EK+   +++  A+KGMLPKN L    + +L  ++   H
  S:    13 SRAWHHVDVGTDPRSLGRLASSIALFLMGKHKPIYDPSTDCGDYVVAVGCHDLKTTGKKRFQKKYYTHTTRPGSLRSMTMDKMFEKWGGGEVLRRAVKGMLPKNRLREKRLARLKTFEGLAH 134
>gi|71032509|ref|XP_765896.1| 60S ribosomal protein L13 [Theileria parva strain Muguga] >gi|68352853|gb|EAN33613.1| 60S ribosomal protein L13, putative [Theileria parva] (240 aa)
Score = 160, Expect = 6.2e-10, Identities = 37/116 (31%), Positives = 64/116 (55%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKW-YTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W++IDASN  +G +A   A IL+GK+   + PN   GD +II+N+  + ++    D + + +    +  G K  + + ++      ++  AIK MLP+N L  +  ++LFIY  A H
  S:    65 WHIIDASNKTVGSIASHVAVILQGKHLPTYQPNKVTGDNVIIVNAIHVTMNGHSWDTKVYKFDRKAHPKGPKIITAKTIMANNPGMILNLAIKRMLPRNKLRPFWYRRLFIYGGAIH 181
>gi|84999290|ref|XP_954366.1| ribosomal protein l13, putative [Theileria annulata strain Ankara] >gi|65305364|emb|CAI73689.1| ribosomal protein l13, putative [Theileria annulata] (257 aa)
Score = 160, Expect = 7.1e-10, Identities = 36/116 (31%), Positives = 65/116 (56%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKW-YTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W++IDA+N  +G +A   + IL+GK+   + PN   GD +II+N+  +V++    D + + +    +  G K  + + ++      ++  AIK MLP+N L  +  ++LFIY  A H
  S:    65 WHIIDAANKTVGSIASHVSVILQGKHLPTYQPNKVTGDNVIIVNAINVVMNGHSWDTKVYKFDRKAHPKGPKIITAKTIMANNPGMILNLAIKRMLPRNKLRPFWYRRLFIYGGAIH 181
>gi|114621494|ref|XP_001144947.1| PREDICTED: similar to mitochondrial ribosomal protein L13 (L13mt) isoform 2 [Pan troglodytes] >gi|114621496|ref|XP_001144876.1| PREDICTED: similar to mitochondrial ribosomal protein L13 (L13mt) isoform 1 [Pan troglodytes] (154 aa)
Score = 159, Expect = 8.0e-10, Identities = 33/104 (31%), Positives = 63/104 (60%)
  Q:    29 GKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           GKLA  A+  L+G +K  +    DCGD+++I+N+  I  S +K +++ + +H+GY GG ++ +   +  +    ++  AI GMLPKN   R ++++L ++ D +
  S:     5 GKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDED 108
>gi|72125718|ref|XP_790299.1| PREDICTED: similar to LOC496258 protein, partial [Strongylocentrotus purpuratus] (100 aa)
Score = 157, Expect = 1.4e-09, Identities = 28/83 (33%), Positives = 52/83 (62%)
  Q:     7 VKNEAALANKKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKE 89
           +  + A  ++ WY+IDA     G++AV  + +L+GK+K  + P  D GD++++IN+ ++  + DK + + +Y H+GY GG  E
  S:     5 ITQQWATFSRIWYLIDAYRQPPGRVAVAISKVLQGKHKPIYHPLSDVGDHVVVINTSQVAYAKDKWEEKIYYHHTGYPGGFSE 87
>gi|85109839|ref|XP_963113.1| hypothetical protein NCU07852 [Neurospora crassa OR74A] >gi|28924765|gb|EAA33877.1| hypothetical protein NCU07852 [Neurospora crassa OR74A] (183 aa)
Score = 157, Expect = 1.7e-09, Identities = 35/106 (33%), Positives = 60/106 (56%)
  Q:    28 LGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSD-KLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           LG+LA   A IL GK+K  + P+ DCGDY+++ N   +  +  K  R+ +Y H+   G L+  +   ++EK+   +++  A+ GMLPKN L    + +L  ++   H
  S:    43 LGRLASRIATILMGKHKPIWDPSTDCGDYVVVTNCAGLYTTGHKKWRKTYYRHNTRPGSLQAITMDALMEKHGGAEVLRKAVSGMLPKNRLRDKRLARLKAFEGDAH 149
>gi|50426555|ref|XP_461874.1| hypothetical protein DEHA0G08173g [Debaryomyces hansenii CBS767] >gi|49657544|emb|CAG90337.1| unnamed protein product [Debaryomyces hansenii CBS767] (174 aa)
Score = 157, Expect = 1.7e-09, Identities = 40/127 (31%), Positives = 70/127 (55%)
  Q:     7 VKNEAALANKKWYVID--ASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLK-EKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           + N A   ++ W+ +D  A    LG++A   A  L+GK+K  F+PN D GDY+++ N   + ++ +K     +++HS   G LK     R++  K   +++  A+KGM+PKN L    + +L +Y    H
  S:     5 IGNSALALSRVWHHVDVAADERTLGRIASSIALTLQGKHKPTFSPNRDHGDYVVVTNCAHLKVTGNKLQDRTYWSHSTRPGSLKLVPMERMIANKGYAEVLRRAVKGMIPKNKLRLIRMDRLKLYDGDEH 134
>gi|66880497|ref|ZP_00405478.1| COG0102: Ribosomal protein L13 [Mycoplasma genitalium G-37] (62 aa)
Score = 156, Expect = 1.8e-09, Identities = 32/57 (56%), Positives = 42/57 (73%)
  Q:    84 IGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           +GG+K+ SGR MI K SDKL++ A+KGMLP N LSR LI K+ ++K+  H   AQKP
  S:     1 MGGIKKTSGRDMINKNSDKLVFNAVKGMLPDNRLSRRLITKVHVFKNDKHNMEAQKP 57
>gi|46116566|ref|XP_384301.1| hypothetical protein FG04125.1 [Gibberella zeae PH-1] (179 aa)
Score = 154, Expect = 3.0e-09, Identities = 34/106 (32%), Positives = 61/106 (57%)
  Q:    28 LGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKY-SDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           LG+LA   A +L GK+K  F P+ DCGDY+++ N   +  +  K  ++ +Y H+   G LK  +  +++E++   +++  A+ GMLPKN L    + +L  ++   H
  S:    39 LGRLASRIAVLLMGKHKPIFDPSTDCGDYVVVTNCAALHTTGRKKWQKPYYRHTTRPGSLKTVTMDVLMEQHGGSEVLRKAVSGMLPKNRLRDKRLARLKAFEGDAH 145
>gi|28828553|gb|AAO51161.1| similar to Synechocystis sp. (strain PCC 6803). 50S ribosomal protein L13 [Dictyostelium discoideum] (200 aa)
Score = 151, Expect = 6.9e-09, Identities = 31/76 (40%), Positives = 52/76 (68%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNK--VDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGR 93
           W+VIDAS   +G+LA + + +LRGK+K   D +  ++CGDY++++N+ K+  +  K D++ +  HSGY   LKE S +
  S:    16 WHVIDASGHRVGRLATKISELLRGKHKPIYDRSVPLECGDYVVVLNAHKVEFTGKKWDQKMYRKHSGYPRWLKEPSQK 93
>gi|4929425|gb|AAD33988.1|AF147722_1 ribosomal protein L23 [Kluyveromyces lactis] (155 aa)
Score = 149, Expect = 1.1e-08, Identities = 34/118 (28%), Positives = 65/118 (55%)
  Q:    16 KKWYVIDASN--LILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           + W+ +D S      G++A + A  L GK+K  + P+ DCGDY+++ N   + ++ +K  ++ +++H+   G LK  +   MI  K   +++  A+ GM PKN   +    +L I+  + H
  S:    14 RMWHHVDMSKDKRTTGRVASQVATALMGKHKPVYHPSADCGDYVVVTNCQALRVTGNKMTQKTYWSHTSRPGSLKLTTMEDMISNKGYSEVLKKAVSGMTPKNKTRKIRTARLKIFDGSEH 134
>gi|68475105|ref|XP_718438.1| likely mitochondrial ribosomal protein (E. coli L13) [Candida albicans SC5314] >gi|68475646|ref|XP_718171.1| likely mitochondrial ribosomal protein (E. coli L13) [Candida albicans SC5314] >gi|46439927|gb|EAK99239.1| likely mitochondrial ribosomal protein (E. coli L13) [Candida albicans SC5314] >gi|46440203|gb|EAK99512.1| likely mitochondrial ribosomal protein (E. coli L13) [Candida albicans SC5314] (176 aa)
Score = 148, Expect = 1.6e-08, Identities = 39/123 (31%), Positives = 69/123 (56%)
  Q:    11 AALANKKWYVID--ASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIE-KYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           A+   + W+ +D  A N  LG+LA   A  L GK+K  +TPN D GDY+++ N   + ++ +K   + +++H+   G L+      MI+ K   ++I  A+KGM+PKN      + +L ++   +H
  S:     9 ASALTRVWHHVDVAADNRSLGRLASSIAITLMGKHKPTYTPNRDHGDYVVVTNCAHLKVTGNKLKEKTYWSHTTRPGTLRLVPMERMIDNKGYGEIIKRAVKGMIPKNKHRLVRMDRLKLFDGDDH 134
>gi|158298887|ref|XP_319028.4| AGAP009908-PA [Anopheles gambiae str. PEST] >gi|157014102|gb|EAA14080.4| AGAP009908-PA [Anopheles gambiae str. PEST] (177 aa)
Score = 147, Expect = 2.2e-08, Identities = 37/116 (31%), Positives = 71/116 (61%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILR----GKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGG--------LKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDA 131
           + W++ D +     +   EAA+++R    G +K  + P  DCGD++++IN+ +I L  D+  +  ++ H+GY GG        L EK   ++++    K +Y A+KG L +    R+ +++L ++KDA
  S:    14 RTWHIFDCT----WQNPFEAASLIRKHLMGLHKPIYHPMNDCGDHVVVINTGEIALPGDEWKKRAYFHHTGYAGGATWTLAWQLHEKDPTMIMK----KAVYRAMKGNLQR----RHTMQRLHLFKDA 129
>gi|157137689|ref|XP_001657133.1| 39S ribosomal protein L13, mitochondrial [Aedes aegypti] >gi|108880790|gb|EAT45015.1| 39S ribosomal protein L13, mitochondrial [Aedes aegypti] (178 aa)
Score = 141, Expect = 9.9e-08, Identities = 39/135 (28%), Positives = 72/135 (53%)
  Q:     1 MQKTTFVKNEAALANKKWYVIDASNLILGKLAVEAANILR----GKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQ 135
           M  T  V+  A  A + W+V D +     +   E+A+++R    G +K  + P  DCGD++++IN+ +I L  D+  +  ++ H+GY GG        + EK   +++  AI   +  N   R+ +++L ++KD N  Q
  S:     1 MSVTRRVQQWATFA-RTWHVYDCT----WQNPFESASLIRKHLMGLHKPIYHPMNDCGDHVVVINTAEIALPGDEWKKRVYFHHTGYAGGASWTLAWELHEKDPTQIMKKAIYRSMHGNLQRRHTMQRLHLFKDDNVPQ 134
>gi|115384678|ref|XP_001208886.1| 60S ribosomal protein L23, mitochondrial precursor [Aspergillus terreus NIH2624] >gi|114196578|gb|EAU38278.1| 60S ribosomal protein L23, mitochondrial precursor [Aspergillus terreus NIH2624] (127 aa)
Score = 139, Expect = 1.8e-07, Identities = 30/93 (32%), Positives = 53/93 (56%)
  Q:    41 GKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKY-SDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           GK+K  + P+ DCGDY++ I    +  +  K  ++K+YTH+   G L+  +   M EK+   +++  A++GMLPKN L    + +L  ++   H
  S:     2 GKHKPIYDPSTDCGDYVVAIGCHDLRTTGKKRFQKKYYTHTTRPGSLRSMTMDKMFEKWGGGEVLRRAVRGMLPKNRLREKRLARLKTFEGVAH 95
>gi|153820432|ref|ZP_01973099.1| ribosomal protein L13 [Vibrio cholerae NCTC 8457] >gi|153827389|ref|ZP_01980056.1| ribosomal protein L13 [Vibrio cholerae MZO-2] >gi|126509026|gb|EAZ71620.1| ribosomal protein L13 [Vibrio cholerae NCTC 8457] >gi|149738692|gb|EDM53034.1| ribosomal protein L13 [Vibrio cholerae MZO-2] >gi|150422852|gb|EDN14804.1| ribosomal protein L13 [Vibrio cholerae AM-19226] (70 aa)
Score = 133, Expect = 8.3e-07, Identities = 27/64 (42%), Positives = 40/64 (62%)
  Q:    77 WYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANHKQAAQKP 140
           ++ HS + GGLK  S   +IE+  + ++  A+KGMLPK  L R + +KL +Y  A H  AAQ+P
  S:     2 YHRHSEFPGGLKSFSFEKLIERKPEMVLELAVKGMLPKGPLGRAMYRKLKVYAGAEHNHAAQQP 65
>gi|124801264|ref|XP_001349647.1| Ribosomal protein L13, putative [Plasmodium falciparum 3D7] >gi|23503402|gb|AAC71918.2| Ribosomal protein L13, putative [Plasmodium falciparum 3D7] (212 aa)
Score = 132, Expect = 1.2e-06, Identities = 33/116 (28%), Positives = 60/116 (51%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKW-YTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W+VIDA+N  +G LA   + +L+GK +VD+ PN      +I++N+  +       D + + +    +    K  S + +  +    ++  A+K MLP N L +   +KL++Y  A H
  S:    66 WFVIDATNKSVGSLAACISKLLQGKYRVDYNPNKVNSSSVIVVNAIHVKFYGHTWDTKIYKFPRKSHSKSHKILSCKTVFARNPSMILNLAVKRMLPNNRLRQIFYRKLYVYPGALH 182
>gi|71410787|ref|XP_807671.1| ribosomal protein L13, putative [Trypanosoma cruzi strain CL Brener] >gi|71424291|ref|XP_812745.1| ribosomal protein L13, putative [Trypanosoma cruzi strain CL Brener] >gi|70871723|gb|EAN85820.1| ribosomal protein L13, putative [Trypanosoma cruzi] >gi|70877563|gb|EAN90894.1| ribosomal protein L13, putative [Trypanosoma cruzi] (202 aa)
Score = 132, Expect = 1.3e-06, Identities = 34/125 (27%), Positives = 68/125 (54%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKL----------FIYKDANHKQAAQKP 140
           ++W+++DA    L ++A  AA  + G+++ DFTP +  GD++II+N   +V+  D+  R      + Y GG        M E+    L++  +     K+ ++R+ ++KL          ++Y+D+ H    + P
  S:    42 ERWWILDAKGEQLPRVAAVAAQYITGQHRPDFTPGMISGDHVIIVNIKDVVMVGDEWIRVPITWQTAYPGGKYRIRLTDMYERDPCMLMWWFL-----KDEVNRHFVRKLKTRVAPLEKAWLYEDSVHPHGEKNP 171
>gi|72387666|ref|XP_844257.1| 50S ribosomal protein L13, putative [Trypanosoma brucei TREU927] >gi|62360518|gb|AAX80931.1| 50S ribosomal protein L13, putative [Trypanosoma brucei] >gi|70800790|gb|AAZ10698.1| 50S ribosomal protein L13, putative [Trypanosoma brucei] (202 aa)
Score = 131, Expect = 1.6e-06, Identities = 34/125 (27%), Positives = 69/125 (55%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKL----------FIYKDANHKQAAQKP 140
           ++W+++DA    L ++A  AA  + G+++ DFTP +  GD+++I+N   +V+  D+  R      + Y GG        M E+    L++  +     K+ ++R+ ++KL          ++Y+D+ H  A + P
  S:    42 ERWWLLDARGEQLPRVAAVAAQYITGQHRPDFTPGMITGDHVVIVNIKDVVMVGDQWIRVPITWQTAYPGGKYRIRLTDMYERDPCMLMWWFL-----KDEVNRHFVRKLKTRIAPLEKAWLYEDSIHPHADKNP 171
>gi|70932631|ref|XP_737808.1| hypothetical protein PC300468.00.0 [Plasmodium chabaudi chabaudi] >gi|56513502|emb|CAH83368.1| hypothetical protein PC300468.00.0 [Plasmodium chabaudi] (168 aa)
Score = 123, Expect = 1.2e-05, Identities = 33/116 (28%), Positives = 60/116 (51%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKW-YTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W+VIDA N  +G L+V  + +L+GK +VD+  N      +I++N+  +       D + + +    +  G K  + + +  +    ++  A+K MLP N L +   +KLF+Y  A H
  S:    22 WFVIDAYNKSVGSLSVCISKLLQGKYRVDYNSNRVNSSSVIVVNAIHLKFYGHTWDTKIYKFPRKSHSKGHKILTCKTVFARNPSMILNLAVKRMLPNNRLRQIYYRKLFVYPGALH 138
>gi|70947086|ref|XP_743192.1| Ribosomal protein L13 [Plasmodium chabaudi chabaudi] >gi|56522573|emb|CAH77708.1| Ribosomal protein L13, putative [Plasmodium chabaudi] (212 aa)
Score = 123, Expect = 1.3e-05, Identities = 33/116 (28%), Positives = 60/116 (51%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKW-YTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W+VIDA N  +G L+V  + +L+GK +VD+  N      +I++N+  +       D + + +    +  G K  + + +  +    ++  A+K MLP N L +   +KLF+Y  A H
  S:    66 WFVIDAYNKSVGSLSVCISKLLQGKYRVDYNSNRVNSSSVIVVNAIHLKFYGHTWDTKIYKFPRKSHSKGHKILTCKTVFARNPSMILNLAVKRMLPNNRLRQIYYRKLFVYPGALH 182
>gi|157876227|ref|XP_001686472.1| 50S ribosomal protein L13-like protein [Leishmania major] >gi|68129546|emb|CAJ08089.1| 50S ribosomal protein L13-like protein [Leishmania major] (171 aa)
Score = 120, Expect = 2.8e-05, Identities = 33/125 (26%), Positives = 66/125 (52%)
  Q:    16 KKWYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKL----------FIYKDANHKQAAQKP 140
           ++W+++DA    L  +A  AA  + G+++ DFTP +  GD+++I N    V++ D   R      + Y GG        M E+    +++  +     K+ ++R+ ++KL          ++Y+D+ H  A + P
  S:    11 ERWWLLDARGQQLPHVAKIAAQYMTGQHRPDFTPGMMTGDHVVITNIKDAVMTGDNWIRVPITWQTAYPGGKYRVRLSEMYERDPCMVMWWYL-----KDEVNRHFVRKLKTRTAPLEKAWLYEDSVHPHAEKNP 140
>gi|48142734|ref|XP_397367.1| PREDICTED: similar to mitochondrial ribosomal protein L13 CG10603-PA [Apis mellifera] (178 aa)
Score = 119, Expect = 4.2e-05, Identities = 38/115 (33%), Positives = 59/115 (51%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKWYTHSGYIGG--------LKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDAN 132
           W++ DA+     + A      L G  K  + P   CGD++IIINS  I L  ++  +  ++ H+ YIGG        L  K   L+ +    K IY A+ G L +    RY +++L I+ D N
  S:    17 WHIFDATWQDPFQSAPLIKKYLMGLYKPIYHPLNKCGDHVIIINSKDIALRGNEWQKRVYFHHTTYIGGASWTLAWELHSKDPTLIFK----KAIYSAMDGNLQR----RYTMERLHIFPDEN 131
>gi|67983599|ref|XP_669176.1| hypothetical protein PB300108.00.0 [Plasmodium berghei strain ANKA] >gi|56482990|emb|CAI01166.1| hypothetical protein PB300108.00.0 [Plasmodium berghei] (151 aa)
Score = 118, Expect = 4.5e-05, Identities = 33/116 (28%), Positives = 59/116 (50%)
  Q:    18 WYVIDASNLILGKLAVEAANILRGKNKVDFTPNVDCGDYLIIINSDKIVLSSDKADREKW-YTHSGYIGGLKEKSGRLMIEKYSDKLIYGAIKGMLPKNTLSRYLIKKLFIYKDANH 133
           W+VIDA N  +G L+V  + +L+GK +VD+  N      +I++N+  +       D + + +       G K  + + +  +    ++  A+K MLP N L +   +KLF+Y  A H
  S:     5 WFVIDAYNKSVGSLSVCISKLLQGKYRVDYNSNRVNSSSVIVVNAIHLKFYGHTWDTKIYKFPRKSNSKGHKILTCKTVFARNPSMILNLAVKRMLPNNRLRQIYYRKLFVYPGALH 121