>gi|26553534|ref|NP_757468.1| 30S ribosomal protein S9 [Mycoplasma penetrans HF-2] >gi|39932208|sp|Q8EWW8|RS9_MYCPE 30S ribosomal protein S9 >gi|26453540|dbj|BAC43872.1| ribosomal protein S9 [Mycoplasma penetrans HF-2] (130 aa)
Score = 610, Expect = 3.9e-62, Identities = 130/130 (100%), Positives = 130/130 (100%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR
  S:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
>gi|13358141|ref|NP_078415.1| 30S ribosomal protein S9 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971231|ref|ZP_02553508.1| ribosomal protein S9 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168281947|ref|ZP_02689614.1| ribosomal protein S9 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308095|ref|ZP_02690770.1| ribosomal protein S9 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762446|ref|YP_001752661.1| ribosomal protein S9 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189045722|sp|B1AJL7|RS9_UREP2 30S ribosomal protein S9 >gi|20139950|sp|Q9PPR3|RS9_UREPA 30S ribosomal protein S9 >gi|11276568|pir||D82873 ribosomal protein S9 UU576 [imported] - Ureaplasma urealyticum >gi|6899585|gb|AAF30990.1|AE002156_5 ribosomal protein S9 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828023|gb|ACA33285.1| ribosomal protein S9 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902637|gb|EDT48926.1| ribosomal protein S9 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675894|gb|EDT87799.1| ribosomal protein S9 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700873|gb|EDU19155.1| ribosomal protein S9 [Ureaplasma parvum serovar 6 str. ATCC 27818] (133 aa)
Score = 430, Expect = 3.6e-41, Identities = 87/127 (68%), Positives = 105/127 (82%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           VEYKGLGRRKSS+A VKLVPG+GK+L+N R+P  YFPN LVIQDM QPLV+T T + +DV+VKV+GGGF GQAGAIRLGI RAL+    D +  L+ + ++TRD R KERKK+GLYGARR+PQFTKR
  S:     7 VEYKGLGRRKSSIARVKLVPGSGKVLVNDRQPENYFPNKLVIQDMMQPLVLTKTAETYDVYVKVIGGGFNGQAGAIRLGITRALIQTREDLKTDLRKAGLVTRDSRVKERKKFGLYGARRAPQFTKR 133
>gi|167940804|ref|ZP_02527879.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 8] >gi|167958879|ref|ZP_02545951.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973417|ref|ZP_02555694.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974163|ref|ZP_02556440.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975444|ref|ZP_02557721.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988823|ref|ZP_02570494.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337849|ref|ZP_02694464.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 10] >gi|168362517|ref|ZP_02695696.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808060|ref|ZP_02829119.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 2] >gi|195867439|ref|ZP_03079443.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903330|gb|EDT49619.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208949|gb|EDU05992.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018710|gb|EDU56750.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998075|gb|EDU67172.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660100|gb|EDX53480.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660915|gb|EDX54168.1| ribosomal protein S9 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (133 aa)
Score = 428, Expect = 5.2e-41, Identities = 87/127 (68%), Positives = 104/127 (81%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           VEYKGLGRRKSS+A VKLVPG+GK+ IN R+P  YFPN LVIQDM QPLV+T T + +DV+VKV+GGGF GQAGAIRLGI RAL+    D +  L+ + ++TRD R KERKK+GLYGARR+PQFTKR
  S:     7 VEYKGLGRRKSSIARVKLVPGSGKVFINDRQPENYFPNKLVIQDMMQPLVLTKTAETYDVYVKVIGGGFNGQAGAIRLGITRALIQTREDLKTDLRKAGLVTRDSRVKERKKFGLYGARRAPQFTKR 133
>gi|31544498|ref|NP_853076.1| hypothetical protein MGA_1055 [Mycoplasma gallisepticum R] >gi|39932041|sp|Q7NBH4|RS9_MYCGA 30S ribosomal protein S9 >gi|31541343|gb|AAP56644.1| RpsI [Mycoplasma gallisepticum R] (131 aa)
Score = 401, Expect = 6.8e-38, Identities = 86/130 (66%), Positives = 103/130 (79%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V +KGLGRRKSS A VKL PG+GK++IN RK  +YFPN +VIQDM QPL +T T   +D+ V V GGGFTGQAGAIRLGIARAL+  N + +K LK  K++TRD R KERKK+GLYGARR+PQFTKR
  S:     2 MAVVTFKGLGRRKSSTALVKLTPGSGKLVINNRKAEDYFPNKIVIQDMRQPLEVTKTASIYDINVVVNGGGFTGQAGAIRLGIARALVNMNPELKKQLKQHKLVTRDARVKERKKFGLYGARRAPQFTKR 131
>gi|167925160|ref|ZP_02512251.1| 30S ribosomal protein S9 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (132 aa)
Score = 391, Expect = 1.1e-36, Identities = 80/127 (62%), Positives = 101/127 (79%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y+G GRRKSS+A V L PG+G I +N +   E+FP + ++QD+EQPLV T+T K+FD+ VKV+GGGFTGQAGA RLGIARALL A+ D+RK L+   +LTRD R KERKKYGL GARR+PQ++KR
  S:     6 VIYRGTGRRKSSIAQVILTPGSGSITVNGKPALEFFPYATLVQDLEQPLVATNTLKDFDIIVKVIGGGFTGQAGATRLGIARALLQASEDYRKLLRDQGLLTRDARIKERKKYGLRGARRAPQYSKR 132
>gi|42561238|ref|NP_975689.1| 30S ribosomal protein S9 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|83319563|ref|YP_424626.1| 30S ribosomal protein S9 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|42492736|emb|CAE77331.1| 30S RIBOSOMAL PROTEIN S9 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|83283449|gb|ABC01381.1| 30S ribosomal protein S9 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (132 aa)
Score = 389, Expect = 1.8e-36, Identities = 80/127 (62%), Positives = 101/127 (79%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y+G GRRKSS+A V L PG+G I +N +   E+FP + ++QD+EQPLV T+T K+FD+ VKV+GGGFTGQAGA RLGIARALL A+ D+RK L+   +LTRD R KERKKYGL GARR+PQ++KR
  S:     6 VIYRGTGRRKSSIAQVILTPGSGLITVNGKPALEFFPYATLVQDLEQPLVATNTLKDFDIIVKVIGGGFTGQAGATRLGIARALLQASEDYRKLLRDQGLLTRDARIKERKKYGLRGARRAPQYSKR 132
>gi|52078644|ref|YP_077435.1| 30S ribosomal protein S9 [Bacillus licheniformis ATCC 14580] >gi|52784006|ref|YP_089835.1| 30S ribosomal protein S9 [Bacillus licheniformis ATCC 14580] >gi|81691241|sp|Q65P72|RS9_BACLD 30S ribosomal protein S9 >gi|52001855|gb|AAU21797.1| ribosomal protein S9 [Bacillus licheniformis ATCC 14580] >gi|52346508|gb|AAU39142.1| RpsI [Bacillus licheniformis DSM 13] (130 aa)
Score = 388, Expect = 2.3e-36, Identities = 79/130 (60%), Positives = 105/130 (80%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I++N R+ +E+ P++ +I+D++QPL +T+T   +DV V V GGGF+GQAGAIR GIARALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGEGRIIVNNREISEHIPSAALIEDIKQPLTLTETAGTYDVLVNVHGGGFSGQAGAIRHGIARALLEADPEYRSTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|157690934|ref|YP_001485396.1| 30S ribosomal protein S9 [Bacillus pumilus SAFR-032] >gi|194017641|ref|ZP_03056252.1| ribosomal protein S9 [Bacillus pumilus ATCC 7061] >gi|167012620|sp|A8F9B9|RS9_BACP2 30S ribosomal protein S9 >gi|157679692|gb|ABV60836.1| ribosomal protein S9 [Bacillus pumilus SAFR-032] >gi|194010913|gb|EDW20484.1| ribosomal protein S9 [Bacillus pumilus ATCC 7061] (130 aa)
Score = 385, Expect = 6.0e-36, Identities = 79/130 (60%), Positives = 104/130 (80%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I++N R+  EY P + +I+D++QPL IT+T  ++DV V V GGGF+GQAGAIR GI+RALL  + ++R +LK + +LTRDPR KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREITEYIPFAALIEDVKQPLNITETANSYDVLVTVHGGGFSGQAGAIRHGISRALLEVDPEYRTSLKRAGLLTRDPRMKERKKYGLKGARRAPQFSKR 130
>gi|16077218|ref|NP_388031.1| 30S ribosomal protein S9 [Bacillus subtilis subsp. subtilis str. 168] >gi|2507325|sp|P21470|RS9_BACSU 30S ribosomal protein S9 (BS10) >gi|1644208|dbj|BAA10989.1| ribosomal protein S9 [Bacillus subtilis] >gi|2632417|emb|CAB11926.1| ribosomal protein S9 [Bacillus subtilis subsp. subtilis str. 168] (130 aa)
Score = 381, Expect = 1.7e-35, Identities = 78/130 (60%), Positives = 104/130 (80%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I++N R+ +E+ P++ +I+D++QPL +T+T   +DV V V GGG +GQAGAIR GIARALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|154684668|ref|YP_001419829.1| 30S ribosomal protein S9 [Bacillus amyloliquefaciens FZB42] >gi|166228553|sp|A7Z0S2|RS9_BACA2 30S ribosomal protein S9 >gi|154350519|gb|ABS72598.1| RpsI [Bacillus amyloliquefaciens FZB42] (130 aa)
Score = 379, Expect = 2.9e-35, Identities = 78/130 (60%), Positives = 103/130 (79%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I++N R+ +E+ P+  +I+D++QPL +T+T   +DV V V GGG +GQAGAIR GIARALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSPALIEDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRATLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|171326685|ref|ZP_02915134.1| ribosomal protein S9 [Geobacillus sp. WCH70] >gi|171087324|gb|EDT33733.1| ribosomal protein S9 [Geobacillus sp. WCH70] (130 aa)
Score = 377, Expect = 4.8e-35, Identities = 80/130 (61%), Positives = 101/130 (77%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I+IN R   +Y P+  +I+ ++QPLV+T+T  N+DV V V GGGF+GQAGAIR GIARALL  + D+R  LK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGRIVINDRDIRDYIPSEALIEVVKQPLVLTETLGNYDVLVNVKGGGFSGQAGAIRHGIARALLQVDPDYRPVLKRAGLLTRDARVKERKKYGLKGARRAPQFSKR 130
>gi|50365309|ref|YP_053734.1| 30S ribosomal protein S9 [Mesoplasma florum L1] >gi|81695663|sp|Q6F0X3|RS9_MESFL 30S ribosomal protein S9 >gi|50363865|gb|AAT75850.1| 30S ribosomal protein S9 [Mesoplasma florum L1] (131 aa)
Score = 377, Expect = 5.0e-35, Identities = 80/127 (62%), Positives = 97/127 (76%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y+G GRRK+SVA V L PG G I++N     E+FP   ++QD+EQPLV T T K+FD+ V V GGGFTGQAGA RLGIARALLVA+ D+RK L+   +LTRD R KERKKYGL GARR+PQ++KR
  S:     5 VIYRGTGRRKTSVAQVILTPGKGNIIVNGVPALEFFPYPTLVQDLEQPLVATGTEKDFDITVTVKGGGFTGQAGATRLGIARALLVASEDYRKGLRAVGLLTRDARIKERKKYGLRGARRAPQYSKR 131
>gi|13508355|ref|NP_110305.1| 30S ribosomal protein S9 [Mycoplasma pneumoniae M129] >gi|2500423|sp|P75179|RS9_MYCPN 30S ribosomal protein S9 >gi|1673892|gb|AAB95874.1| ribosomal protein S9 [Mycoplasma pneumoniae M129] (132 aa)
Score = 373, Expect = 1.2e-34, Identities = 89/130 (68%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVP--GTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M    Y GLGRRKSS A V L P    GKI +N+R P+EYFPN LVIQDMEQPL +TD +KNFD+ V V GGGFTGQAGAIRLGI RALL  N + +K LK  K+ TRD R KERKK+GLYGARR+PQFTKR
  S:     1 MEKQSYYGLGRRKSSSAKVYLTPTQDKGKITVNRRDPSEYFPNKLVIQDMEQPLDLTDLKKNFDINVVVKGGGFTGQAGAIRLGIVRALLQFNPELKKILKSKKLTTRDKRVKERKKFGLYGARRAPQFTKR 132
>gi|16801806|ref|NP_472074.1| 30S ribosomal protein S9 [Listeria innocua Clip11262] >gi|46908768|ref|YP_015157.1| 30S ribosomal protein S9 [Listeria monocytogenes str. 4b F2365] >gi|47093536|ref|ZP_00231297.1| ribosomal protein S9 [Listeria monocytogenes str. 4b H7858] >gi|153168761|ref|ZP_01928522.1| hypothetical protein LMHG_00811 [Listeria monocytogenes FSL N1-017] >gi|153204247|ref|ZP_01945044.1| hypothetical protein LMSG_00016 [Listeria monocytogenes HPB2262] >gi|167015695|ref|ZP_02278228.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL J1-194] >gi|167215263|ref|ZP_02285570.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL R2-503] >gi|167218392|ref|ZP_02288028.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL J1-175] >gi|167455064|ref|ZP_02321287.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL J2-064] >gi|168266814|ref|ZP_02688779.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL J2-071] >gi|20139891|sp|Q927P3|RS9_LISIN 30S ribosomal protein S9 >gi|67461156|sp|Q71WI2|RS9_LISMF 30S ribosomal protein S9 >gi|16415281|emb|CAC97971.1| ribosomal protein S9 [Listeria innocua] >gi|46882041|gb|AAT05334.1| ribosomal protein S9 [Listeria monocytogenes str. 4b F2365] >gi|47018096|gb|EAL08868.1| ribosomal protein S9 [Listeria monocytogenes str. 4b H7858] >gi|133725995|gb|EBA27693.1| hypothetical protein LMHG_00811 [Listeria monocytogenes FSL N1-017] >gi|133734027|gb|EBA35725.1| hypothetical protein LMSG_00016 [Listeria monocytogenes HPB2262] (130 aa)
Score = 373, Expect = 1.4e-34, Identities = 79/130 (60%), Positives = 99/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG GKI+IN R   +Y P + + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR G+ARALL    ++R  LK + +LTRDPR KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEYRPALKSAGLLTRDPRMKERKKYGLKGARRAPQFSKR 130
>gi|167756119|ref|ZP_02428246.1| hypothetical protein CLORAM_01639 [Clostridium ramosum DSM 1402] >gi|167704111|gb|EDS18690.1| hypothetical protein CLORAM_01639 [Clostridium ramosum DSM 1402] (130 aa)
Score = 371, Expect = 2.5e-34, Identities = 78/130 (60%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+NV+Y+G GRRKSSVA V L PGTG I+IN +   EY P+ +++  + QPL +T+T   FDV V V GGG++GQAGAIR GI+RALL A  D+R TLK +  LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MANVQYRGTGRRKSSVARVILTPGTGNIVINDKPAKEYLPSDVLLMIVNQPLELTNTTSQFDVSVNVYGGGYSGQAGAIRHGISRALLQAGTDYRPTLKAAGFLTRDARVKERKKYGLKKARRAPQFSKR 130
>gi|149183449|ref|ZP_01861881.1| 30S ribosomal protein S9P [Bacillus sp. SG-1] >gi|148848859|gb|EDL63077.1| 30S ribosomal protein S9P [Bacillus sp. SG-1] (130 aa)
Score = 368, Expect = 4.8e-34, Identities = 81/130 (62%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG GKI+IN R+   Y P   + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR GIARALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGNGKIVINDREVENYIPFEALREVIKQPLVATETVGNYDVLVNVNGGGYTGQAGAIRHGIARALLQADPEYRGTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|89100311|ref|ZP_01173176.1| 30S ribosomal protein S9 [Bacillus sp. NRRL B-14911] >gi|89084932|gb|EAR64068.1| 30S ribosomal protein S9 [Bacillus sp. NRRL B-14911] (130 aa)
Score = 367, Expect = 6.0e-34, Identities = 80/130 (61%), Positives = 101/130 (77%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG GKI+IN R+   Y P + + + ++QPLV T+T  ++D+ V V GGG+TGQAGAIR GIARALL A+ +FR TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYIGTGRRKSSVARVRLVPGDGKIIINGREIESYIPFAALREVVKQPLVATETLNSYDILVNVNGGGYTGQAGAIRHGIARALLQADPEFRPTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|15925207|ref|NP_372741.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus Mu50] >gi|15927797|ref|NP_375330.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus N315] >gi|49484431|ref|YP_041655.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486999|ref|YP_044220.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus MSSA476] >gi|148268657|ref|YP_001247600.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus JH9] >gi|150394722|ref|YP_001317397.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus JH1] >gi|151222331|ref|YP_001333153.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980532|ref|YP_001442791.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus Mu3] >gi|168727000|ref|ZP_02759277.1| ribosomal protein S9 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166229608|sp|A7X5B3|RS9_STAA1 30S ribosomal protein S9 >gi|172049001|sp|A6QJ59|RS9_STAAE 30S ribosomal protein S9 >gi|189045718|sp|A6U3U2|RS9_STAA2 30S ribosomal protein S9 >gi|189045719|sp|A5IV01|RS9_STAA9 30S ribosomal protein S9 >gi|54039561|sp|P66646|RS9_STAAN 30S ribosomal protein S9 >gi|54039562|sp|P66647|RS9_STAAW 30S ribosomal protein S9 >gi|54041998|sp|P66645|RS9_STAAM 30S ribosomal protein S9 >gi|81696287|sp|Q6G7A4|RS9_STAAS 30S ribosomal protein S9 >gi|81696449|sp|Q6GEL8|RS9_STAAR 30S ribosomal protein S9 >gi|13702017|dbj|BAB43309.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus N315] >gi|14247990|dbj|BAB58379.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus Mu50] >gi|49242560|emb|CAG41281.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245442|emb|CAG43919.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus MSSA476] >gi|147741726|gb|ABQ50024.1| SSU ribosomal protein S9P [Staphylococcus aureus subsp. aureus JH9] >gi|149947174|gb|ABR53110.1| ribosomal protein S9 [Staphylococcus aureus subsp. aureus JH1] >gi|150375131|dbj|BAF68391.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722667|dbj|BAF79084.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus Mu3] (130 aa)
Score = 367, Expect = 6.3e-34, Identities = 79/130 (60%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ VEY+G GRRK+SVA V+LVPG G I +N R   EY P   +I D+ QP  +T+T+ N+DV V V GGGFTGQA AIR GIARALL A+ ++R +LK + +LTRDPR KERKK GL  ARRSPQF+KR
  S:     1 MAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSKR 130
>gi|70725837|ref|YP_252751.1| 30S ribosomal protein S9 [Staphylococcus haemolyticus JCSC1435] >gi|82581626|sp|Q4L880|RS9_STAHJ 30S ribosomal protein S9 >gi|68446561|dbj|BAE04145.1| 30S ribosomal protein S9 [Staphylococcus haemolyticus JCSC1435] (130 aa)
Score = 366, Expect = 7.9e-34, Identities = 79/130 (60%), Positives = 98/130 (75%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ VEY+G GRRK+SVA V+LVPG G I +N+R   EY P   +I D+ QP  +T+T+ N+DV V V GGGFTGQA AIR GIARALL A+ ++R +LK + +LTRDPR KERKK GL  ARRSPQF+KR
  S:     1 MAQVEYRGTGRRKNSVARVRLVPGEGNITVNERDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKKARRSPQFSKR 130
>gi|27468708|ref|NP_765345.1| 30S ribosomal protein S9 [Staphylococcus epidermidis ATCC 12228] >gi|57867737|ref|YP_189361.1| 30S ribosomal protein S9 [Staphylococcus epidermidis RP62A] >gi|38258356|sp|Q8CRJ0|RS9_STAES 30S ribosomal protein S9 >gi|81673652|sp|Q5HM32|RS9_STAEQ 30S ribosomal protein S9 >gi|27316256|gb|AAO05431.1|AE016750_36 30S ribosomal protein S9 [Staphylococcus epidermidis ATCC 12228] >gi|57638395|gb|AAW55183.1| ribosomal protein S9 [Staphylococcus epidermidis RP62A] (130 aa)
Score = 366, Expect = 8.8e-34, Identities = 79/130 (60%), Positives = 98/130 (75%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ VEYKG GRRK+SVA V+LVPG G I +N+R   +Y P   +I D+ QP  +T+T+ N+DV V V GGGFTGQA AIR GIARALL A+ ++R +LK + +LTRDPR KERKK GL  ARRSPQF+KR
  S:     1 MAQVEYKGTGRRKNSVARVRLVPGEGNITVNERDVRDYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKKARRSPQFSKR 130
>gi|169349497|ref|ZP_02866435.1| hypothetical protein CLOSPI_00215 [Clostridium spiroforme DSM 1552] >gi|169293572|gb|EDS75705.1| hypothetical protein CLOSPI_00215 [Clostridium spiroforme DSM 1552] (130 aa)
Score = 365, Expect = 1.2e-33, Identities = 76/130 (58%), Positives = 96/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+NV+Y+G GRRK+SVA V L PGTG  +IN +   EY P+ +++  + QPL +T+T   FDV V V GGG++GQAGAIR GI+RALL A  D+R TLK +  LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MANVQYRGTGRRKASVARVILTPGTGNFVINDKPAKEYLPSDVLLMIVNQPLELTNTTSQFDVSVNVYGGGYSGQAGAIRHGISRALLQAGEDYRPTLKAAGFLTRDARVKERKKYGLKKARRAPQFSKR 130
>gi|21283865|ref|NP_646953.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus MW2] >gi|57650801|ref|YP_187016.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus COL] >gi|82751807|ref|YP_417548.1| 30S ribosomal protein S9 [Staphylococcus aureus RF122] >gi|87161732|ref|YP_494806.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus USA300] >gi|88196129|ref|YP_500946.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161510421|ref|YP_001576080.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122538870|sp|Q2FW39|RS9_STAA8 30S ribosomal protein S9 >gi|123484816|sp|Q2FES2|RS9_STAA3 30S ribosomal protein S9 >gi|123549319|sp|Q2YYM9|RS9_STAAB 30S ribosomal protein S9 >gi|189045720|sp|A8Z324|RS9_STAAT 30S ribosomal protein S9 >gi|81693977|sp|Q5HDZ1|RS9_STAAC 30S ribosomal protein S9 >gi|21205307|dbj|BAB96001.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus MW2] >gi|57284987|gb|AAW37081.1| ribosomal protein S9 [Staphylococcus aureus subsp. aureus COL] >gi|82657338|emb|CAI81779.1| 30S ribosomal protein S9 [Staphylococcus aureus RF122] >gi|87127706|gb|ABD22220.1| 30S ribosomal protein S9 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203687|gb|ABD31497.1| ribosomal protein S9, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|160369230|gb|ABX30201.1| ribosomal protein S9 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (132 aa)
Score = 365, Expect = 1.2e-33, Identities = 78/130 (60%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++ VEY+G GRRK+SVA V+LVPG G I +N R   EY P   +I D+ QP  +T+T+ N+DV V V GGGFTGQA AIR GIARALL A+ ++R +LK + +LTRDPR KERKK GL  ARRSPQF+KR
  S:     3 LAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSKR 132
>gi|110005509|emb|CAK99831.1| 30s ribosomal protein s9 [Spiroplasma citri] (133 aa)
Score = 364, Expect = 1.4e-33, Identities = 74/127 (58%), Positives = 99/127 (77%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y+G GRRKSS+A V L PG G +++N +   ++FP + ++QD+EQPL IT ++  FD+ VKV GGGFTGQAGA RLGIARAL+ A+ D++  L+ + MLTRD R KERKKYGL+GARR+PQ++KR
  S:     7 VIYRGTGRRKSSIAQVVLTPGKGNVVVNGKPALKFFPYATLVQDLEQPLEITGSKSEFDIRVKVSGGGFTGQAGATRLGIARALVEASQDYKTLLRHAGMLTRDARIKERKKYGLHGARRAPQYSKR 133
>gi|126650663|ref|ZP_01722886.1| 30S ribosomal protein S9 [Bacillus sp. B14905] >gi|169829998|ref|YP_001700156.1| 30S ribosomal protein S9 [Lysinibacillus sphaericus C3-41] >gi|126592819|gb|EAZ86818.1| 30S ribosomal protein S9 [Bacillus sp. B14905] >gi|168994486|gb|ACA42026.1| 30S ribosomal protein S9 [Lysinibacillus sphaericus C3-41] (130 aa)
Score = 363, Expect = 1.8e-33, Identities = 79/130 (60%), Positives = 101/130 (77%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPGTGKI+IN+R+  EY P + + + ++QPLV T+T  ++D+ V V GGG+TGQAGA+R GIARALL  + DFR  LK + +LTRD R KERKK GL GARR+PQF+KR
  S:     1 MAQVQYIGTGRRKSSVARVRLVPGTGKIVINKREIEEYVPFAALREVIKQPLVATETTGSYDIHVNVNGGGYTGQAGAVRHGIARALLQVDPDFRAALKSAGLLTRDSRMKERKKPGLRGARRAPQFSKR 130
>gi|81429334|ref|YP_396335.1| 30S ribosomal protein S9 [Lactobacillus sakei subsp. sakei 23K] >gi|123563694|sp|Q38UV5|RS9_LACSS 30S ribosomal protein S9 >gi|78610977|emb|CAI56029.1| 30S ribosomal protein S9 [Lactobacillus sakei subsp. sakei 23K] (130 aa)
Score = 362, Expect = 2.9e-33, Identities = 78/130 (60%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V Y G GRRK+SVA V+LVPGTGKI IN +   +Y P + +I DM+QPL IT+T  ++D+ V V GGGF+GQAGAIR GI+RALL  + DFR  LK + MLTRDPR KERKK GL  AR++ QF+KR
  S:     1 MAQVTYNGTGRRKNSVARVRLVPGTGKITINNKDVVDYVPFANLILDMKQPLTITETTDSYDILVNVNGGGFSGQAGAIRHGISRALLTVDPDFRPALKSAGMLTRDPRMKERKKPGLKKARKASQFSKR 130
>gi|124523075|ref|ZP_01697374.1| ribosomal protein S9 [Bacillus coagulans 36D1] >gi|124495723|gb|EAY43384.1| ribosomal protein S9 [Bacillus coagulans 36D1] (130 aa)
Score = 361, Expect = 3.5e-33, Identities = 78/130 (60%), Positives = 98/130 (75%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G I +N R   +Y P   +++ ++QPL IT+T  ++DV V V GGGFTGQAGAIR GIARALL A+ ++R  LK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYAGTGRRKSSVARVRLVPGNGNITVNGRDVKDYIPFEALVEVIKQPLNITETNGSYDVLVNVRGGGFTGQAGAIRHGIARALLQADPEYRAVLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|152973990|ref|YP_001373507.1| 30S ribosomal protein S9 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189045686|sp|A7GK54|RS9_BACCN 30S ribosomal protein S9 >gi|152022742|gb|ABS20512.1| ribosomal protein S9 [Bacillus cereus subsp. cytotoxis NVH 391-98] (130 aa)
Score = 360, Expect = 4.0e-33, Identities = 79/130 (60%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+++IN R    Y P + + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR GIARALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGEGRVIINGRDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGIARALLKADPEYRLTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|126697676|ref|YP_001086573.1| 30S ribosomal protein S9 [Clostridium difficile 630] >gi|145956423|ref|ZP_01805419.1| hypothetical protein CdifQ_04000120 [Clostridium difficile QCD-32g58] >gi|168695379|ref|ZP_02727656.1| 30S ribosomal protein S9 [Clostridium difficile QCD-37x79] >gi|168707197|ref|ZP_02739474.1| 30S ribosomal protein S9 [Clostridium difficile QCD-63q42] >gi|168724499|ref|ZP_02756776.1| 30S ribosomal protein S9 [Clostridium difficile QCD-76w55] >gi|168730370|ref|ZP_02762647.1| 30S ribosomal protein S9 [Clostridium difficile QCD-97b34] >gi|196125932|ref|ZP_03117681.1| 30S ribosomal protein S9 [Clostridium difficile ATCC 43255] >gi|196162627|ref|ZP_03123188.1| 30S ribosomal protein S9 [Clostridium difficile CIP 107932] >gi|196163366|ref|ZP_03123897.1| 30S ribosomal protein S9 [Clostridium difficile QCD-23m63] >gi|123174673|sp|Q18CJ5|RS9_CLOD6 30S ribosomal protein S9 >gi|115249113|emb|CAJ66924.1| 30S ribosomal protein S9 [Clostridium difficile 630] (130 aa)
Score = 358, Expect = 6.7e-33, Identities = 80/130 (61%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+NV+Y G GRRKSSVA V+LV G G IL+N R    YF    +I+D++QPLV+T     +DV VKV GGGFTGQAGAIR GI+RALL A+ D R  LK    LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MANVQYYGTGRRKSSVARVRLVAGEGNILVNGRALENYFNYETLIRDVKQPLVLTGNENKYDVIVKVEGGGFTGQAGAIRHGISRALLKADLDLRPALKKEGFLTRDARMKERKKYGLKAARRAPQFSKR 130
>gi|30018413|ref|NP_830044.1| 30S ribosomal protein S9 [Bacillus cereus ATCC 14579] >gi|42779225|ref|NP_976472.1| 30S ribosomal protein S9 [Bacillus cereus ATCC 10987] >gi|47570256|ref|ZP_00240907.1| ribosomal protein S9 [Bacillus cereus G9241] >gi|49481688|ref|YP_034495.1| 30S ribosomal protein S9 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145075|ref|YP_081754.1| 30S ribosomal protein S9 [Bacillus cereus E33L] >gi|118475912|ref|YP_893063.1| 30S ribosomal protein S9 [Bacillus thuringiensis str. Al Hakam] >gi|166986224|ref|ZP_02257479.1| 30S ribosomal protein S9 [Bacillus cereus AH187] >gi|166995382|ref|ZP_02261842.1| 30S ribosomal protein S9 [Bacillus cereus AH820] >gi|167937006|ref|ZP_02524081.1| 30S ribosomal protein S9 [Bacillus cereus AH1134] >gi|168138398|ref|ZP_02581627.1| 30S ribosomal protein S9 [Bacillus cereus B4264] >gi|168144588|ref|ZP_02587817.1| 30S ribosomal protein S9 [Bacillus cereus G9842] >gi|168163723|ref|ZP_02598956.1| 30S ribosomal protein S9 [Bacillus cereus H3081.97] >gi|196036013|ref|ZP_03103414.1| ribosomal protein S9 [Bacillus cereus W] >gi|196041104|ref|ZP_03108400.1| ribosomal protein S9 [Bacillus cereus NVH0597-99] >gi|196046248|ref|ZP_03113475.1| ribosomal protein S9 [Bacillus cereus 03BB108] >gi|81689821|sp|Q63H57|RS9_BACCZ 30S ribosomal protein S9 >gi|81697010|sp|Q6HPM5|RS9_BACHK 30S ribosomal protein S9 >gi|81700040|sp|Q73F62|RS9_BACC1 30S ribosomal protein S9 >gi|166228554|sp|A0R8L3|RS9_BACAH 30S ribosomal protein S9 >gi|39932141|sp|Q81J12|RS9_BACCR 30S ribosomal protein S9 >gi|29893953|gb|AAP07245.1| SSU ribosomal protein S9P [Bacillus cereus ATCC 14579] >gi|42735140|gb|AAS39080.1| ribosomal protein S9 [Bacillus cereus ATCC 10987] >gi|47553080|gb|EAL11480.1| ribosomal protein S9 [Bacillus cereus G9241] >gi|49333244|gb|AAT63890.1| ribosomal protein S9 (30S ribosomal protein S9) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978544|gb|AAU20094.1| ribosomal protein S9 (30S ribosomal protein S9) [Bacillus cereus E33L] >gi|118415137|gb|ABK83556.1| SSU ribosomal protein S9P [Bacillus thuringiensis str. Al Hakam] >gi|195991382|gb|EDX55349.1| ribosomal protein S9 [Bacillus cereus W] >gi|196022993|gb|EDX61673.1| ribosomal protein S9 [Bacillus cereus 03BB108] >gi|196028039|gb|EDX66650.1| ribosomal protein S9 [Bacillus cereus NVH0597-99] (130 aa)
Score = 358, Expect = 8.5e-33, Identities = 78/130 (60%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+++IN R    Y P + + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR GI+RALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGEGRVIINGRDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|160881745|ref|YP_001560713.1| ribosomal protein S9 [Clostridium phytofermentans ISDg] >gi|189045694|sp|A9KJF4|RS9_CLOPH 30S ribosomal protein S9 >gi|160430411|gb|ABX43974.1| ribosomal protein S9 [Clostridium phytofermentans ISDg] (130 aa)
Score = 357, Expect = 9.7e-33, Identities = 79/130 (60%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS+A V LVPGTGK+ IN+R  + YF    +     QPLV+T+T   FDV V V GGGFTGQAGAIR GI+RALL A+ D+R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKAKYYGTGRRKSSIARVYLVPGTGKVTINKRDMDAYFGLETLKLIARQPLVLTETADKFDVLVNVHGGGFTGQAGAIRHGISRALLQADADYRPALKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|125974286|ref|YP_001038196.1| 30S ribosomal protein S9 [Clostridium thermocellum ATCC 27405] >gi|196254199|ref|ZP_03152767.1| ribosomal protein S9 [Clostridium thermocellum DSM 4150] >gi|166229555|sp|A3DGC4|RS9_CLOTH 30S ribosomal protein S9 >gi|125714511|gb|ABN53003.1| SSU ribosomal protein S9P [Clostridium thermocellum ATCC 27405] >gi|196196381|gb|EDX91310.1| ribosomal protein S9 [Clostridium thermocellum DSM 4150] (130 aa)
Score = 357, Expect = 9.7e-33, Identities = 78/130 (60%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG GKI+IN+R+ ++YF    +   ++QPLV+TDT   FDV  KV GGG+TGQAGAIR GI+RALL  + + R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYYGTGRRKKSVARVRLVPGDGKIIINERELDDYFGLETLKTIVKQPLVLTDTLGKFDVLCKVAGGGYTGQAGAIRHGISRALLKFDEELRPALKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|153816308|ref|ZP_01968976.1| hypothetical protein RUMTOR_02559 [Ruminococcus torques ATCC 27756] >gi|145846361|gb|EDK23279.1| hypothetical protein RUMTOR_02559 [Ruminococcus torques ATCC 27756] (130 aa)
Score = 357, Expect = 1.1e-32, Identities = 79/130 (60%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+N +Y G GRRK S+A V LVPGTGKI IN+R  +EY     +   + QPLV T T   FDV V V GGG+TGQAGAIR GI+RALL A+ D+R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MANAKYYGTGRRKKSIARVYLVPGTGKITINKRDIDEYLGLETLKVVVRQPLVATGTADKFDVIVNVCGGGYTGQAGAIRHGISRALLEADADYRPVLKSAGYLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|16804634|ref|NP_466119.1| 30S ribosomal protein S9 [Listeria monocytogenes EGD-e] >gi|47097150|ref|ZP_00234717.1| ribosomal protein S9 [Listeria monocytogenes str. 1/2a F6854] >gi|153175901|ref|ZP_01931160.1| hypothetical protein LMIG_00011 [Listeria monocytogenes FSL N3-165] >gi|153180760|ref|ZP_01933756.1| hypothetical protein LMMG_02429 [Listeria monocytogenes F6900] >gi|153185647|ref|ZP_01936197.1| hypothetical protein LMOG_02139 [Listeria monocytogenes J0161] >gi|153192352|ref|ZP_01939344.1| hypothetical protein LMPG_01356 [Listeria monocytogenes J2818] >gi|153197624|ref|ZP_01941851.1| hypothetical protein LMRG_02140 [Listeria monocytogenes 10403S] >gi|167058672|ref|ZP_02280929.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL F2-515] >gi|167213220|ref|ZP_02283527.1| 30S ribosomal protein S9 [Listeria monocytogenes LO28] >gi|167405412|ref|ZP_02310168.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL J2-003] >gi|20139886|sp|Q8Y459|RS9_LISMO 30S ribosomal protein S9 >gi|16412084|emb|CAD00674.1| ribosomal protein S9 [Listeria monocytogenes] >gi|47014485|gb|EAL05451.1| ribosomal protein S9 [Listeria monocytogenes str. 1/2a F6854] >gi|126941783|gb|EBA19662.1| hypothetical protein LMOG_02139 [Listeria monocytogenes J0161] >gi|127632797|gb|EBA22231.1| hypothetical protein LMRG_02140 [Listeria monocytogenes 10403S] >gi|127763856|gb|EBA24674.1| hypothetical protein LMPG_01356 [Listeria monocytogenes J2818] >gi|133728614|gb|EBA30312.1| hypothetical protein LMIG_00011 [Listeria monocytogenes FSL N3-165] >gi|133731707|gb|EBA33405.1| hypothetical protein LMMG_02429 [Listeria monocytogenes F6900] (130 aa)
Score = 355, Expect = 1.5e-32, Identities = 77/130 (59%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG GKI+IN R   +Y P + + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR G+ARALL    ++R  LK + +LTRD R KERKK GL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEYRPALKSAGLLTRDSRMKERKKPGLKGARRAPQFSKR 130
>gi|116495906|ref|YP_807640.1| ribosomal protein S9 [Lactobacillus casei ATCC 334] >gi|191639390|ref|YP_001988556.1| 30S ribosomal protein S9 [Lactobacillus casei] >gi|122262694|sp|Q035C4|RS9_LACC3 30S ribosomal protein S9 >gi|116106056|gb|ABJ71198.1| SSU ribosomal protein S9P [Lactobacillus casei ATCC 334] >gi|190713692|emb|CAQ67698.1| 30S ribosomal protein S9 [Lactobacillus casei BL23] (130 aa)
Score = 355, Expect = 1.7e-32, Identities = 77/130 (59%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK+SVA V+LVPGTGKI +N +   +Y P   +I D+ QP  IT+T  ++DV V V GGGF+GQAGA R GIARALL  + DFR  LK + MLTRDPR KERKKYGL  AR++ QF+KR
  S:     1 MAQVQYAGTGRRKNSVARVRLVPGTGKITMNGKDVRDYLPYENLITDLSQPFGITETTGSYDVLVNVNGGGFSGQAGATRHGIARALLTVDPDFRGPLKKAGMLTRDPRMKERKKYGLKKARKASQFSKR 130
>gi|23097607|ref|NP_691073.1| 30S ribosomal protein S9 [Oceanobacillus iheyensis HTE831] >gi|39932205|sp|Q8ETV3|RS9_OCEIH 30S ribosomal protein S9 >gi|22775830|dbj|BAC12108.1| 30S ribosomal protein S9 [Oceanobacillus iheyensis HTE831] (130 aa)
Score = 355, Expect = 1.8e-32, Identities = 77/130 (59%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK S A V+LVPGTG + IN R   +YFP    +  + QPL  T+T+  +DV V V GGGFTGQAGAIR GIARALL A+ ++R TLK    LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MAQVQYYGTGRRKKSTARVRLVPGTGNVTINGRDAQDYFPYETQLLILNQPLAATETQGTYDVLVNVDGGGFTGQAGAIRHGIARALLQADPEYRSTLKSEGYLTRDARMKERKKYGLKKARRAPQFSKR 130
>gi|169190313|ref|ZP_02850285.1| ribosomal protein S9 [Paenibacillus sp. JDR-2] >gi|169002920|gb|EDS49795.1| ribosomal protein S9 [Paenibacillus sp. JDR-2] (130 aa)
Score = 353, Expect = 2.7e-32, Identities = 77/130 (59%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG G+I++N+R  NEYF    +   ++QPLV+T+T  N+DV V   GGG +GQAGAIR GI+RALL A+ +FR  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAQVQYYGTGRRKHSVARVRLVPGEGRIIVNKRDLNEYFGLETLKLIVKQPLVLTETLNNYDVIVIANGGGMSGQAGAIRHGISRALLKADPEFRPALKRAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|116873962|ref|YP_850743.1| 30S ribosomal protein S9 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123461444|sp|A0ALT2|RS9_LISW6 30S ribosomal protein S9 >gi|116742840|emb|CAK21964.1| rpsI [Listeria welshimeri serovar 6b str. SLCC5334] (130 aa)
Score = 352, Expect = 3.6e-32, Identities = 77/130 (59%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG GKI+IN R   +Y P + + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR G+ARALL    ++R  LK + +LTRD R KERKK GL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVRGGGYTGQAGAIRHGVARALLQVAPEYRPALKSAGLLTRDSRMKERKKPGLKGARRAPQFSKR 130
>gi|163938152|ref|YP_001643036.1| 30S ribosomal protein S9 [Bacillus weihenstephanensis KBAB4] >gi|163860349|gb|ABY41408.1| ribosomal protein S9 [Bacillus weihenstephanensis KBAB4] (130 aa)
Score = 352, Expect = 3.6e-32, Identities = 77/130 (59%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+++IN R    Y P + + + ++QPLV T+T  N++V V V GGG+TGQAGAIR GI+RALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGEGRVIINGRDFENYIPFAALREVVKQPLVATETLGNYNVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|153855381|ref|ZP_01996530.1| hypothetical protein DORLON_02544 [Dorea longicatena DSM 13814] >gi|149752201|gb|EDM62132.1| hypothetical protein DORLON_02544 [Dorea longicatena DSM 13814] (130 aa)
Score = 352, Expect = 4.0e-32, Identities = 79/130 (60%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  ++ G GRRK SVA V LVPGTGKI IN+R  +EYF    +   + QPL  TDT   FDV V V GGG+TGQAGAIR G+ARALL A+ D+R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MATAKFYGTGRRKKSVARVYLVPGTGKITINKRDIDEYFGLETLKVVVRQPLAATDTEGKFDVIVNVKGGGYTGQAGAIRHGVARALLEADADYRPVLKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|12045277|ref|NP_073088.1| 30S ribosomal protein S9 [Mycoplasma genitalium G37] >gi|1351016|sp|P47656|RS9_MYCGE 30S ribosomal protein S9 >gi|3845009|gb|AAC71643.1| ribosomal protein S9 [Mycoplasma genitalium G37] >gi|166078667|gb|ABY79285.1| ribosomal protein S9 [synthetic Mycoplasma genitalium JCVI-1.0] (132 aa)
Score = 352, Expect = 4.2e-32, Identities = 86/130 (66%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGT--GKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M    + GLGRRKSS A V L      GKI IN R P++YFPN LVIQDMEQPL +T  + NFD+ V V GGGFTGQAGAIRLGI RAL+  N D +K LK  K+ TRD RAKERKK+GLYGARR+PQFTKR
  S:     1 MDKKSFYGLGRRKSSTAKVYLYQSKDKGKITINHRNPSDYFPNKLVIQDMEQPLELTKLKDNFDINVVVKGGGFTGQAGAIRLGIVRALIKFNPDLKKLLKTKKLTTRDKRAKERKKFGLYGARRAPQFTKR 132
>gi|66880498|ref|ZP_00405479.1| COG0103: Ribosomal protein S9 [Mycoplasma genitalium G-37] (137 aa)
Score = 351, Expect = 4.8e-32, Identities = 86/130 (66%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGT--GKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M    + GLGRRKSS A V L      GKI IN R P++YFPN LVIQDMEQPL +T  + NFD+ V V GGGFTGQAGAIRLGI RAL+  N D +K LK  K+ TRD RAKERKK+GLYGARR+PQFTKR
  S:     6 MDKKSFYGLGRRKSSTAKVYLYQSKDKGKITINHRNPSDYFPNKLVIQDMEQPLELTKLKDNFDINVVVKGGGFTGQAGAIRLGIVRALIKFNPDLKKLLKTKKLTTRDKRAKERKKFGLYGARRAPQFTKR 137
>gi|164686561|ref|ZP_02210589.1| hypothetical protein CLOBAR_00128 [Clostridium bartlettii DSM 16795] >gi|164604430|gb|EDQ97895.1| hypothetical protein CLOBAR_00128 [Clostridium bartlettii DSM 16795] (136 aa)
Score = 351, Expect = 5.2e-32, Identities = 77/130 (59%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M  V++ G GRRKSSVA V+LV G G I +N R  +EYF    +I+D++QPLV+T+    +DV VKV GGGFTGQAGAIR GI+RALL A+ + R  LK +  LTRD R KERKKYGL  ARR+PQF+KR
  S:     7 MEKVQFYGTGRRKSSVARVRLVAGEGNITVNGRALDEYFDYDTLIRDVKQPLVLTNNENKYDVIVKVEGGGFTGQAGAIRHGISRALLKADAELRPELKKAGFLTRDARMKERKKYGLKAARRAPQFSKR 136
>gi|89210523|ref|ZP_01188911.1| Ribosomal protein S9 [Halothermothrix orenii H 168] >gi|89159785|gb|EAR79445.1| Ribosomal protein S9 [Halothermothrix orenii H 168] (131 aa)
Score = 351, Expect = 5.5e-32, Identities = 76/129 (58%), Positives = 96/129 (74%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V+Y G GRRK+S A V+LVPG+GKILIN +   EYF    +I+D++ PL +T+   +FDV V V GGG +GQAGAIR GIARALL  + D+RK LK +  LTRDPR KERKKYGL  AR++PQF+KR
  S:     3 AEVQYWGTGRRKTSTARVRLVPGSGKILINGKDVKEYFGRETLIKDLKSPLELTNNLDSFDVLVNVNGGGLSGQAGAIRHGIARALLRVDKDYRKPLKKAGYLTRDPRMKERKKYGLKKARKAPQFSKR 131
>gi|167748469|ref|ZP_02420596.1| hypothetical protein ANACAC_03213 [Anaerostipes caccae DSM 14662] >gi|167652461|gb|EDR96590.1| hypothetical protein ANACAC_03213 [Anaerostipes caccae DSM 14662] (130 aa)
Score = 350, Expect = 6.2e-32, Identities = 79/130 (60%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS+A V LVPGTGKI IN+R  +EY     +   + QPLV TDT   +DV V V+GGGFTGQAGAIR GI+RALL  + DFR  LK +  LTRDPR KERKK GL  ARR+PQF+KR
  S:     1 MATAKYYGTGRRKSSIARVYLVPGTGKITINKRDIDEYLGLETLKVVVRQPLVATDTLGKYDVLVNVIGGGFTGQAGAIRHGISRALLQVDGDFRPVLKKAGYLTRDPRMKERKKPGLRSARRAPQFSKR 130
>gi|118727196|ref|ZP_01575804.1| ribosomal protein S9 [Clostridium cellulolyticum H10] >gi|118663413|gb|EAV70066.1| ribosomal protein S9 [Clostridium cellulolyticum H10] (130 aa)
Score = 350, Expect = 6.5e-32, Identities = 78/130 (60%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V Y G GRRK SVA V+LVPG GK  IN R  ++YF    +   ++QPL +TDT   FDV  KV+GGGFTGQAGAIR GI+RALL A+ + R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVYYYGTGRRKKSVARVRLVPGEGKFSINDRSLDDYFGLETLKVIVKQPLTLTDTLTKFDVICKVIGGGFTGQAGAIRHGISRALLKADEELRPALKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|30260334|ref|NP_842711.1| 30S ribosomal protein S9 [Bacillus anthracis str. Ames] >gi|47525400|ref|YP_016749.1| 30S ribosomal protein S9 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183178|ref|YP_026430.1| 30S ribosomal protein S9 [Bacillus anthracis str. Sterne] >gi|65317589|ref|ZP_00390548.1| COG0103: Ribosomal protein S9 [Bacillus anthracis str. A2012] >gi|165873344|ref|ZP_02217945.1| ribosomal protein S9 [Bacillus anthracis str. A0488] >gi|170689683|ref|ZP_02880861.1| ribosomal protein S9 [Bacillus anthracis str. A0465] >gi|170709414|ref|ZP_02899823.1| ribosomal protein S9 [Bacillus anthracis str. A0389] >gi|190567344|ref|ZP_03020258.1| ribosomal protein S9 [Bacillus anthracis Tsiankovskii-I] >gi|39932144|sp|Q81VP8|RS9_BACAN 30S ribosomal protein S9 >gi|30253655|gb|AAP24197.1| ribosomal protein S9 [Bacillus anthracis str. Ames] >gi|47500548|gb|AAT29224.1| ribosomal protein S9 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177105|gb|AAT52481.1| ribosomal protein S9 [Bacillus anthracis str. Sterne] >gi|164710912|gb|EDR16488.1| ribosomal protein S9 [Bacillus anthracis str. A0488] >gi|170125669|gb|EDS94587.1| ribosomal protein S9 [Bacillus anthracis str. A0389] >gi|170666354|gb|EDT17139.1| ribosomal protein S9 [Bacillus anthracis str. A0465] >gi|190561471|gb|EDV15442.1| ribosomal protein S9 [Bacillus anthracis Tsiankovskii-I] (130 aa)
Score = 350, Expect = 6.7e-32, Identities = 77/130 (59%), Positives = 99/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LV G G+++IN R    Y P + + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR GI+RALL A+ ++R TLK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVSGEGRVIINGRDFENYIPFAALREVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130
>gi|42518462|ref|NP_964392.1| 30S ribosomal protein S9 [Lactobacillus johnsonii NCC 533] >gi|41582747|gb|AAS08358.1| 30S ribosomal protein S9 [Lactobacillus johnsonii NCC 533] (131 aa)
Score = 348, Expect = 1.1e-31, Identities = 75/125 (60%), Positives = 92/125 (73%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK SVA V+LVPG G+I IN+    +Y P   ++QDM+QPL +T+T   +D+ V V GGGF+GQAGAIRLGIARALL  + DFR  LK + MLTRDPR KERKK GL  AR++ QF+KR
  S:     7 YAGTGRRKDSVARVRLVPGNGQITINKEDVTKYIPYPNLVQDMKQPLALTETEGQYDILVNVNGGGFSGQAGAIRLGIARALLEVDPDFRGPLKKAGMLTRDPRMKERKKPGLKKARKASQFSKR 131
>gi|28212147|ref|NP_783091.1| 30S ribosomal protein S9 [Clostridium tetani E88] >gi|39932175|sp|Q890R7|RS9_CLOTE 30S ribosomal protein S9 >gi|28204591|gb|AAO37028.1| SSU ribosomal protein S9P [Clostridium tetani E88] (130 aa)
Score = 348, Expect = 1.1e-31, Identities = 78/130 (60%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK S+A V+LVPG GK+LIN+R   EYF    +   + QPLV+T T+  FDV V V GGG TGQAGAIR GI+RALL A+   R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYYGTGRRKKSIARVRLVPGEGKVLINKRDEEEYFGLETLRVIVNQPLVLTGTKDKFDVLVNVYGGGLTGQAGAIRHGISRALLKADESLRPELKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|154502970|ref|ZP_02040030.1| hypothetical protein RUMGNA_00791 [Ruminococcus gnavus ATCC 29149] >gi|153796509|gb|EDN78929.1| hypothetical protein RUMGNA_00791 [Ruminococcus gnavus ATCC 29149] (130 aa)
Score = 347, Expect = 1.3e-31, Identities = 79/130 (60%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+N +Y G GRRK SVA V LVPGTGKI IN+R  +EY     +   + QPLV T T   FDV V V GGG+TGQAGAIR GI+RALL A  ++R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MANAKYYGTGRRKKSVARVYLVPGTGKITINKRDIDEYLGLETLKVVVRQPLVATGTTDKFDVIVNVHGGGYTGQAGAIRHGISRALLEAEAEYRPVLKSAGYLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|114567805|ref|YP_754959.1| ribosomal protein S9 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317315|sp|Q0AUL6|RS9_SYNWW 30S ribosomal protein S9 >gi|114338740|gb|ABI69588.1| SSU ribosomal protein S9P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (130 aa)
Score = 347, Expect = 1.4e-31, Identities = 73/130 (56%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK +VA V+LVPG G I+IN R   ++FPN      ++QPLV+T  +  FD+  +V GGG +GQAGAI+LGIARALL AN D +  L+ S  LTRDPR KERKKYGL+ AR++PQ++KR
  S:     1 MAKVQYWGTGRRKEAVARVRLVPGEGNIIINNRSFEDFFPNQTSRLIVQQPLVLTAMQGRFDIICRVNGGGVSGQAGAIQLGIARALLKANPDIKAMLRRSGFLTRDPRMKERKKYGLHKARKAPQYSKR 130
>gi|148377719|ref|YP_001256595.1| 30S ribosomal protein S9 [Mycoplasma agalactiae PG2] >gi|148291765|emb|CAL59154.1| 30S ribosomal protein S9 [Mycoplasma agalactiae PG2] (135 aa)
Score = 346, Expect = 2.0e-31, Identities = 79/129 (61%), Positives = 95/129 (73%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           S VEY+GLGRRKSS A V L PG+GK  IN R+   Y  + L IQD EQPLV+T+T+  FD+ V V GGG  GQAGAIRLGIARALL+A++ +R  LK + MLTRD R+ ERKK GL  ARR+ QF+KR
  S:     7 SIVEYRGLGRRKSSTARVILRPGSGKFTINNREAKNYLLSDLHIQDAEQPLVLTETKGQFDILVNVRGGGLKGQAGAIRLGIARALLLASDTYRAKLKPAGMLTRDARSVERKKPGLNKARRARQFSKR 135
>gi|172056174|ref|YP_001812634.1| ribosomal protein S9 [Exiguobacterium sibiricum 255-15] >gi|171988695|gb|ACB59617.1| ribosomal protein S9 [Exiguobacterium sibiricum 255-15] (130 aa)
Score = 345, Expect = 2.2e-31, Identities = 75/130 (57%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++V Y G GRRK + A V LV G GK+ +N R  +EYF    +I   ++PLV+T+T   +D+ V V GGGFTGQAGAIR GI+RALL A+ DFR TLK    LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MADVRYYGTGRRKHAAARVFLVAGDGKVTVNGRDISEYFGYETLIMTAKEPLVLTETEGKYDIMVTVKGGGFTGQAGAIRHGISRALLQADPDFRGTLKAKGFLTRDARMKERKKYGLKAARRAPQFSKR 130
>gi|73662005|ref|YP_300786.1| 30S ribosomal protein S9 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581627|sp|Q49ZD5|RS9_STAS1 30S ribosomal protein S9 >gi|72494520|dbj|BAE17841.1| 30S ribosomal protein S9 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (130 aa)
Score = 345, Expect = 2.4e-31, Identities = 76/130 (58%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ VEY+G GRRK+SVA V+LVPG G I +N R    Y P   +I D+ Q   +T+T+ N+DV V V GGGFTGQA AIR GI+RALL A+ ++R +LK + +LTRDPR KERKK GL  ARRSPQF+KR
  S:     1 MAQVEYRGTGRRKNSVARVRLVPGEGNITVNGRDVRSYLPFESLILDINQAFDVTETKGNYDVLVNVQGGGFTGQAQAIRHGISRALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKKARRSPQFSKR 130
>gi|168335272|ref|ZP_02693373.1| ribosomal protein S9 [Epulopiscium sp. 'N.t. morphotype B'] (130 aa)
Score = 345, Expect = 2.5e-31, Identities = 77/130 (59%), Positives = 96/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V L PG GKI+IN+R+ ++YF    +   ++QPL +T T   FDV V V GGG +GQAGAIR G++RALL A+ D+R TLK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVKYYGTGRRKSSVARVYLTPGNGKIVINKREMDDYFGLDTLKLIVKQPLELTGTTIKFDVLVNVHGGGVSGQAGAIRHGVSRALLQADGDYRLTLKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|20808625|ref|NP_623796.1| ribosomal protein S9 [Thermoanaerobacter tengcongensis MB4] >gi|22096134|sp|Q8R7Y9|RS9_THETN 30S ribosomal protein S9 >gi|20517258|gb|AAM25400.1| Ribosomal protein S9 [Thermoanaerobacter tengcongensis MB4] (130 aa)
Score = 344, Expect = 2.8e-31, Identities = 72/130 (55%), Positives = 96/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ ++Y G GRRK +VA V+L+PG G I+IN +   EYFP   +   ++QPL++T+T   FDV+VKV GGG +GQAGAIR GIARAL+ A+ + R  LK +  LTRDPR KER+KYGL  AR++PQF+KR
  S:     1 MATIQYYGTGRRKEAVARVRLMPGKGNIIINNKSLEEYFPLETLRYTVKQPLILTETIDKFDVYVKVSGGGLSGQAGAIRHGIARALVKADAELRPILKKAGFLTRDPRMKERRKYGLKKARKAPQFSKR 130
>gi|187605219|ref|ZP_02991420.1| ribosomal protein S9 [Exiguobacterium sp. AT1b] >gi|187482788|gb|EDU20791.1| ribosomal protein S9 [Exiguobacterium sp. AT1b] (130 aa)
Score = 344, Expect = 3.0e-31, Identities = 74/130 (56%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++V Y G GRRK SVA V LV G GK+++N R  +EYF +  +I   + PLV+T+T   +DV V V GGG+TGQAGAIR G++RALL A+ +FR +LK    LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MADVRYYGTGRRKHSVARVHLVAGDGKVVVNGRDISEYFGHETLIMMAKSPLVLTETEGKYDVIVNVNGGGYTGQAGAIRHGVSRALLQADPEFRPSLKEKGFLTRDARMKERKKYGLKAARRAPQFSKR 130
>gi|153952896|ref|YP_001393661.1| 30S ribosomal protein S9 [Clostridium kluyveri DSM 555] >gi|189045693|sp|A5N4T2|RS9_CLOK5 30S ribosomal protein S9 >gi|146345777|gb|EDK32313.1| RpsI [Clostridium kluyveri DSM 555] (130 aa)
Score = 344, Expect = 3.1e-31, Identities = 79/130 (60%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK S+A V+LVPG GKI IN+R   EYF    +   + QPLV+T T   FDV V V GGGFTGQAGAIR GI+RALL A+ + R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYFGTGRRKKSIARVRLVPGEGKITINKRSIEEYFGLETLRVIVNQPLVLTSTNGKFDVLVNVHGGGFTGQAGAIRHGISRALLKADENLRLELKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|404617|gb|AAD10556.1| uncertain [Mycoplasma genitalium] (132 aa)
Score = 344, Expect = 3.2e-31, Identities = 85/130 (65%), Positives = 96/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGT--GKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M    + GLGRRKSS A V L      GKI IN R P++YFPN LVIQDMEQPL +T  + NFD+ V V GGGFTGQAG IRLGI RAL+  N D +K LK  K+ TRD RAKERKK+GLYGARR+PQFTKR
  S:     1 MDKKSFYGLGRRKSSTAKVYLYQSKDKGKITINHRNPSDYFPNKLVIQDMEQPLELTKLKDNFDINVVVKGGGFTGQAGRIRLGIVRALIKFNPDLKKLLKTKKLTTRDKRAKERKKFGLYGARRAPQFTKR 132
>gi|153809625|ref|ZP_01962293.1| hypothetical protein RUMOBE_00006 [Ruminococcus obeum ATCC 29174] >gi|149833803|gb|EDM88883.1| hypothetical protein RUMOBE_00006 [Ruminococcus obeum ATCC 29174] (130 aa)
Score = 344, Expect = 3.3e-31, Identities = 75/130 (57%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++ ++ G GRRK S+A V L PGTGKI IN+R  +EYF    +   + QPL  T+T   FDV V V GGG+TGQAGAIR G+ARALL A+ ++R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MASAKFYGTGRRKKSIARVYLTPGTGKITINKRDIDEYFGLETLKVIVRQPLAATETEGKFDVLVNVKGGGYTGQAGAIRHGVARALLEADAEYRPVLKAAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|116493130|ref|YP_804865.1| SSU ribosomal protein S9P [Pediococcus pentosaceus ATCC 25745] >gi|122265406|sp|Q03EE9|RS9_PEDPA 30S ribosomal protein S9 >gi|116103280|gb|ABJ68423.1| SSU ribosomal protein S9P [Pediococcus pentosaceus ATCC 25745] (130 aa)
Score = 344, Expect = 3.3e-31, Identities = 75/130 (57%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y+G GRRK+SVA V+LVPGTGKI +N R   EY P + + Q + QP  +T+T  N+DV   V GGGF+GQ+GAIR GIARALL  + DFR  LK + +LTRDPR KERKKYGL  AR++ QF+KR
  S:     1 MAEAQYRGTGRRKNSVARVRLVPGTGKITVNDRPIEEYIPFANLRQVVVQPFGVTETNGNYDVIANVNGGGFSGQSGAIRHGIARALLDVDPDFRAPLKKAGLLTRDPRMKERKKYGLKKARKAAQFSKR 130
>gi|167759104|ref|ZP_02431231.1| hypothetical protein CLOSCI_01451 [Clostridium scindens ATCC 35704] >gi|167663222|gb|EDS07352.1| hypothetical protein CLOSCI_01451 [Clostridium scindens ATCC 35704] (130 aa)
Score = 344, Expect = 3.5e-31, Identities = 77/130 (59%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   + G GRRK S+A V LVPGTG I IN+R  +EYF    +   + QPLV T+T   FDV V V GGG+TGQAGAIR GI+RALL A+ D+R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKARFYGTGRRKKSIARVYLVPGTGNITINKRNIDEYFGLETLKVVVRQPLVATETNDKFDVIVNVKGGGYTGQAGAIRHGISRALLEADADYRPVLKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|90962373|ref|YP_536289.1| 30S ribosomal protein S9 [Lactobacillus salivarius UCC118] >gi|122448617|sp|Q1WSC3|RS9_LACS1 30S ribosomal protein S9 >gi|90821567|gb|ABE00206.1| SSU ribosomal protein S9P [Lactobacillus salivarius UCC118] (130 aa)
Score = 343, Expect = 3.8e-31, Identities = 75/130 (57%), Positives = 96/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y+G GRRK+SVA V+LVPGTGKI +N +   EY P + + +DM QP  +T+T+  +DVFV V GGGF+GQAGA R GIARALL  + DFR  LK + +LTRD R KERKK GL  AR++ QF+KR
  S:     1 MAQVQYQGTGRRKNSVARVRLVPGTGKITMNGKPAEEYIPFANIREDMVQPFGVTETKGQYDVFVNVNGGGFSGQAGATRHGIARALLEVDPDFRGVLKSTGLLTRDARMKERKKPGLKKARKASQFSKR 130
>gi|161611237|ref|YP_278209.2| 30S ribosomal protein S9 [Mycoplasma synoviae 53] >gi|144574953|gb|AAZ43498.2| 30S ribosomal protein S9 [Mycoplasma synoviae 53] (131 aa)
Score = 343, Expect = 3.9e-31, Identities = 78/127 (61%), Positives = 91/127 (71%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           VEYKGLGRRKSSVA V + PG G+  IN+R   EY  + L ++D  QP V+T+T + FD FV V GGG  GQAGAIRLGIARALL A+ D+R  LK   MLTRD R KERKK GL  ARR+ QF+KR
  S:     5 VEYKGLGRRKSSVARVIIRPGKGEFHINKRPAREYLTSDLYLKDANQPFVLTETFQKFDTFVNVKGGGLNGQAGAIRLGIARALLHASPDYRTKLKAEGMLTRDARIKERKKPGLRAARRARQFSKR 131
>gi|192814013|ref|ZP_03042664.1| ribosomal protein S9 [Geobacillus sp. Y412MC10] >gi|192797177|gb|EDV73706.1| ribosomal protein S9 [Geobacillus sp. Y412MC10] (130 aa)
Score = 342, Expect = 4.8e-31, Identities = 76/130 (58%), Positives = 96/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG G+I+IN+R  NEYF    +   ++QPL +T+T   +DV V   GGG +GQAGAIR GI+RALL A+ +FR +LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAQVQYYGTGRRKHSVARVRLVPGEGRIVINKRDINEYFGLETLKLIVKQPLNLTETLGKYDVLVIAHGGGISGQAGAIRHGISRALLKADPEFRPSLKRAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|148381385|ref|YP_001255926.1| ribosomal protein S9 [Clostridium botulinum A str. ATCC 3502] >gi|153933064|ref|YP_001385760.1| 30S ribosomal protein S9 [Clostridium botulinum A str. ATCC 19397] >gi|153936368|ref|YP_001389167.1| 30S ribosomal protein S9 [Clostridium botulinum A str. Hall] >gi|153940966|ref|YP_001392798.1| 30S ribosomal protein S9 [Clostridium botulinum F str. Langeland] >gi|168178868|ref|ZP_02613532.1| ribosomal protein S9 [Clostridium botulinum NCTC 2916] >gi|168181900|ref|ZP_02616564.1| ribosomal protein S9 [Clostridium botulinum Bf] >gi|170755850|ref|YP_001783085.1| ribosomal protein S9 [Clostridium botulinum B1 str. Okra] >gi|170759135|ref|YP_001788785.1| ribosomal protein S9 [Clostridium botulinum A3 str. Loch Maree] >gi|166200065|sp|A7FZ37|RS9_CLOB1 30S ribosomal protein S9 >gi|166200066|sp|A5I7H0|RS9_CLOBH 30S ribosomal protein S9 >gi|166200067|sp|A7GJ38|RS9_CLOBL 30S ribosomal protein S9 >gi|148290869|emb|CAL85005.1| 30S ribosomal protein S9 [Clostridium botulinum A str. ATCC 3502] >gi|152929108|gb|ABS34608.1| ribosomal protein S9 [Clostridium botulinum A str. ATCC 19397] >gi|152932282|gb|ABS37781.1| ribosomal protein S9 [Clostridium botulinum A str. Hall] >gi|152936862|gb|ABS42360.1| ribosomal protein S9 [Clostridium botulinum F str. Langeland] >gi|169121062|gb|ACA44898.1| ribosomal protein S9 [Clostridium botulinum B1 str. Okra] >gi|169406124|gb|ACA54535.1| ribosomal protein S9 [Clostridium botulinum A3 str. Loch Maree] >gi|182670259|gb|EDT82235.1| ribosomal protein S9 [Clostridium botulinum NCTC 2916] >gi|182674889|gb|EDT86850.1| ribosomal protein S9 [Clostridium botulinum Bf] (130 aa)
Score = 342, Expect = 4.8e-31, Identities = 75/130 (57%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LV G GK++IN R    YFP   +   + QPLV+T+T+  +DV V V GGGFTGQAGA+R GI+RAL+ A+ + + +LK +  LTRDPR KERKKYGL  ARRSPQF+KR
  S:     1 MAKVQYFGTGRRKKSVARVRLVAGDGKVIINNRDIENYFPIETLRVIVNQPLVLTETKDKYDVLVNVHGGGFTGQAGAVRHGISRALVKADENMKSSLKKAGFLTRDPRMKERKKYGLKKARRSPQFSKR 130
>gi|187776611|ref|ZP_02993084.1| hypothetical protein CLOSPO_00125 [Clostridium sporogenes ATCC 15579] >gi|187775270|gb|EDU39072.1| hypothetical protein CLOSPO_00125 [Clostridium sporogenes ATCC 15579] (130 aa)
Score = 342, Expect = 5.9e-31, Identities = 75/130 (57%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LV G GK++IN R    YFP   +   + QPLV+T+T+  +DV V V GGGFTGQAGA+R GI+RAL+ A+ + + +LK +  LTRDPR KERKKYGL  ARRSPQF+KR
  S:     1 MAKVQYFGTGRRKKSVARVRLVAGDGKVIINNRDIENYFPIETLRVIVNQPLVLTETKDKYDVLVNVHGGGFTGQAGAVRHGISRALVKADENMKPSLKKAGFLTRDPRMKERKKYGLKKARRSPQFSKR 130
>gi|163764713|ref|ZP_02171767.1| protein of unknown function DUF1212 [Bacillus selenitireducens MLS10] >gi|160354739|gb|EDP81398.1| protein of unknown function DUF1212 [Bacillus selenitireducens MLS10] (130 aa)
Score = 341, Expect = 7.4e-31, Identities = 75/130 (57%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK+S A V+LVPG G+I IN+R  +EYF    +   ++QPL  T T   +DV V V GGG+TGQAGAIR G+ARALL A+ +FR +LK +  LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MAQVQYIGTGRRKNSTARVRLVPGDGQITINKRNIDEYFDLETLKVIVKQPLAETQTEGTYDVHVNVHGGGYTGQAGAIRHGVARALLQADPEFRASLKSAGYLTRDARMKERKKYGLKAARRAPQFSKR 130
>gi|167036836|ref|YP_001664414.1| ribosomal protein S9 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039555|ref|YP_001662540.1| ribosomal protein S9 [Thermoanaerobacter sp. X514] >gi|166853795|gb|ABY92204.1| ribosomal protein S9 [Thermoanaerobacter sp. X514] >gi|166855670|gb|ABY94078.1| ribosomal protein S9 [Thermoanaerobacter pseudethanolicus ATCC 33223] (130 aa)
Score = 341, Expect = 7.5e-31, Identities = 72/130 (55%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK +VA V+L+PG G I+IN R   EYF    +   ++QPL++T+T   FDV+ KV GGG TGQAGA+RLGIARAL+  +++ R  LK +  LTRDPR KER+KYGL  AR++PQF+KR
  S:     1 MATVQYYGTGRRKEAVARVRLMPGKGNIIINNRPLEEYFTLDTLKYTVKQPLILTETIDKFDVYAKVSGGGLTGQAGAVRLGIARALVKVDSELRPILKKAGFLTRDPRMKERRKYGLKKARKAPQFSKR 130
>gi|56961966|ref|YP_173688.1| 30S ribosomal protein S9 [Bacillus clausii KSM-K16] >gi|81679079|sp|Q5WLM8|RS9_BACSK 30S ribosomal protein S9 >gi|56908200|dbj|BAD62727.1| 30S ribosomal protein S9 [Bacillus clausii KSM-K16] (130 aa)
Score = 341, Expect = 7.8e-31, Identities = 77/130 (59%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+L+PG GKI++N R  +EYF    +   ++QPLV T     +DV V V GGGFTGQAGAIR GIARALL  + D R TLK +  LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MAQVQYYGTGRRKHSVARVRLIPGEGKIVVNGRDLDEYFGLETLKLIVKQPLVETGVTGQYDVHVNVNGGGFTGQAGAIRHGIARALLQVDPDNRATLKAAGFLTRDARMKERKKYGLKAARRAPQFSKR 130
>gi|116628995|ref|YP_814167.1| 30S ribosomal protein S9 [Lactobacillus gasseri ATCC 33323] >gi|116094577|gb|ABJ59729.1| SSU ribosomal protein S9P [Lactobacillus gasseri ATCC 33323] (131 aa)
Score = 340, Expect = 8.5e-31, Identities = 75/125 (60%), Positives = 92/125 (73%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK SVA V+LVPG G+I IN+    +Y P   ++QDM+QPL +T+T   ++V V V GGGF+GQAGAIRLGIARALL  + DFR  LK + MLTRDPR KERKK GL  AR++ QF+KR
  S:     7 YAGTGRRKDSVARVRLVPGNGQITINKEDVTKYIPYPNLVQDMKQPLALTETEGQYNVEVNVNGGGFSGQAGAIRLGIARALLEVDPDFRGPLKKAGMLTRDPRMKERKKPGLKKARKASQFSKR 131
>gi|167767768|ref|ZP_02439821.1| hypothetical protein CLOSS21_02303 [Clostridium sp. SS2/1] >gi|167710507|gb|EDS21086.1| hypothetical protein CLOSS21_02303 [Clostridium sp. SS2/1] (136 aa)
Score = 340, Expect = 1.0e-30, Identities = 78/130 (60%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++  +Y G GRRK SVA V LVPGTGKI IN+R  +EY     +   + QPLV TDT   +DV V V GGGFTGQAGAIR GI+RALL  + +FR TLK +  LTRDPR KERKK GL  ARR+PQF+KR
  S:     7 VATAKYYGTGRRKHSVARVYLVPGTGKITINKRDIDEYLGLETLKVVVRQPLVATDTIDKYDVLVNVHGGGFTGQAGAIRHGISRALLQVDGEFRSTLKKAGFLTRDPRMKERKKPGLRKARRAPQFSKR 136
>gi|166033532|ref|ZP_02236361.1| hypothetical protein DORFOR_03258 [Dorea formicigenerans ATCC 27755] >gi|166026717|gb|EDR45474.1| hypothetical protein DORFOR_03258 [Dorea formicigenerans ATCC 27755] (130 aa)
Score = 340, Expect = 1.0e-30, Identities = 77/130 (59%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  ++ G GRRK SVA V LVPGTG I IN+R  +EY     +   + QPLV T+T   FDV V V GGG+TGQAGAIR GIARALL A++++R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKAKFYGTGRRKKSVARVYLVPGTGNITINKRDIDEYLGLETLKVVVRQPLVATETADKFDVIVNVKGGGYTGQAGAIRHGIARALLEADSEYRPVLKKAGYLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|15612732|ref|NP_241035.1| 30S ribosomal protein S9 [Bacillus halodurans C-125] >gi|20139938|sp|Q9KGD4|RS9_BACHD 30S ribosomal protein S9 >gi|10172781|dbj|BAB03888.1| 30S ribosomal protein S9 [Bacillus halodurans C-125] (130 aa)
Score = 339, Expect = 1.1e-30, Identities = 77/130 (59%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG G I+IN R  +EYF    +   ++QPLV T T   +DV V V GGGFTGQAGAIR GIARALL  + ++R +LK +  LTRD R KERKKYGL  ARR+PQF+KR
  S:     1 MAQVQYYGTGRRKHSVARVRLVPGDGNIVINGRSLDEYFGLETLKLIVKQPLVETGTEGQYDVRVNVDGGGFTGQAGAIRHGIARALLQVDPEYRPSLKSAGFLTRDARMKERKKYGLKAARRAPQFSKR 130
>gi|150015079|ref|YP_001307333.1| 30S ribosomal protein S9 [Clostridium beijerinckii NCIMB 8052] >gi|189045692|sp|A6LPU7|RS9_CLOB8 30S ribosomal protein S9 >gi|149901544|gb|ABR32377.1| ribosomal protein S9 [Clostridium beijerinckii NCIMB 8052] (130 aa)
Score = 339, Expect = 1.3e-30, Identities = 75/130 (57%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG+GK+L+N+R+   +F    +   + QPLV+T T+  FDV V V GGGFTGQAGAIR GIARAL+ ++   +  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYMGTGRRKKSVARVRLVPGSGKVLVNKREIENFFGLETLRVIVNQPLVLTGTKDRFDVLVNVHGGGFTGQAGAIRHGIARALVKSDEALKPELKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|58336662|ref|YP_193247.1| 30S ribosomal protein S9 [Lactobacillus acidophilus NCFM] >gi|58253979|gb|AAV42216.1| 30S ribosomal protein S9 [Lactobacillus acidophilus NCFM] (131 aa)
Score = 337, Expect = 2.2e-30, Identities = 72/125 (57%), Positives = 92/125 (73%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK SVA V+LVPG GKI +N +  ++Y P   +++D++QPL +T+T   +D+ V V GGGF+GQAGAIRLGIARALL  + DFR  LK +  LTRDPR KERKK GL  AR++ QF+KR
  S:     7 YTGTGRRKDSVARVRLVPGNGKITVNGKDIDQYIPFPNLVKDLKQPLTLTETEGQYDIHVNVNGGGFSGQAGAIRLGIARALLEVDPDFRGPLKKAGFLTRDPRMKERKKPGLKKARKASQFSKR 131
>gi|150392124|ref|YP_001322173.1| ribosomal protein S9 [Alkaliphilus metalliredigens QYMF] >gi|167012618|sp|A6TWE6|RS9_ALKMQ 30S ribosomal protein S9 >gi|149951986|gb|ABR50514.1| ribosomal protein S9 [Alkaliphilus metalliredigens QYMF] (130 aa)
Score = 337, Expect = 2.2e-30, Identities = 74/130 (56%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V Y G GRRK+++A V+LVPG G I IN+R   EYF    + +D+  PL +T+T   FDV   V GGG+TGQAGA+R GIARALL A+++ R  LK +  LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MARVTYYGTGRRKNAIARVRLVPGEGNITINKRNIEEYFNYETLRRDVRLPLELTETLSQFDVLATVNGGGYTGQAGALRHGIARALLKADDELRPALKKAGYLTRDSRMKERKKYGLKGARRAPQFSKR 130
>gi|104773575|ref|YP_618555.1| 30S ribosomal protein S9 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513572|ref|YP_812478.1| 30S ribosomal protein S9 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422656|emb|CAI97264.1| 30S ribosomal protein S9 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092887|gb|ABJ58040.1| SSU ribosomal protein S9P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (131 aa)
Score = 336, Expect = 2.3e-30, Identities = 72/127 (56%), Positives = 92/127 (72%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRK +VA V+LVPG GKI +N +   +Y P  ++++D++QPL +T+T   +DV V V GGGF+GQAGAIR GIARALL  + DFR  LK +  LTRDPR KERKK GL  AR++ QF+KR
  S:     5 VAYAGTGRRKDAVARVRLVPGDGKITVNNKDVADYIPLPILVKDLKQPLTLTETEGQYDVIVNVNGGGFSGQAGAIRHGIARALLEVDPDFRGPLKKAGFLTRDPRMKERKKPGLKKARKASQFSKR 131
>gi|47459065|ref|YP_015927.1| 30S ribosomal protein S9 [Mycoplasma mobile 163K] >gi|81697066|sp|Q6KI60|RS9_MYCMO 30S ribosomal protein S9 >gi|47458394|gb|AAT27716.1| 30S ribosomal protein s9 [Mycoplasma mobile 163K] (130 aa)
Score = 336, Expect = 2.8e-30, Identities = 75/130 (57%), Positives = 97/130 (74%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS++ Y+GLGRRKSS A V L PG G+ LIN+R   +Y  + ++++D  QP+VI+D ++ FD+ V V GGG +GQAGAIRLGIARALL  + DFRK LK + MLTRD R KERKK GL  AR++ QF+KR
  S:     1 MSDIMYRGLGRRKSSSARVILRPGKGEFLINKRVARDYLMSDILLKDALQPIVISDQKEKFDITVNVRGGGLSGQAGAIRLGIARALLEVSVDFRKNLKTAGMLTRDARVKERKKPGLKKARKARQFSKR 130
>gi|163816012|ref|ZP_02207382.1| hypothetical protein COPEUT_02192 [Coprococcus eutactus ATCC 27759] >gi|158448822|gb|EDP25817.1| hypothetical protein COPEUT_02192 [Coprococcus eutactus ATCC 27759] (131 aa)
Score = 336, Expect = 3.0e-30, Identities = 73/126 (57%), Positives = 92/126 (73%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++ G GRRKSS+A V + PGTGKI+IN++  +EYF    +   ++QPLV T T   +DV V V GGGFTGQAGAIR GI+RALL  + ++R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     6 KFYGTGRRKSSIARVYITPGTGKIVINKKDMDEYFGLDTLKVIVKQPLVATGTEGKYDVLVNVCGGGFTGQAGAIRHGISRALLEVDAEYRPILKKAGYLTRDPRMKERKKYGLKAARRAPQFSKR 131
>gi|158319579|ref|YP_001512086.1| ribosomal protein S9 [Alkaliphilus oremlandii OhILAs] >gi|167012619|sp|A8MLH6|RS9_ALKOO 30S ribosomal protein S9 >gi|158139778|gb|ABW18090.1| ribosomal protein S9 [Alkaliphilus oremlandii OhILAs] (130 aa)
Score = 335, Expect = 3.1e-30, Identities = 75/130 (57%), Positives = 89/130 (68%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V Y G GRRK S+A V+LVPG G I IN R   EYF    + +D+  PL ITDT   FDV   V GGG+TGQAGA+R GI+RAL  ++ + R TLK +  LTRD R KERKKYGL  ARRSPQF+KR
  S:     1 MARVAYYGTGRRKQSIARVRLVPGEGNIKINNRDIEEYFKYETLKRDVRMPLTITDTLSRFDVIATVAGGGYTGQAGALRHGISRALTKSDEELRGTLKRAGFLTRDARMKERKKYGLKAARRSPQFSKR 130
>gi|167629503|ref|YP_001680002.1| 30S ribosomal protein s9 [Heliobacterium modesticaldum Ice1] >gi|167592243|gb|ABZ83991.1| 30S ribosomal protein s9 [Heliobacterium modesticaldum Ice1] (130 aa)
Score = 334, Expect = 5.1e-30, Identities = 77/130 (59%), Positives = 90/130 (69%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V++ G GRRK SVA V+LVPG GK LIN R   EYF    +   + QPL +T +   FDV   V GGG +GQAGAIRLGIARALL A+   R  LK +  LTRDPRAKERKKYGL  ARR+PQF+KR
  S:     1 MAQVQFLGTGRRKKSVARVRLVPGDGKFLINNRSLMEYFGKKTLEMIVRQPLELTKSEGRFDVLCNVHGGGTSGQAGAIRLGIARALLKADIGLRPVLKRAGFLTRDPRAKERKKYGLKAARRAPQFSKR 130
>gi|15896348|ref|NP_349697.1| 30S ribosomal protein S9 [Clostridium acetobutylicum ATCC 824] >gi|20139907|sp|Q97EL3|RS9_CLOAB 30S ribosomal protein S9 >gi|15026162|gb|AAK81037.1|AE007806_10 Ribosomal protein S9 [Clostridium acetobutylicum ATCC 824] (130 aa)
Score = 333, Expect = 6.0e-30, Identities = 75/130 (57%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK +VA V+LVPG GK++IN+R   +YF    +   + QPL +T T+  FDV V V GGGFTGQAGAIR GI+RALL A+   +  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYMGTGRRKEAVARVRLVPGEGKVVINKRSAEDYFGLETLRFIVNQPLNLTGTKGKFDVLVNVHGGGFTGQAGAIRHGISRALLKADETLKGELKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|161506905|ref|YP_001576859.1| 30S ribosomal protein S9 [Lactobacillus helveticus DPC 4571] >gi|160347894|gb|ABX26568.1| 30S ribosomal protein S9 [Lactobacillus helveticus DPC 4571] (131 aa)
Score = 333, Expect = 6.3e-30, Identities = 72/125 (57%), Positives = 91/125 (72%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK SVA V+LVPG GKI +N +  ++Y P   +++D++QPL +T+T   +DV V V GGGF+GQAGAIR GIARALL  + DFR  LK +  LTRDPR KERKK GL  AR++ QF+KR
  S:     7 YTGTGRRKDSVARVRLVPGNGKITVNGKDVDQYIPYPNLVKDLKQPLTLTETEGQYDVHVNVNGGGFSGQAGAIRHGIARALLEVDPDFRGPLKKAGFLTRDPRMKERKKPGLKKARKASQFSKR 131
>gi|162447008|ref|YP_001620140.1| small subunit ribosomal protein S9 [Acholeplasma laidlawii PG-8A] >gi|161985115|gb|ABX80764.1| small subunit ribosomal protein S9 [Acholeplasma laidlawii PG-8A] (132 aa)
Score = 333, Expect = 6.6e-30, Identities = 74/127 (58%), Positives = 90/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V+Y G GRRKSSVA V L PGTGK ++N R+  EY P++    D+ QPL +T+    FDV   V GGG TGQAGAIRLGI RAL+  + D RK LK + ++TRDPRAKER KYGL  ARR+ QF+KR
  S:     6 VQYLGTGRRKSSVARVILTPGTGKFIVNGREFEEYIPSAATRLDVLQPLELTENVGKFDVRANVNGGGLTGQAGAIRLGITRALMEVDEDLRKVLKPAGLVTRDPRAKERYKYGLRKARRATQFSKR 132
>gi|187935155|ref|YP_001884509.1| ribosomal protein S9 [Clostridium botulinum B str. Eklund 17B] >gi|187723308|gb|ACD24529.1| ribosomal protein S9 [Clostridium botulinum B str. Eklund 17B] (130 aa)
Score = 332, Expect = 7.9e-30, Identities = 75/130 (57%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG GK++IN+R+   +F    +   + QPLV+T T+  FDV V V GGGFTGQAGAIR GI RAL+ ++   R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYMGTGRRKKSVARVRLVPGNGKVVINKREIETFFGLETLRVIVNQPLVLTGTKDKFDVLVNVHGGGFTGQAGAIRHGITRALVKSDETLRPELKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|121534667|ref|ZP_01666488.1| ribosomal protein S9 [Thermosinus carboxydivorans Nor1] >gi|121306687|gb|EAX47608.1| ribosomal protein S9 [Thermosinus carboxydivorans Nor1] (130 aa)
Score = 331, Expect = 1.0e-29, Identities = 73/130 (56%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK++VA V+L+PG GKI+IN R  N+YF    +   ++QPL +TDT   +DV  +V GGG +GQAGA+R GIARALL  + DFR  LK +  LTRDPR KER+KYGL  AR++PQF+KR
  S:     1 MALVQYYGTGRRKTAVARVRLIPGEGKIIINGRNLNDYFGRKTLELIVKQPLHLTDTLGKYDVIARVNGGGPSGQAGAVRHGIARALLKVDADFRPALKKAGFLTRDPREKERRKYGLKKARKAPQFSKR 130
>gi|188587721|ref|YP_001919708.1| ribosomal protein S9 [Clostridium botulinum E3 str. Alaska E43] >gi|188498002|gb|ACD51138.1| ribosomal protein S9 [Clostridium botulinum E3 str. Alaska E43] (130 aa)
Score = 329, Expect = 1.5e-29, Identities = 75/130 (57%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG GK+ IN+R+   +F    +   + QPLV+T T+  FDV V V GGGFTGQAGAIR GI RAL+ ++   R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYMGTGRRKKSVARVRLVPGNGKVTINKREIETFFGLETLRVIVNQPLVLTGTKDKFDVLVNVHGGGFTGQAGAIRHGITRALVKSDETLRPELKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|168187778|ref|ZP_02622413.1| ribosomal protein S9 [Clostridium botulinum C str. Eklund] >gi|169294349|gb|EDS76482.1| ribosomal protein S9 [Clostridium botulinum C str. Eklund] (130 aa)
Score = 329, Expect = 1.6e-29, Identities = 76/130 (58%), Positives = 91/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V LVPG GK+ IN+R    YF    +   + QPLV+T T++ FDV V V GGGFTGQAGAIR GI RAL+ A+   +  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYFGTGRRKKSVARVILVPGDGKVTINKRDIEAYFGLETLRYIVNQPLVLTGTKEKFDVIVNVNGGGFTGQAGAIRHGITRALVKADETLKPELKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|195978841|ref|YP_002124085.1| 30S ribosomal protein S9 RpsI [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975546|gb|ACG63072.1| 30S ribosomal protein S9 RpsI [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (130 aa)
Score = 328, Expect = 2.0e-29, Identities = 70/130 (53%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T  ++DVFV VVGGG+ GQ+GAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|22536399|ref|NP_687250.1| 30S ribosomal protein S9 [Streptococcus agalactiae 2603V/R] >gi|25010285|ref|NP_734680.1| 30S ribosomal protein S9 [Streptococcus agalactiae NEM316] >gi|76786886|ref|YP_328945.1| 30S ribosomal protein S9 [Streptococcus agalactiae A909] >gi|76798155|ref|ZP_00780408.1| ribosomal protein S9 [Streptococcus agalactiae 18RS21] >gi|77405345|ref|ZP_00782440.1| ribosomal protein S9 [Streptococcus agalactiae H36B] >gi|77409657|ref|ZP_00786327.1| ribosomal protein S9 [Streptococcus agalactiae COH1] >gi|77410969|ref|ZP_00787325.1| ribosomal protein S9 [Streptococcus agalactiae CJB111] >gi|77413787|ref|ZP_00789967.1| ribosomal protein S9 [Streptococcus agalactiae 515] >gi|123602504|sp|Q3K3F8|RS9_STRA1 30S ribosomal protein S9 >gi|39932196|sp|Q8E1Y6|RS9_STRA5 30S ribosomal protein S9 >gi|39932199|sp|Q8E7E4|RS9_STRA3 30S ribosomal protein S9 >gi|22533226|gb|AAM99122.1|AE014201_20 ribosomal protein S9 [Streptococcus agalactiae 2603V/R] >gi|23094637|emb|CAD45855.1| ribosomal protein S9 [Streptococcus agalactiae NEM316] >gi|76561943|gb|ABA44527.1| ribosomal protein S9 [Streptococcus agalactiae A909] >gi|76586514|gb|EAO63019.1| ribosomal protein S9 [Streptococcus agalactiae 18RS21] >gi|77160149|gb|EAO71280.1| ribosomal protein S9 [Streptococcus agalactiae 515] >gi|77163024|gb|EAO73979.1| ribosomal protein S9 [Streptococcus agalactiae CJB111] >gi|77171726|gb|EAO74925.1| ribosomal protein S9 [Streptococcus agalactiae COH1] >gi|77176023|gb|EAO78797.1| ribosomal protein S9 [Streptococcus agalactiae H36B] (130 aa)
Score = 328, Expect = 2.2e-29, Identities = 70/130 (53%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK++VA V+LVPGTGKI IN++   EY P++ +   + QP  +T T+ ++DVFV VVGGG+ GQ+GAIR GI+RALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYAGTGRRKNAVARVRLVPGTGKITINKKDVEEYIPHADLRLVINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|24378685|ref|NP_720640.1| 30S ribosomal protein S9 [Streptococcus mutans UA159] >gi|39932193|sp|Q8DW97|RS9_STRMU 30S ribosomal protein S9 >gi|24376548|gb|AAN57946.1|AE014868_8 30S ribosomal protein S9 [Streptococcus mutans UA159] (130 aa)
Score = 327, Expect = 2.6e-29, Identities = 70/130 (53%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T  ++DVFV VVGGG+ GQ+GAIR GIARALL  + DFR  LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTEGSYDVFVNVVGGGYAGQSGAIRHGIARALLEVDPDFRDALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|118444492|ref|YP_877234.1| 30S ribosomal protein S9 [Clostridium novyi NT] >gi|166200068|sp|A0PXY2|RS9_CLONN 30S ribosomal protein S9 >gi|118134948|gb|ABK61992.1| ribosomal protein S9 [Clostridium novyi NT] (130 aa)
Score = 327, Expect = 3.1e-29, Identities = 76/130 (58%), Positives = 90/130 (69%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V LVPG GK+ IN+R    YF    +   + QPLV+T T+  FDV V V GGGFTGQAGAIR GI RAL+ A+   +  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAKVQYFGTGRRKKSVARVILVPGDGKVTINKRDIEVYFGLETLRYIVNQPLVLTGTKDKFDVIVNVNGGGFTGQAGAIRHGITRALVKADETLKPELKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|28377872|ref|NP_784764.1| 30S ribosomal protein S9 [Lactobacillus plantarum WCFS1] >gi|38258335|sp|Q88XU7|RS9_LACPL 30S ribosomal protein S9 >gi|28270705|emb|CAD63611.1| ribosomal protein S9 [Lactobacillus plantarum WCFS1] (130 aa)
Score = 326, Expect = 3.4e-29, Identities = 71/130 (54%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y+G GRRK SVA V+LVPGTGKI++N +   +Y P + + +++ QP  +T+T   +DV V V GGGF GQAGA R GIARALL  + DFR  LK + +LTRD R KERKK GL  AR++ QF+KR
  S:     1 MAQVQYRGTGRRKDSVARVRLVPGTGKIVMNDKSVEDYIPFADIRKELLQPFEVTETTDQYDVLVNVNGGGFHGQAGATRHGIARALLEVDPDFRTPLKRAGLLTRDARMKERKKPGLKKARKASQFSKR 130
>gi|15902316|ref|NP_357866.1| 30S ribosomal protein S9 [Streptococcus pneumoniae R6] >gi|116517105|ref|YP_815793.1| 30S ribosomal protein S9 [Streptococcus pneumoniae D39] >gi|148983703|ref|ZP_01817022.1| ribosomal protein S9 [Streptococcus pneumoniae SP3-BS71] >gi|148988037|ref|ZP_01819500.1| ribosomal protein S9 [Streptococcus pneumoniae SP6-BS73] >gi|148994678|ref|ZP_01823782.1| 30S ribosomal protein S9 [Streptococcus pneumoniae SP9-BS68] >gi|148996721|ref|ZP_01824439.1| ribosomal protein S9 [Streptococcus pneumoniae SP11-BS70] >gi|149001585|ref|ZP_01826558.1| 30S ribosomal protein S9 [Streptococcus pneumoniae SP14-BS69] >gi|149006049|ref|ZP_01829778.1| ribosomal protein S9 [Streptococcus pneumoniae SP18-BS74] >gi|149011167|ref|ZP_01832472.1| ribosomal protein S9 [Streptococcus pneumoniae SP19-BS75] >gi|149017992|ref|ZP_01834451.1| ribosomal protein S9 [Streptococcus pneumoniae SP23-BS72] >gi|168484169|ref|ZP_02709121.1| ribosomal protein S9 [Streptococcus pneumoniae CDC1873-00] >gi|168489773|ref|ZP_02713972.1| ribosomal protein S9 [Streptococcus pneumoniae SP195] >gi|168490775|ref|ZP_02714918.1| ribosomal protein S9 [Streptococcus pneumoniae CDC0288-04] >gi|168494707|ref|ZP_02718850.1| ribosomal protein S9 [Streptococcus pneumoniae CDC3059-06] >gi|168576709|ref|ZP_02722567.1| ribosomal protein S9 [Streptococcus pneumoniae MLV-016] >gi|169834176|ref|YP_001693823.1| ribosomal protein S9 [Streptococcus pneumoniae Hungary19A-6] >gi|182683279|ref|YP_001835026.1| 30S ribosomal protein S9 [Streptococcus pneumoniae CGSP14] >gi|194397340|ref|YP_002036995.1| 30S ribosomal protein S9 [Streptococcus pneumoniae G54] >gi|122279321|sp|Q04MF5|RS9_STRP2 30S ribosomal protein S9 >gi|39932187|sp|Q8CWU4|RS9_STRR6 30S ribosomal protein S9 >gi|15457823|gb|AAK99076.1| 30S Ribosomal protein S9 [Streptococcus pneumoniae R6] >gi|116077681|gb|ABJ55401.1| ribosomal protein S9 [Streptococcus pneumoniae D39] >gi|147757296|gb|EDK64335.1| ribosomal protein S9 [Streptococcus pneumoniae SP11-BS70] >gi|147760043|gb|EDK67032.1| 30S ribosomal protein S9 [Streptococcus pneumoniae SP14-BS69] >gi|147762405|gb|EDK69366.1| ribosomal protein S9 [Streptococcus pneumoniae SP18-BS74] >gi|147764803|gb|EDK71733.1| ribosomal protein S9 [Streptococcus pneumoniae SP19-BS75] >gi|147923850|gb|EDK74962.1| ribosomal protein S9 [Streptococcus pneumoniae SP3-BS71] >gi|147926501|gb|EDK77574.1| ribosomal protein S9 [Streptococcus pneumoniae SP6-BS73] >gi|147927078|gb|EDK78118.1| 30S ribosomal protein S9 [Streptococcus pneumoniae SP9-BS68] >gi|147931556|gb|EDK82534.1| ribosomal protein S9 [Streptococcus pneumoniae SP23-BS72] >gi|168996678|gb|ACA37290.1| ribosomal protein S9 [Streptococcus pneumoniae Hungary19A-6] >gi|172042531|gb|EDT50577.1| ribosomal protein S9 [Streptococcus pneumoniae CDC1873-00] >gi|182628613|gb|ACB89561.1| 30S ribosomal protein S9 [Streptococcus pneumoniae CGSP14] >gi|183571841|gb|EDT92369.1| ribosomal protein S9 [Streptococcus pneumoniae SP195] >gi|183574862|gb|EDT95390.1| ribosomal protein S9 [Streptococcus pneumoniae CDC0288-04] >gi|183575393|gb|EDT95921.1| ribosomal protein S9 [Streptococcus pneumoniae CDC3059-06] >gi|183577532|gb|EDT98060.1| ribosomal protein S9 [Streptococcus pneumoniae MLV-016] >gi|194357007|gb|ACF55455.1| 30S ribosomal protein S9 [Streptococcus pneumoniae G54] (130 aa)
Score = 326, Expect = 3.4e-29, Identities = 71/130 (54%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T  ++DVFV VVGGG+ GQ+GAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130
>gi|15900229|ref|NP_344833.1| 30S ribosomal protein S9 [Streptococcus pneumoniae TIGR4] >gi|111656949|ref|ZP_01407765.1| hypothetical protein SpneT_02001813 [Streptococcus pneumoniae TIGR4] >gi|168486580|ref|ZP_02711088.1| ribosomal protein S9 [Streptococcus pneumoniae CDC1087-00] >gi|20139909|sp|Q97SN4|RS9_STRPN 30S ribosomal protein S9 >gi|14971768|gb|AAK74473.1| ribosomal protein S9 [Streptococcus pneumoniae TIGR4] >gi|183570382|gb|EDT90910.1| ribosomal protein S9 [Streptococcus pneumoniae CDC1087-00] (130 aa)
Score = 326, Expect = 4.0e-29, Identities = 70/130 (53%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T  ++DVFV V+GGG+ GQ+GAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130
>gi|69245532|ref|ZP_00603496.1| Ribosomal protein S9 [Enterococcus faecium DO] >gi|68195783|gb|EAN10220.1| Ribosomal protein S9 [Enterococcus faecium DO] (130 aa)
Score = 325, Expect = 4.5e-29, Identities = 70/130 (53%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK++VA V+LVPGTGKI +N++   EY P++ + + + QP  +T+T+  +DVFV V GGG+ GQ+GAIR GIARALL  + DFR  LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQVQYIGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFAVTETKGAYDVFVNVNGGGYAGQSGAIRHGIARALLEVDPDFRLALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|160946551|ref|ZP_02093754.1| hypothetical protein PEPMIC_00509 [Peptostreptococcus micros ATCC 33270] >gi|158446935|gb|EDP23930.1| hypothetical protein PEPMIC_00509 [Peptostreptococcus micros ATCC 33270] (129 aa)
Score = 325, Expect = 4.6e-29, Identities = 74/126 (58%), Positives = 88/126 (69%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK+SVA V L PG GK +IN++   EYF    +    + PL IT++   FDV+V V GGGFTGQAGAIR GIARALL  + + R  LK +  LTRDPR KERKKYGL  ARRSPQF+KR
  S:     4 QYMGTGRRKTSVARVFLTPGNGKFIINKKDIEEYFDYDTLKVTAKSPLEITESLGKFDVYVTVKGGGFTGQAGAIRHGIARALLEVSAELRPVLKRAGYLTRDPRKKERKKYGLKKARRSPQFSKR 129
>gi|18311351|ref|NP_563285.1| 30S ribosomal protein S9 [Clostridium perfringens str. 13] >gi|110798864|ref|YP_697058.1| 30S ribosomal protein S9 [Clostridium perfringens ATCC 13124] >gi|110803894|ref|YP_699628.1| 30S ribosomal protein S9 [Clostridium perfringens SM101] >gi|168205198|ref|ZP_02631203.1| ribosomal protein S9 [Clostridium perfringens E str. JGS1987] >gi|168216667|ref|ZP_02642292.1| ribosomal protein S9 [Clostridium perfringens NCTC 8239] >gi|169347126|ref|ZP_02866068.1| ribosomal protein S9 [Clostridium perfringens C str. JGS1495] >gi|182625806|ref|ZP_02953573.1| ribosomal protein S9 [Clostridium perfringens D str. JGS1721] >gi|123047169|sp|Q0SQH9|RS9_CLOPS 30S ribosomal protein S9 >gi|123344495|sp|Q0TMT2|RS9_CLOP1 30S ribosomal protein S9 >gi|20139884|sp|Q8XHV7|RS9_CLOPE 30S ribosomal protein S9 >gi|18146035|dbj|BAB82075.1| 30S ribosomal protein S9 [Clostridium perfringens str. 13] >gi|110673511|gb|ABG82498.1| ribosomal protein S9 [Clostridium perfringens ATCC 13124] >gi|110684395|gb|ABG87765.1| ribosomal protein S9 [Clostridium perfringens SM101] >gi|169296809|gb|EDS78938.1| ribosomal protein S9 [Clostridium perfringens C str. JGS1495] >gi|170663296|gb|EDT15979.1| ribosomal protein S9 [Clostridium perfringens E str. JGS1987] >gi|177908962|gb|EDT71449.1| ribosomal protein S9 [Clostridium perfringens D str. JGS1721] >gi|182381188|gb|EDT78667.1| ribosomal protein S9 [Clostridium perfringens NCTC 8239] (130 aa)
Score = 325, Expect = 5.2e-29, Identities = 72/130 (55%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK SVA V+LVPG G++++N R+   YF    +   + QPLV+T+T+  +DV V V GGG +GQAGAIR GI+RALL A+ + R  LK +  LTRDPR  ERKK GL  ARRSPQF+KR
  S:     1 MAKVQYMGTGRRKKSVARVRLVPGEGRVIVNNREIETYFGLETLRVVVNQPLVLTETKDKYDVLVNVHGGGLSGQAGAIRHGISRALLKADENLRPELKKAGFLTRDPRMVERKKCGLKKARRSPQFSKR 130
>gi|193216714|ref|YP_001999956.1| ribosomal protein S9 [Mycoplasma arthritidis 158L3-1] >gi|193002037|gb|ACF07252.1| ribosomal protein S9 [Mycoplasma arthritidis 158L3-1] (132 aa)
Score = 324, Expect = 5.9e-29, Identities = 73/127 (57%), Positives = 91/127 (71%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVA-NNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + Y GLGRRKSSVA V +VPG G   IN ++  +Y  + ++I+D   P  +T+T+  FDV  KV GGG TGQAGAIRLGIARALL A NN++R  LK +  LTRD R KERKK+GL  ARR+ QF+KR
  S:     5 IRYYGLGRRKSSVARVYIVPGKGNFAINTKEAKQYLNSDILIKDALSPFAVTETQGTFDVIAKVNGGGLTGQAGAIRLGIARALLEASNNEYRNKLKDAGFLTRDARVKERKKFGLRKARRARQFSKR 132
>gi|160894720|ref|ZP_02075495.1| hypothetical protein CLOL250_02271 [Clostridium sp. L2-50] >gi|156863654|gb|EDO57085.1| hypothetical protein CLOL250_02271 [Clostridium sp. L2-50] (132 aa)
Score = 324, Expect = 6.5e-29, Identities = 75/126 (59%), Positives = 93/126 (73%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANN-DFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++ G GRRKSS+A V + PGTGKI IN++  +EYF    +   ++QPLV T T   FDV V V GGGFTGQAGAIR GI+RALL A++ ++R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     6 KFYGTGRRKSSIARVYIAPGTGKITINKKDMDEYFGLDTLKVIVKQPLVATGTDGKFDVMVNVKGGGFTGQAGAIRHGISRALLEADSEEYRPILKKAGYLTRDPRMKERKKYGLKAARRAPQFSKR 132
>gi|171778438|ref|ZP_02919596.1| hypothetical protein STRINF_00447 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282839|gb|EDT48263.1| hypothetical protein STRINF_00447 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (130 aa)
Score = 323, Expect = 7.5e-29, Identities = 70/130 (53%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK++VA V+LVPGTGKI +N++   EY P+  +   + QP  +T T  ++DVFV VVGGG+ GQ+GAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYTGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHPDLRLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|163790160|ref|ZP_02184594.1| 30S ribosomal protein S9 [Carnobacterium sp. AT7] >gi|159874651|gb|EDP68721.1| 30S ribosomal protein S9 [Carnobacterium sp. AT7] (130 aa)
Score = 323, Expect = 9.4e-29, Identities = 69/130 (53%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y   GRRK+S A V+LVPGTGKI++N++   EY P   + + ++QPL +T+T  ++DV V V GGGFTGQ+GA R GI+RALL  + DFR  LK + +LTRDPR  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYIATGRRKNSTARVRLVPGTGKIIMNKKDITEYIPFPYLHEVIKQPLALTETLGSYDVHVNVNGGGFTGQSGAARHGISRALLQVDPDFRGALKAAGLLTRDPRMVERKKPGLKKARKASQFSKR 130
>gi|55820196|ref|YP_138638.1| 30S ribosomal protein S9 [Streptococcus thermophilus LMG 18311] >gi|55822084|ref|YP_140525.1| 30S ribosomal protein S9 [Streptococcus thermophilus CNRZ1066] >gi|116627054|ref|YP_819673.1| 30S ribosomal protein S9 [Streptococcus thermophilus LMD-9] >gi|81676629|sp|Q5M1V6|RS9_STRT1 30S ribosomal protein S9 >gi|81676780|sp|Q5M6E6|RS9_STRT2 30S ribosomal protein S9 >gi|122268343|sp|Q03MU5|RS9_STRTD 30S ribosomal protein S9 >gi|55736181|gb|AAV59823.1| 30S ribosomal protein S9 [Streptococcus thermophilus LMG 18311] >gi|55738069|gb|AAV61710.1| 30S ribosomal protein S9 [Streptococcus thermophilus CNRZ1066] >gi|116100331|gb|ABJ65477.1| SSU ribosomal protein S9P [Streptococcus thermophilus LMD-9] (130 aa)
Score = 322, Expect = 1.1e-28, Identities = 69/130 (53%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T  ++DV V VVGGG+ GQ+GAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDLEEYIPHADLRLVINQPFAVTSTEGSYDVHVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|169825175|ref|YP_001692786.1| 30S ribosomal protein S9 [Finegoldia magna ATCC 29328] >gi|167831980|dbj|BAG08896.1| 30S ribosomal protein S9 [Finegoldia magna ATCC 29328] (130 aa)
Score = 320, Expect = 1.9e-28, Identities = 72/130 (55%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+N  Y+G GRRK+SVA V LVPG+GK  IN++  +EYF    +    ++ L +T+  +++DV V V GGG+TGQAGAIR G+ARALL  + D+R  LK +  LTRDPR KERKKYGL  AR+SPQF+KR
  S:     1 MANNRYQGTGRRKTSVARVTLVPGSGKFTINKKDISEYFNFDTLRVIAKEALELTNNAESYDVTVNVKGGGYTGQAGAIRHGVARALLEVDPDYRAELKRAGFLTRDPRKKERKKYGLKKARKSPQFSKR 130
>gi|118466344|ref|YP_883520.1| 30S ribosomal protein S9 [Mycobacterium avium 104] >gi|166229572|sp|A0QKT2|RS9_MYCA1 30S ribosomal protein S9 >gi|118167631|gb|ABK68528.1| ribosomal protein S9 [Mycobacterium avium 104] (166 aa)
Score = 319, Expect = 2.3e-28, Identities = 67/122 (54%), Positives = 88/122 (72%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTGK  +N R    YFPN +  Q ++ PLV  D   +FD++  + GGG +GQAGA+RLGIARAL++A+ D R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    45 VGRRKEAVVRVRLVPGTGKFNLNGRTLEGYFPNKVHQQLIKAPLVTVDRVDSFDIYAHLHGGGPSGQAGALRLGIARALILASPDDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 166
>gi|116617364|ref|YP_817735.1| SSU ribosomal protein S9P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096211|gb|ABJ61362.1| SSU ribosomal protein S9P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (131 aa)
Score = 319, Expect = 2.4e-28, Identities = 69/127 (54%), Positives = 91/127 (71%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V+Y G GRRK+SVA V+LVPG G+I +N +   EY P + + + + QP  +T+T  N+DV V V+GGG++GQAGA R GIARALL  + DFR  LK + +LTRD R KERKK GL  AR++ QF+KR
  S:     5 VQYAGTGRRKNSVARVRLVPGNGQITMNGKSIEEYIPFANLREVVLQPFNVTETLGNYDVLVNVIGGGYSGQAGATRHGIARALLTVDPDFRAALKAAGLLTRDSRMKERKKPGLKKARKASQFSKR 131
>gi|167772461|ref|ZP_02444514.1| hypothetical protein ANACOL_03839 [Anaerotruncus colihominis DSM 17241] >gi|167665564|gb|EDS09694.1| hypothetical protein ANACOL_03839 [Anaerotruncus colihominis DSM 17241] (132 aa)
Score = 319, Expect = 2.4e-28, Identities = 71/125 (56%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + G GRRK SV+ V+L PG+G I IN R  N+YF    +   + QPL +TDT   FDV   V GGG +GQAGAIR GI+RALL    D R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     8 FYGTGRRKQSVSRVRLYPGSGSITINGRDINDYFGLETLKLIVRQPLTLTDTLGKFDVVCTVTGGGVSGQAGAIRHGISRALLQNGEDMRPVLKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 132
>gi|29377675|ref|NP_816829.1| 30S ribosomal protein S9 [Enterococcus faecalis V583] >gi|39932155|sp|Q82Z47|RS9_ENTFA 30S ribosomal protein S9 >gi|29345143|gb|AAO82899.1| ribosomal protein S9 [Enterococcus faecalis V583] (130 aa)
Score = 319, Expect = 2.5e-28, Identities = 69/130 (53%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK++VA V+LVPGTGKI +N++   EY P++ + + + QP  +T+T+  +DV V V GGG+ GQ+GAIR GIARALL  + DFR  LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQVQYSGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFGVTETKGAYDVIVNVNGGGYAGQSGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|146296365|ref|YP_001180136.1| ribosomal protein S9 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409941|gb|ABP66945.1| SSU ribosomal protein S9P [Caldicellulosiruptor saccharolyticus DSM 8903] (132 aa)
Score = 318, Expect = 3.2e-28, Identities = 69/130 (53%), Positives = 90/130 (69%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++ + Y   GRRK+SVA V L PG GKI++N +   EYFP   +   ++QPL +T+T   +DV  KV GGG +GQAGA+R GIARAL++A+   R  LK +  LTRDPR  ERKKYGL  ARR+PQF+KR
  S:     3 VAQIRYYATGRRKTSVAKVWLSPGNGKIIVNDKNMEEYFPLETLRIIVKQPLTLTETLNKYDVIAKVKGGGLSGQAGALRHGIARALVLADPTLRPVLKKAGFLTRDPRMVERKKYGLKKARRAPQFSKR 132
>gi|41410344|ref|NP_963180.1| 30S ribosomal protein S9 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|81700270|sp|Q73S30|RS9_MYCPA 30S ribosomal protein S9 >gi|41399178|gb|AAS06796.1| RpsI [Mycobacterium avium subsp. paratuberculosis K-10] (166 aa)
Score = 317, Expect = 4.3e-28, Identities = 67/122 (54%), Positives = 87/122 (71%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTGK  +N R    YFPN +  Q ++ PLV  D    FD++  + GGG +GQAGA+RLGIARAL++A+ D R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    45 VGRRKEAVVRVRLVPGTGKFNLNGRTLEGYFPNKVHQQLVKAPLVTVDRVDGFDIYAHLHGGGPSGQAGALRLGIARALILASPDDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 166
>gi|56418675|ref|YP_145993.1| 30S ribosomal protein S9 [Geobacillus kaustophilus HTA426] >gi|81675957|sp|Q5L3Q5|RS9_GEOKA 30S ribosomal protein S9 >gi|56378517|dbj|BAD74425.1| 30S ribosomal protein S9 [Geobacillus kaustophilus HTA426] (130 aa)
Score = 317, Expect = 4.4e-28, Identities = 79/130 (60%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I++N+R   EY P   +I+ ++QPLV+T+T  ++DV V V GGGF GQAGAIR GIARALL  + +FR  LK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGRIIVNKRDIREYIPTEALIEMVKQPLVLTETLGSYDVLVNVQGGGFAGQAGAIRHGIARALLEVDPEFRTVLKRAGLLTRDARVKERKKYGLKGARRAPQFSKR 130
>gi|118616640|ref|YP_904972.1| 30S ribosomal protein S9 [Mycobacterium ulcerans Agy99] >gi|166229578|sp|A0PMD2|RS9_MYCUA 30S ribosomal protein S9 >gi|118568750|gb|ABL03501.1| ribosomal protein S9, RpsI [Mycobacterium ulcerans Agy99] (152 aa)
Score = 316, Expect = 5.1e-28, Identities = 67/122 (54%), Positives = 89/122 (72%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPG+GK  +N R    YFPN +  Q ++ PLV  D  +++D+F  + GGG +GQAGA+RLGIARAL+VAN + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    31 VGRRKEAVVRVRLVPGSGKFDLNGRSLEAYFPNKVHQQLIKAPLVTVDRLESYDIFALLHGGGPSGQAGALRLGIARALIVANPEDRPALKKACFLTRDPRATERKKYGLKKARKAPQYSKR 152
>gi|138893817|ref|YP_001124270.1| 30S ribosomal protein S9 [Geobacillus thermodenitrificans NG80-2] >gi|196250990|ref|ZP_03149672.1| ribosomal protein S9 [Geobacillus sp. G11MC16] >gi|166229559|sp|A4IJM1|RS9_GEOTN 30S ribosomal protein S9 >gi|134265330|gb|ABO65525.1| Ribosomal protein S9 [Geobacillus thermodenitrificans NG80-2] >gi|196209462|gb|EDY04239.1| ribosomal protein S9 [Geobacillus sp. G11MC16] (130 aa)
Score = 315, Expect = 6.5e-28, Identities = 78/130 (60%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I++N+    EY P+  +I+ ++QPLV+T+T  ++DV V V GGGF GQAGAIR GIARALL  + +FR  LK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGRIIVNKHDIREYIPSEALIEMVKQPLVLTETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLEVDPEFRAVLKRAGLLTRDARVKERKKYGLKGARRAPQFSKR 130
>gi|183981127|ref|YP_001849418.1| ribosomal protein S9, RpsI [Mycobacterium marinum M] >gi|183174453|gb|ACC39563.1| ribosomal protein S9, RpsI [Mycobacterium marinum M] (152 aa)
Score = 315, Expect = 7.4e-28, Identities = 67/122 (54%), Positives = 89/122 (72%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPG+GK  +N R    YFPN +  Q ++ PLV  D  +++D+F  + GGG +GQAGA+RLGIARAL+VAN + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    31 VGRRKEAVVRVRLVPGSGKFDLNGRSLEAYFPNKVHQQLIKAPLVTVDRLESYDIFALLHGGGPSGQAGALRLGIARALIVANPEDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 152
>gi|167344691|ref|ZP_02290532.1| 30S ribosomal protein S9 [Listeria monocytogenes FSL J1-208] (115 aa)
Score = 315, Expect = 8.2e-28, Identities = 67/115 (58%), Positives = 85/115 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKK 115
           M+ V+Y G GRRKSSVA V+LVPG GKI+IN R   +Y P + + + ++QPLV T+T  N+DV V V GGG+TGQAGAIR G+ARALL    ++R  LK + +LTRDPR KERKK
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALREVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEYRPALKSAGLLTRDPRMKERKK 115
>gi|170017910|ref|YP_001728829.1| ribosomal protein S9 [Leuconostoc citreum KM20] >gi|169804767|gb|ACA83385.1| Ribosomal protein S9 [Leuconostoc citreum KM20] (131 aa)
Score = 314, Expect = 9.3e-28, Identities = 69/127 (54%), Positives = 90/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V+Y G GRRK+SVA V+LVPG G+I +N +   EY P + + + + QP   T+T  N+DV V V+GGG++GQAGA R GIARALL  + DFR  LK + +LTRD R KERKK GL  AR++ QF+KR
  S:     5 VQYAGTGRRKNSVARVRLVPGNGQITMNGKSIEEYIPFANLREVVLQPFNATETLGNYDVLVNVIGGGYSGQAGATRHGIARALLTVDPDFRAALKSAGLLTRDSRMKERKKPGLKKARKASQFSKR 131
>gi|54020650|ref|YP_116179.1| 30S ribosomal protein S9 [Mycoplasma hyopneumoniae 232] >gi|71893998|ref|YP_279444.1| 30S ribosomal protein S9 [Mycoplasma hyopneumoniae J] >gi|72080977|ref|YP_288035.1| 30S ribosomal protein S9 [Mycoplasma hyopneumoniae 7448] >gi|81680585|sp|Q5ZZN6|RS9_MYCH2 30S ribosomal protein S9 >gi|123644624|sp|Q4A777|RS9_MYCH7 30S ribosomal protein S9 >gi|123645398|sp|Q4A938|RS9_MYCHJ 30S ribosomal protein S9 >gi|53987823|gb|AAV28024.1| 30s ribosomal protein S9 [Mycoplasma hyopneumoniae 232] >gi|71852125|gb|AAZ44733.1| 30S ribosomal protein S9 [Mycoplasma hyopneumoniae J] >gi|71914101|gb|AAZ54012.1| 30S ribosomal protein S9 [Mycoplasma hyopneumoniae 7448] (132 aa)
Score = 314, Expect = 1.0e-27, Identities = 73/127 (57%), Positives = 89/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + Y G GRRKSSVA V L  G G+  IN R   EY  + ++I+D  QPL IT+T   F++ V   GGG +GQAGAIRLGIARALL  + D+R  LKV+ MLTRD RAKERKK+GL  ARR+ QF+KR
  S:     6 LSYYGTGRRKSSVARVTLKHGNGQFKINNRVAKEYLKSDILIKDALQPLSITNTVSEFNIRVNAHGGGISGQAGAIRLGIARALLKVSADYRPGLKVAGMLTRDARAKERKKFGLRKARRARQFSKR 132
>gi|30918501|sp|P07842|RS9_BACST 30S ribosomal protein S9 (BS10) (130 aa)
Score = 313, Expect = 1.2e-27, Identities = 78/130 (60%), Positives = 100/130 (76%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRKSSVA V+LVPG G+I++N++   EY P   +I+ ++QPLV+T+T  ++DV V V GGGF GQAGAIR GIARALL  + +FR  LK + +LTRD R KERKKYGL GARR+PQF+KR
  S:     1 MAQVQYYGTGRRKSSVARVRLVPGDGRIIVNKQDIREYIPTEALIEMVKQPLVLTETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLQVDPEFRTVLKRAGLLTRDARVKERKKYGLKGARRAPQFSKR 130
>gi|85057861|ref|YP_456777.1| 30S ribosomal protein S9 [Aster yellows witches'-broom phytoplasma AYWB] >gi|123518076|sp|Q2NIP5|RS9_AYWBP 30S ribosomal protein S9 >gi|84789966|gb|ABC65698.1| SSU ribosomal protein S9P [Aster yellows witches'-broom phytoplasma AYWB] (130 aa)
Score = 312, Expect = 1.5e-27, Identities = 75/130 (57%), Positives = 87/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M  V Y G GRRKSSVA V L  GTGKI IN R   +Y P      +M QPL +T+ R+ FDV V V GGG + QAGAIRLGIARAL+ +  + R  LK S +LTRD R  ERKKYGL  ARR+PQF+KR
  S:     1 MKKVNYFGTGRRKSSVARVILTNGTGKITINTRDFEKYLPLPATRLEMIQPLELTEKREVFDVSVNVNGGGLSAQAGAIRLGIARALIESIPELRAILKKSGLLTRDARCVERKKYGLKKARRAPQFSKR 130
>gi|160931444|ref|ZP_02078840.1| hypothetical protein CLOLEP_00277 [Clostridium leptum DSM 753] >gi|156869509|gb|EDO62881.1| hypothetical protein CLOLEP_00277 [Clostridium leptum DSM 753] (133 aa)
Score = 311, Expect = 2.0e-27, Identities = 71/125 (56%), Positives = 89/125 (71%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND-FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + G GRRKSSVA V++  GTGK+ IN R  ++YF    +   + QPLV T+T + FD+  +V GGG TGQAGAIR GIARALL  +++  R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     8 FYGTGRRKSSVARVRVYQGTGKVTINDRDIDDYFGLETLKLIVRQPLVATETDQKFDIVCRVAGGGVTGQAGAIRHGIARALLQYDSENLRPILKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 133
>gi|54022834|ref|YP_117076.1| 30S ribosomal protein S9 [Nocardia farcinica IFM 10152] >gi|81680277|sp|Q5Z1H9|RS9_NOCFA 30S ribosomal protein S9 >gi|54014342|dbj|BAD55712.1| putative ribosomal protein S9 [Nocardia farcinica IFM 10152] (167 aa)
Score = 311, Expect = 2.0e-27, Identities = 63/122 (51%), Positives = 88/122 (72%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTG+ ++N R   +YFPN +  Q ++ PLV  +  ++FD+  ++VGGG +GQAGA+RL IARAL+    + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    46 VGRRKEAVVRVRLVPGTGQFVLNGRSIEDYFPNKVHQQLVKSPLVTVERTESFDIHARLVGGGPSGQAGALRLAIARALIEVTPEDRPALKRAGFLTRDPRATERKKYGLKKARKAPQYSKR 167
>gi|188584872|ref|YP_001916417.1| SSU ribosomal protein S9P [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349559|gb|ACB83829.1| SSU ribosomal protein S9P [Natranaerobius thermophilus JW/NM-WN-LF] (132 aa)
Score = 311, Expect = 2.1e-27, Identities = 70/130 (53%), Positives = 90/130 (69%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++ V+Y G GRRK+SVA V+LVPG GKI++N +  ++YF    +   ++QPL   +    FDV V V GGG +GQA AIR GIARAL+ A+ + R  LK    LTRDPR KERKKYGL  ARR+PQF+KR
  S:     3 VAKVQYFGTGRRKTSVARVRLVPGNGKIVVNNKAMDDYFGLETLKAIIKQPLQTVEMEDKFDVLVNVRGGGHSGQAEAIRHGIARALVKADGELRPVLKKEGYLTRDPRMKERKKYGLRKARRAPQFSKR 132
>gi|116334236|ref|YP_795763.1| 30S ribosomal protein S9 [Lactobacillus brevis ATCC 367] >gi|122269082|sp|Q03PZ0|RS9_LACBA 30S ribosomal protein S9 >gi|116099583|gb|ABJ64732.1| SSU ribosomal protein S9P [Lactobacillus brevis ATCC 367] (130 aa)
Score = 311, Expect = 2.1e-27, Identities = 69/130 (53%), Positives = 93/130 (71%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y+G GRRK+S A V+LVPG+GKI++N +   +Y P + + + + QP  +T+T  N+D  V V GGGF+GQAGA R GIARALL  + DFR  LK + +LTRD R KERKK GL  AR++ QF+KR
  S:     1 MAQVQYRGTGRRKNSSARVRLVPGSGKIVMNNKAIEDYIPFASIREVVLQPFNVTETLGNYDALVTVRGGGFSGQAGATRHGIARALLEVDPDFRGPLKRAGLLTRDARMKERKKPGLKKARKASQFSKR 130
>gi|167749886|ref|ZP_02422013.1| hypothetical protein EUBSIR_00854 [Eubacterium siraeum DSM 15702] >gi|167657198|gb|EDS01328.1| hypothetical protein EUBSIR_00854 [Eubacterium siraeum DSM 15702] (132 aa)
Score = 310, Expect = 3.0e-27, Identities = 67/125 (53%), Positives = 86/125 (68%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK SVA V++ PG+G I +N R  ++YF    +   + QPL +T T + FD+   V GGG TGQAGAIR G++RALL  +++ R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     8 YYGTGRRKHSVARVRVYPGSGVITVNGRGIDDYFGLETLKLIVRQPLALTGTTEKFDIVCTVAGGGVTGQAGAIRHGLSRALLQYSDELRPVLKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 132
>gi|160914425|ref|ZP_02076640.1| hypothetical protein EUBDOL_00429 [Eubacterium dolichum DSM 3991] >gi|158433583|gb|EDP11872.1| hypothetical protein EUBDOL_00429 [Eubacterium dolichum DSM 3991] (134 aa)
Score = 309, Expect = 3.3e-27, Identities = 66/129 (51%), Positives = 87/129 (67%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRK+SVA V + PG G I++N +   EY P   +   +  PL +T+T   FD+ + V GGG+TGQAGA+R GI RAL+ A+ D+R  LK +  +TRD R KERKKYGL  ARR+PQF+KR
  S:     6 NTVTYNGTGRRKTSVARVFMTPGKGNIVVNGKTLEEYLPLETLRMVVRSPLELTETLGQFDIKINVQGGGYTGQAGAMRHGITRALMAASEDYRPALKAAGFVTRDSRMKERKKYGLKAARRAPQFSKR 134
>gi|147676692|ref|YP_001210907.1| ribosomal protein S9 [Pelotomaculum thermopropionicum SI] >gi|189045705|sp|A5D5F7|RS9_PELTS 30S ribosomal protein S9 >gi|146272789|dbj|BAF58538.1| ribosomal protein S9 [Pelotomaculum thermopropionicum SI] (130 aa)
Score = 308, Expect = 4.3e-27, Identities = 68/130 (52%), Positives = 91/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V + G GRRK+++A V  +PG G+I+IN R  +EYF    +   + QPL +T T   FD+  KV GGG +GQAGAI+LGIARAL+ A+ + R  LK +  LTRDPR KER+KYGL  ARR+PQ++KR
  S:     1 MAKVMFYGTGRRKNAIARVFAMPGEGRIIINNRPLSEYFGRKTLETIVRQPLDLTGTASRFDIMAKVQGGGISGQAGAIKLGIARALIQADPNLRPVLKKAGFLTRDPRMKERRKYGLKKARRAPQYSKR 130
>gi|39938625|ref|NP_950391.1| 30S ribosomal protein S9 [Onion yellows phytoplasma OY-M] >gi|81698697|sp|Q6YR77|RS9_ONYPE 30S ribosomal protein S9 >gi|39721734|dbj|BAD04224.1| ribosomal protein S9 [Onion yellows phytoplasma OY-M] (130 aa)
Score = 308, Expect = 4.6e-27, Identities = 73/130 (56%), Positives = 87/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M  V Y G GRRKS+VA V L  GTGKI IN R   +Y P      +M QPL +T+ R+ FDV V V GGG + QAGAIRLGIARAL+ +  + R  LK + +LTRD R  ERKKYGL  ARR+PQF+KR
  S:     1 MKKVNYFGTGRRKSAVARVILTNGTGKITINTRDFEKYLPLPATRLEMIQPLELTEKREAFDVSVNVNGGGLSAQAGAIRLGIARALIESVPELRAILKKAGLLTRDARCVERKKYGLKKARRAPQFSKR 130
>gi|148544663|ref|YP_001272033.1| SSU ribosomal protein S9P [Lactobacillus reuteri F275] >gi|184154016|ref|YP_001842357.1| 30S ribosomal protein S9 [Lactobacillus reuteri F275] >gi|194466920|ref|ZP_03072907.1| ribosomal protein S9 [Lactobacillus reuteri 100-23] >gi|148531697|gb|ABQ83696.1| SSU ribosomal protein S9P [Lactobacillus reuteri F275] >gi|183225360|dbj|BAG25877.1| 30S ribosomal protein S9 [Lactobacillus reuteri F275] >gi|194453956|gb|EDX42853.1| ribosomal protein S9 [Lactobacillus reuteri 100-23] (131 aa)
Score = 307, Expect = 6.0e-27, Identities = 66/127 (51%), Positives = 87/127 (68%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V+Y G GRRK + A V+LVPG+GKI +N +   +Y P + +   + QP  +T T   +DV   V GGGF+GQAGA+R GIARALL  + DFR  LK + +LTRDPR KER+K GL  AR++ QF+KR
  S:     5 VQYSGTGRRKDATARVRLVPGSGKITMNGKAIEDYIPFANLRAIVNQPFAVTKTEGQYDVLANVNGGGFSGQAGAVRHGIARALLAVDPDFRDALKKAGLLTRDPRMKERRKPGLKKARKAAQFSKR 131
>gi|15674235|ref|NP_268410.1| 30S ribosomal protein S9 [Lactococcus lactis subsp. lactis Il1403] >gi|116513207|ref|YP_812114.1| 30S ribosomal protein S9 [Lactococcus lactis subsp. cremoris SK11] >gi|125625298|ref|YP_001033781.1| 30S ribosomal protein S9 [Lactococcus lactis subsp. cremoris MG1363] >gi|123320062|sp|Q02VM1|RS9_LACLS 30S ribosomal protein S9 >gi|166229567|sp|A2RP61|RS9_LACLM 30S ribosomal protein S9 >gi|20139919|sp|Q9CDG7|RS9_LACLA 30S ribosomal protein S9 >gi|12725323|gb|AAK06351.1|AE006454_4 30S ribosomal protein S9 [Lactococcus lactis subsp. lactis Il1403] >gi|116108861|gb|ABJ74001.1| SSU ribosomal protein S9P [Lactococcus lactis subsp. cremoris SK11] >gi|124494106|emb|CAL99107.1| 30S ribosomal protein S9 [Lactococcus lactis subsp. cremoris MG1363] (130 aa)
Score = 307, Expect = 6.2e-27, Identities = 69/130 (53%), Positives = 89/130 (68%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V+Y G GRRK++VA V+LVPGTGKI +N R+   Y P++ +   + QP   T T  ++D  V V GGG +GQAGAIR GIARALL  + DFR  LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQVQYAGTGRRKNAVARVRLVPGTGKITVNGREVESYIPHADMRLVINQPFAATQTEGSYDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|15827098|ref|NP_301361.1| 30S ribosomal protein S9 [Mycobacterium leprae TN] >gi|730673|sp|P40828|RS9_MYCLE 30S ribosomal protein S9 >gi|467114|gb|AAA17296.1| rpsI; small ribosomal subunit protein S9; B229_C2_191 [Mycobacterium leprae] >gi|13092646|emb|CAC29873.1| 30S ribosomal protein S9 [Mycobacterium leprae] (153 aa)
Score = 307, Expect = 6.3e-27, Identities = 65/122 (53%), Positives = 89/122 (72%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LV GTGK  +N R   +YFPN +  Q ++ PLV  +  +NFD+F  + GGG +GQAGA+RLGIARAL++A+ + R  LK +  LTRDPR+ ERKKYGL  AR++PQ++KR
  S:    32 VGRRKEAVVRVRLVLGTGKFDLNGRSLEDYFPNKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAGALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQYSKR 153
>gi|154249130|ref|YP_001409955.1| ribosomal protein S9 [Fervidobacterium nodosum Rt17-B1] >gi|154153066|gb|ABS60298.1| ribosomal protein S9 [Fervidobacterium nodosum Rt17-B1] (132 aa)
Score = 307, Expect = 6.9e-27, Identities = 70/125 (56%), Positives = 85/125 (68%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPN---EYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+S A V L PG+GKI+IN R+ N   EYF N +      +PL I       DV ++V GGG  GQAGA+RLG+ARAL+  N+D RKT +    LTRDPR  ERKKYGL  ARR+PQF+KR
  S:     5 YMGTGRRKTSTARVYLKPGSGKIVINDREYNDFNEYFENKVWTMHAIEPLKIAGLEGTLDVMIRVQGGGKNGQAGAVRLGLARALVSYNSDLRKTFRDKGFLTRDPRMVERKKYGLKKARRAPQFSKR 132
>gi|171853869|emb|CAM11831.1| 30S ribosomal protein S9 [Candidatus Phytoplasma australiense] (130 aa)
Score = 306, Expect = 8.3e-27, Identities = 70/130 (53%), Positives = 85/130 (65%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M  V + G GRRK++VA V L  GTGKI IN +    Y P      DM QPL+I++ +  +DV V V GGG   QAGAIRLGIARALL +  + R  LK + +LTRD R  ERKKYGL  ARR+PQF+KR
  S:     1 MKQVNFCGTGRRKTAVARVILTNGTGKITINTKNFETYLPQPTTRLDMLQPLIISEKKDVYDVRVNVNGGGLCAQAGAIRLGIARALLESIPELRPVLKKAGLLTRDARCVERKKYGLKKARRAPQFSKR 130
>gi|78045116|ref|YP_361082.1| ribosomal protein S9 [Carboxydothermus hydrogenoformans Z-2901] >gi|123575548|sp|Q3A9V2|RS9_CARHZ 30S ribosomal protein S9 >gi|77997231|gb|ABB16130.1| ribosomal protein S9 [Carboxydothermus hydrogenoformans Z-2901] (130 aa)
Score = 306, Expect = 8.5e-27, Identities = 71/130 (54%), Positives = 88/130 (67%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V + G GRRK +VA V +VPG G I IN +   EYFP   +   ++QPL +T+T   FDV  KV GGG +GQAGA+RLGIARAL+ A+   R  LK +  LTRDPR  ERKKYGL  +RR PQ+TKR
  S:     1 MAVVNFYGTGRRKEAVARVFVVPGEGNITINGKSLEEYFPRKTLQIIVKQPLELTNTVGKFDVKAKVHGGGISGQAGAVRLGIARALVQADPSLRPVLKKAGFLTRDPRMVERKKYGLRKSRRRPQWTKR 130
>gi|170077658|ref|YP_001734296.1| ribosomal protein S9 [Synechococcus sp. PCC 7002] >gi|169885327|gb|ACA99040.1| ribosomal protein S9 [Synechococcus sp. PCC 7002] (137 aa)
Score = 306, Expect = 8.6e-27, Identities = 64/125 (51%), Positives = 87/125 (69%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+S+A V+LVPG+GK+++N R   +YF   P  L +  ++ PL        +D+ V   GGG TGQA A++LG+ARAL   + D R+ LK+   LTRDPR KERKKYGL+ AR++PQF+KR
  S:    12 YWGTGRRKASIARVRLVPGSGKVVVNNRSGEDYFNRIPGYLAV--LKSPLETLGLESEYDILVNAHGGGLTGQADAVKLGVARALCELDPDNRQPLKIEGYLTRDPRCKERKKYGLHKARKAPQFSKR 137
>gi|150020923|ref|YP_001306277.1| ribosomal protein S9 [Thermosipho melanesiensis BI429] >gi|149793444|gb|ABR30892.1| ribosomal protein S9 [Thermosipho melanesiensis BI429] (132 aa)
Score = 306, Expect = 9.1e-27, Identities = 71/125 (56%), Positives = 87/125 (69%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRK---PNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V L  G GK+++N ++    N Y  NS+      +PL +T    +FD+ ++V GGG +GQAGAIRLGIARALL  N D R TLK   MLTRDPR  ERKKYGL  ARR+PQF+KR
  S:     5 YMGTGRRKTSVARVYLKEGNGKVVVNNKEYEDLNGYLKNSVWTLHAMEPLKVTGLEGSFDIMIRVNGGGKSGQAGAIRLGIARALLQYNADLRPTLKEKGMLTRDPRMVERKKYGLRKARRAPQFSKR 132
>gi|163847954|ref|YP_001635998.1| ribosomal protein S9 [Chloroflexus aurantiacus J-10-fl] >gi|187599505|ref|ZP_02985739.1| ribosomal protein S9 [Chloroflexus sp. Y-400-fl] >gi|163669243|gb|ABY35609.1| ribosomal protein S9 [Chloroflexus aurantiacus J-10-fl] >gi|187488937|gb|EDU26904.1| ribosomal protein S9 [Chloroflexus sp. Y-400-fl] (132 aa)
Score = 305, Expect = 9.3e-27, Identities = 67/125 (53%), Positives = 91/125 (72%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQ-DMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y+G GRRK++VA V+L PG+G  ++N +KP EYF    + Q ++  PLV+T+    F+V VKV GGG + Q GA+R GIARALL  +++ R TLK + +LTRDPR KERKK GL  AR++PQ+TKR
  S:     7 YQGTGRRKTAVARVRLFPGSGDFIVNGKKPEEYFGRRELFQHELRLPLVLTNHLNTFNVLVKVKGGGISSQVGAVRHGIARALLDYDSELRPTLKQAGLLTRDPRMKERKKVGLKRARKAPQYTKR 132
>gi|118047115|ref|ZP_01515757.1| ribosomal protein S9 [Chloroflexus aggregans DSM 9485] >gi|117996432|gb|EAV10631.1| ribosomal protein S9 [Chloroflexus aggregans DSM 9485] (132 aa)
Score = 305, Expect = 1.1e-26, Identities = 67/125 (53%), Positives = 92/125 (73%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQ-DMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y+G GRRK++VA V+L PG+G +++N +KP +YF    + Q ++  PLV+T+    F+V VKV GGG +GQ GA+R GIARALL  ++  R  LK + +LTRDPRAKERKK GL  AR++PQ+TKR
  S:     7 YQGTGRRKTAVARVRLFPGSGDMIVNGKKPEDYFGKRDLFQHELRMPLVLTNHLNTFNVLVKVKGGGVSGQVGAVRHGIARALLDYDSGLRPVLKQAGLLTRDPRAKERKKAGLKRARKAPQYTKR 132
>gi|145225525|ref|YP_001136203.1| ribosomal protein S9 [Mycobacterium gilvum PYR-GCK] >gi|145218011|gb|ABP47415.1| SSU ribosomal protein S9P [Mycobacterium gilvum PYR-GCK] (171 aa)
Score = 305, Expect = 1.1e-26, Identities = 62/122 (50%), Positives = 86/122 (70%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTG+  ++ R    YFPN +  Q ++ PLV+ D  + FD++  + GGG +GQAGA+RL IARAL++   + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    50 VGRRKEAVVRVRLVPGTGQFHLDGRSLESYFPNKVHQQLIKAPLVLVDRLEQFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKRAGFLTRDPRAIERKKYGLKKARKAPQYSKR 171
>gi|196244475|ref|ZP_03143202.1| ribosomal protein S9 [Cyanothece sp. PCC 8802] >gi|196207923|gb|EDY02715.1| ribosomal protein S9 [Cyanothece sp. PCC 8802] (135 aa)
Score = 304, Expect = 1.2e-26, Identities = 65/127 (51%), Positives = 88/127 (69%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPN-SLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRKS++A V+LVPG+G I +N +  N+YF   +  IQ ++ PL       ++D+ V   GGG TGQA A++LG+ARAL     + R+ LKV   LTRDPRAKERKKYGL+ AR++PQ++KR
  S:     8 VVYWGTGRRKSAIARVRLVPGSGAITVNDKPGNDYFNRIASYIQSIKAPLETLGLENDYDILVNAHGGGLTGQADAVKLGVARALCELAPENRQPLKVEGYLTRDPRAKERKKYGLHKARKAPQYSKR 135
>gi|117927551|ref|YP_872102.1| SSU ribosomal protein S9P [Acidothermus cellulolyticus 11B] >gi|117648014|gb|ABK52116.1| SSU ribosomal protein S9P [Acidothermus cellulolyticus 11B] (170 aa)
Score = 304, Expect = 1.4e-26, Identities = 65/121 (53%), Positives = 86/121 (71%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +VA V+LVPGTG+  IN R+  +YFP+ +  Q ++ PL + D    FDV  +V GGG +GQAGA+RLGIARAL+V + + R  LK +  LTRD R  ERKKYGL  AR++PQ++KR
  S:    50 GRRKEAVARVRLVPGTGQWKINGRELTDYFPSRVHQQLVKSPLALLDAVTQFDVIARVHGGGISGQAGALRLGIARALVVIDPENRPVLKKAGFLTRDARVVERKKYGLKKARKAPQYSKR 170
>gi|108798103|ref|YP_638300.1| SSU ribosomal protein S9P [Mycobacterium sp. MCS] >gi|119867199|ref|YP_937151.1| SSU ribosomal protein S9P [Mycobacterium sp. KMS] >gi|126433761|ref|YP_001069452.1| SSU ribosomal protein S9P [Mycobacterium sp. JLS] >gi|123070550|sp|Q1BCZ0|RS9_MYCSS 30S ribosomal protein S9 >gi|166229575|sp|A3PVN4|RS9_MYCSJ 30S ribosomal protein S9 >gi|166229576|sp|A1UC03|RS9_MYCSK 30S ribosomal protein S9 >gi|108768522|gb|ABG07244.1| SSU ribosomal protein S9P [Mycobacterium sp. MCS] >gi|119693288|gb|ABL90361.1| SSU ribosomal protein S9P [Mycobacterium sp. KMS] >gi|126233561|gb|ABN96961.1| SSU ribosomal protein S9P [Mycobacterium sp. JLS] (158 aa)
Score = 304, Expect = 1.5e-26, Identities = 64/122 (52%), Positives = 87/122 (71%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTGK  ++ R    YFPN +  Q ++ PLV+ D  ++FDV+  + GGG +GQAGA+RL IARAL++   + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    37 VGRRKEAVVRVRLVPGTGKFNLDGRTLEAYFPNKVHQQLIKAPLVLVDRLESFDVYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKKAGFLTRDPRAIERKKYGLKKARKAPQYSKR 158
>gi|15644202|ref|NP_229252.1| ribosomal protein S9 [Thermotoga maritima MSB8] >gi|7388236|sp|Q9X1G4|RS9_THEMA 30S ribosomal protein S9 >gi|4982018|gb|AAD36521.1|AE001797_1 ribosomal protein S9 [Thermotoga maritima MSB8] (134 aa)
Score = 303, Expect = 1.6e-26, Identities = 69/127 (54%), Positives = 90/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRK---PNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRK++VA V L PG GK+ +N ++    N+YF N    +   +PL +T+T   FD+ ++V GGG +GQ+GA+RLGIARALL  + + R  LK  KMLTRDPR  ERKKYGL  ARR+PQF+KR
  S:     5 VGYYGTGRRKTAVARVYLRPGEGKVKVNGKEYESLNDYFKNPAWTKHAIEPLEVTNTLGKFDLVIRVNGGGLSGQSGAVRLGIARALLQYDQNLRPVLKKYKMLTRDPREVERKKYGLKKARRAPQFSKR 134
>gi|154495892|ref|ZP_02034588.1| hypothetical protein BACCAP_00172 [Bacteroides capillosus ATCC 29799] >gi|150274775|gb|EDN01831.1| hypothetical protein BACCAP_00172 [Bacteroides capillosus ATCC 29799] (134 aa)
Score = 303, Expect = 1.6e-26, Identities = 73/123 (59%), Positives = 83/123 (67%)
  Q:     8 GLGRRKSSVAHVKLVP-GTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V L P GTG I IN R  ++YF    +   + QPL  T T    D+   VVGGG TGQAGAIR GIARALL  + +FR  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:    11 GTGRRKSSVARVHLFPNGTGAITINGRDIDDYFGLDTLKMVVRQPLNTTGTVGKVDIVATVVGGGVTGQAGAIRHGIARALLNVDPEFRPALKAAGFLTRDPRMKERKKYGLKAARRAPQFSKR 134
>gi|119484805|ref|ZP_01619287.1| 30S ribosomal protein S9 [Lyngbya sp. PCC 8106] >gi|119457623|gb|EAW38747.1| 30S ribosomal protein S9 [Lyngbya sp. PCC 8106] (136 aa)
Score = 303, Expect = 1.9e-26, Identities = 67/125 (53%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+S+A V+LVPGTG + IN R+   Y   N   I   + PL       ++D+ V V GGG TGQA +IRLG+ARAL   + D R+ LK+   LTRDPRAKERKKYGL  AR++PQF+KR
  S:    11 YWGTGRRKASIARVRLVPGTGILTINHREGESYLQFNPSYIASAKAPLETLGLENDYDILVNVQGGGLTGQAESIRLGVARALCELSPDNRQPLKIEGYLTRDPRAKERKKYGLRKARKAPQFSKR 136
>gi|170289134|ref|YP_001739372.1| ribosomal protein S9 [Thermotoga sp. RQ2] >gi|170176637|gb|ACB09689.1| ribosomal protein S9 [Thermotoga sp. RQ2] (134 aa)
Score = 302, Expect = 2.1e-26, Identities = 68/127 (53%), Positives = 90/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRK---PNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + Y G GRRK++VA V L PG GK+ +N ++    N+YF N    +   +PL +T+T   FD+ ++V GGG +GQ+GA+RLGIARALL  + + R  LK  KMLTRDPR  ERKKYGL  ARR+PQF+KR
  S:     5 IGYYGTGRRKTAVARVYLRPGEGKVKVNGKEYESLNDYFKNPAWTKHAIEPLEVTNTLGKFDLVIRVNGGGLSGQSGAVRLGIARALLQYDQNLRPVLKKYKMLTRDPREVERKKYGLKKARRAPQFSKR 134
>gi|194246727|ref|YP_002004366.1| 30S ribosomal protein S9 [Candidatus Phytoplasma mali] >gi|193807084|emb|CAP18520.1| 30S ribosomal protein S9 [Candidatus Phytoplasma mali] (129 aa)
Score = 302, Expect = 2.3e-26, Identities = 66/126 (52%), Positives = 90/126 (71%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y GLGRRK +VA V L  GTG I++N++K  EY P      +   PL +TD+ + +DV V V GGG   Q+GA+RLGI+++LL+ N ++R  LK + +LTRDPR+KERKKYGL  ARR+PQF+KR
  S:     4 QYFGLGRRKRAVARVILTKGTGNIIVNKKKFEEYIPFITKRLETLYPLKLTDSLEKYDVMVNVNGGGLVSQSGAMRLGISKSLLIINPEWRTVLKKAGLLTRDPRSKERKKYGLKKARRAPQFSKR 129
>gi|154483150|ref|ZP_02025598.1| hypothetical protein EUBVEN_00851 [Eubacterium ventriosum ATCC 27560] >gi|149735958|gb|EDM51844.1| hypothetical protein EUBVEN_00851 [Eubacterium ventriosum ATCC 27560] (131 aa)
Score = 301, Expect = 3.0e-26, Identities = 70/130 (53%), Positives = 88/130 (67%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND-FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS+A V ++PG G I IN+R  +EYF    +   + QPL   D    FDV + V GGG+TGQAGAIR GI+RALL  ++D +R  LK +  LTRD R KERKK GL  ARR+PQF+KR
  S:     1 MATEKYYGTGRRKSSIARVYVMPGKGNITINKRSIDEYFGLETLKVIVRQPLAAIDAVDKFDVIITVHGGGYTGQAGAIRHGISRALLQVDSDAYRPILKKAGFLTRDSRMKERKKPGLKAARRAPQFSKR 131
>gi|149918680|ref|ZP_01907168.1| 30S ribosomal protein S9 [Plesiocystis pacifica SIR-1] >gi|149820521|gb|EDM79935.1| 30S ribosomal protein S9 [Plesiocystis pacifica SIR-1] (127 aa)
Score = 300, Expect = 3.7e-26, Identities = 68/127 (53%), Positives = 86/127 (67%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++Y   GRRK+S+A V L+PG GKI IN+R   +Y      ++ +EQP+  TDTRK +DV+    GGG +GQAGA+RLGIARALL  N ++R  LK    LTRD R KERKKYG  GAR   QF+KR
  S:     1 MKYYATGRRKTSIARVWLMPGEGKIQINRRDAEDYLTRVTNMKFVEQPMHATDTRKQYDVWATAKGGGLSGQAGAVRLGIARALLRVNGEYRPQLKAGGYLTRDARKKERKKYGRRGARARFQFSKR 127
>gi|184155958|ref|YP_001844298.1| 30S ribosomal protein S9 [Lactobacillus fermentum IFO 3956] >gi|183227302|dbj|BAG27818.1| 30S ribosomal protein S9 [Lactobacillus fermentum IFO 3956] (131 aa)
Score = 300, Expect = 3.7e-26, Identities = 66/127 (51%), Positives = 85/127 (66%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V+Y G GRRK + A V+LVPG+G I +N +   +Y P + +   + QP   T T   +DV V V GGGF+GQAGA R GIARALL  + DFR  LK + +LTRDPR KER+K GL  AR++ QF+KR
  S:     5 VQYSGTGRRKDATARVRLVPGSGNITMNGKAIEDYIPFANLRAIVNQPFAATKTEGQYDVLVNVNGGGFSGQAGATRHGIARALLTVDPDFRDALKKAGLLTRDPRMKERRKPGLKKARKASQFSKR 131
>gi|148270471|ref|YP_001244931.1| ribosomal protein S9 [Thermotoga petrophila RKU-1] >gi|166229617|sp|A5IMD2|RS9_THEP1 30S ribosomal protein S9 >gi|147736015|gb|ABQ47355.1| SSU ribosomal protein S9P [Thermotoga petrophila RKU-1] (134 aa)
Score = 299, Expect = 4.8e-26, Identities = 68/127 (53%), Positives = 89/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRK---PNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + Y G GRRK++VA V L PG GK+ +N ++    N+YF N    +   +PL +T+T   FD+ ++V GGG +GQ+GA+RLGIARALL  +   R  LK  KMLTRDPR  ERKKYGL  ARR+PQF+KR
  S:     5 IGYYGTGRRKTAVARVYLRPGEGKVKVNGKEYESLNDYFKNPAWTKHAIEPLEVTNTLGKFDLVIRVNGGGLSGQSGAVRLGIARALLQYDQKLRPVLKKYKMLTRDPREVERKKYGLKKARRAPQFSKR 134
>gi|169630830|ref|YP_001704479.1| 30s ribosomal protein S9 [Mycobacterium abscessus] >gi|169242797|emb|CAM63825.1| 30s ribosomal protein S9 [Mycobacterium abscessus] (175 aa)
Score = 298, Expect = 6.4e-26, Identities = 62/122 (50%), Positives = 85/122 (69%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTGK  ++ R   EYFPN +  Q ++ PLV  +   + D++  + GGG +GQAGA+RL IARAL++   + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    54 VGRRKEAVVRVRLVPGTGKFHLDGRSLEEYFPNKVHQQLIKAPLVSVNRVDSVDIYAHLTGGGPSGQAGALRLAIARALIIVEPEDRPVLKKAGFLTRDPRAIERKKYGLKKARKAPQYSKR 175
>gi|67923566|ref|ZP_00517039.1| Ribosomal protein S9 [Crocosphaera watsonii WH 8501] >gi|67854592|gb|EAM49878.1| Ribosomal protein S9 [Crocosphaera watsonii WH 8501] (137 aa)
Score = 298, Expect = 6.8e-26, Identities = 67/127 (52%), Positives = 90/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRKS+VA V+LVPG+G+I++N++  N YF   P+ L  Q+++ PL       ++D+ V   GGG TGQA AI+LG+ARAL     + R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    10 VVYWGTGRRKSAVARVRLVPGSGEIVVNKKPGNIYFNRIPSYL--QNIQGPLETLGLESDYDILVNAHGGGLTGQADAIKLGVARALCELAPENRPPLKAEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|51894176|ref|YP_076867.1| 30S ribosomal protein S9 [Symbiobacterium thermophilum IAM 14863] >gi|51857865|dbj|BAD42023.1| 30S ribosomal protein S9 [Symbiobacterium thermophilum IAM 14863] (128 aa)
Score = 297, Expect = 7.8e-26, Identities = 62/126 (49%), Positives = 84/126 (66%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK+++A  +L+PGTG  ++N R   EYF    +   +E P  +T T   FDV++ V+GGG +GQAGA R  IARAL+  + + R  LK +  LTRDPR KER+KYGL  AR+ PQF+KR
  S:     3 QYWGTGRRKTAIARARLLPGTGNFVVNGRTLQEYFGLQTLQMMVESPFTVTGTTGKFDVYLNVIGGGISGQAGACRHAIARALVKYDPELRPALKQAGFLTRDPRMKERRKYGLKKARKRPQFSKR 128
>gi|157364826|ref|YP_001471593.1| ribosomal protein S9 [Thermotoga lettingae TMO] >gi|167012631|sp|A8F8P5|RS9_THELT 30S ribosomal protein S9 >gi|157315430|gb|ABV34529.1| ribosomal protein S9 [Thermotoga lettingae TMO] (134 aa)
Score = 297, Expect = 8.7e-26, Identities = 66/130 (50%), Positives = 88/130 (67%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQR---KPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M    + GLGRRK+SVA V +V G GK+ IN +      EYF + +  +   +PLV+T+     DVFV+V GGG +GQAGA+RL +ARAL+  +  F+  LK   ML+RDPR  ERKKYGL  ARR+PQ++KR
  S:     2 MDKAIFNGLGRRKTSVARVYIVSGNGKLTINDKIFASAEEYFKDRVRARHAFEPLVVTNNDGKLDVFVRVEGGGLSGQAGAVRLALARALIKMDTSFKPVLKSHGMLSRDPRMVERKKYGLRKARRAPQYSKR 134
>gi|186684482|ref|YP_001867678.1| ribosomal protein S9 [Nostoc punctiforme PCC 73102] >gi|186466934|gb|ACC82735.1| ribosomal protein S9 [Nostoc punctiforme PCC 73102] (138 aa)
Score = 297, Expect = 9.7e-26, Identities = 66/125 (52%), Positives = 87/125 (69%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK++VA V+LVPGTG++ +N +  N YF   PN L +  ++ PL        +D+ VK  GGG TGQA ++RLG+ARAL   + D R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    13 YWGTGRRKNAVARVRLVPGTGQLTVNGKDGNLYFQFNPNYLGV--IKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPDNRPPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 138
>gi|48374278|gb|AAT41967.1| 30S ribosomal subunit S9 [Fremyella diplosiphon] (139 aa)
Score = 297, Expect = 9.7e-26, Identities = 64/125 (51%), Positives = 86/125 (68%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKS+VA V+L+PG+G++ +N +  N YF  N+  +  ++ PL        +D+ VK  GGG TGQA +IRLG+ARAL   + D R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    14 YWGTGRRKSAVARVRLIPGSGQLTVNGKDGNLYFQFNANYLGVIKGPLETLGLENEYDILVKAEGGGLTGQADSIRLGVARALCQLDPDNRSPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 139
>gi|186455344|ref|ZP_02965658.1| ribosomal protein S9 [bacterium Ellin514] >gi|184207422|gb|EDU04467.1| ribosomal protein S9 [bacterium Ellin514] (131 aa)
Score = 296, Expect = 1.2e-25, Identities = 70/126 (55%), Positives = 84/126 (66%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           E+ G GRRK+SVA V+L  GTGKI +N R    YFP   +   + QPL +T T   +DV V V GGG TGQAGA+R GIARALL  +  FR TLK   +LTRD R KERKKYG  GAR+  Q++KR
  S:     6 EFLGTGRRKTSVARVRLASGTGKIQVNGRAFETYFPTDTLRMVVTQPLTVTATTGKYDVRVNVQGGGPTGQAGAVRHGIARALLEVDVAFRPTLKAEGLLTRDSREKERKKYGQPGARKRFQYSKR 131
>gi|51209920|ref|YP_063584.1| ribosomal protein S9 [Gracilaria tenuistipitata var. liui] >gi|68052939|sp|Q6B8X6|RR9_GRATL Chloroplast 30S ribosomal protein S9 >gi|50657674|gb|AAT79659.1| 30S ribosomal protein S9 [Gracilaria tenuistipitata var. liui] (137 aa)
Score = 296, Expect = 1.2e-25, Identities = 71/129 (55%), Positives = 86/129 (66%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           S + Y G GRRK+S+A VKLVPG+GK++IN      Y    PN L +     PL I    K +D++VK  GGG TGQA AIRLG+ARAL   N D R TLK    LTRD R KERKKYGL  AR++PQ++KR
  S:     8 SKIIYAGTGRRKTSIARVKLVPGSGKLIINGLPGESYLQFSPNYLRVS--YSPLKILGLNKEYDIYVKTEGGGLTGQANAIRLGLARALCRMNPDNRTTLKAEGFLTRDARIKERKKYGLRKARKAPQYSKR 137
>gi|22297653|ref|NP_680900.1| 30S ribosomal protein S9 [Thermosynechococcus elongatus BP-1] >gi|39932190|sp|Q8DMK7|RS9_SYNEL 30S ribosomal protein S9 >gi|22293830|dbj|BAC07662.1| 30S ribosomal protein S9 [Thermosynechococcus elongatus BP-1] (137 aa)
Score = 296, Expect = 1.3e-25, Identities = 65/127 (51%), Positives = 88/127 (69%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDM-EQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRKS+VA V+L+PG+G++ IN R   +Y  N+ +  ++ + PL       ++D++V   GGG TGQA AIRLGIARAL   + + RK LK    LTRDPRAKER+KYGL  AR++PQ++KR
  S:    10 VVYLGTGRRKSAVARVRLIPGSGQLWINGRNGADYLQNNPIYLNLVKAPLETLGLENSYDIYVNATGGGLTGQADAIRLGIARALCQLDIENRKPLKTEGYLTRDPRAKERRKYGLRKARKAPQYSKR 137
>gi|120402479|ref|YP_952308.1| ribosomal protein S9 [Mycobacterium vanbaalenii PYR-1] >gi|119955297|gb|ABM12302.1| SSU ribosomal protein S9P [Mycobacterium vanbaalenii PYR-1] (171 aa)
Score = 295, Expect = 1.6e-25, Identities = 62/122 (50%), Positives = 85/122 (69%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTG+  ++ R    YFPN +  Q ++ PLV  D  + FD++  + GGG +GQAGA+RL IARAL++   + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    50 VGRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVTVDRVEQFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKKAGFLTRDPRAIERKKYGLKKARKAPQYSKR 171
>gi|159904192|ref|YP_001551536.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9211] >gi|159889368|gb|ABX09582.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9211] (137 aa)
Score = 294, Expect = 1.9e-25, Identities = 68/129 (52%), Positives = 86/129 (66%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRK+SVA V+L+PGTGKI IN R  + Y   N   +  ++ PL       ++DV V V GGG TGQA AI+ G ARAL   + D RK LK+   L+RDPRAKER+KYGL  AR++PQF+KR
  S:     8 NTVVYWGTGRRKTSVARVRLIPGTGKITINGRPGDHYLNFNPAYLAAVKAPLQTLGLSDSYDVLVNVYGGGLTGQADAIKQGAARALCELSADNRKPLKIEGHLSRDPRAKERRKYGLKKARKAPQFSKR 137
>gi|158317759|ref|YP_001510267.1| ribosomal protein S9 [Frankia sp. EAN1pec] >gi|158113164|gb|ABW15361.1| ribosomal protein S9 [Frankia sp. EAN1pec] (135 aa)
Score = 294, Expect = 2.0e-25, Identities = 63/124 (50%), Positives = 87/124 (70%)
  Q:     7 KGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +  GRRK +V  V+L+PGTG   +N RK  EYFPN +  Q + +PL   +  +++DV  ++ GGG +GQAGA+RL IARAL+V + + R TLK +  LTRD R KERKKYGL  AR++PQ++KR
  S:    12 RATGRRKEAVVRVRLIPGTGNWNLNGRKLEEYFPNKVHQQLVNEPLKTLERAESYDVVARLHGGGVSGQAGALRLAIARALIVVDEEARPTLKKAGFLTRDARVKERKKYGLKKARKAPQYSKR 135
>gi|196181244|gb|EDX76233.1| ribosomal protein S9 [Microcoleus chthonoplastes PCC 7420] (138 aa)
Score = 294, Expect = 2.2e-25, Identities = 65/125 (52%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKSSVA V+LVPGTG++ +N R  + YF  N   +   + PL       ++D+ V   GGG TGQ+ AIRLG+ARAL   +   R  LK+   LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    13 YWGTGRRKSSVARVRLVPGTGQLTVNGRPGDVYFNLNPAYLMVTKSPLETLGLENDYDILVNAHGGGLTGQSDAIRLGVARALCELDPANRSPLKMEGYLTRDPRAKERKKYGLHKARKAPQYSKR 138
>gi|196257759|ref|ZP_03156295.1| ribosomal protein S9 [Cyanothece sp. PCC 7822] >gi|196201359|gb|EDX96178.1| ribosomal protein S9 [Cyanothece sp. PCC 7822] (137 aa)
Score = 293, Expect = 2.4e-25, Identities = 63/127 (49%), Positives = 88/127 (69%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPN-SLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRK+++A V+L+PGTG+I +N +  + YF   +  IQ ++ PL       ++D+ VK  GGG TGQA A++LG+ARAL     + R+ LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    10 VVYWGTGRRKTAIARVRLIPGTGQITVNGKTGDIYFNQIADYIQGIKAPLETLGLENDYDILVKAHGGGLTGQADAVKLGVARALCQLAPENRQPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|148655306|ref|YP_001275511.1| ribosomal protein S9 [Roseiflexus sp. RS-1] >gi|148567416|gb|ABQ89561.1| SSU ribosomal protein S9P [Roseiflexus sp. RS-1] (132 aa)
Score = 293, Expect = 2.4e-25, Identities = 68/125 (54%), Positives = 91/125 (72%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF-PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++G GRRK++VA V+L PG+G+I++N +   EYF    L  +++ QPL +T T   ++V VKV GGG +GQA A+R GI RALL AN DFR TLK + ++TRDPR KERKK GL  AR+ PQ+TKR
  S:     7 FQGTGRRKTAVARVRLFPGSGEIVVNGKSIREYFGARELYAREILQPLELTGTTGAYNVLVKVRGGGVSGQAQAVRHGITRALLDANPDFRPTLKKAGLITRDPRMKERKKAGLKRARKRPQYTKR 132
>gi|118468477|ref|YP_885937.1| ribosomal protein S9 [Mycobacterium smegmatis str. MC2 155] >gi|166229574|sp|A0QSP9|RS9_MYCS2 30S ribosomal protein S9 >gi|118169764|gb|ABK70660.1| ribosomal protein S9 [Mycobacterium smegmatis str. MC2 155] (150 aa)
Score = 293, Expect = 2.5e-25, Identities = 62/122 (50%), Positives = 84/122 (68%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTG+  ++ R    YFPN +  Q ++ PLV  D    FD++  + GGG +GQAGA+RL IARAL++   + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    29 VGRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVTVDRVDQFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKKAGFLTRDPRAIERKKYGLKKARKAPQYSKR 150
>gi|17231679|ref|NP_488227.1| 30S ribosomal protein S9 [Nostoc sp. PCC 7120] >gi|75906942|ref|YP_321238.1| 30S ribosomal protein S9 [Anabaena variabilis ATCC 29413] >gi|123610561|sp|Q3MF93|RS9_ANAVT 30S ribosomal protein S9 >gi|20139888|sp|Q8YPK7|RS9_ANASP 30S ribosomal protein S9 >gi|17133322|dbj|BAB75886.1| 30S ribosomal protein S9 [Nostoc sp. PCC 7120] >gi|75700667|gb|ABA20343.1| SSU ribosomal protein S9P [Anabaena variabilis ATCC 29413] (138 aa)
Score = 293, Expect = 2.8e-25, Identities = 63/125 (50%), Positives = 87/125 (69%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKS+VA V+LVPGTG++++N +  + YF  N+  +  ++ PL        +D+ VK  GGG TGQA ++RLG+ARAL   + + R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    13 YWGTGRRKSAVARVRLVPGTGQLIVNGKPGDLYFQFNANYLGVIKAPLETLGLENEYDILVKAEGGGLTGQADSVRLGVARALCQLDPENRPPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 138
>gi|68536834|ref|YP_251539.1| 30S ribosomal protein S9 [Corynebacterium jeikeium K411] >gi|68264433|emb|CAI37921.1| 30S ribosomal protein S9 [Corynebacterium jeikeium K411] (186 aa)
Score = 292, Expect = 3.1e-25, Identities = 63/122 (51%), Positives = 81/122 (66%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V++VPG+G+ L N R   +YFPN L  Q ++ PLV+ D    FD+   + GGG +GQAGA RL IARAL   N   R  LK +  LTRD RA ERKK GL+ ARR+PQ++KR
  S:    65 VGRRKEAVVRVRMVPGSGEFLCNGRSLEDYFPNKLHQQLIKAPLVLLDRENQFDIQANLNGGGPSGQAGAFRLAIARALNKYNPAERTDLKRAGFLTRDARAVERKKAGLHKARRAPQYSKR 186
>gi|169830539|ref|YP_001716521.1| ribosomal protein S9 [Candidatus Desulforudis audaxviator MP104C] >gi|169637383|gb|ACA58889.1| ribosomal protein S9 [Candidatus Desulforudis audaxviator MP104C] (130 aa)
Score = 292, Expect = 3.2e-25, Identities = 66/130 (50%), Positives = 87/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V Y G GRRK+++A V L PG+G + +N ++   Y     +   + QPL +T T   F+V   V GGG +GQAGAI+LGIARAL+ A+ + R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MAQVHYYGTGRRKNAIARVFLSPGSGTVQVNDKELGAYLGRKTLEMIVRQPLEVTGTAGRFNVRATVSGGGISGQAGAIKLGIARALVQADPNLRPVLKKAGFLTRDPRMKERKKYGLKKARRAPQFSKR 130
>gi|172038956|ref|YP_001805457.1| 30S ribosomal protein S9 [Cyanothece sp. ATCC 51142] >gi|171700410|gb|ACB53391.1| 30S ribosomal protein S9 [Cyanothece sp. ATCC 51142] (137 aa)
Score = 292, Expect = 3.2e-25, Identities = 66/127 (51%), Positives = 89/127 (70%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRKS+VA V+LVPG+G+I++N++  N YF   P+ L  Q ++ PL       ++D+ V   GGG TGQA A++LG+ARAL     + R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    10 VVYWGTGRRKSAVARVRLVPGSGEIIVNKKPGNIYFNRIPDYL--QAIKGPLETLGLENDYDILVNAHGGGLTGQADAVKLGVARALCELAPENRPPLKAEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|119511151|ref|ZP_01630268.1| 30S ribosomal protein S9 [Nodularia spumigena CCY9414] >gi|119464139|gb|EAW45059.1| 30S ribosomal protein S9 [Nodularia spumigena CCY9414] (138 aa)
Score = 292, Expect = 3.6e-25, Identities = 65/125 (52%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKS+VA V+LVPG GK+ +N +    YF  N+  +  ++ PL        +D+ VK  GGG TGQA +IRLG+ARAL   + D R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    13 YWGTGRRKSAVARVRLVPGEGKLTVNGKDGELYFQFNANYLGVIKNPLETLGLENEYDILVKAEGGGLTGQADSIRLGVARALCQLDPDNRPPLKTEGYLTRDPRAKERKKYGLHKARKAPQYSKR 138
>gi|113476551|ref|YP_722612.1| 30S ribosomal protein S9 [Trichodesmium erythraeum IMS101] >gi|110167599|gb|ABG52139.1| SSU ribosomal protein S9P [Trichodesmium erythraeum IMS101] (136 aa)
Score = 292, Expect = 3.8e-25, Identities = 66/125 (52%), Positives = 85/125 (68%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKSSVA V+LVPGTGK++IN ++   Y   N   +  ++ PL        +D+ VK  GGG TGQA +IRLG+ARAL   + + RK LK+   LTRDPRAKERKKYGL  AR++ Q++KR
  S:    11 YWGTGRRKSSVASVRLVPGTGKLIINGKEGEIYLQYNHNYLSSVKAPLDTLGFENEYDILVKATGGGLTGQAESIRLGVARALCQLDPENRKPLKIEGYLTRDPRAKERKKYGLRKARKASQYSKR 136
>gi|124026682|ref|YP_001015797.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. NATL1A] >gi|123961750|gb|ABM76533.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. NATL1A] (135 aa)
Score = 291, Expect = 4.0e-25, Identities = 67/129 (51%), Positives = 87/129 (67%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           S V Y G GRRK+SVA V+L PG G+I+IN R  + Y   N   I  ++ PL      +++DV V V GGG TGQ+ AI+ G ARAL   + D RK+LK+   L+RDPRAKER+KYGL  AR++PQF+KR
  S:     6 SKVVYWGTGRRKTSVARVRLTPGKGEIIINGRPGDHYLNFNPAYISAVKAPLKTLGLSESYDVLVNVYGGGLTGQSDAIKQGAARALCTLSLDNRKSLKLEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|83591240|ref|YP_431249.1| SSU ribosomal protein S9P [Moorella thermoacetica ATCC 39073] >gi|123523772|sp|Q2RFT3|RS9_MOOTA 30S ribosomal protein S9 >gi|83574154|gb|ABC20706.1| SSU ribosomal protein S9P [Moorella thermoacetica ATCC 39073] (130 aa)
Score = 291, Expect = 4.8e-25, Identities = 74/130 (56%), Positives = 95/130 (73%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V++ G GRRK+++A V+LVPG G+I++N R  NEYF   ++   + QPL +TD    FDV  +V GGG TGQAGAIRLGIARALL A+ D R  LK +  LTRDPR KER+KYGL  AR++PQF+KR
  S:     1 MAQVQFYGTGRRKNAIARVRLVPGEGRIIVNNRPLNEYFGQKILEMLVRQPLEVTDMAGRFDVLARVEGGGTTGQAGAIRLGIARALLQADGDLRPVLKRNGFLTRDPRMKERRKYGLKKARKAPQFSKR 130
>gi|148322935|gb|EDK88185.1| ribosomal protein S9 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (133 aa)
Score = 290, Expect = 5.1e-25, Identities = 67/126 (53%), Positives = 88/126 (69%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDM-EQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK+SVA V+L+PG   + IN +  +EYF    ++  + EQPL +T+T   F V V VVGGG +GQAGAIR G+ARALL+A+   ++ L+ +  LTRD R  ERKKYG   ARRSPQF+KR
  S:     7 QYLGTGRRKTSVARVRLIPGGQGVEINGKAMDEYFGGRAILSKIVEQPLALTETLNKFAVKVNVVGGGNSGQAGAIRHGVARALLLADESLKEALREAGFLTRDSRMVERKKYGKKKARRSPQFSKR 133
>gi|111220579|ref|YP_711373.1| 30S ribosomal subunit protein S9 [Frankia alni ACN14a] >gi|111148111|emb|CAJ59779.1| 30S ribosomal subunit protein S9 [Frankia alni ACN14a] (135 aa)
Score = 290, Expect = 5.4e-25, Identities = 62/124 (50%), Positives = 85/124 (68%)
  Q:     7 KGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +  GRRK +V  V+L+PG GK  +N R   EYFPN +  Q + +PL   D  +++D+  ++ GGG +GQAGA+RL IARAL +A  + R TLK +  LTRD R KERKKYGL  AR++PQ++KR
  S:    12 RATGRRKEAVVRVRLLPGNGKWTLNGRTLEEYFPNKVHQQLVNEPLKALDKAESYDIVARLHGGGVSGQAGALRLAIARALTLAEEESRPTLKKAGFLTRDARVKERKKYGLKKARKAPQYSKR 135
>gi|119715135|ref|YP_922100.1| 30S ribosomal protein S9 [Nocardioides sp. JS614] >gi|166229581|sp|A1SF28|RS9_NOCSJ 30S ribosomal protein S9 >gi|119535796|gb|ABL80413.1| SSU ribosomal protein S9P [Nocardioides sp. JS614] (166 aa)
Score = 290, Expect = 5.9e-25, Identities = 64/121 (52%), Positives = 83/121 (68%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDF-RKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +VA V+LVPGTG+  +N R  + YFPN L  Q + +P V T     FDV  ++ GGG TGQAGA+RLG+ARAL   + +  R +LK + +LTRD R  ERKK GL  AR++PQF+KR
  S:    45 GRRKEAVARVRLVPGTGEWTVNGRTLDSYFPNKLHQQVVNEPFVTTQLEGRFDVIARIHGGGITGQAGALRLGVARALNAVDVEANRPSLKKAGLLTRDARVIERKKAGLKKARKAPQFSKR 166
>gi|124024023|ref|YP_001018330.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9303] >gi|166229586|sp|A2CC55|RS9_PROM3 30S ribosomal protein S9 >gi|123964309|gb|ABM79065.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9303] (135 aa)
Score = 290, Expect = 6.0e-25, Identities = 68/129 (52%), Positives = 85/129 (65%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++V Y G GRRK+SVA V+LVPGTG I IN R  + Y   N   +  ++ PL      + +DV V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     6 NSVVYWGTGRRKTSVARVRLVPGTGTITINGRPGDHYLNFNPAYLAAVKAPLQTLGLNEQYDVLVNVHGGGLTGQADAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|126658017|ref|ZP_01729169.1| 30S ribosomal protein S9 [Cyanothece sp. CCY0110] >gi|126620655|gb|EAZ91372.1| 30S ribosomal protein S9 [Cyanothece sp. CCY0110] (137 aa)
Score = 289, Expect = 6.6e-25, Identities = 64/125 (51%), Positives = 88/125 (70%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKS+VA V+L+PG+G+I++N++  N YF   P+ L  Q ++ PL       ++D+ V   GGG TGQA A++LG+ARAL     + R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    12 YWGTGRRKSAVARVRLIPGSGEIIVNKKPGNIYFNRIPDYL--QAIKGPLETLGLENDYDILVNAHGGGLTGQADAVKLGVARALCELAPENRPPLKAEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|159027089|emb|CAO89274.1| rpsI [Microcystis aeruginosa PCC 7806] (137 aa)
Score = 289, Expect = 6.8e-25, Identities = 66/129 (51%), Positives = 84/129 (65%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPN-SLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRKS+VA V+LVPGTG I +N R    +F      IQ ++ PL        +D+ VK  GGG TGQA A++LG+ARAL     + R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:     8 NKVVYWGTGRRKSAVASVRLVPGTGAITVNGRDGETHFNRIPTYIQTIKAPLETLGLENEYDIIVKAEGGGLTGQADAVKLGVARALCQLAPENRPPLKSEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|19703673|ref|NP_603235.1| SSU ribosomal protein S9P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22096135|sp|Q8RGG8|RS9_FUSNN 30S ribosomal protein S9 >gi|19713793|gb|AAL94534.1| SSU ribosomal protein S9P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (133 aa)
Score = 289, Expect = 7.4e-25, Identities = 67/126 (53%), Positives = 88/126 (69%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDM-EQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK+SVA V+L+PG   + IN +  +EYF    ++  + EQPL +T+T   F V V VVGGG +GQAGAIR G+ARALL+A+   ++ L+ +  LTRD R  ERKKYG   ARRSPQF+KR
  S:     7 QYLGTGRRKTSVARVRLIPGGQGVEINGKAMDEYFGGRAILSRIVEQPLALTETLNKFAVKVNVVGGGNSGQAGAIRHGVARALLLADESLKEALREAGFLTRDSRMVERKKYGKKKARRSPQFSKR 133
>gi|78185549|ref|YP_377983.1| 30S ribosomal protein S9 [Synechococcus sp. CC9902] >gi|116072173|ref|ZP_01469441.1| 30S ribosomal protein S9 [Synechococcus sp. BL107] >gi|123581058|sp|Q3AW66|RS9_SYNS9 30S ribosomal protein S9 >gi|78169843|gb|ABB26940.1| SSU ribosomal protein S9P [Synechococcus sp. CC9902] >gi|116065796|gb|EAU71554.1| 30S ribosomal protein S9 [Synechococcus sp. BL107] (133 aa)
Score = 289, Expect = 8.1e-25, Identities = 68/129 (52%), Positives = 84/129 (65%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++V Y G GRRK+SVA V+LVPG G I IN R  + Y   N   I  ++ PL        +DV V V GGG TGQ+GAI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     4 NSVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYIAAVKAPLETLGLSTEYDVLVNVHGGGLTGQSGAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 133
>gi|166367991|ref|YP_001660264.1| 30S ribosomal protein S9 [Microcystis aeruginosa NIES-843] >gi|189045703|sp|B0JY34|RS9_MICAN 30S ribosomal protein S9 >gi|166090364|dbj|BAG05072.1| 30S ribosomal protein S9 [Microcystis aeruginosa NIES-843] (137 aa)
Score = 289, Expect = 8.1e-25, Identities = 66/129 (51%), Positives = 84/129 (65%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPN-SLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRKS+VA V+LVPGTG I +N R    +F      IQ ++ PL        +D+ VK  GGG TGQA A++LG+ARAL     + R  LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:     8 NKVVYWGTGRRKSAVAAVRLVPGTGAITVNGRDGETHFNRIPTYIQTIKAPLETLGLENEYDIIVKAEGGGLTGQADAVKLGVARALCQLAPENRPPLKSEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|194342038|gb|EDX23004.1| 30S ribosomal protein S9 [Streptomyces sp. Mg1] (171 aa)
Score = 289, Expect = 8.3e-25, Identities = 62/123 (50%), Positives = 87/123 (70%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND-FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GLGRRK+++A V++VPGTGK  IN R   +YFPN +  Q++ +P  + +    +DV  ++ GGG +GQAGA+RLG+ARAL  A+ D  R  LK +  L+RD RA ERKK GL  AR++PQ++KR
  S:    48 GLGRRKNAIARVRIVPGTGKWKINGRTLEDYFPNKVHQQEVNEPFKLLELDNRYDVIARIAGGGVSGQAGALRLGVARALNEADVDNNRPALKKAGFLSRDDRAVERKKAGLKKARKAPQYSKR 171
>gi|154507832|ref|ZP_02043474.1| hypothetical protein ACTODO_00314 [Actinomyces odontolyticus ATCC 17982] >gi|153797466|gb|EDN79886.1| hypothetical protein ACTODO_00314 [Actinomyces odontolyticus ATCC 17982] (169 aa)
Score = 289, Expect = 8.3e-25, Identities = 66/123 (53%), Positives = 84/123 (68%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDF-RKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GLGRRK +VA V+LVPG+GK  IN R   +YFPN L  Q ++ P V+ D    FDV  ++ GGG +GQAGA+RLG++RAL   + D  R  LK +  LTRD RA ERKK GL  AR++ QF+KR
  S:    46 GLGRRKEAVARVRLVPGSGKWTINGRTLEDYFPNKLHQQLVKSPFVLLDIDGRFDVIARINGGGVSGQAGALRLGVSRALNEIDRDANRPALKKAGFLTRDARATERKKAGLKKARKASQFSKR 169
>gi|78221828|ref|YP_383575.1| 30S ribosomal protein S9 [Geobacter metallireducens GS-15] >gi|78193083|gb|ABB30850.1| SSU ribosomal protein S9P [Geobacter metallireducens GS-15] (130 aa)
Score = 288, Expect = 8.9e-25, Identities = 66/130 (50%), Positives = 86/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ + Y G G+RKSSVA V L PGTG I+IN +  ++YF        ++QPL + +   NFD++V V GGG +GQAGAI+ GI +ALL  +   R TLK +  +TRD R KERKKYG   ARRS QF+KR
  S:     1 MAAISYYGTGKRKSSVARVWLKPGTGNIVINNKSIDDYFGRETSKMVVKQPLELVEKVGNFDIYVNVRGGGDSGQAGAIKHGITKALLEVDVALRGTLKKAGFITRDSRIKERKKYGKRAARRSCQFSKR 130
>gi|186901608|ref|ZP_02974559.1| ribosomal protein S9 [Cyanothece sp. PCC 7424] >gi|186691466|gb|EDU16091.1| ribosomal protein S9 [Cyanothece sp. PCC 7424] (137 aa)
Score = 288, Expect = 9.0e-25, Identities = 62/125 (49%), Positives = 86/125 (68%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPN-SLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V+L+PGTG++ +N +  + YF   +  +Q ++ PL        +D+ VK  GGG TGQA A++LG+ARAL     + R+ LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:    12 YWGTGRRKTSVARVRLIPGTGQVTVNGKPGDTYFNRIADYLQGIKAPLETLGLENEYDILVKAHGGGLTGQADAVKLGVARALCELAPENRQPLKSEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|172040056|ref|YP_001799770.1| 30S ribosomal protein S9 [Corynebacterium urealyticum DSM 7109] >gi|171851360|emb|CAQ04336.1| 30S ribosomal protein S9 [Corynebacterium urealyticum DSM 7109] (181 aa)
Score = 288, Expect = 9.4e-25, Identities = 61/122 (50%), Positives = 83/122 (68%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK ++  V++V G+G+I  N R   +YFPN L  Q ++ PLV+ +    FD+   + GGG +GQAGA+RL IARAL   N + R  LK +  LTRD RA ERKK GL+GARR+PQ++KR
  S:    60 VGRRKRAIVRVRMVEGSGQITCNGRALEDYFPNKLHEQLIKDPLVLLERENQFDIQATLTGGGPSGQAGAMRLAIARALNKYNPEERTQLKKAGFLTRDARAVERKKAGLHGARRAPQYSKR 181
>gi|182436594|ref|YP_001824313.1| putative 30S ribosomal protein S9 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178465110|dbj|BAG19630.1| putative 30S ribosomal protein S9 [Streptomyces griseus subsp. griseus NBRC 13350] (175 aa)
Score = 288, Expect = 9.4e-25, Identities = 62/123 (50%), Positives = 88/123 (71%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND-FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GLGRRK+++A V++VPGTGK  IN R   +YFPN +  Q++ +P  + +    +DV  ++ GGG +GQAGA+RLG+AR+L  A+ D  R TLK +  L+RD RA ERKK GL  AR++PQ++KR
  S:    52 GLGRRKNAIARVRIVPGTGKWKINGRTLEDYFPNKVHQQEVNEPFKVLELDGRYDVIARISGGGVSGQAGALRLGVARSLNEADVDNNRATLKKAGFLSRDDRAVERKKAGLKKARKAPQYSKR 175
>gi|78780008|ref|YP_398120.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9312] >gi|123553723|sp|Q318L1|RS9_PROM9 30S ribosomal protein S9 >gi|78713507|gb|ABB50684.1| SSU ribosomal protein S9P [Prochlorococcus marinus str. MIT 9312] (136 aa)
Score = 288, Expect = 9.7e-25, Identities = 65/125 (52%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V+L+PG G+I IN R  ++Y   N L +  ++ PL       ++D+ V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:    11 YWGTGRRKTSVARVRLIPGNGQIKINGRSGDDYLNFNPLHLNSIKAPLQTLGLENSYDILVNVFGGGLTGQADAIKQGAARALCELSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136
>gi|116794364|gb|ABK27114.1| unknown [Picea sitchensis] (218 aa)
Score = 288, Expect = 1.0e-24, Identities = 65/121 (53%), Positives = 81/121 (66%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK++VA V L+ G+GK++IN R   EY   N L +Q ++ PL        +DVFVK  GGG +GQA A  LGIARAL  AN D R  LK   +LTRDPR  ERKK GL+ AR++PQF+KR
  S:    97 GRRKTAVARVVLLEGSGKVIINGRTAQEYLQGNPLWLQYLKHPLATLGYETKYDVFVKAEGGGLSGQAQATLLGIARALCKANPDNRDPLKKQGLLTRDPRKVERKKAGLHKARKAPQFSKR 218
>gi|78211901|ref|YP_380680.1| 30S ribosomal protein S9 [Synechococcus sp. CC9605] >gi|123578845|sp|Q3AMQ7|RS9_SYNSC 30S ribosomal protein S9 >gi|78196360|gb|ABB34125.1| 30S ribosomal protein S9 [Synechococcus sp. CC9605] (133 aa)
Score = 287, Expect = 1.2e-24, Identities = 70/130 (53%), Positives = 85/130 (65%)
  Q:     1 MSN--VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MSN  V Y G GRRK+SVA V+LVPG G I IN R  + Y   N   I  ++ PL        +D+ V V GGG TGQ+GAI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     1 MSNNSVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPSYIAAVKAPLETLGLSSEYDILVNVHGGGLTGQSGAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 133
>gi|11466356|ref|NP_038359.1| ribosomal protein S9 [Mesostigma viride] >gi|14285749|sp|Q9MUV1|RR9_MESVI Chloroplast 30S ribosomal protein S9 >gi|7259499|gb|AAF43800.1|AF166114_12 ribosomal protein S9 [Mesostigma viride] (137 aa)
Score = 287, Expect = 1.2e-24, Identities = 66/130 (50%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M  + Y G GRRKS+VA V+LVPG G+++IN      Y   N   +  +  PL       N+D+ VK VGGG TGQA AIRLG+ARAL   +   R  LK    LTRD R KERKKYGL  AR++PQF+KR
  S:     7 MPIINYLGTGRRKSAVARVRLVPGNGEVIINGLPGTNYLQFNGSYLSAVRSPLETLGLEDNYDIIVKAVGGGLTGQAEAIRLGVARALCTIDTSNRHPLKKEGFLTRDSRVKERKKYGLKKARKAPQFSKR 137
>gi|160941030|ref|ZP_02088368.1| hypothetical protein CLOBOL_05923 [Clostridium bolteae ATCC BAA-613] >gi|158435979|gb|EDP13746.1| hypothetical protein CLOBOL_05923 [Clostridium bolteae ATCC BAA-613] (130 aa)
Score = 287, Expect = 1.2e-24, Identities = 77/130 (59%), Positives = 91/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+N ++ G GRRK S+A V LVPGTG I IN+R  NEY     +   + QPLV T+T   FDV V V GGG TGQAGAIR GI+RALL  + D+R  LK +  LTRDPR KERKKYGL  ARR+PQF+KR
  S:     1 MANAKFYGTGRRKKSIARVYLVPGTGNITINKRDINEYLGLETLKVIVRQPLVATETTDKFDVMVNVRGGGTTGQAGAIRHGISRALLQVDADYRPALKKAGFLTRDPRMKERKKYGLKAARRAPQFSKR 130
>gi|156743917|ref|YP_001434046.1| ribosomal protein S9 [Roseiflexus castenholzii DSM 13941] >gi|156235245|gb|ABU60028.1| ribosomal protein S9 [Roseiflexus castenholzii DSM 13941] (132 aa)
Score = 287, Expect = 1.3e-24, Identities = 66/125 (52%), Positives = 89/125 (71%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF-PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++G GRRK++VA V+L PG+G I++N +   EYF    L  +++ +PL +T T   ++V VKV GGG +GQA A+R GI RALL AN DFR  LK + ++TRDPR KERKK GL  AR+ PQ+TKR
  S:     7 FQGTGRRKTAVARVRLFPGSGDIVVNSKSIREYFGARELYAREIARPLELTGTAGAYNVLVKVRGGGVSGQAQAVRHGITRALLDANPDFRPVLKQAGLITRDPRMKERKKAGLKRARKRPQYTKR 132
>gi|87124990|ref|ZP_01080837.1| 30S ribosomal protein S9 [Synechococcus sp. RS9917] >gi|86167310|gb|EAQ68570.1| 30S ribosomal protein S9 [Synechococcus sp. RS9917] (134 aa)
Score = 287, Expect = 1.3e-24, Identities = 71/130 (54%), Positives = 86/130 (66%)
  Q:     1 MSN-VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MSN V Y G GRRK+SVA V+LVPG+G I IN R  + Y   N   +  ++ PL        +DV V V GGG TGQA AI+ G ARAL   + D RK LKV   L+RDPRAKER+KYGL  AR++PQF+KR
  S:     3 MSNSVVYWGTGRRKTSVARVRLVPGSGTITINGRPGDNYLNYNPAYLAAVKAPLQTLGLATEYDVLVNVRGGGLTGQADAIKQGAARALCELSADNRKPLKVEGHLSRDPRAKERRKYGLKKARKAPQFSKR 134
>gi|167041125|gb|ABZ05885.1| putative ribosomal protein S9/S16 [uncultured marine microorganism HF4000_001A02] (130 aa)
Score = 287, Expect = 1.3e-24, Identities = 67/130 (51%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+N  Y  +GRRK S+A V + PG G I IN R   EY     +   + QPL + D R+++D+ V V GGG +GQAGAIRLGIARAL   + DFR  LK +  LTRD R  ERKKYG  GAR+  QF+KR
  S:     1 MANAFYNAIGRRKESIARVFMTPGKGNISINGRPFKEYVSRESLAIVVTQPLNLIDQRESYDIKVTVKGGGLSGQAGAIRLGIARALNDVSADFRPQLKAAGFLTRDAREVERKKYGQPGARKKFQFSKR 130
>gi|157414136|ref|YP_001485002.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9215] >gi|167012628|sp|A8G735|RS9_PROM2 30S ribosomal protein S9 >gi|157388711|gb|ABV51416.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9215] (136 aa)
Score = 287, Expect = 1.3e-24, Identities = 65/125 (52%), Positives = 83/125 (66%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V+L+PG G I IN R  ++Y   N L +  ++ PL       ++D+ V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:    11 YWGTGRRKTSVARVRLIPGNGLITINGRSGDDYLNFNPLHLNSVKAPLQTLGLENSYDILVNVFGGGLTGQADAIKQGAARALCELSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136
>gi|33864026|ref|NP_895586.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9313] >gi|39932087|sp|Q7V520|RS9_PROMM 30S ribosomal protein S9 >gi|33635610|emb|CAE21934.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9313] (135 aa)
Score = 287, Expect = 1.4e-24, Identities = 67/129 (51%), Positives = 85/129 (65%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++V Y G GRRK+SVA V+LVPG+G I IN R  + Y   N   +  ++ PL      + +DV V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     6 NSVVYWGTGRRKTSVARVRLVPGSGTITINGRPGDHYLNFNPAYLAAVKAPLQTLGLNEQYDVLVNVHGGGLTGQADAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|160902266|ref|YP_001567847.1| ribosomal protein S9 [Petrotoga mobilis SJ95] >gi|189045706|sp|A9BHB5|RS9_PETMO 30S ribosomal protein S9 >gi|160359910|gb|ABX31524.1| ribosomal protein S9 [Petrotoga mobilis SJ95] (135 aa)
Score = 286, Expect = 1.6e-24, Identities = 69/127 (54%), Positives = 87/127 (68%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPN---EYFPNSLVIQ-DMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +EY G GRRK++VA V L PG GKI IN ++     EY   + V + +  +PL +T T   FD+ ++V GGG +GQAGAIRLGIARALL  +  FR  LK   +LTRDPR  ERKKYGL  AR+  QF+KR
  S:     5 IEYYGTGRRKTAVARVHLRPGNGKIKINGKEYKSLVEYLRGNEVWEIEALKPLTVTSTNGQFDLVIRVNGGGLSGQAGAIRLGIARALLSYDESFRPILKKEGLLTRDPREVERKKYGLRKARKRAQFSKR 135
>gi|33241134|ref|NP_876076.1| 30S ribosomal protein S9 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|37154400|sp|O07828|RS9_PROMA 30S ribosomal protein S9 >gi|33238664|gb|AAQ00729.1| Ribosomal protein S9 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (136 aa)
Score = 286, Expect = 1.6e-24, Identities = 67/127 (52%), Positives = 84/127 (66%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRK+SVA V+L+PGTGKI IN R  + Y   N   +  ++ PL      + +DV V V GGG TGQ+ AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     9 VVYWGTGRRKTSVARVRLIPGTGKITINGRPGDHYLNFNPAYLSAVKAPLHTLGLGEAYDVLVNVYGGGLTGQSDAIKQGAARALCELSVDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136
>gi|33866626|ref|NP_898185.1| 30S ribosomal protein S9 [Synechococcus sp. WH 8102] >gi|39932065|sp|Q7U4H4|RS9_SYNPX 30S ribosomal protein S9 >gi|33633404|emb|CAE08609.1| 30S ribosomal protein S9 [Synechococcus sp. WH 8102] (133 aa)
Score = 286, Expect = 1.7e-24, Identities = 67/129 (51%), Positives = 84/129 (65%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++V Y G GRRK+SVA V+LVPG G I IN R  + Y   N   I  ++ PL        +D+ V V GGG TGQ+GAI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     4 NSVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYIAAVKAPLETLGLGTEYDILVNVHGGGLTGQSGAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 133
>gi|123966946|ref|YP_001012027.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9515] >gi|166229587|sp|A2BYQ9|RS9_PROM5 30S ribosomal protein S9 >gi|123201312|gb|ABM72920.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9515] (136 aa)
Score = 286, Expect = 1.7e-24, Identities = 65/125 (52%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V+L+PG G+I IN R  ++Y   N   +  ++ PL       ++D+FV V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:    11 YWGTGRRKTSVARVRLIPGNGQIKINGRSGDDYLNFNPSHLNSVKAPLQTLGLENSYDIFVNVFGGGLTGQADAIKQGAARALCDLSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136
>gi|72382940|ref|YP_292295.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. NATL2A] >gi|72002790|gb|AAZ58592.1| SSU ribosomal protein S9P [Prochlorococcus marinus str. NATL2A] (135 aa)
Score = 286, Expect = 1.8e-24, Identities = 66/129 (51%), Positives = 86/129 (66%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRK+SVA V+L PG G+I+IN R  + Y   N   I  ++ PL      +++DV V V GGG TGQ+ AI+ G ARAL   + D RK LK+   L+RDPRAKER+KYGL  AR++PQF+KR
  S:     6 NKVVYWGTGRRKTSVARVRLTPGKGEIIINGRPGDHYLNFNPAYISAVKAPLKTLGLSESYDVLVNVYGGGLTGQSDAIKQGAARALCTLSLDNRKPLKLEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|56751901|ref|YP_172602.1| 30S ribosomal protein S9 [Synechococcus elongatus PCC 6301] >gi|81301014|ref|YP_401222.1| 30S ribosomal protein S9 [Synechococcus elongatus PCC 7942] >gi|56686860|dbj|BAD80082.1| 30S ribosomal protein S9 [Synechococcus elongatus PCC 6301] >gi|81169895|gb|ABB58235.1| SSU ribosomal protein S9P [Synechococcus elongatus PCC 7942] (135 aa)
Score = 286, Expect = 1.8e-24, Identities = 66/127 (51%), Positives = 84/127 (66%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRK++VA V+LVPG+GK++IN R+ + Y   N   +     PL       ++D+   V GGG TGQA AIRLG+ARAL     + RK LKV   L+RDPR KERKKYGL  AR++PQF+KR
  S:     8 VVYWGTGRRKTAVARVRLVPGSGKLVINGREGDNYLNYNPAYLNATRLPLETLGLEGDYDILANVHGGGLTGQADAIRLGVARALCELAPENRKPLKVEGFLSRDPRRKERKKYGLKKARKAPQFSKR 135
>gi|123969271|ref|YP_001010129.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. AS9601] >gi|166229588|sp|A2BTB1|RS9_PROMS 30S ribosomal protein S9 >gi|123199381|gb|ABM71022.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. AS9601] (136 aa)
Score = 285, Expect = 1.9e-24, Identities = 65/125 (52%), Positives = 83/125 (66%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V+L+PG G I IN R  ++Y   N L +  ++ PL       ++D+ V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:    11 YWGTGRRKTSVARVRLIPGNGLIKINGRSGDDYLNFNPLHLNSIKAPLQTLGLENSYDILVNVFGGGLTGQADAIKQGAARALCELSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136
>gi|126697061|ref|YP_001091947.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9301] >gi|166229585|sp|A3PF21|RS9_PROM0 30S ribosomal protein S9 >gi|126544104|gb|ABO18346.1| 30S ribosomal protein S9 [Prochlorococcus marinus str. MIT 9301] (136 aa)
Score = 285, Expect = 2.0e-24, Identities = 65/125 (52%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V+L+PG G I IN R  ++Y   N L +  ++ PL       ++D++V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:    11 YWGTGRRKTSVARVRLIPGNGLIKINGRAGDDYLNFNPLHLNSIKAPLQTLGLENSYDMYVNVFGGGLTGQADAIKQGAARALCELSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136
>gi|114777706|ref|ZP_01452666.1| 30S ribosomal protein S9 [Mariprofundus ferrooxydans PV-1] >gi|114551922|gb|EAU54456.1| 30S ribosomal protein S9 [Mariprofundus ferrooxydans PV-1] (130 aa)
Score = 285, Expect = 2.1e-24, Identities = 66/130 (50%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   ++G GRRK SVA V + PG G++L+N R+   YFP  ++ Q    PL  T+    FD+ V V GGG +GQAGAIR G+ARALLV +   R  LK +  LTRD R  ERKK GL  ARR+PQF+KR
  S:     1 MAETIFRGTGRRKRSVARVIIQPGKGQVLVNGREVENYFPIDIIRQQALLPLDETELAGRFDIRVNVFGGGISGQAGAIRHGLARALLVYDAALRPQLKAAGFLTRDSRKVERKKAGLKKARRAPQFSKR 130
>gi|88856973|ref|ZP_01131623.1| 30S ribosomal protein S9 [marine actinobacterium PHSC20C1] >gi|88813790|gb|EAR23662.1| 30S ribosomal protein S9 [marine actinobacterium PHSC20C1] (162 aa)
Score = 285, Expect = 2.3e-24, Identities = 62/123 (50%), Positives = 84/123 (68%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARAL-LVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK ++A V+LVPG+G I +N R+  EYFPN L  Q +  P  + D    +DV  ++ GGG +GQAGA+RLGI+R+L L+   + R  LK +  LTRD R KERKK GL  AR++PQF+KR
  S:    39 AVGRRKQAIARVRLVPGSGTITVNGRELAEYFPNKLHQQLINDPFKVLDLLGGYDVIARITGGGPSGQAGALRLGISRSLNLIDEENNRAILKKAGFLTRDARVKERKKAGLKKARKAPQFSKR 162
>gi|39997966|ref|NP_953917.1| 30S ribosomal protein S9 [Geobacter sulfurreducens PCA] >gi|39984911|gb|AAR36267.1| ribosomal protein S9 [Geobacter sulfurreducens PCA] (130 aa)
Score = 285, Expect = 2.4e-24, Identities = 66/130 (50%), Positives = 85/130 (65%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ + Y G G+RKSSVA V L PGTG I+IN +  +EYF        ++QPL + +    FD++V V GGG +GQAGAI+ GI +ALL  +   R TLK +  +TRD R KERKKYG   ARRS QF+KR
  S:     1 MAGISYYGTGKRKSSVARVWLKPGTGAIVINNKPIDEYFGRETSKMIVKQPLELVEKVGAFDIYVNVRGGGDSGQAGAIKHGITKALLEVDVALRGTLKKAGFITRDSRIKERKKYGKRAARRSCQFSKR 130
>gi|16329913|ref|NP_440641.1| 30S ribosomal protein S9 [Synechocystis sp. PCC 6803] >gi|2500426|sp|P73293|RS9_SYNY3 30S ribosomal protein S9 >gi|1652399|dbj|BAA17321.1| 30S ribosomal protein S9 [Synechocystis sp. PCC 6803] (137 aa)
Score = 285, Expect = 2.4e-24, Identities = 62/129 (48%), Positives = 89/129 (68%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLV--IQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRK+++A V+LVPG G++++N  KP E + N +   IQ ++ PL        +++ V   GGG TGQA A++LG+ARAL   + + R+ LK    LTRDPRAKERKKYGL+ AR++PQ++KR
  S:     8 NKVVYWGTGRRKAAIARVRLVPGQGEVIVNG-KPGEIYFNRIANYIQSLKAPLETLGLEGEYNILVNAHGGGLTGQADAVKLGVARALCQLSPENRQPLKAEGYLTRDPRAKERKKYGLHKARKAPQYSKR 137
>gi|196240987|ref|ZP_03139753.1| ribosomal protein S9 [Cyanothece sp. PCC 7425] >gi|196215066|gb|EDY09719.1| ribosomal protein S9 [Cyanothece sp. PCC 7425] (137 aa)
Score = 285, Expect = 2.4e-24, Identities = 66/125 (52%), Positives = 83/125 (66%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKSSVA V+LVPGTG++ IN +    Y   N   +   + PL       ++D+ V   GGG TGQA +IRLG+ARAL   + + RK LKV   LTRDPRAKERKKYGL  AR++PQ++KR
  S:    12 YIGTGRRKSSVARVRLVPGTGQLTINGKSGELYLQFNPTYLAIAKAPLESLGLENDYDILVNTSGGGLTGQADSIRLGVARALCQLDPENRKPLKVEGYLTRDPRAKERKKYGLRKARKAPQYSKR 137
>gi|29831501|ref|NP_826135.1| 30S ribosomal protein S9 [Streptomyces avermitilis MA-4680] >gi|39932147|sp|Q82DL8|RS9_STRAW 30S ribosomal protein S9 >gi|29608617|dbj|BAC72670.1| putative ribosomal protein S9 [Streptomyces avermitilis MA-4680] (173 aa)
Score = 284, Expect = 3.1e-24, Identities = 62/123 (50%), Positives = 86/123 (69%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND-FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GLGRRK+++A V++VPGTGK  IN R   +YFPN +  Q++ +P  + +    +DV  ++ GGG +GQAGA+RLG+ARAL  A+ D  R  LK +  L RD RA ERKK GL  AR++PQ++KR
  S:    50 GLGRRKNAIARVRIVPGTGKWKINGRTLEDYFPNKVHQQEVNEPFKVLELEGRYDVIARISGGGVSGQAGALRLGVARALNEADVDNNRGALKKAGFLKRDDRAVERKKAGLKKARKAPQYSKR 173
>gi|168036408|ref|XP_001770699.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162678060|gb|EDQ64523.1| predicted protein [Physcomitrella patens subsp. patens] (222 aa)
Score = 283, Expect = 3.3e-24, Identities = 64/123 (52%), Positives = 82/123 (66%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK++VA V LV GTGKI+IN R   +Y   N L +Q ++ PL        +D+ V+V GGG + QA AI LG+ARAL+VAN   R  LK   +LTRD R  ERKKYGL  AR++PQ++KR
  S:    99 GTGRRKTAVARVVLVEGTGKIVINNRTAQDYLQGNPLWLQSVKYPLASLGYETKYDIIVRVEGGGLSAQAQAILLGVARALIVANAANRDPLKKQGLLTRDSRVVERKKYGLRKARKAPQYSKR 222
>gi|90994481|ref|YP_536971.1| ribosomal protein S9 [Porphyra yezoensis] >gi|122194695|sp|Q1XDJ7|RR9_PORYE Chloroplast 30S ribosomal protein S9 >gi|90819045|dbj|BAE92414.1| 30S ribosomal protein S9 [Porphyra yezoensis] >gi|116266140|gb|ABJ91308.1| 30S ribosomal protein S9 [Porphyra yezoensis] (137 aa)
Score = 283, Expect = 3.4e-24, Identities = 67/125 (53%), Positives = 80/125 (64%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK SVA V+LVPG+G ++IN      Y    PN L +     PL +      +D+ V   GGG TGQA AIRLG+ARAL   N + R TLK    LTRDPR KERKKYGL  AR++PQF+KR
  S:    12 YSGTGRRKCSVAQVRLVPGSGNLIINGIPGESYLQFSPNYLRVS--YAPLQVLGLLNQYDIHVNARGGGLTGQADAIRLGVARALCSINPENRTTLKSEGYLTRDPRVKERKKYGLKKARKAPQFSKR 137
>gi|158334428|ref|YP_001515600.1| 30S ribosomal protein S9 [Acaryochloris marina MBIC11017] >gi|189045685|sp|B0C426|RS9_ACAM1 30S ribosomal protein S9 >gi|158304669|gb|ABW26286.1| 30S ribosomal protein S9 [Acaryochloris marina MBIC11017] (137 aa)
Score = 283, Expect = 3.6e-24, Identities = 65/127 (51%), Positives = 85/127 (66%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y+G GRRKSS+  V+LVPG+G + IN +  + Y   N   I + + PL       ++DV V   GGG TGQA AI+LG+ARAL   + + RK LK+   LTRDPRAKERKKYGL  AR++PQ++KR
  S:    10 VAYRGTGRRKSSIVRVRLVPGSGVMTINGKPGDLYLQFNPSYIANAKAPLESLGLENDYDVLVNARGGGLTGQADAIKLGVARALCELDPENRKPLKLEGYLTRDPRAKERKKYGLRKARKAPQYSKR 137
>gi|124112123|ref|YP_001019080.1| ribosomal protein S9 [Chlorokybus atmophyticus] >gi|124012230|gb|ABM87968.1| ribosomal protein S9 [Chlorokybus atmophyticus] (137 aa)
Score = 283, Expect = 3.7e-24, Identities = 66/130 (50%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +S V Y G GRRKS+VA V+LV G G+I+IN +K   Y   N   I  ++ PL      +N+D+FV   GGG TGQA AIR+G+ARAL   +   R  LK    LTRD R  ERKKYGL  AR++PQF+KR
  S:     7 LSKVHYLGTGRRKSAVARVRLVAGKGEIIINNQKGTPYLQFNPAYISAVKLPLETLGLEENYDIFVTAKGGGLTGQAEAIRMGVARALCEIDPSNRYPLKKEGFLTRDSRCVERKKYGLKKARKAPQFSKR 137
>gi|21223114|ref|NP_628893.1| 30S ribosomal protein S9 [Streptomyces coelicolor A3(2)] >gi|2500425|sp|Q53875|RS9_STRCO 30S ribosomal protein S9 >gi|1155338|gb|AAC46061.1| ScoS9 [Streptomyces coelicolor A3(2)] >gi|3449247|emb|CAA20391.1| 30S ribosomal protein S9 [Streptomyces coelicolor A3(2)] (170 aa)
Score = 283, Expect = 3.7e-24, Identities = 61/123 (49%), Positives = 86/123 (69%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND-FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GLGRRK+++A V++VPGTGK  +N R   +YFPN +  Q++ +P  + +    +DV  ++ GGG +GQAGA+RLG+ARAL  A+ D  R  LK +  L RD RA ERKK GL  AR++PQ++KR
  S:    47 GLGRRKNAIARVRIVPGTGKWKVNGRTLEDYFPNKVHQQEVNEPFKVLELDNRYDVIARISGGGVSGQAGALRLGVARALNEADVDNNRGALKKAGYLKRDDRAVERKKAGLKKARKAPQYSKR 170
>gi|19551816|ref|NP_599818.1| 30S ribosomal protein S9 [Corynebacterium glutamicum ATCC 13032] >gi|62389471|ref|YP_224873.1| 30S ribosomal protein S9 [Corynebacterium glutamicum ATCC 13032] >gi|145294752|ref|YP_001137573.1| 30S ribosomal protein S9 [Corynebacterium glutamicum R] >gi|166229556|sp|A4QBS4|RS9_CORGB 30S ribosomal protein S9 >gi|24212284|sp|Q8NST5|RS9_CORGL 30S ribosomal protein S9 >gi|21323347|dbj|BAB97975.1| Ribosomal protein S9 [Corynebacterium glutamicum ATCC 13032] >gi|41324805|emb|CAF19287.1| 30S RIBOSOMAL PROTEIN S9 [Corynebacterium glutamicum ATCC 13032] >gi|140844672|dbj|BAF53671.1| hypothetical protein [Corynebacterium glutamicum R] (182 aa)
Score = 283, Expect = 4.2e-24, Identities = 63/122 (51%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK ++  V+LV G+G+   N R   EYFPN L  Q ++ PLV+ D    FD+   + GGG TGQAGA RL IARAL   N   R  LK +  LTRD RA ERKK GL+ ARR+PQ++KR
  S:    61 VGRRKRAIVRVRLVAGSGEFKCNGRTLEEYFPNKLHQQLIKAPLVLLDRENQFDIVATLKGGGPTGQAGAFRLAIARALNAYNPAERGELKKAGFLTRDARAVERKKAGLHKARRAPQYSKR 182
>gi|124516670|gb|EAY58178.1| Ribosomal protein S9 [Leptospirillum sp. Group II UBA] (135 aa)
Score = 282, Expect = 4.4e-24, Identities = 62/121 (51%), Positives = 83/121 (68%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK+++A V++  G+G+I +N R   EYFP ++    ++ PL IT+     DVF +V GGG TGQA AIR GI+RALL  N + R++LK    LTRDPR KERKKYG  GAR+  QF+KR
  S:    15 GKRKTAIARVRVQAGSGQIRVNDRALEEYFPRTIWSNQVKAPLEITNMLSRIDVFARVTGGGLTGQAEAIRHGISRALLEINPELRESLKKEGFLTRDPRIKERKKYGQKGARKRFQFSKR 135
>gi|189426239|ref|YP_001953416.1| ribosomal protein S9 [Geobacter lovleyi SZ] >gi|189422498|gb|ACD96896.1| ribosomal protein S9 [Geobacter lovleyi SZ] (130 aa)
Score = 282, Expect = 4.8e-24, Identities = 65/130 (50%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+ V + G G+RKSSVA V L PG G+I++N +  +EYF        + QPL +T+    FDVFV V GGG +GQAGAI+ GI +ALL A+ + R  LK +  +TRD R KERKKYG   AR   QF+KR
  S:     1 MAAVSFYGTGKRKSSVARVWLKPGAGRIVVNNKTLDEYFGRETSKMVVRQPLELTENVGKFDVFVNVCGGGDSGQAGAIKHGITKALLEADPELRANLKKAGFITRDSRVKERKKYGRKAARARFQFSKR 130
>gi|38233171|ref|NP_938938.1| 30S ribosomal protein S9 [Corynebacterium diphtheriae NCTC 13129] >gi|38199430|emb|CAE49074.1| 30S ribosomal protein S9 [Corynebacterium diphtheriae] (177 aa)
Score = 282, Expect = 5.3e-24, Identities = 62/122 (50%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK ++  V++V G+G+   N R   EYFPN L  Q ++ PL + D    FD+   + GGG TGQAGA RL IARAL V N   R  LK +  LTRD RA ERKK GL+ ARR+PQ++KR
  S:    56 VGRRKRAIVRVRMVEGSGQFTCNGRTLEEYFPNKLHQQLIKAPLALIDRDGQFDIQATLTGGGPTGQAGAFRLAIARALNVYNPADRAALKKAGFLTRDARAVERKKAGLHKARRAPQYSKR 177
>gi|116075740|ref|ZP_01472999.1| 30S ribosomal protein S9 [Synechococcus sp. RS9916] >gi|116067055|gb|EAU72810.1| 30S ribosomal protein S9 [Synechococcus sp. RS9916] (134 aa)
Score = 282, Expect = 5.3e-24, Identities = 68/129 (52%), Positives = 83/129 (64%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++V Y G GRRK+SVA V+LVPG G I IN R  + Y   N   I  ++ PL        +DV V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     5 NSVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYISAVKAPLQTLGLTGEYDVLVNVRGGGLTGQADAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 134
>gi|134103209|ref|YP_001108870.1| 30S ribosomal protein S9 [Saccharopolyspora erythraea NRRL 2338] >gi|166229599|sp|A4FPH0|RS9_SACEN 30S ribosomal protein S9 >gi|133915832|emb|CAM05945.1| 30S ribosomal protein S9 [Saccharopolyspora erythraea NRRL 2338] (153 aa)
Score = 282, Expect = 5.4e-24, Identities = 61/122 (50%), Positives = 85/122 (69%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPG G   +N +   +YFPN +  Q +++PLV  +  ++FDV   + GGG +GQAGA+R+ IARAL+  + D R  LK + MLTRD R KERKKYGL  AR++PQ++KR
  S:    32 VGRRKEAVVRVRLVPGNGGFKLNGKSLEQYFPNKVHQQLIKEPLVTVERVESFDVAATLRGGGPSGQAGALRMAIARALVELDADDRPALKKAGMLTRDSREKERKKYGLKKARKAPQYSKR 153
>gi|89074191|ref|ZP_01160690.1| ribosomal protein S9 [Photobacterium sp. SKA34] >gi|90580208|ref|ZP_01236015.1| 30S ribosomal protein S9 [Vibrio angustum S14] >gi|89050127|gb|EAR55653.1| ribosomal protein S9 [Photobacterium sp. SKA34] >gi|90438510|gb|EAS63694.1| 30S ribosomal protein S9 [Vibrio angustum S14] (130 aa)
Score = 281, Expect = 6.5e-24, Identities = 63/130 (48%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PGTG I+IN+R   EYF        + QPL + +  +N D+++ V GGG TGQ+GAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGTGNIVINKRSIEEYFGRPTARMVVRQPLELVEMTENLDLYITVKGGGITGQSGAIRHGITRALMEYDETLRPALRAAGYVTRDARCVERKKVGLRKARRRPQFSKR 130
>gi|86609049|ref|YP_477811.1| 30S ribosomal protein S9 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123502211|sp|Q2JL70|RS9_SYNJB 30S ribosomal protein S9 >gi|86557591|gb|ABD02548.1| ribosomal protein S9 [Synechococcus sp. JA-2-3B'a(2-13)] (136 aa)
Score = 280, Expect = 7.4e-24, Identities = 63/125 (50%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK++VA V+LVPGTGKI+IN R  ++Y      ++  ++ PL I     ++D+ V+  GGG  GQA AI+LG+ARAL   +   R  LKV   L RDPRA ERKKYGL  AR++PQ++KR
  S:    11 YWGTGRRKTAVARVRLVPGTGKIIINDRPGDQYLQYQEALLASVKGPLEILGLENSYDILVRAHGGGVHGQADAIKLGVARALCEVDPANRGPLKVEGYLKRDPRAVERKKYGLRKARKAPQYSKR 136
>gi|27364059|ref|NP_759587.1| 30S ribosomal protein S9 [Vibrio vulnificus CMCP6] >gi|37678779|ref|NP_933388.1| 30S ribosomal protein S9 [Vibrio vulnificus YJ016] >gi|31340393|sp|Q8DEJ0|RS9_VIBVU 30S ribosomal protein S9 >gi|39932023|sp|Q7MNX0|RS9_VIBVY 30S ribosomal protein S9 >gi|27360177|gb|AAO09114.1|AE016799_12 Ribosomal protein S9 [Vibrio vulnificus CMCP6] >gi|37197520|dbj|BAC93359.1| ribosomal protein S9 [Vibrio vulnificus YJ016] (130 aa)
Score = 280, Expect = 7.9e-24, Identities = 62/130 (47%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I+IN+R   EYF        ++QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGNIVINKRALEEYFGRPTSCMVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRPALRAAGYVTRDARCVERKKVGLRKARRRPQFSKR 130
>gi|148273763|ref|YP_001223324.1| 30S ribosomal protein S9 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|166200250|sp|A5CU75|RS9_CLAM3 30S ribosomal protein S9 >gi|147831693|emb|CAN02662.1| 30S ribosomal protein S9 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (161 aa)
Score = 280, Expect = 8.7e-24, Identities = 63/128 (49%), Positives = 86/128 (67%)
  Q:     3 NVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARAL-LVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           NV    +GRRK ++A V+LVPG+G I +N R+  +YFPN L  Q +  P  + D   ++DV  ++ GGG +GQAGA+RLGIARAL  +   + R  LK +  L+RD R KERKK GL  AR++PQF+KR
  S:    33 NVSGGAVGRRKQAIARVRLVPGSGSITVNGREFADYFPNKLHQQLVNDPFKVLDLLGSYDVVARISGGGPSGQAGALRLGIARALNEIDEENNRAVLKKNGFLSRDARVKERKKAGLKKARKAPQFSKR 161
>gi|83593486|ref|YP_427238.1| 30S ribosomal protein S9 [Rhodospirillum rubrum ATCC 11170] >gi|83576400|gb|ABC22951.1| SSU ribosomal protein S9P [Rhodospirillum rubrum ATCC 11170] (158 aa)
Score = 280, Expect = 8.8e-24, Identities = 61/121 (50%), Positives = 78/121 (64%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +VA V +  G+G+I +N R+   YFP  ++   + QP V+T+T   FDV   V GGG +GQAGA+R GI+RAL   + D R  LK    +TRDPR  ERKKYG   ARRS QF+KR
  S:    38 GRRKDAVARVWIKAGSGRITVNGRELENYFPRPVLRMVINQPFVVTNTTNQFDVVCTVTGGGLSGQAGALRHGISRALTYFDPDMRPALKAEGFMTRDPRTVERKKYGRAKARRSFQFSKR 158
>gi|149192585|ref|ZP_01870746.1| 30S ribosomal protein S9 [Vibrio shilonii AK1] >gi|148833580|gb|EDL50656.1| 30S ribosomal protein S9 [Vibrio shilonii AK1] (130 aa)
Score = 280, Expect = 9.1e-24, Identities = 63/130 (48%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PGTG I++N+R    YF        + QPL +T+  +  D+FV V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGTGNIVVNKRDLETYFGRETSCMVVRQPLELTELTEKLDLFVTVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGYVTRDARCVERKKVGLRKARRRPQFSKR 130
>gi|108804939|ref|YP_644876.1| SSU ribosomal protein S9P [Rubrobacter xylanophilus DSM 9941] >gi|123068979|sp|Q1AU64|RS9_RUBXD 30S ribosomal protein S9 >gi|108766182|gb|ABG05064.1| ribosomal protein S9 [Rubrobacter xylanophilus DSM 9941] (130 aa)
Score = 280, Expect = 9.1e-24, Identities = 65/130 (50%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   Y G GRRK+SVA V+++PG G+I +N R   EYFP     + +  PL + D    +DV  K+ GGG TGQA A+R GIARAL   + + R  LK + +LTRD RA ERKKYGL  AR+ PQF+KR
  S:     1 MAQTLYTGTGRRKTSVARVRVLPGDGRITVNGRPVEEYFPRVTHQRAVRAPLELLDAAGRYDVVAKIEGGGPTGQAEALRHGIARALAEESPEARGELKAAGLLTRDARAVERKKYGLKKARKRPQFSKR 130
>gi|54310324|ref|YP_131344.1| putative 30S ribosomal subunit protein S9 [Photobacterium profundum SS9] >gi|46914765|emb|CAG21542.1| putative 30S ribosomal subunit protein S9 [Photobacterium profundum SS9] (135 aa)
Score = 280, Expect = 9.4e-24, Identities = 66/130 (50%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PGTGKI+IN+R    YF        + QPLV+ D    FD+ + V GGG TGQ+GAIR GI RAL+  +   R TL+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     6 MAENQYYGTGRRKSSAARVFIKPGTGKIVINKRSLEVYFGRETARMVVNQPLVLLDMVDKFDLNITVKGGGITGQSGAIRHGITRALMEYDETLRPTLRSAGYVTRDARKVERKKVGLRKARRKPQFSKR 135
>gi|147855629|emb|CAN79164.1| hypothetical protein [Vitis vinifera] >gi|157335405|emb|CAO61235.1| unnamed protein product [Vitis vinifera] (209 aa)
Score = 279, Expect = 9.8e-24, Identities = 65/123 (52%), Positives = 81/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK ++A V L  GTGK++IN R   EY   N L +Q ++ PLV      ++DVFVK  GGG +GQA AI LGIARALL  + D R  L+   +LTRD R  ERKK GL  AR++PQF+KR
  S:    86 GTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYESSYDVFVKAHGGGLSGQAQAISLGIARALLKVSEDHRGPLRKEGLLTRDSRVVERKKVGLKKARKAPQFSKR 209
>gi|86159790|ref|YP_466575.1| SSU ribosomal protein S9P [Anaeromyxobacter dehalogenans 2CP-C] >gi|163767196|ref|ZP_02174212.1| ribosomal protein S9 [Anaeromyxobacter sp. K] >gi|167457066|ref|ZP_02323282.1| ribosomal protein S9 [Anaeromyxobacter dehalogenans 2CP-1] >gi|123496487|sp|Q2IEX8|RS9_ANADE 30S ribosomal protein S9 >gi|85776301|gb|ABC83138.1| SSU ribosomal protein S9P [Anaeromyxobacter dehalogenans 2CP-C] >gi|167416889|gb|EDR83600.1| ribosomal protein S9 [Anaeromyxobacter dehalogenans 2CP-1] >gi|196173693|gb|ACG74666.1| ribosomal protein S9 [Anaeromyxobacter sp. K] (130 aa)
Score = 279, Expect = 9.9e-24, Identities = 64/122 (52%), Positives = 80/122 (65%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +VA V+LVPGTG I IN R  +EYF        + +PL + D     DVFV   GGG +GQAGAIR GI+RAL+  N ++R  LK +  +TRD RA ERKKYG  GAR+  QF+KR
  S:     9 VGRRKEAVARVRLVPGTGNITINGRSMDEYFGRETSKMILVEPLKLVDQMGKLDVFVNAAGGGLSGQAGAIRHGISRALVELNPEYRPVLKKAGFMTRDARAVERKKYGRPGARKRFQFSKR 130
>gi|114327630|ref|YP_744787.1| 30S ribosomal protein S9 [Granulibacter bethesdensis CGDNIH1] >gi|114315804|gb|ABI61864.1| SSU ribosomal protein S9P [Granulibacter bethesdensis CGDNIH1] (166 aa)
Score = 279, Expect = 1.0e-23, Identities = 62/123 (50%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK +VA V + PG G I +N +K   YF   ++   + QP ++TD    FDV+  V GGG +GQAGA+R GI+RAL+    + R  LKV+  LTRDPR  ERKKYG   ARRS QF+KR
  S:    44 GTGRRKDAVARVWVKPGKGDIQVNGKKVGTYFARPVLRMLITQPFLVTDRYNQFDVYCTVTGGGLSGQAGAVRHGISRALVNYEPELRSVLKVAGFLTRDPRVVERKKYGKAKARRSFQFSKR 166
>gi|15805211|ref|NP_293899.1| 30S ribosomal protein S9 [Deinococcus radiodurans R1] >gi|20139955|sp|Q9RXY0|RS9_DEIRA 30S ribosomal protein S9 >gi|6457841|gb|AAF09761.1|AE001879_9 ribosomal protein S9 [Deinococcus radiodurans R1] (133 aa)
Score = 279, Expect = 1.1e-23, Identities = 67/126 (53%), Positives = 82/126 (65%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK++VA V L PG GKI++N ++   YF   L   +  Q    T T   FD  + V GGG +GQA AI+LGIARALL  N DFR  +K   +LTRDPR  ERKKYGL  ARR+PQF+KR
  S:     8 QYYGTGRRKAAVARVFLRPGEGKIVVNGKEFQTYFRGLLRAVNALQGFRETGTAGRFDAVITVTGGGPSGQADAIKLGIARALLKVNPDFRAQMKPKGLLTRDPREVERKKYGLKKARRAPQFSKR 133
>gi|169335664|ref|ZP_02862857.1| hypothetical protein ANASTE_02084 [Anaerofustis stercorihominis DSM 17244] >gi|169258402|gb|EDS72368.1| hypothetical protein ANASTE_02084 [Anaerofustis stercorihominis DSM 17244] (130 aa)
Score = 279, Expect = 1.1e-23, Identities = 67/121 (55%), Positives = 83/121 (68%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDM-EQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK SVA V L  G GKI IN R   EYF  +  ++ +  Q LV+T++   FD+ V V GGG +GQAGAIR GI+RAL+  N D RK +K +  LTRD R KERKKYGL  AR++PQF+KR
  S:     9 GRRKHSVARVVLKQGNGKITINGRDIEEYFGGNDTLKLIARQSLVLTNSADKFDISVNVYGGGISGQAGAIRHGISRALVAENPDLRKEVKKAGFLTRDSRMKERKKYGLKKARKAPQFSKR 130
>gi|148261236|ref|YP_001235363.1| 30S ribosomal protein S9 [Acidiphilium cryptum JF-5] >gi|146402917|gb|ABQ31444.1| SSU ribosomal protein S9P [Acidiphilium cryptum JF-5] (163 aa)
Score = 279, Expect = 1.1e-23, Identities = 62/121 (51%), Positives = 77/121 (63%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +VA V + PG G+I+IN RK  +YF   ++   + QP ++ D    FDV   V GGG +GQAGA+R GI+RAL     D R  LK +  LTRDPR  ERKKYG   ARRS QF+KR
  S:    43 GRRKDAVARVWIKPGKGEIVINGRKAAQYFARPVLRMLITQPFLVADRYNQFDVMATVTGGGLSGQAGAVRHGISRALTYYEPDLRGILKAAGFLTRDPRTVERKKYGKAKARRSFQFSKR 163
>gi|148263123|ref|YP_001229829.1| 30S ribosomal protein S9 [Geobacter uraniireducens Rf4] >gi|189045699|sp|A5GAY7|RS9_GEOUR 30S ribosomal protein S9 >gi|146396623|gb|ABQ25256.1| SSU ribosomal protein S9P [Geobacter uraniireducens Rf4] (130 aa)
Score = 279, Expect = 1.2e-23, Identities = 63/130 (48%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   + G G+RKSS+A V L PGTG I +N +  +EYF        ++QPL +T+    FD++V V GGG +GQAGAI+ GI +ALL  +   R TLK +  +TRD R KERKKYG   AR S QF+KR
  S:     1 MAAASFYGTGKRKSSIARVWLKPGTGVITVNHKTLDEYFGRETSKMVVKQPLELTENMGKFDIYVTVCGGGDSGQAGAIKHGITKALLEVDAALRGTLKKAGFVTRDSRIKERKKYGKKAARASFQFSKR 130
>gi|88807912|ref|ZP_01123423.1| 30S ribosomal protein S9 [Synechococcus sp. WH 7805] >gi|88787951|gb|EAR19107.1| 30S ribosomal protein S9 [Synechococcus sp. WH 7805] (134 aa)
Score = 279, Expect = 1.2e-23, Identities = 67/129 (51%), Positives = 82/129 (63%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++V Y G GRRK+SVA V+LVPG G I IN R  + Y   N   +  +  PL        +DV V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     5 NSVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYLSAVRAPLQTLGLLTEYDVLVNVRGGGLTGQADAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 134
>gi|90413019|ref|ZP_01221017.1| putative 30S ribosomal subunit protein S9 [Photobacterium profundum 3TCK] >gi|90326034|gb|EAS42473.1| putative 30S ribosomal subunit protein S9 [Photobacterium profundum 3TCK] (130 aa)
Score = 279, Expect = 1.2e-23, Identities = 66/130 (50%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PGTGKI+IN+R    YF        + QPLV+ D    FD+ + V GGG TGQ+GAIR GI RAL+  +   R TL+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGTGKIVINKRSLEVYFGRETARMVVNQPLVLLDMVDKFDLNITVKGGGITGQSGAIRHGITRALMEYDETLRPTLRAAGYVTRDARKVERKKVGLRKARRRPQFSKR 130
>gi|33862087|ref|NP_893648.1| 30S ribosomal protein S9 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|39932078|sp|Q7UZW9|RS9_PROMP 30S ribosomal protein S9 >gi|33634305|emb|CAE19990.1| 30S ribosomal protein S9 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (136 aa)
Score = 279, Expect = 1.2e-23, Identities = 64/125 (51%), Positives = 84/125 (67%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK+SVA V+L+PG G+I IN R  ++Y   N   +  ++ PL+      ++D+FV V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPR+KERKKYGL  AR++ QF+KR
  S:    11 YWGTGRRKTSVARVRLIPGNGQIKINGRSGDDYLNFNPSHLNSVKAPLLTLGLENSYDIFVNVFGGGLTGQADAIKQGAARALCGLSPDNRKPLKTEGHLSRDPRSKERKKYGLKKARKAGQFSKR 136
>gi|114773864|ref|ZP_01450823.1| 30S ribosomal subunit protein S9 [alpha proteobacterium HTCC2255] (130 aa)
Score = 278, Expect = 1.3e-23, Identities = 62/130 (47%), Positives = 85/130 (65%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++ +Y G GRRKSS A V L PGTG I+IN+R  + +F        + QPL + +  + FD++V V GGG +GQAGAIR GI RAL+  +   R +L+ +  +TRD R  ERKK GL+ AR+ PQF+KR
  S:     1 MADTQYYGTGRRKSSTARVFLRPGTGNIVINKRPIDVFFGRETARMIVRQPLELVEMTEKFDLYVTVSGGGISGQAGAIRHGITRALMEFDETLRPSLRQAGFVTRDARKVERKKVGLHKARKRPQFSKR 130
>gi|113953485|ref|YP_729640.1| 30S ribosomal protein S9 [Synechococcus sp. CC9311] >gi|123327987|sp|Q0ID32|RS9_SYNS3 30S ribosomal protein S9 >gi|113880836|gb|ABI45794.1| ribosomal protein S9 [Synechococcus sp. CC9311] (135 aa)
Score = 278, Expect = 1.3e-23, Identities = 67/129 (51%), Positives = 82/129 (63%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRK+SVA V+LVPG G I IN R  + Y   N   +  ++ PL        +DV V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     6 NTVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYLAAVKAPLQTLGLSTEYDVLVNVRGGGLTGQADAIKQGAARALCELSVDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|77957462|ref|ZP_00821517.1| COG0103: Ribosomal protein S9 [Yersinia bercovieri ATCC 43970] >gi|77963494|ref|ZP_00827303.1| COG0103: Ribosomal protein S9 [Yersinia mollaretii ATCC 43969] >gi|77973393|ref|ZP_00828941.1| COG0103: Ribosomal protein S9 [Yersinia frederiksenii ATCC 33641] >gi|77977070|ref|ZP_00832530.1| COG0103: Ribosomal protein S9 [Yersinia intermedia ATCC 29909] (132 aa)
Score = 278, Expect = 1.3e-23, Identities = 65/130 (50%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V L PG+GKI+INQR    YF        + QPL + D    FD+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     3 MAENQYYGTGRRKSSAARVFLKPGSGKIVINQRSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFVTRDAREVERKKVGLRKARRRPQFSKR 132
>gi|152996421|ref|YP_001341256.1| ribosomal protein S9 [Marinomonas sp. MWYL1] >gi|189045702|sp|A6VXZ2|RS9_MARMS 30S ribosomal protein S9 >gi|150837345|gb|ABR71321.1| ribosomal protein S9 [Marinomonas sp. MWYL1] (130 aa)
Score = 278, Expect = 1.3e-23, Identities = 63/130 (48%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK+S A V L  G+G ++IN R  ++YF        + QPL + D  + FDV++ V GGG +GQAGAIR GI RAL+  +   R+TL+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MSATQYYGTGRRKTSTARVFLKAGSGNLVINNRSIDQYFGRETARMVVRQPLELVDATEKFDVYITVKGGGISGQAGAIRHGITRALMQYDETLRRTLRSAGFVTRDSREVERKKVGLRKARRRPQFSKR 130
>gi|156973202|ref|YP_001444109.1| 30S ribosomal protein S9 [Vibrio harveyi ATCC BAA-1116] >gi|166229619|sp|A7MWN0|RS9_VIBHB 30S ribosomal protein S9 >gi|156524796|gb|ABU69882.1| hypothetical protein VIBHAR_00882 [Vibrio harveyi ATCC BAA-1116] (130 aa)
Score = 278, Expect = 1.4e-23, Identities = 63/130 (48%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I+IN+R  +EYF        ++QPL + +  +  D++V V GGG +GQAGAIR GI RAL+  +   R TL+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGNIVINKRSLDEYFGRPTSRMVVKQPLELVELTEKLDLYVTVKGGGISGQAGAIRHGITRALMEYDESLRPTLRAAGYVTRDARCVERKKVGLRKARRRPQFSKR 130
>gi|148238743|ref|YP_001224130.1| 30S ribosomal protein S9 [Synechococcus sp. WH 7803] >gi|147847282|emb|CAK22833.1| 30S ribosomal protein S9 [Synechococcus sp. WH 7803] (134 aa)
Score = 278, Expect = 1.4e-23, Identities = 67/129 (51%), Positives = 82/129 (63%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++V Y G GRRK+SVA V+LVPG G I IN R  + Y   N   +  +  PL        +DV V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     5 NSVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYLAAVRAPLQTLGLLTEYDVLVNVRGGGLTGQADAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 134
>gi|118483304|gb|ABK93554.1| unknown [Populus trichocarpa] (210 aa)
Score = 278, Expect = 1.5e-23, Identities = 65/123 (52%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK ++A V L  GTGK++IN R   EY   N L +Q ++ PLV      ++DVFVK  GGG  GQA AI LG+ARALL  + D R  LK   +LTRD R  ERKK GL  AR++PQF+KR
  S:    87 GTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYESSYDVFVKAHGGGLAGQAQAISLGVARALLKVSQDHRIPLKREGLLTRDSRIVERKKVGLKKARKAPQFSKR 210
>gi|67156165|ref|ZP_00417791.1| Ribosomal protein S9 [Azotobacter vinelandii AvOP] >gi|67086495|gb|EAM05964.1| Ribosomal protein S9 [Azotobacter vinelandii AvOP] (130 aa)
Score = 278, Expect = 1.5e-23, Identities = 63/130 (48%), Positives = 85/130 (65%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTGKI IN R   ++F        + QPL +T+T + FD++V V+GGG +GQAGAIR GI RAL+  +  FR +L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGKISINNRSLEQFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALIEYDETFRSSLRHAGYVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|184200293|ref|YP_001854500.1| 30S ribosomal protein S9 [Kocuria rhizophila DC2201] >gi|183580523|dbj|BAG28994.1| 30S ribosomal protein S9 [Kocuria rhizophila DC2201] (167 aa)
Score = 278, Expect = 1.6e-23, Identities = 59/124 (47%), Positives = 84/124 (67%)
  Q:     7 KGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDF-RKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + +GRRK ++A V+LVPG+GK  +N R   EYFPN L  Q++  P  + + +  +DV  ++ GGG +GQAGA+RLG+ARAL   + +  R  LK +  LTRD R  ERKK GL  AR++PQ++KR
  S:    43 QAVGRRKQAIARVRLVPGSGKWTVNGRSLEEYFPNKLHQQEVNDPFTLLELQGGYDVIARISGGGPSGQAGALRLGVARALNEIDAEHNRPALKKAGFLTRDARVIERKKAGLKKARKAPQYSKR 167
>gi|125718823|ref|YP_001035956.1| 30S ribosomal protein S9 [Streptococcus sanguinis SK36] >gi|166229615|sp|A3CQF1|RS9_STRSV 30S ribosomal protein S9 >gi|125498740|gb|ABN45406.1| 30S ribosomal protein S9, putative [Streptococcus sanguinis SK36] (130 aa)
Score = 277, Expect = 1.6e-23, Identities = 72/130 (55%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T  ++DVFV VVGGG+ GQAGAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTAGSYDVFVNVVGGGYAGQAGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130
>gi|52842912|ref|YP_096711.1| 30S ribosomal protein S9 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54295547|ref|YP_127962.1| 30S ribosomal protein S9 [Legionella pneumophila str. Lens] >gi|54298697|ref|YP_125066.1| 30S ribosomal protein S9 [Legionella pneumophila str. Paris] >gi|148358557|ref|YP_001249764.1| 30S ribosomal protein S9 [Legionella pneumophila str. Corby] >gi|52630023|gb|AAU28764.1| 30S ribosomal protein S9 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53752482|emb|CAH13914.1| 30S ribosomal subunit protein S9 [Legionella pneumophila str. Paris] >gi|53755379|emb|CAH16875.1| 30S ribosomal subunit protein S9 [Legionella pneumophila str. Lens] >gi|148280330|gb|ABQ54418.1| 30S ribosomal protein S9 [Legionella pneumophila str. Corby] (143 aa)
Score = 277, Expect = 1.7e-23, Identities = 65/126 (51%), Positives = 82/126 (65%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND------------FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKSS+A V L PG G I +N R   EYF        + QPL   D    FDV++ V GGG +GQAGA+RLGIARAL+  + D            FR+ L+   +LTRD R  ERKK GL+ ARR+ Q++KR
  S:     6 QYYGTGRRKSSIARVFLRPGKGDIKVNDRTLQEYFCRETSCMIVMQPLETVDLLNKFDVYITVTGGGISGQAGAVRLGIARALVAYDEDGLAEGAEPSPDSFRRKLRARGLLTRDSRRVERKKVGLHKARRATQYSKR 143
>gi|123443923|ref|YP_001007894.1| 30S ribosomal protein S9 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166229620|sp|A1JR92|RS9_YERE8 30S ribosomal protein S9 >gi|122090884|emb|CAL13766.1| 30S ribosomal protein S9 [Yersinia enterocolitica subsp. enterocolitica 8081] (130 aa)
Score = 277, Expect = 1.7e-23, Identities = 65/130 (50%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V L PG+GKI+INQR    YF        + QPL + D    FD+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFLKPGSGKIVINQRSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFVTRDAREVERKKVGLRKARRRPQFSKR 130
>gi|15222063|ref|NP_177635.1| RPS9 (RIBOSOMAL PROTEIN S9); structural constituent of ribosome [Arabidopsis thaliana] >gi|48428563|sp|Q9XJ27|RR9_ARATH 30S ribosomal protein S9, chloroplast precursor >gi|5882726|gb|AAD55279.1|AC008263_10 Identical to gb|AB022676 ribosomal protein S9 from Arabidopsis thaliana. ESTs gb|T13861, gb|AA389790, gb|T42539, gb|AA586013, gb|AA395093 and gb|AA041154 come from this gene >gi|12744979|gb|AAK06869.1|AF344318_1 putative ribosomal protein S9 [Arabidopsis thaliana] >gi|5456946|dbj|BAA82396.1| ribosomal protein S9 [Arabidopsis thaliana] >gi|15010598|gb|AAK73958.1| ATg74970/F25A4.6 [Arabidopsis thaliana] >gi|15027999|gb|AAK76530.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|20259211|gb|AAM14321.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|21554316|gb|AAM63421.1| ribosomal protein S9, putative [Arabidopsis thaliana] >gi|51968396|dbj|BAD42890.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51969144|dbj|BAD43264.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51969266|dbj|BAD43325.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51969626|dbj|BAD43505.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51969796|dbj|BAD43590.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51969932|dbj|BAD43658.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51970078|dbj|BAD43731.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51970878|dbj|BAD44131.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51971589|dbj|BAD44459.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51971705|dbj|BAD44517.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51971713|dbj|BAD44521.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51971743|dbj|BAD44536.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51971777|dbj|BAD44553.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51971791|dbj|BAD44560.1| putative ribosomal protein S9 [Arabidopsis thaliana] >gi|51971913|dbj|BAD44621.1| putative ribosomal protein S9 [Arabidopsis thaliana] (208 aa)
Score = 277, Expect = 1.7e-23, Identities = 64/123 (52%), Positives = 81/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK ++A V L  GTGK++IN R   EY   N L +Q ++ PLV      ++D+FVK  GGG +GQA AI LG+ARALL  + D R  LK   +LTRD R  ERKK GL  AR++PQF+KR
  S:    85 GTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYENSYDIFVKAHGGGLSGQAQAITLGVARALLKVSADHRSPLKKEGLLTRDARVVERKKAGLKKARKAPQFSKR 208
>gi|94985835|ref|YP_605199.1| 30S ribosomal protein S9 [Deinococcus geothermalis DSM 11300] >gi|94556116|gb|ABF46030.1| ribosomal protein S9 [Deinococcus geothermalis DSM 11300] (131 aa)
Score = 277, Expect = 1.7e-23, Identities = 66/126 (52%), Positives = 82/126 (65%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++ G GRRK++VA V L PG G+IL+N ++   YF   L      Q    T T   +D ++ V GGG +GQA AI+LGIARALL  N DFR  LK   +LTRDPR  ERKKYGL  ARR+PQF+KR
  S:     6 QFYGTGRRKAAVARVFLRPGEGRILVNGKEFQTYFRGLLRAVHALQGFRETGTAGRYDAYITVTGGGPSGQADAIKLGIARALLKVNPDFRAQLKPRGLLTRDPREVERKKYGLKKARRAPQFSKR 131
>gi|87120442|ref|ZP_01076336.1| ribosomal protein S9 [Marinomonas sp. MED121] >gi|86164085|gb|EAQ65356.1| ribosomal protein S9 [Marinomonas sp. MED121] (130 aa)
Score = 277, Expect = 1.8e-23, Identities = 64/130 (49%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRKSS A V L  GTG ++IN R   +YF        + QPL + +  + FDV++ V GGG +GQAGAIR GI RALL  +   R++L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MSATQYYGTGRRKSSTARVFLKAGTGNLVINDRTIEQYFGRETARMVVRQPLELVEATEKFDVYITVKGGGISGQAGAIRHGITRALLQYDETLRRSLRTAGYVTRDSREVERKKVGLRKARRRPQFSKR 130
>gi|86140803|ref|ZP_01059362.1| 30S ribosomal protein S9 [Flavobacterium sp. MED217] >gi|85832745|gb|EAQ51194.1| 30S ribosomal protein S9 [Leeuwenhoekiella blandensis MED217] (128 aa)
Score = 277, Expect = 1.9e-23, Identities = 61/122 (50%), Positives = 82/122 (67%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V L PG+G I +N+R+ N YF    +   + QPLV+T+  KNFDV V V GGG TGQA A+RL ++RA+   + + R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYLAPGSGNITVNKRELNNYFTTGTLQYKVNQPLVMTENDKNFDVKVNVYGGGITGQAEAVRLALSRAMCEVDAENRLILKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|170780771|ref|YP_001709103.1| 30S ribosomal protein S9 [Clavibacter michiganensis subsp. sepedonicus] >gi|189045691|sp|B0RB77|RS9_CLAMS 30S ribosomal protein S9 >gi|169155339|emb|CAQ00442.1| 30S ribosomal protein S9 [Clavibacter michiganensis subsp. sepedonicus] (161 aa)
Score = 277, Expect = 1.9e-23, Identities = 63/128 (49%), Positives = 85/128 (66%)
  Q:     3 NVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARAL-LVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           NV    +GRRK + A V+LVPG+G I +N R+  +YFPN L  Q +  P  + D   ++DV  ++ GGG +GQAGA+RLGIARAL  +   + R  LK +  L+RD R KERKK GL  AR++PQF+KR
  S:    33 NVSGGAVGRRKQATARVRLVPGSGSITVNGREFADYFPNKLHQQLVNDPFKVLDLLGSYDVVARISGGGPSGQAGALRLGIARALNEIDEENNRAVLKKNGFLSRDARVKERKKAGLKKARKAPQFSKR 161
>gi|167400546|ref|ZP_02306055.1| ribosomal protein S9 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|21956800|gb|AAM83727.1|AE013614_1 30S ribosomal subunit protein S9 [Yersinia pestis KIM] >gi|45438417|gb|AAS63964.1| 30S ribosomal subunit protein S9 [Yersinia pestis biovar Microtus str. 91001] >gi|167049914|gb|EDR61322.1| ribosomal protein S9 [Yersinia pestis biovar Antiqua str. UG05-0454] (132 aa)
Score = 277, Expect = 2.0e-23, Identities = 65/130 (50%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V L PG+GKI+INQR    YF        + QPL + D    FD+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     3 MAENQYYGTGRRKSSSARVFLKPGSGKIVINQRSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFVTRDAREVERKKVGLRKARRRPQFSKR 132
>gi|157372581|ref|YP_001480570.1| 30S ribosomal protein S9 [Serratia proteamaculans 568] >gi|167012630|sp|A8GK02|RS9_SERP5 30S ribosomal protein S9 >gi|157324345|gb|ABV43442.1| ribosomal protein S9 [Serratia proteamaculans 568] (130 aa)
Score = 277, Expect = 2.1e-23, Identities = 64/130 (49%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I+INQR   +YF        + QPL +TD    FD+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGNIVINQRSLEQYFGRETARMVVRQPLELTDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYDETLRGELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|62424145|ref|ZP_00379295.1| COG0103: Ribosomal protein S9 [Brevibacterium linens BL2] (171 aa)
Score = 277, Expect = 2.1e-23, Identities = 62/123 (50%), Positives = 82/123 (66%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARAL-LVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+GRRK ++A V+L+PG+G+  IN R   EYFPN L  Q + +P  + D    FDV V++ GGG +GQAGA+RLGIAR+L  +     R  LK +  L RD R  ERKK GL  AR++PQF+KR
  S:    48 GVGRRKQAIARVRLIPGSGEWTINGRTLEEYFPNKLHQQLVNEPFRLLDLEGRFDVVVRISGGGPSGQAGAVRLGIARSLNQIDEESNRAELKKAGYLRRDARVPERKKAGLKKARKAPQFSKR 171
>gi|196191117|gb|EDX86081.1| ribosomal protein S9 [Synechococcus sp. PCC 7335] (135 aa)
Score = 276, Expect = 2.4e-23, Identities = 63/125 (50%), Positives = 81/125 (64%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF-PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKSSVA V+LVPG G + IN++   +Y   N+  +   + PL        +D+ V V GGG TGQA +I+LG+ARAL + + D R  LK    LTRDPR KERKKYGL  AR++ QF+KR
  S:    10 YWGTGRRKSSVARVRLVPGNGTLTINKKAGEDYLQANAAYLTAAKAPLETLGLEGEYDILVNVRGGGLTGQADSIKLGVARALCMLDPDNRMPLKTEGYLTRDPRQKERKKYGLKKARKAGQFSKR 135
>gi|146321746|ref|YP_001201457.1| 30S ribosomal protein S9 [Streptococcus suis 98HAH33] >gi|166229614|sp|A4W3W8|RS9_STRS2 30S ribosomal protein S9 >gi|145692552|gb|ABP93057.1| 30S ribosomal protein S9 [Streptococcus suis 98HAH33] (130 aa)
Score = 276, Expect = 2.4e-23, Identities = 69/130 (53%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T+ ++DVFV V GGG+ GQ+GAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYTGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTQGSYDVFVNVNGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|16123706|ref|NP_407019.1| 30S ribosomal protein S9 [Yersinia pestis CO92] >gi|51597799|ref|YP_071990.1| 30S ribosomal protein S9 [Yersinia pseudotuberculosis IP 32953] >gi|108809732|ref|YP_653648.1| 30S ribosomal protein S9 [Yersinia pestis Antiqua] >gi|108813604|ref|YP_649371.1| 30S ribosomal protein S9 [Yersinia pestis Nepal516] >gi|145597651|ref|YP_001161727.1| 30S ribosomal protein S9 [Yersinia pestis Pestoides F] >gi|153950498|ref|YP_001399453.1| 30S ribosomal protein S9 [Yersinia pseudotuberculosis IP 31758] >gi|153997337|ref|ZP_02022437.1| 30S ribosomal protein S9 [Yersinia pestis CA88-4125] >gi|161484917|ref|NP_667476.2| 30S ribosomal protein S9 [Yersinia pestis KIM] >gi|161511292|ref|NP_995087.2| 30S ribosomal protein S9 [Yersinia pestis biovar Microtus str. 91001] >gi|162419232|ref|YP_001605679.1| 30S ribosomal protein S9 [Yersinia pestis Angola] >gi|165928118|ref|ZP_02223950.1| ribosomal protein S9 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937548|ref|ZP_02226111.1| ribosomal protein S9 [Yersinia pestis biovar Orientalis str. IP275] >gi|166011393|ref|ZP_02232291.1| ribosomal protein S9 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212154|ref|ZP_02238189.1| ribosomal protein S9 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167420733|ref|ZP_02312486.1| ribosomal protein S9 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426973|ref|ZP_02318726.1| ribosomal protein S9 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170022776|ref|YP_001719281.1| ribosomal protein S9 [Yersinia pseudotuberculosis YPIII] >gi|186896990|ref|YP_001874102.1| ribosomal protein S9 [Yersinia pseudotuberculosis PB1/+] >gi|81691656|sp|Q665L0|RS9_YERPS 30S ribosomal protein S9 >gi|122979311|sp|Q1C1G9|RS9_YERPA 30S ribosomal protein S9 >gi|123372900|sp|Q1CE09|RS9_YERPN 30S ribosomal protein S9 >gi|166229621|sp|A4THJ2|RS9_YERPP 30S ribosomal protein S9 >gi|167012632|sp|A7FDX5|RS9_YERP3 30S ribosomal protein S9 >gi|20139889|sp|Q8ZB62|RS9_YERPE 30S ribosomal protein S9 >gi|51591081|emb|CAH22745.1| 30S ribosomal protein S9 [Yersinia pseudotuberculosis IP 32953] >gi|108777252|gb|ABG19771.1| SSU ribosomal protein S9P [Yersinia pestis Nepal516] >gi|108781645|gb|ABG15703.1| SSU ribosomal protein S9P [Yersinia pestis Antiqua] >gi|115349185|emb|CAL22150.1| 30S ribosomal protein S9 [Yersinia pestis CO92] >gi|145209347|gb|ABP38754.1| SSU ribosomal protein S9P [Yersinia pestis Pestoides F] >gi|149288974|gb|EDM39054.1| 30S ribosomal protein S9 [Yersinia pestis CA88-4125] >gi|152961993|gb|ABS49454.1| ribosomal protein S9 [Yersinia pseudotuberculosis IP 31758] >gi|162352047|gb|ABX85995.1| ribosomal protein S9 [Yersinia pestis Angola] >gi|165914653|gb|EDR33267.1| ribosomal protein S9 [Yersinia pestis biovar Orientalis str. IP275] >gi|165919892|gb|EDR37193.1| ribosomal protein S9 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989777|gb|EDR42078.1| ribosomal protein S9 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206900|gb|EDR51380.1| ribosomal protein S9 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961539|gb|EDR57560.1| ribosomal protein S9 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167054013|gb|EDR63841.1| ribosomal protein S9 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749310|gb|ACA66828.1| ribosomal protein S9 [Yersinia pseudotuberculosis YPIII] >gi|186700016|gb|ACC90645.1| ribosomal protein S9 [Yersinia pseudotuberculosis PB1/+] (130 aa)
Score = 276, Expect = 2.5e-23, Identities = 65/130 (50%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V L PG+GKI+INQR    YF        + QPL + D    FD+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSSARVFLKPGSGKIVINQRSLEVYFGRETARMVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFVTRDAREVERKKVGLRKARRRPQFSKR 130
>gi|171912632|ref|ZP_02928102.1| ribosomal protein S9 [Verrucomicrobium spinosum DSM 4136] (130 aa)
Score = 276, Expect = 2.5e-23, Identities = 62/130 (47%), Positives = 87/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS   +   GRRK++VA + L  G+G I +N R  ++YFP   +   +  PL +T++ +++D+ V+  GGG TGQ GAIR+GIARAL++AN + R  LK + MLTRD R KERKK G  GAR+  QF+KR
  S:     1 MSTTSFDATGRRKNAVARIHLKNGSGTITVNGRPLDDYFPTVSLQNQLLAPLQLTNSAQSYDINVRADGGGVTGQMGAIRMGIARALILANAENRGVLKQNGMLTRDSRMKERKKPGRPGARKRFQFSKR 130
>gi|15640593|ref|NP_230222.1| 30S ribosomal protein S9 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121730042|ref|ZP_01682452.1| ribosomal protein S9 [Vibrio cholerae V52] >gi|147673670|ref|YP_001216069.1| 30S ribosomal protein S9 [Vibrio cholerae O395] >gi|153216760|ref|ZP_01950600.1| ribosomal protein S9 [Vibrio cholerae 1587] >gi|153224125|ref|ZP_01954230.1| ribosomal protein S9 [Vibrio cholerae MAK 757] >gi|153820431|ref|ZP_01973098.1| ribosomal protein S9 [Vibrio cholerae NCTC 8457] >gi|153824141|ref|ZP_01976808.1| ribosomal protein S9 [Vibrio cholerae B33] >gi|153827394|ref|ZP_01980061.1| ribosomal protein S9 [Vibrio cholerae MZO-2] >gi|153830234|ref|ZP_01982901.1| ribosomal protein S9 [Vibrio cholerae 623-39] >gi|194531100|ref|YP_002066616.1| ribosomal protein S9 [Vibrio cholerae MO10] >gi|172047725|sp|A5F998|RS9_VIBC3 30S ribosomal protein S9 >gi|20139941|sp|Q9KUF0|RS9_VIBCH 30S ribosomal protein S9 >gi|9655001|gb|AAF93739.1| ribosomal protein S9 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121628210|gb|EAX60732.1| ribosomal protein S9 [Vibrio cholerae V52] >gi|124114148|gb|EAY32968.1| ribosomal protein S9 [Vibrio cholerae 1587] >gi|124117823|gb|EAY36566.1| ribosomal protein S9 [Vibrio cholerae MAK 757] >gi|125617268|gb|EAZ45844.1| ribosomal protein S9 [Vibrio cholerae MO10] >gi|126509025|gb|EAZ71619.1| ribosomal protein S9 [Vibrio cholerae NCTC 8457] >gi|126518335|gb|EAZ75558.1| ribosomal protein S9 [Vibrio cholerae B33] >gi|146315553|gb|ABQ20092.1| ribosomal protein S9 [Vibrio cholerae O395] >gi|148874294|gb|EDL72429.1| ribosomal protein S9 [Vibrio cholerae 623-39] >gi|149738697|gb|EDM53039.1| ribosomal protein S9 [Vibrio cholerae MZO-2] >gi|150422851|gb|EDN14803.1| ribosomal protein S9 [Vibrio cholerae AM-19226] (130 aa)
Score = 276, Expect = 2.7e-23, Identities = 62/130 (47%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I+IN+R   EYF        ++QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGNIVINKRSLEEYFGRPTSCMVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRPVLRAAGYVTRDARRVERKKVGLRKARRRPQFSKR 130
>gi|11465757|ref|NP_053901.1| ribosomal protein S9 [Porphyra purpurea] >gi|1710710|sp|P51291|RR9_PORPU Chloroplast 30S ribosomal protein S9 >gi|1276757|gb|AAC08177.1| 30S ribosomal protein S9 [Porphyra purpurea] (137 aa)
Score = 276, Expect = 2.7e-23, Identities = 65/125 (52%), Positives = 79/125 (63%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK SVA V+LVPG+G ++IN      Y    PN L +     PL +      +D+ V   GGG TGQA AIRLG+ARAL   N + R  LK    LTRDP+ KERKKYGL  AR++PQF+KR
  S:    12 YSGTGRRKCSVAQVRLVPGSGNLVINGIPGESYLQFSPNYLRVS--YAPLQVLGLLNQYDIHVNARGGGLTGQADAIRLGVARALCSINPENRSALKSEGYLTRDPKVKERKKYGLKKARKAPQFSKR 137
>gi|163840481|ref|YP_001624886.1| SSU ribosomal protein S9P [Renibacterium salmoninarum ATCC 33209] >gi|162953957|gb|ABY23472.1| SSU ribosomal protein S9P [Renibacterium salmoninarum ATCC 33209] (167 aa)
Score = 275, Expect = 2.8e-23, Identities = 62/123 (50%), Positives = 86/123 (69%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALL---VANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK ++A V++ PGTGK ++N R+  +YFPN L  Q++ +P  I D    +DV  ++ GGG +GQAGA+RLG+AR+L    V NN  R TLK +  LTRD R  ERKK GL  AR++PQ++KR
  S:    44 AVGRRKEAIARVRVTPGTGKWIVNGRELADYFPNKLHQQEVNEPFKILDLDGAYDVAARISGGGPSGQAGALRLGVARSLNEIDVDNN--RATLKKAGFLTRDARVIERKKAGLKKARKAPQYSKR 167
>gi|91228494|ref|ZP_01262416.1| 30S ribosomal protein S9 [Vibrio alginolyticus 12G01] >gi|91187928|gb|EAS74238.1| 30S ribosomal protein S9 [Vibrio alginolyticus 12G01] (130 aa)
Score = 275, Expect = 2.8e-23, Identities = 61/130 (46%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I++N+R  +EYF        ++QPL + +  +  D++V V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGNIVVNKRNLDEYFGRPTARMVVQQPLELVELTEKLDLYVTVKGGGISGQAGAIRHGITRALMEYDESLRPALRAAGYVTRDARCVERKKVGLRKARRRPQFSKR 130
>gi|51971475|dbj|BAD44402.1| putative ribosomal protein S9 [Arabidopsis thaliana] (208 aa)
Score = 275, Expect = 3.0e-23, Identities = 63/123 (51%), Positives = 81/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK ++A V L  GTGK++IN R   EY   N L +Q ++ PLV      ++D+F+K  GGG +GQA AI LG+ARALL  + D R  LK   +LTRD R  ERKK GL  AR++PQF+KR
  S:    85 GTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYENSYDIFMKAHGGGLSGQAQAITLGVARALLKVSADHRSPLKKEGLLTRDARVVERKKAGLKKARKAPQFSKR 208
>gi|146313299|ref|YP_001178373.1| 30S ribosomal protein S9 [Enterobacter sp. 638] >gi|167012623|sp|A4WF42|RS9_ENT38 30S ribosomal protein S9 >gi|145320175|gb|ABP62322.1| SSU ribosomal protein S9P [Enterobacter sp. 638] (130 aa)
Score = 275, Expect = 3.1e-23, Identities = 63/130 (48%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|86131447|ref|ZP_01050045.1| ribosomal protein S9 [Cellulophaga sp. MED134] >gi|85817892|gb|EAQ39060.1| ribosomal protein S9 [Dokdonia donghaensis MED134] (128 aa)
Score = 275, Expect = 3.3e-23, Identities = 60/122 (49%), Positives = 81/122 (66%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V L  G GKI +N+++ N YFP   +   + QPLV+T+   NFD+ V V GGG TGQA AIRL ++RA+   + + R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYLTEGEGKITVNKKELNNYFPTGTLQYKVNQPLVLTNNEGNFDINVNVYGGGITGQAEAIRLALSRAMCELDEENRLILKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|156319654|ref|XP_001618145.1| hypothetical protein NEMVEDRAFT_v1g155616 [Nematostella vectensis] >gi|156197661|gb|EDO26045.1| predicted protein [Nematostella vectensis] (130 aa)
Score = 275, Expect = 3.5e-23, Identities = 64/125 (51%), Positives = 79/125 (63%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKSSVA V L  G+GKI++N R   EYF        + QPL +T+   +FD+ V V GGG +GQAGAI+ GI RAL+  N D + TL  +  +TRD R  ERKK GL  ARR  QF+KR
  S:     6 YYGTGRRKSSVARVXLAKGSGKIIVNDRDFEEYFSRPTNCMIVRQPLTLTEHLDSFDIKVNVHGGGESGQAGAIKHGITRALIDFNADLKPTLSKAGFVTRDAREVERKKCGLRKARRRKQFSKR 130
>gi|108762003|ref|YP_630229.1| ribosomal protein S9 [Myxococcus xanthus DK 1622] >gi|108465883|gb|ABF91068.1| ribosomal protein S9 [Myxococcus xanthus DK 1622] (133 aa)
Score = 275, Expect = 3.5e-23, Identities = 66/125 (52%), Positives = 78/125 (62%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +   GRRK + A V + PGTG + IN R+ NEYF        + QPL I + +   DV V V GGG +GQAGAIR GIARAL   N +FR  LK +  LTRD RA ERKKYG  GARR  QF+KR
  S:     9 FYATGRRKEATARVWIRPGTGLVTINGRELNEYFGRETSKMILNQPLEILEQKGKVDVTVNVKGGGLSGQAGAIRHGIARALCSFNPEFRPALKKAGFLTRDARAVERKKYGQPGARRRFQFSKR 133
>gi|111023134|ref|YP_706106.1| 30S ribosomal protein S9 [Rhodococcus sp. RHA1] >gi|110822664|gb|ABG97948.1| 30S ribosomal protein S9 [Rhodococcus sp. RHA1] (178 aa)
Score = 275, Expect = 3.5e-23, Identities = 58/122 (47%), Positives = 81/122 (66%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+L PG+G   +N R   +YFPN +  Q ++ PLV  +  ++FD+   + GGG +GQAGA+RL IARAL+    + R  LK +  LTRD RA ERKKYGL  AR++ Q++KR
  S:    57 VGRRKEAVVRVRLTPGSGDFKLNGRTIEDYFPNKVHQQLIKAPLVTVERAESFDIVALLHGGGPSGQAGALRLAIARALIEVTPEDRPALKSAGFLTRDARAVERKKYGLKKARKASQYSKR 178
>gi|156935746|ref|YP_001439662.1| 30S ribosomal protein S9 [Enterobacter sakazakii ATCC BAA-894] >gi|156534000|gb|ABU78826.1| hypothetical protein ESA_03616 [Enterobacter sakazakii ATCC BAA-894] (132 aa)
Score = 274, Expect = 3.8e-23, Identities = 63/130 (48%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     3 MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 132
>gi|87300886|ref|ZP_01083728.1| 30S ribosomal protein S9 [Synechococcus sp. WH 5701] >gi|87284757|gb|EAQ76709.1| 30S ribosomal protein S9 [Synechococcus sp. WH 5701] (135 aa)
Score = 274, Expect = 4.0e-23, Identities = 65/129 (50%), Positives = 83/129 (64%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRK++VA V++VPGTG I IN R  + Y   N   +  ++ PL        +D+ V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     6 NRVVYWGTGRRKTAVARVRVVPGTGSITINGRPGDNYLNYNPSYLSAVKAPLDTLGLSAEYDLLVNVKGGGLTGQADAIKQGAARALCELSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|149197647|ref|ZP_01874697.1| SSU ribosomal protein S9P [Lentisphaera araneosa HTCC2155] >gi|149139217|gb|EDM27620.1| SSU ribosomal protein S9P [Lentisphaera araneosa HTCC2155] (130 aa)
Score = 274, Expect = 4.0e-23, Identities = 64/130 (49%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  E  G GRRKS+VA VKL  G+G I +N++K  +YFP   +   + QP+ +T T   FD+ + V GGG  GQAGA+R GIARA+L  +   R  LK S +LTR+ R KER+K G  GAR+  QF+KR
  S:     1 MSKEEIWGTGRRKSAVARVKLTKGSGVITVNKQKLEDYFPQEQLRNYLAQPIQVTGTEGQFDLLINVNGGGKVGQAGALRHGIARAILAYDESARPVLKQSGLLTRNARVKERQKPGQPGARKRFQFSKR 130
>gi|109900003|ref|YP_663258.1| ribosomal protein S9 [Pseudoalteromonas atlantica T6c] >gi|123170642|sp|Q15PI4|RS9_PSEA6 30S ribosomal protein S9 >gi|109702284|gb|ABG42204.1| SSU ribosomal protein S9P [Pseudoalteromonas atlantica T6c] (130 aa)
Score = 274, Expect = 4.1e-23, Identities = 60/130 (46%), Positives = 85/130 (65%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++ +Y G GRRKSS A V L  G+G I++N+R  +E+F        + QPL + +  + FD++V V GGG +GQAGAIR GI RAL+  +   R +L+ +  +TRD R  ERKK GL+ AR+ PQF+KR
  S:     1 MADTQYYGTGRRKSSTARVFLRAGSGNIVVNKRPLDEFFGRETARMIVRQPLELVEMTEKFDLYVTVAGGGISGQAGAIRHGITRALMEFDETLRPSLRKAGFVTRDARKVERKKVGLHKARKRPQFSKR 130
>gi|51969174|dbj|BAD43279.1| putative ribosomal protein S9 [Arabidopsis thaliana] (208 aa)
Score = 274, Expect = 4.2e-23, Identities = 63/123 (51%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK ++A V L  GTGK++IN R   EY   N L +Q ++ PLV      ++D+FVK  GGG +GQA AI  G+ARALL  + D R  LK   +LTRD R  ERKK GL  AR++PQF+KR
  S:    85 GTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYENSYDIFVKAHGGGLSGQAQAITFGVARALLKVSADHRSPLKKEGLLTRDARVVERKKAGLKKARKAPQFSKR 208
>gi|119963208|ref|YP_948613.1| ribosomal protein S9 [Arthrobacter aurescens TC1] >gi|166228550|sp|A1R8Q1|RS9_ARTAT 30S ribosomal protein S9 >gi|119950067|gb|ABM08978.1| ribosomal protein S9 [Arthrobacter aurescens TC1] (168 aa)
Score = 274, Expect = 4.4e-23, Identities = 63/123 (51%), Positives = 84/123 (68%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALL---VANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK +VA V++VPG+GK  IN R  + YFPN L  QD+ +P  I D    +DV  ++ GGG +GQAGA+RLG+AR+L    V NN  R TLK +  L+RD R  ERKK GL  AR++ Q++KR
  S:    45 AVGRRKEAVARVRVVPGSGKWTINGRTLDNYFPNKLHQQDVNEPFKILDLEGAYDVIARIHGGGISGQAGALRLGVARSLNEIDVDNN--RATLKKAGYLSRDARVIERKKAGLKKARKAQQYSKR 168
>gi|117923563|ref|YP_864180.1| SSU ribosomal protein S9P [Magnetococcus sp. MC-1] >gi|166229569|sp|A0L481|RS9_MAGSM 30S ribosomal protein S9 >gi|117607319|gb|ABK42774.1| SSU ribosomal protein S9P [Magnetococcus sp. MC-1] (130 aa)
Score = 274, Expect = 4.4e-23, Identities = 60/130 (46%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   +   G+RK SVA V++VPG+GK+ INQ+  + YF   ++   + QP  +T+    FDV V V GGG +GQAGAI+ GI++AL+  +   R  LK +  LTRD R  ERKKYG + AR+S QF+KR
  S:     1 MAQETFNATGKRKESVARVRIVPGSGKVTINQKPMDVYFGRPVLRMVVNQPFSVTEMENKFDVLVNVHGGGVSGQAGAIKHGISKALVDYDEALRPALKKAGFLTRDARTVERKKYGRHKARKSTQFSKR 130
>gi|15803764|ref|NP_289798.1| 30S ribosomal protein S9 [Escherichia coli O157:H7 EDL933] >gi|15833357|ref|NP_312130.1| 30S ribosomal protein S9 [Escherichia coli O157:H7 str. Sakai] >gi|16131120|ref|NP_417697.1| 30S ribosomal subunit protein S9 [Escherichia coli str. K-12 substr. MG1655] >gi|26249810|ref|NP_755850.1| 30S ribosomal protein S9 [Escherichia coli CFT073] >gi|30064563|ref|NP_838734.1| 30S ribosomal protein S9 [Shigella flexneri 2a str. 2457T] >gi|82545541|ref|YP_409488.1| 30S ribosomal protein S9 [Shigella boydii Sb227] >gi|89109992|ref|AP_003772.1| 30S ribosomal subunit protein S9 [Escherichia coli W3110] >gi|91212649|ref|YP_542635.1| 30S ribosomal protein S9 [Escherichia coli UTI89] >gi|110643464|ref|YP_671194.1| 30S ribosomal protein S9 [Escherichia coli 536] >gi|110807092|ref|YP_690612.1| 30S ribosomal protein S9 [Shigella flexneri 5 str. 8401] >gi|117625514|ref|YP_858837.1| 30S ribosomal protein S9 [Escherichia coli APEC O1] >gi|152972143|ref|YP_001337289.1| 30S ribosomal protein S9 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|157148800|ref|YP_001456119.1| 30S ribosomal protein S9 [Citrobacter koseri ATCC BAA-895] >gi|157157775|ref|YP_001464703.1| 30S ribosomal protein S9 [Escherichia coli E24377A] >gi|157162708|ref|YP_001460026.1| 30S ribosomal protein S9 [Escherichia coli HS] >gi|168708804|ref|ZP_02741081.1| hypothetical protein EschericoliO157_14239 [Escherichia coli O157:H7 str. EC4045] >gi|168718045|ref|ZP_02750322.1| hypothetical protein EschericcoliO157_09857 [Escherichia coli O157:H7 str. EC4206] >gi|168734764|ref|ZP_02767041.1| hypothetical protein EschecoliO157_06910 [Escherichia coli O157:H7 str. EC4115] >gi|168751633|ref|ZP_02776655.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4113] >gi|168754209|ref|ZP_02779216.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4401] >gi|168763764|ref|ZP_02788771.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4501] >gi|168769083|ref|ZP_02794090.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4486] >gi|168777622|ref|ZP_02802629.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4196] >gi|168781371|ref|ZP_02806378.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4076] >gi|168786113|ref|ZP_02811120.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC869] >gi|168795863|ref|ZP_02820870.1| hypothetical protein EschercoliO157_27068 [Escherichia coli O157:H7 str. EC4042] >gi|168800940|ref|ZP_02825947.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC508] >gi|170018526|ref|YP_001723480.1| ribosomal protein S9 [Escherichia coli ATCC 8739] >gi|170082762|ref|YP_001732082.1| 30S ribosomal subunit protein S9 [Escherichia coli str. K12 substr. DH10B] >gi|170682792|ref|YP_001745502.1| ribosomal protein S9 [Escherichia coli SMS-3-5] >gi|170765747|ref|ZP_02900558.1| ribosomal protein S9 [Escherichia albertii TW07627] >gi|187732361|ref|YP_001881863.1| ribosomal protein S9 [Shigella boydii CDC 3083-94] >gi|188492908|ref|ZP_03000178.1| ribosomal protein S9 [Escherichia coli 53638] >gi|191168182|ref|ZP_03029978.1| ribosomal protein S9 [Escherichia coli B7A] >gi|191174417|ref|ZP_03035920.1| ribosomal protein S9 [Escherichia coli F11] >gi|193065386|ref|ZP_03046457.1| ribosomal protein S9 [Escherichia coli E22] >gi|193070301|ref|ZP_03051244.1| ribosomal protein S9 [Escherichia coli E110019] >gi|194429096|ref|ZP_03061626.1| ribosomal protein S9 [Escherichia coli B171] >gi|194434501|ref|ZP_03066761.1| ribosomal protein S9 [Shigella dysenteriae 1012] >gi|194439160|ref|ZP_03071241.1| ribosomal protein S9 [Escherichia coli 101-1] >gi|195939425|ref|ZP_03084807.1| 30S ribosomal protein S9 [Escherichia coli O157:H7 str. EC4024] >gi|67472279|sp|P0A7X3|RS9_ECOLI 30S ribosomal protein S9 >gi|122422260|sp|Q1R6B0|RS9_ECOUT 30S ribosomal protein S9 >gi|123047870|sp|Q0T058|RS9_SHIF8 30S ribosomal protein S9 >gi|123147638|sp|Q0TCN6|RS9_ECOL5 30S ribosomal protein S9 >gi|123558596|sp|Q31W98|RS9_SHIBS 30S ribosomal protein S9 >gi|166200249|sp|A8AQC0|RS9_CITK8 30S ribosomal protein S9 >gi|166229558|sp|A1AGC3|RS9_ECOK1 30S ribosomal protein S9 >gi|166229566|sp|A6TEN8|RS9_KLEP7 30S ribosomal protein S9 >gi|167012621|sp|A7ZSC4|RS9_ECO24 30S ribosomal protein S9 >gi|167012622|sp|A8A539|RS9_ECOHS 30S ribosomal protein S9 >gi|189045698|sp|B1IQP9|RS9_ECOLC 30S ribosomal protein S9 >gi|67472280|sp|P0A7X4|RS9_ECOL6 30S ribosomal protein S9 >gi|67472281|sp|P0A7X5|RS9_ECO57 30S ribosomal protein S9 >gi|116666556|pdb|1VS5|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666608|pdb|1VS7|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|12517851|gb|AAG58358.1|AE005551_1 30S ribosomal subunit protein S9 [Escherichia coli O157:H7 EDL933] >gi|26110238|gb|AAN82424.1|AE016767_184 30S ribosomal protein S9 [Escherichia coli CFT073] >gi|535073|emb|CAA26042.1| unnamed protein product [Escherichia coli] >gi|606169|gb|AAA58032.1| 30S ribosomal subunit protein S9 [Escherichia coli] >gi|1789625|gb|AAC76262.1| 30S ribosomal subunit protein S9 [Escherichia coli str. K-12 substr. MG1655] >gi|13363576|dbj|BAB37526.1| 30S ribosomal subunit protein S9 [Escherichia coli O157:H7 str. Sakai] >gi|30042822|gb|AAP18545.1| 30S ribosomal subunit protein S9 [Shigella flexneri 2a str. 2457T] >gi|81246952|gb|ABB67660.1| 30S ribosomal subunit protein S9 [Shigella boydii Sb227] >gi|85676023|dbj|BAE77273.1| 30S ribosomal subunit protein S9 [Escherichia coli W3110] >gi|91074223|gb|ABE09104.1| 30S ribosomal subunit protein S9 [Escherichia coli UTI89] >gi|110345056|gb|ABG71293.1| 30S ribosomal protein S9 [Escherichia coli 536] >gi|110616640|gb|ABF05307.1| 30S ribosomal subunit protein S9 [Shigella flexneri 5 str. 8401] >gi|115514638|gb|ABJ02713.1| 30S ribosomal subunit protein S9 [Escherichia coli APEC O1] >gi|150956992|gb|ABR79022.1| 30S ribosomal protein S9 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|157068388|gb|ABV07643.1| ribosomal protein S9 [Escherichia coli HS] >gi|157079805|gb|ABV19513.1| ribosomal protein S9 [Escherichia coli E24377A] >gi|157086005|gb|ABV15683.1| hypothetical protein CKO_04633 [Citrobacter koseri ATCC BAA-895] >gi|169753454|gb|ACA76153.1| ribosomal protein S9 [Escherichia coli ATCC 8739] >gi|169890597|gb|ACB04304.1| 30S ribosomal subunit protein S9 [Escherichia coli str. K12 substr. DH10B] >gi|170124893|gb|EDS93824.1| ribosomal protein S9 [Escherichia albertii TW07627] >gi|170520510|gb|ACB18688.1| ribosomal protein S9 [Escherichia coli SMS-3-5] >gi|187429353|gb|ACD08627.1| ribosomal protein S9 [Shigella boydii CDC 3083-94] >gi|187767171|gb|EDU31015.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4196] >gi|188014377|gb|EDU52499.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4113] >gi|188488107|gb|EDU63210.1| ribosomal protein S9 [Escherichia coli 53638] >gi|189001010|gb|EDU69996.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4076] >gi|189358473|gb|EDU76892.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4401] >gi|189361818|gb|EDU80237.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4486] >gi|189366143|gb|EDU84559.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC4501] >gi|189374168|gb|EDU92584.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC869] >gi|189376863|gb|EDU95279.1| ribosomal protein S9 [Escherichia coli O157:H7 str. EC508] >gi|190901790|gb|EDV61543.1| ribosomal protein S9 [Escherichia coli B7A] >gi|190905307|gb|EDV64943.1| ribosomal protein S9 [Escherichia coli F11] >gi|192927027|gb|EDV81650.1| ribosomal protein S9 [Escherichia coli E22] >gi|192956360|gb|EDV86820.1| ribosomal protein S9 [Escherichia coli E110019] >gi|194412821|gb|EDX29113.1| ribosomal protein S9 [Escherichia coli B171] >gi|194417280|gb|EDX33389.1| ribosomal protein S9 [Shigella dysenteriae 1012] >gi|194421856|gb|EDX37862.1| ribosomal protein S9 [Escherichia coli 101-1] (130 aa)
Score = 274, Expect = 4.6e-23, Identities = 63/130 (48%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|77919495|ref|YP_357310.1| 30S ribosomal protein S9 [Pelobacter carbinolicus DSM 2380] >gi|123573942|sp|Q3A3B7|RS9_PELCD 30S ribosomal protein S9 >gi|77545578|gb|ABA89140.1| SSU ribosomal protein S9P [Pelobacter carbinolicus DSM 2380] (130 aa)
Score = 273, Expect = 4.8e-23, Identities = 63/130 (48%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   +   G+RK+S+A V L PG G I +N+R  +EYF        + QPL +TD    FD+ V V GGG +GQAGAI+ GI +ALL A+ + R  LK +  +TRD RAKERKKYG  GAR   QF+KR
  S:     1 MAEQRFYATGKRKTSIARVWLKPGEGNITVNRRTLDEYFGRETSKMVIRQPLELTDNMGKFDIMVNVCGGGPSGQAGAIKHGITKALLEADPELRGVLKKAGFITRDSRAKERKKYGRKGARARFQFSKR 130
>gi|88803942|ref|ZP_01119462.1| 30S ribosomal protein S9 [Robiginitalea biformata HTCC2501] >gi|88784821|gb|EAR15990.1| 30S ribosomal protein S9 [Robiginitalea biformata HTCC2501] (128 aa)
Score = 273, Expect = 5.1e-23, Identities = 58/122 (47%), Positives = 80/122 (65%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V +  G G I +N++   EYFP + +   ++QP  +T+   N+DV V V GGG TGQA A+RL ++RAL   + + R TLK   +LTRDPR  ERKKYG   AR+  QF+KR
  S:     7 IGRRKTAVARVYVSQGNGSITVNKKDLAEYFPTATLQYKVKQPFTLTENENNYDVSVNVFGGGITGQAEAVRLALSRALCEIDEEHRATLKPEGLLTRDPRMVERKKYGQKKARKKFQFSKR 128
>gi|50119267|ref|YP_048434.1| 30S ribosomal protein S9 [Pectobacterium atrosepticum SCRI1043] >gi|81693455|sp|Q6DAE6|RS9_ERWCT 30S ribosomal protein S9 >gi|49609793|emb|CAG73227.1| 30S ribosomal protein S9 [Erwinia carotovora subsp. atroseptica SCRI1043] (130 aa)
Score = 273, Expect = 5.2e-23, Identities = 63/130 (48%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I+INQR   +YF        + QPL + D    FD+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGNIVINQRSLEQYFGRETARMVVRQPLELVDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|48428519|sp|P82278|RR9_SPIOL 30S ribosomal protein S9, chloroplast precursor >gi|188036210|pdb|3BBN|I Chain I, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. >gi|7578887|gb|AAF64170.1|AF242547_1 plastid ribosomal protein S9 precursor [Spinacia oleracea] (197 aa)
Score = 273, Expect = 5.2e-23, Identities = 64/123 (52%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK ++A V L  GTGK +IN R   EY   N L +Q ++ PL       N+DVFVK  GGG +GQA AI LG+ARALL  +   R  LK   +LTRD R  ERKK GL  AR++PQF+KR
  S:    74 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYVKTPLATLGYETNYDVFVKAHGGGLSGQAQAISLGVARALLKVSASHRAPLKQEGLLTRDSRIVERKKPGLKKARKAPQFSKR 197
>gi|82778538|ref|YP_404887.1| 30S ribosomal protein S9 [Shigella dysenteriae Sd197] >gi|123561489|sp|Q32BA9|RS9_SHIDS 30S ribosomal protein S9 >gi|81242686|gb|ABB63396.1| 30S ribosomal subunit protein S9 [Shigella dysenteriae Sd197] (130 aa)
Score = 273, Expect = 5.3e-23, Identities = 63/130 (48%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSTARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|86606115|ref|YP_474878.1| 30S ribosomal protein S9 [Synechococcus sp. JA-3-3Ab] >gi|123506464|sp|Q2JUJ9|RS9_SYNJA 30S ribosomal protein S9 >gi|86554657|gb|ABC99615.1| ribosomal protein S9 [Synechococcus sp. JA-3-3Ab] (137 aa)
Score = 273, Expect = 5.4e-23, Identities = 60/125 (48%), Positives = 83/125 (66%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRK++VA V+LVPGTGK++IN R  ++Y      ++  ++ PL +     ++D+ V+  GGG  GQA AI+LG+ARAL   +   R  LK    L RDPRA ERKKYGL  AR++PQ++KR
  S:    12 YWGTGRRKTAVARVRLVPGTGKLIINDRPGDQYLQYQEALLASVKAPLELLGLENSYDILVRAHGGGVHGQADAIKLGVARALCEVDPANRGPLKTEGYLKRDPRAVERKKYGLRKARKAPQYSKR 137
>gi|28897213|ref|NP_796818.1| 30S ribosomal protein S9 [Vibrio parahaemolyticus RIMD 2210633] >gi|153842052|ref|ZP_01993466.1| ribosomal protein S9 [Vibrio parahaemolyticus AQ3810] >gi|31340376|sp|Q87SI4|RS9_VIBPA 30S ribosomal protein S9 >gi|28805422|dbj|BAC58702.1| ribosomal protein S9 [Vibrio parahaemolyticus RIMD 2210633] >gi|149745418|gb|EDM56669.1| ribosomal protein S9 [Vibrio parahaemolyticus AQ3810] (130 aa)
Score = 272, Expect = 6.7e-23, Identities = 61/130 (46%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I++N+R  +EYF        ++QPL + +  +  D++V V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGNIVVNKRSLDEYFGRPTSRMVVKQPLELVELTEKLDLYVTVKGGGISGQAGAIRHGITRALMEYDESLRPALRAAGYVTRDARCVERKKVGLRKARRRPQFSKR 130
>gi|148243242|ref|YP_001228399.1| 30S ribosomal protein S9 [Synechococcus sp. RCC307] >gi|147851552|emb|CAK29046.1| 30S ribosomal protein S9 [Synechococcus sp. RCC307] (135 aa)
Score = 272, Expect = 7.1e-23, Identities = 66/127 (51%), Positives = 81/127 (63%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V Y G GRRK+SVA V++VPG G I IN R  + Y   N   +  +  PL      K +D+ V V GGG TGQA AI+ G ARAL   + D RK LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     8 VVYWGTGRRKTSVARVRVVPGDGTITINGRPGDNYLNYNPSYLNAVRAPLDTLGLSKEYDILVNVRGGGLTGQADAIKQGAARALCELSPDNRKPLKSEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|16762104|ref|NP_457721.1| 30S ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16766639|ref|NP_462254.1| 30S ribosomal protein S9 [Salmonella typhimurium LT2] >gi|29143593|ref|NP_806935.1| 30S ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415272|ref|YP_152347.1| 30S ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62181852|ref|YP_218269.1| 30S ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161506093|ref|YP_001573205.1| 30S ribosomal protein S9 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161616360|ref|YP_001590325.1| 30S ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|168223481|ref|ZP_02648713.1| hypothetical protein Senterenterica_24015 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168228666|ref|ZP_02653897.1| hypothetical protein Sententeric_23039 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168231958|ref|ZP_02657016.1| hypothetical protein Sententerica_13325 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168262639|ref|ZP_02684612.1| hypothetical protein Salmentericaenterica_16255 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168463426|ref|ZP_02697343.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168477450|ref|ZP_02706473.1| hypothetical protein Salmoentericaenterica_22585 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194443039|ref|YP_002042599.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450050|ref|YP_002047372.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472800|ref|ZP_03078784.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194735399|ref|YP_002116292.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|75505536|sp|Q57JC4|RS9_SALCH 30S ribosomal protein S9 >gi|81678004|sp|Q5PJS6|RS9_SALPA 30S ribosomal protein S9 >gi|189045710|sp|A9MNY1|RS9_SALAR 30S ribosomal protein S9 >gi|189045711|sp|A9N839|RS9_SALPB 30S ribosomal protein S9 >gi|54039560|sp|P66644|RS9_SALTI 30S ribosomal protein S9 >gi|54041997|sp|P66643|RS9_SALTY 30S ribosomal protein S9 >gi|25294626|pir||AF0908 ribosomal protein S9 [similarity] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16421903|gb|AAL22213.1| 30S ribosomal subunit protein S9 [Salmonella typhimurium LT2] >gi|16504407|emb|CAD07860.1| 30S ribosomal subunit protein S9 [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139228|gb|AAO70795.1| 30S ribosomal subunit protein S9 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129529|gb|AAV79035.1| 30S ribosomal subunit protein S9 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129485|gb|AAX67188.1| 30S ribosomal subunit protein S9 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|160867440|gb|ABX24063.1| hypothetical protein SARI_04280 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161365724|gb|ABX69492.1| hypothetical protein SPAB_04169 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401702|gb|ACF61924.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194408354|gb|ACF68573.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194459164|gb|EDX48003.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710901|gb|ACF90122.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195633412|gb|EDX51826.1| ribosomal protein S9 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (130 aa)
Score = 272, Expect = 7.6e-23, Identities = 63/130 (48%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|24114517|ref|NP_709027.1| 30S ribosomal protein S9 [Shigella flexneri 2a str. 301] >gi|33301553|sp|Q83Q07|RS9_SHIFL 30S ribosomal protein S9 >gi|24053706|gb|AAN44734.1| 30S ribosomal subunit protein S9 [Shigella flexneri 2a str. 301] (130 aa)
Score = 271, Expect = 8.7e-23, Identities = 62/130 (47%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG GKI+INQR   +YF        + QP+ + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPMELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|146281448|ref|YP_001171601.1| 30S ribosomal protein S9 [Pseudomonas stutzeri A1501] >gi|166229592|sp|A4VIF8|RS9_PSEU5 30S ribosomal protein S9 >gi|145569653|gb|ABP78759.1| ribosomal protein S9 [Pseudomonas stutzeri A1501] (130 aa)
Score = 271, Expect = 9.0e-23, Identities = 62/130 (47%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTGKI IN R+ + +F        + QPL +T+T + FD++V V+GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGKISINNRELDNFFGRETARMVVRQPLELTETAEKFDIYVTVLGGGVSGQAGAIRHGITRALISYDESLRSPLRKAGFVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|194477031|ref|YP_002049210.1| 30S ribosomal protein S9 [Paulinella chromatophora] >gi|171192038|gb|ACB43000.1| 30S ribosomal protein S9 [Paulinella chromatophora] (135 aa)
Score = 271, Expect = 9.3e-23, Identities = 63/129 (48%), Positives = 82/129 (63%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + V Y G GRRK+SVA V++ PG G + IN R  + Y   N   +  ++ PL        +D+ V V GGG TGQA AI+ G ARAL   + D RK+LK    L+RDPRAKER+KYGL  AR++PQF+KR
  S:     6 NRVVYWGTGRRKTSVARVRITPGNGSVTINGRPGDNYLNYNPAYLTAVKAPLQTLGFSSEYDIIVNVRGGGLTGQADAIKQGAARALCEISADNRKSLKAEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135
>gi|88858773|ref|ZP_01133414.1| 30S ribosomal subunit protein S9 [Pseudoalteromonas tunicata D2] >gi|88818999|gb|EAR28813.1| 30S ribosomal subunit protein S9 [Pseudoalteromonas tunicata D2] (129 aa)
Score = 271, Expect = 9.3e-23, Identities = 63/126 (50%), Positives = 80/126 (63%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKSS A V L PGTG I+IN+R   EYF        + QPL +    + FD+++ V GGG TGQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ AR+ PQF+KR
  S:     4 QYYGTGRRKSSSARVFLRPGTGNIVINKRSIEEYFGRETSRMVVRQPLELVGMVEKFDLYITVAGGGNTGQAGAIRHGITRALMEFDESLRPALRKAGFVTRDARKVERKKVGLHKARKRPQFSKR 129
>gi|167957400|ref|ZP_02544474.1| ribosomal protein S9 [candidate division TM7 single-cell isolate TM7c] (132 aa)
Score = 270, Expect = 1.1e-22, Identities = 59/125 (47%), Positives = 83/125 (66%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + GLGRRKS+ A  +L  G G I IN +   EY   N  ++ ++  PL +   +K FD+ ++V GGG +GQ  AI+L I++A++ A ND R TLK +++L RDPR KERKKYGL  AR+  QF+KR
  S:     7 FYGLGRRKSATARARLYSGKGDIKINDKPAMEYLSGNKTLLAEVTDPLALVGKQKEFDITIRVSGGGLSGQVDAIKLAISKAIVTAYNDLRGTLKKAELLKRDPREKERKKYGLRSARKREQFSKR 132
>gi|54778762|gb|AAV39596.1| ribosomal protein S9 [synthetic construct] (157 aa)
Score = 270, Expect = 1.1e-22, Identities = 62/126 (49%), Positives = 79/126 (62%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:    29 QYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 154
>gi|157150984|ref|YP_001449678.1| 30S ribosomal protein S9 [Streptococcus gordonii str. Challis substr. CH1] >gi|189045721|sp|A8AV68|RS9_STRGC 30S ribosomal protein S9 >gi|157075778|gb|ABV10461.1| ribosomal protein S9 [Streptococcus gordonii str. Challis substr. CH1] (130 aa)
Score = 270, Expect = 1.2e-22, Identities = 71/130 (54%), Positives = 92/130 (70%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T   +DVFV V GGG+ GQAGAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTVGQYDVFVNVNGGGYGGQAGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|59712828|ref|YP_205604.1| 30S ribosomal protein S9 [Vibrio fischeri ES114] >gi|163730338|ref|ZP_02137813.1| 30S ribosomal protein S9 [Vibrio fischeri MJ11] >gi|75506925|sp|Q5E2N0|RS9_VIBF1 30S ribosomal protein S9 >gi|59480929|gb|AAW86716.1| 30S ribosomal subunit protein S9 [Vibrio fischeri ES114] >gi|161396490|gb|EDQ20784.1| 30S ribosomal protein S9 [Vibrio fischeri MJ11] (130 aa)
Score = 270, Expect = 1.2e-22, Identities = 61/130 (46%), Positives = 79/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PGTG I+IN+R    YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGTGNIVINKRSLEVYFGRPTARMVVNQPLELVEMTDKLDLYITVSGGGISGQAGAIRHGITRALMQYDESLRPALRAAGYVTRDARCVERKKVGLRKARRKPQFSKR 130
>gi|74313760|ref|YP_312179.1| 30S ribosomal protein S9 [Shigella sonnei Ss046] >gi|123616042|sp|Q3YX18|RS9_SHISS 30S ribosomal protein S9 >gi|73857237|gb|AAZ89944.1| 30S ribosomal subunit protein S9 [Shigella sonnei Ss046] (130 aa)
Score = 270, Expect = 1.2e-22, Identities = 62/130 (47%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKNSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|115377540|ref|ZP_01464740.1| ribosomal protein S9 [Stigmatella aurantiaca DW4/3-1] >gi|115365480|gb|EAU64515.1| ribosomal protein S9 [Stigmatella aurantiaca DW4/3-1] (133 aa)
Score = 270, Expect = 1.3e-22, Identities = 65/125 (52%), Positives = 77/125 (61%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +   GRRK + A V L PGTG + IN R+ N YF        M QPL + + +   D+ V V GGG +GQAGAIR GIARAL   N +FR  LK +  LTRD RA ERKKYG  GARR  QF+KR
  S:     9 FYATGRRKEATARVWLKPGTGIVTINGRELNNYFGRETSKMVMYQPLEVIEQKGKVDLTVNVRGGGLSGQAGAIRHGIARALCAFNPEFRPALKKAGFLTRDARAVERKKYGQPGARRRFQFSKR 133
>gi|33357886|pdb|1P6G|I Chain I, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome >gi|33357963|pdb|1P87|I Chain I, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome >gi|83754047|pdb|2AVY|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754103|pdb|2AW7|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138061|pdb|2I2P|I Chain I, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138132|pdb|2I2U|I Chain I, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|157836031|pdb|2QOU|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836090|pdb|2QOW|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836135|pdb|2QOY|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836194|pdb|2QP0|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|158429706|pdb|2QAL|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429758|pdb|2QAN|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429816|pdb|2QB9|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429868|pdb|2QBB|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429920|pdb|2QBD|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429972|pdb|2QBF|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430026|pdb|2QBH|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430079|pdb|2QBJ|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431379|pdb|2Z4K|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431432|pdb|2Z4M|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|168988796|pdb|2VHO|I Chain I, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 3 Of 4) >gi|168988817|pdb|2VHP|I Chain I, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 4 Of 4) (129 aa)
Score = 270, Expect = 1.4e-22, Identities = 62/126 (49%), Positives = 79/126 (62%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     4 QYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 129
>gi|71278156|ref|YP_271090.1| ribosomal protein S9 [Colwellia psychrerythraea 34H] >gi|123630946|sp|Q47VT2|RS9_COLP3 30S ribosomal protein S9 >gi|71143896|gb|AAZ24369.1| ribosomal protein S9 [Colwellia psychrerythraea 34H] (130 aa)
Score = 269, Expect = 1.4e-22, Identities = 62/130 (47%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++ +Y G GRRKSS A V +  G G I IN+R  +EYF        + QPL + +  + FD  + VVGGG +GQAGAIR GI RAL+V +   R  L+ +  +TRD R  ERKK GL+ AR+ PQF+KR
  S:     1 MADNQYYGTGRRKSSTARVFMKAGNGAITINKRDISEYFGRETARMVVRQPLELVEMLEKFDFNISVVGGGISGQAGAIRHGITRALMVFDETLRGELRKAGFVTRDARKVERKKVGLHKARKKPQFSKR 130
>gi|148982598|ref|ZP_01816817.1| 30S ribosomal protein S9 [Vibrionales bacterium SWAT-3] >gi|145960392|gb|EDK25792.1| 30S ribosomal protein S9 [Vibrionales bacterium SWAT-3] (130 aa)
Score = 269, Expect = 1.4e-22, Identities = 60/130 (46%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G+I+IN+R  + YF        ++QPL + +  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSAARVFIKPGSGEIVINKRSLDVYFGRPTSRMVVKQPLELVELTEKLDLYITVSGGGISGQAGAIRHGITRALMEYDETLRPALRAAGYVTRDARCVERKKVGLRKARRKPQFSKR 130
>gi|163747160|ref|ZP_02154516.1| 30S ribosomal protein S9 [Oceanibulbus indolifex HEL-45] >gi|161379721|gb|EDQ04134.1| 30S ribosomal protein S9 [Oceanibulbus indolifex HEL-45] (168 aa)
Score = 269, Expect = 1.4e-22, Identities = 58/121 (47%), Positives = 79/121 (65%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+++N +  NEYF   +    + QP  IT+T   FDVF  V GGG +GQAGA++ G+++AL + +   R  LK +  LTRD R  ERKKYG   ARRS QF+KR
  S:    48 GKRKDAVARVWIKPGSGKVIVNGKPQNEYFARPVQQLILAQPFGITNTEGQFDVFATVKGGGLSGQAGAVKHGVSKALQLYDPSLRGALKAAGFLTRDSRVVERKKYGKAKARRSFQFSKR 168
>gi|11467398|ref|NP_043255.1| ribosomal protein S9 [Cyanophora paradoxa] >gi|1350902|sp|P48135|RR9_CYAPA Cyanelle 30S ribosomal protein S9 >gi|1016199|gb|AAA81286.1| ribosomal protein S9 (134 aa)
Score = 269, Expect = 1.5e-22, Identities = 62/123 (50%), Positives = 81/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSL-VIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK+SVA V+L+PG G+ILIN +  N Y   +L  +  ++ PL        ++V V   GGG TGQ+ AIRLG+ARAL   +   R  LK    LTRD RAKERKKYGL+ AR++PQ++KR
  S:    11 GTGRRKTSVAKVRLIPGKGEILINSKPANLYLQYNLSYLAAVKSPLESLGLANEYNVIVNTQGGGLTGQSEAIRLGLARALCQISLTHRPLLKSDHHLTRDARAKERKKYGLHKARKAPQYSKR 134
>gi|83816332|ref|YP_444192.1| ribosomal protein S9 [Salinibacter ruber DSM 13855] >gi|83757726|gb|ABC45839.1| ribosomal protein S9 [Salinibacter ruber DSM 13855] (132 aa)
Score = 269, Expect = 1.5e-22, Identities = 61/126 (48%), Positives = 83/126 (65%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGK-ILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y+ +GRRK+S A V L PG G   ++N+R   +YFP +   + ++QP  +TDT   F+V V   GGG TGQA AIRLGIARAL+  + + R  L+ +  LTRD R  ERKKYG  GAR+  Q++KR
  S:     6 QYQAIGRRKTSTARVYLRPGDGSSFVVNERDAEDYFPVAWRRRTLDQPFDVTDTIGQFNVKVNASGGGLTGQAEAIRLGIARALVEYDEELRAPLRDAGYLTRDDRMVERKKYGQPGARKKSQYSKR 132
>gi|127514221|ref|YP_001095418.1| 30S ribosomal protein S9 [Shewanella loihica PV-4] >gi|166229603|sp|A3QI61|RS9_SHELP 30S ribosomal protein S9 >gi|126639516|gb|ABO25159.1| SSU ribosomal protein S9P [Shewanella loihica PV-4] (130 aa)
Score = 269, Expect = 1.5e-22, Identities = 62/130 (47%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK+S A V    G+G I++NQR  +EYF        + QPL + +  +  D++V V GGG TGQAGAIR GI RAL+  +   R +L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MSATQYYGTGRRKTSTARVFAKVGSGNIVVNQRPLDEYFGRETARMVVRQPLELVEMTEKLDIYVTVKGGGITGQAGAIRHGITRALMELDEALRPSLRAAGFVTRDARKVERKKVGLRKARRKPQFSKR 130
>gi|116667418|pdb|2GY9|I Chain I, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 >gi|116667470|pdb|2GYB|I Chain I, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli Ribosome Complex Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1143 (126 aa)
Score = 269, Expect = 1.5e-22, Identities = 62/126 (49%), Positives = 79/126 (62%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + D  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 QYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 126
>gi|55981433|ref|YP_144730.1| 30S ribosomal protein S9 [Thermus thermophilus HB8] >gi|67472310|sp|P80374|RS9_THET8 30S ribosomal protein S9 >gi|119389720|pdb|2HGI|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgj. >gi|119389777|pdb|2HGP|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgq. >gi|119389833|pdb|2HGR|L Chain L, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgu. >gi|149243626|pdb|2UU9|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Gug-Codon In The A-Site And Paromomycin. >gi|149243653|pdb|2UUA|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guc-Codon In The A-Site And Paromomycin. >gi|149243680|pdb|2UUB|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Guu-Codon In The A-Site And Paromomycin. >gi|149243707|pdb|2UUC|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Complexed With A Valine-Asl With Cmo5u In Position 34 Bound To An Mrna With A Gua-Codon In The A-Site And Paromomycin. >gi|55772846|dbj|BAD71287.1| 30S ribosomal protein S9 [Thermus thermophilus HB8] (128 aa)
Score = 269, Expect = 1.5e-22, Identities = 62/126 (49%), Positives = 80/126 (63%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK +VA V L PG GK+ +N +  NEYF   +      +PL   D   +FD ++ V GGG +GQ  AI+LGIARAL+  N D+R  LK    LTRD R  ERKKYG + ARR+PQ++KR
  S:     3 QYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR 128
>gi|167753565|ref|ZP_02425692.1| hypothetical protein ALIPUT_01842 [Alistipes putredinis DSM 17216] >gi|167658190|gb|EDS02320.1| hypothetical protein ALIPUT_01842 [Alistipes putredinis DSM 17216] (128 aa)
Score = 269, Expect = 1.6e-22, Identities = 61/122 (50%), Positives = 83/122 (68%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V + PG G+I IN++    YFP  ++   ++QPL+ T+T +N+D+ + + GGG  GQA A RLGIARAL   + +FR  LK +  LTRDPR  ERKK G  GARR  QF+KR
  S:     7 VGRRKAAVARVFVKPGKGEITINRKSLEVYFPLDILQFQVKQPLLATNTAENYDITINLDGGGIKGQAEAARLGIARALCEIDAEFRPVLKKNGFLTRDPREVERKKPGQPGARRKFQFSKR 128
>gi|191163815|ref|ZP_03025686.1| ribosomal protein S9 [Geobacter sp. M21] >gi|190994980|gb|EDV70437.1| ribosomal protein S9 [Geobacter sp. M21] (129 aa)
Score = 269, Expect = 1.7e-22, Identities = 60/127 (47%), Positives = 81/127 (63%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V +   G+RKSS+A V + PG G+I++N +  + YF        + QPL +T+    FD+F  V GGG +GQAGAI+ GI +AL+ A+ D R TLK +  +TRD R KERKKYG   AR S QF+KR
  S:     3 VSFYATGKRKSSIARVWIKPGNGEIIVNTKTLDNYFGRETSKMVVMQPLELTENVGKFDIFCTVKGGGDSGQAGAIKHGITKALIEADGDLRGTLKKAGFITRDSRIKERKKYGKKAARASFQFSKR 129
>gi|15677878|ref|NP_275046.1| 30S ribosomal protein S9 [Neisseria meningitidis MC58] >gi|15793387|ref|NP_283209.1| 30S ribosomal protein S9 [Neisseria meningitidis Z2491] >gi|121635714|ref|YP_975959.1| 30S ribosomal protein S9 [Neisseria meningitidis FAM18] >gi|161869136|ref|YP_001598302.1| 30S ribosomal protein S9 [Neisseria meningitidis 053442] >gi|166229579|sp|A1KWD5|RS9_NEIMF 30S ribosomal protein S9 >gi|189045704|sp|A9M088|RS9_NEIM0 30S ribosomal protein S9 >gi|54039559|sp|P66642|RS9_NEIMB 30S ribosomal protein S9 >gi|54041996|sp|P66641|RS9_NEIMA 30S ribosomal protein S9 >gi|7227318|gb|AAF42376.1| 30S ribosomal protein S9 [Neisseria meningitidis MC58] >gi|120867420|emb|CAM11192.1| 30S ribosomal protein S9 [Neisseria meningitidis FAM18] >gi|121051380|emb|CAM07672.1| 30S ribosomal protein S9 [Neisseria meningitidis Z2491] >gi|161594689|gb|ABX72349.1| 30S ribosomal protein S9 [Neisseria meningitidis 053442] (130 aa)
Score = 269, Expect = 1.7e-22, Identities = 64/130 (49%), Positives = 85/130 (65%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   Y G GRRKSSVA V L+ GTG+I++N R  +E+F        + QPLV+T+  ++FD+ V VVGGG TGQ+GAIR GI RAL+  +   +  L  +  +TRD R  ERKK GL  ARR+ QF+KR
  S:     1 MNGKYYYGTGRRKSSVARVFLIKGTGQIIVNGRPVDEFFARETSRMVVRQPLVLTENAESFDIKVNVVGGGETGQSGAIRHGITRALIDFDAALKPALSQAGFVTRDAREVERKKPGLRKARRAKQFSKR 130
>gi|15610578|ref|NP_217959.1| 30S ribosomal protein S9 [Mycobacterium tuberculosis H37Rv] >gi|15843037|ref|NP_338074.1| 30S ribosomal protein S9 [Mycobacterium tuberculosis CDC1551] >gi|31794619|ref|NP_857112.1| 30S ribosomal protein S9 [Mycobacterium bovis AF2122/97] >gi|121639363|ref|YP_979587.1| 30S ribosomal protein S9 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148663307|ref|YP_001284830.1| 30S ribosomal protein S9 [Mycobacterium tuberculosis H37Ra] >gi|148824652|ref|YP_001289406.1| 30S ribosomal protein S9 [Mycobacterium tuberculosis F11] >gi|167966784|ref|ZP_02549061.1| 30S ribosomal protein S9 [Mycobacterium tuberculosis H37Ra] >gi|194542097|ref|YP_002077128.1| 30S ribosomal protein S9 rpsI [Mycobacterium tuberculosis C] >gi|166229573|sp|A1KPC9|RS9_MYCBP 30S ribosomal protein S9 >gi|166229577|sp|A5U8B8|RS9_MYCTA 30S ribosomal protein S9 >gi|54039558|sp|P66640|RS9_MYCBO 30S ribosomal protein S9 >gi|54041995|sp|P66639|RS9_MYCTU 30S ribosomal protein S9 >gi|2104363|emb|CAB08691.1| PROBABLE 30S RIBOSOMAL PROTEIN S9 RPSI [Mycobacterium tuberculosis H37Rv] >gi|13883380|gb|AAK47888.1| ribosomal protein S9 [Mycobacterium tuberculosis CDC1551] >gi|31620216|emb|CAD95659.1| PROBABLE 30S RIBOSOMAL PROTEIN S9 RPSI [Mycobacterium bovis AF2122/97] >gi|121495011|emb|CAL73497.1| Probable 30S ribosomal protein S9 rpsI [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124599567|gb|EAY58671.1| 30S ribosomal protein S9 rpsI [Mycobacterium tuberculosis C] >gi|134151558|gb|EBA43603.1| 30S ribosomal protein S9 rpsI [Mycobacterium tuberculosis str. Haarlem] >gi|148507459|gb|ABQ75268.1| 30S ribosomal protein S9 [Mycobacterium tuberculosis H37Ra] >gi|148723179|gb|ABR07804.1| 30S ribosomal protein S9 rpsI [Mycobacterium tuberculosis F11] (151 aa)
Score = 269, Expect = 1.8e-22, Identities = 66/122 (54%), Positives = 89/122 (72%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +V  V+LVPGTGK  +N R   +YFPN +  Q ++ PLV  D  ++FD+F  + GGG +GQAGA+RLGIARAL++ + + R  LK +  LTRDPRA ERKKYGL  AR++PQ++KR
  S:    30 VGRRKEAVVRVRLVPGTGKFDLNGRSLEDYFPNKVHQQLIKAPLVTVDRVESFDIFAHLGGGGPSGQAGALRLGIARALILVSPEDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 151
>gi|196228533|ref|ZP_03127400.1| ribosomal protein S9 [Chthoniobacter flavus Ellin428] >gi|196227936|gb|EDY22439.1| ribosomal protein S9 [Chthoniobacter flavus Ellin428] (130 aa)
Score = 269, Expect = 1.8e-22, Identities = 63/130 (48%), Positives = 78/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  E+   GRRK +VA ++L  GTGKI IN R   EYF  + +   + QPL +      +D+ V   GGG  GQAGA+RL +ARAL   N + R  LK    LTRDPR KERKK G  GAR+  QF+KR
  S:     1 MSQQEFIATGRRKDAVARIRLSAGTGKIKINGRPFEEYFKTTALQNTVLQPLEVAKVVNQYDLAVNATGGGVNGQAGAVRLAVARALTETNAELRGPLKAEGFLTRDPRMKERKKAGQPGARKRFQFSKR 130
>gi|71842333|ref|YP_277421.1| ribosomal protein S9 [Emiliania huxleyi] >gi|122220067|sp|Q4G346|RR9_EMIHU Chloroplast 30S ribosomal protein S9 >gi|60101576|gb|AAX13920.1| ribosomal protein S9 [Emiliania huxleyi] (131 aa)
Score = 268, Expect = 1.9e-22, Identities = 59/130 (45%), Positives = 84/130 (64%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS + Y  +GRRK + A VKL PGTG I +N++    YF  NS  +  +  PL+      ++D+ +   GGG  GQ  A++LG+ARA+   +++ R++LK    LTRD RAKERKKYGL  AR++PQF+KR
  S:     1 MSTISYTAVGRRKEATAKVKLQPGTGIITVNKKPGETYFNYNSEYLSTLRGPLLALGLENDYDLHITAKGGGIKGQTDAVKLGLARAICTMSSEKRESLKPHGYLTRDYRAKERKKYGLRKARKAPQFSKR 131
>gi|46580923|ref|YP_011731.1| 30S ribosomal protein S9 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120601775|ref|YP_966175.1| 30S ribosomal protein S9 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|81699026|sp|Q728T3|RS9_DESVH 30S ribosomal protein S9 >gi|166229557|sp|A1VBD2|RS9_DESVV 30S ribosomal protein S9 >gi|46450343|gb|AAS96991.1| ribosomal protein S9 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562004|gb|ABM27748.1| SSU ribosomal protein S9P [Desulfovibrio vulgaris subsp. vulgaris DP4] (130 aa)
Score = 268, Expect = 1.9e-22, Identities = 63/123 (51%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK++ A  +L PGTG I IN R   E+FP   +   + QPLV+T   + FDV V V GGG +GQA A+R GI+RALL  + + R  LK +  LTRD R KERKKYGL  AR   Q++KR
  S:     8 GTGRRKTATARTRLYPGTGVIEINGRPYEEFFPRKTLQMIIRQPLVLTKMLEKFDVKVNVAGGGISGQAEAVRHGISRALLELDAELRPVLKRAGFLTRDARKKERKKYGLRAARARYQYSKR 130
>gi|145620207|ref|ZP_01776243.1| ribosomal protein S9 [Geobacter bemidjiensis Bem] >gi|144943433|gb|EDJ78522.1| ribosomal protein S9 [Geobacter bemidjiensis Bem] >gi|197086663|gb|ACH37934.1| ribosomal protein S9 [Geobacter bemidjiensis Bem] (129 aa)
Score = 268, Expect = 2.0e-22, Identities = 60/127 (47%), Positives = 81/127 (63%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V +   G+RKSS+A V + PG G+I++N +  + YF        + QPL +T+    FD+F  V GGG +GQAGAI+ GI +AL+ A+ D R TLK +  +TRD R KERKKYG   AR S QF+KR
  S:     3 VSFYATGKRKSSIARVWIKPGNGEIIVNTKTLDNYFGRETSKMVVMQPLELTENVGKFDIFCTVKGGGDSGQAGAIKHGITKALIEADADLRGTLKKAGFITRDSRIKERKKYGKKAARASFQFSKR 129
>gi|119505139|ref|ZP_01627215.1| 30S ribosomal protein S9 [marine gamma proteobacterium HTCC2080] >gi|119459121|gb|EAW40220.1| 30S ribosomal protein S9 [marine gamma proteobacterium HTCC2080] (130 aa)
Score = 268, Expect = 2.1e-22, Identities = 64/130 (49%), Positives = 78/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK+S A V L  GTG I IN R  +EYF   +    + QPL +T    +FD +V V GGG  GQAGAIR G+ RAL+  +   R  L+    +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MSTAQYYGTGRRKTSTARVFLRSGTGNIQINGRTIDEYFGREVARMIVRQPLELTQLNGSFDAYVTVSGGGSFGQAGAIRHGLTRALMDYDESLRGALRAEGFVTRDAREVERKKVGLRKARRRPQFSKR 130
>gi|74316472|ref|YP_314212.1| 30S ribosomal protein S9 [Thiobacillus denitrificans ATCC 25259] >gi|123611078|sp|Q3SF20|RS9_THIDA 30S ribosomal protein S9 >gi|74055967|gb|AAZ96407.1| ribosomal protein S9 [Thiobacillus denitrificans ATCC 25259] (130 aa)
Score = 268, Expect = 2.2e-22, Identities = 61/123 (49%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V +  G+GKI++N +  +EYF        + QPLV+TD    FD+ V V GGG +GQAGA+R GI RAL+  +   + TLK + ++TRD R  ERKK G + ARR  QF+KR
  S:     8 GTGRRKSSVARVFIKAGSGKIVVNDKPVDEYFSRETGRMIVRQPLVLTDNLNRFDIMVNVAGGGESGQAGAVRHGITRALIDLDAGMKPTLKAAGLVTRDAREVERKKVGFHKARRRKQFSKR 130
>gi|72163012|ref|YP_290669.1| 30S ribosomal protein S9 [Thermobifida fusca YX] >gi|71916744|gb|AAZ56646.1| SSU ribosomal protein S9P [Thermobifida fusca YX] (169 aa)
Score = 267, Expect = 2.3e-22, Identities = 60/123 (48%), Positives = 83/123 (67%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDF-RKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK++VA V++VPGTG+  IN +   EYFPN +  Q +++PL        +DVF ++ GGG +GQAGA+R G+ARAL   + +  R  LK +  LTRD R  ERKK GL  AR++PQ++KR
  S:    46 GTGRRKTAVARVRVVPGTGEWKINGKSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQAGALRHGLARALAAMDPEHNRPPLKKAGFLTRDARKVERKKAGLKKARKAPQYSKR 169
>gi|183597942|ref|ZP_02959435.1| hypothetical protein PROSTU_01291 [Providencia stuartii ATCC 25827] >gi|188022714|gb|EDU60754.1| hypothetical protein PROSTU_01291 [Providencia stuartii ATCC 25827] (130 aa)
Score = 267, Expect = 2.4e-22, Identities = 61/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I INQR   +YF        + QPL + +  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R+ ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSSARVFIKPGSGNITINQRTLEQYFGRETARMVVRQPLELVEMLEKLDLYITVKGGGISGQAGAIRHGITRALMAYDETLRSDLRKAGFVTRDARSVERKKVGLRKARRRPQFSKR 130
>gi|88711080|ref|ZP_01105168.1| 30S ribosomal protein S9 [Flavobacteriales bacterium HTCC2170] >gi|88710021|gb|EAR02253.1| 30S ribosomal protein S9 [Flavobacteriales bacterium HTCC2170] (128 aa)
Score = 267, Expect = 2.4e-22, Identities = 59/122 (48%), Positives = 80/122 (65%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V L  G G I +N+++ N YFP + +   ++Q   +T T  N+DV V V GGG TGQA AIRL ++RAL   + + R TLK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYLSEGKGNITVNEKELNTYFPTATLQYKVKQAFALTSTEDNYDVKVNVYGGGITGQAEAIRLALSRALCEIDEENRTTLKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|110633516|ref|YP_673724.1| 30S ribosomal protein S9 [Mesorhizobium sp. BNC1] >gi|110284500|gb|ABG62559.1| SSU ribosomal protein S9P [Mesorhizobium sp. BNC1] (160 aa)
Score = 267, Expect = 2.5e-22, Identities = 57/121 (47%), Positives = 80/121 (66%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK+++A V + PG+GKIL+N ++  +YF   ++   ++QP+V T+    +D+   VVGGG +GQAGA+R GI+RAL     + R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    40 GKRKNAIARVWVKPGSGKILVNDKEFTQYFARPVLQMILQQPIVATNRNGQYDIVATVVGGGLSGQAGAVRHGISRALTFYEPELRAVLKKGGFLTRDSRVVERKKYGRAKARRSFQFSKR 160
>gi|187251947|ref|YP_001876429.1| ribosomal protein S9 [Elusimicrobium minutum Pei191] >gi|186972107|gb|ACC99092.1| ribosomal protein S9 [Elusimicrobium minutum Pei191] (131 aa)
Score = 267, Expect = 2.5e-22, Identities = 63/130 (48%), Positives = 86/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQ-DMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +   +GRRK+S+A  +L+ G GKI +N +   EYF +S   Q D++ PL +T+T K +DV  KV GGG + QAGAIR  IAR+L   + DF+K +K +  LTRDPR  ERKK G  GAR+  QF+KR
  S:     1 MTKTKTSQVGRRKTSIATAELIKGKGKITVNAKPMEEYFVHSAKYQKDVKAPLTVTNTEKEYDVIAKVQGGGVSSQAGAIRHAIARSLAAVSEDFKKAVKKAGYLTRDPRMVERKKPGQPGARKRFQFSKR 131
>gi|33519532|ref|NP_878364.1| 30S ribosomal subunit protein S9 [Candidatus Blochmannia floridanus] >gi|39932109|sp|Q7VQR6|RS9_BLOFL 30S ribosomal protein S9 >gi|33517195|emb|CAD83577.1| 30S ribosomal subunit protein S9 [Candidatus Blochmannia floridanus] (130 aa)
Score = 267, Expect = 2.6e-22, Identities = 60/126 (47%), Positives = 81/126 (64%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKS+ A V L  G G I+IN    ++YFP       +++PL +T+     D ++ V+GGG +GQAGAI  GI RALL  N +F+  L+ + ++TRD R  ERKK GL  ARRSPQF+KR
  S:     5 QYYGTGRRKSASARVFLRFGNGDIVINNLSLDKYFPKDNFQIIIKKPLEVTNVLNILDAYITVIGGGVSGQAGAISHGITRALLQYNAEFKSVLRATGLMTRDSRMVERKKVGLRKARRSPQFSKR 130
>gi|118581488|ref|YP_902738.1| 30S ribosomal protein S9 [Pelobacter propionicus DSM 2379] >gi|166229583|sp|A1ATL0|RS9_PELPD 30S ribosomal protein S9 >gi|118504198|gb|ABL00681.1| SSU ribosomal protein S9P [Pelobacter propionicus DSM 2379] (130 aa)
Score = 267, Expect = 2.9e-22, Identities = 64/130 (49%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   + G G+RKSSVA V L PG+G I +N++  ++YF        + Q L +T+    FDVFV V GGG +GQAGAIR GI +ALL A+ + R TLK +  +TRD R KERKKYG   AR   QF+KR
  S:     1 MAAESFYGTGKRKSSVARVWLKPGSGAITVNKKTLDDYFGRETSKMVVRQSLELTENVGKFDVFVTVQGGGDSGQAGAIRHGITKALLEADAELRGTLKKAGFITRDSRVKERKKYGRKAARARFQFSKR 130
>gi|70732404|ref|YP_262160.1| 30S ribosomal protein S9 [Pseudomonas fluorescens Pf-5] >gi|123653045|sp|Q4K6H3|RS9_PSEF5 30S ribosomal protein S9 >gi|68346703|gb|AAY94309.1| ribosomal protein S9 [Pseudomonas fluorescens Pf-5] (130 aa)
Score = 267, Expect = 3.0e-22, Identities = 61/130 (46%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTG I IN R  + +F        + QPL +T+T + FD++V V+GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGNISINNRSLDNFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMDYDETLRSALRKAGFVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|77460914|ref|YP_350421.1| 30S ribosomal protein S9 [Pseudomonas fluorescens PfO-1] >gi|123603337|sp|Q3K724|RS9_PSEPF 30S ribosomal protein S9 >gi|77384917|gb|ABA76430.1| SSU ribosomal protein S9P [Pseudomonas fluorescens PfO-1] (130 aa)
Score = 266, Expect = 3.3e-22, Identities = 61/130 (46%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTG I IN R  + +F        + QPL +T+T + FD++V V+GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGNISINNRSLDTFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMDYDETLRSALRKAGFVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|145632788|ref|ZP_01788521.1| 30S ribosomal protein S9 [Haemophilus influenzae 3655] >gi|144986444|gb|EDJ93010.1| 30S ribosomal protein S9 [Haemophilus influenzae 3655] (130 aa)
Score = 266, Expect = 3.4e-22, Identities = 60/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +  G GRRKSS A V + PG+GKI INQR+ + YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     1 MAENQNYGTGRRKSSSARVFIKPGSGKITINQRELDVYFGRETARMVVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFVTRDARCVERKKVGLHKARRRPQYSKR 130
>gi|89893474|ref|YP_516961.1| 30S ribosomal protein S9 [Desulfitobacterium hafniense Y51] >gi|109648978|ref|ZP_01372877.1| ribosomal protein S9 [Desulfitobacterium hafniense DCB-2] >gi|122483732|sp|Q24ZM5|RS9_DESHY 30S ribosomal protein S9 >gi|89332922|dbj|BAE82517.1| 30S ribosomal protein S9 [Desulfitobacterium hafniense Y51] >gi|109640275|gb|EAT49831.1| ribosomal protein S9 [Desulfitobacterium hafniense DCB-2] (131 aa)
Score = 266, Expect = 3.8e-22, Identities = 69/129 (53%), Positives = 92/129 (71%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           + ++Y+G GRRK++VA V+L+PG GK+ IN+R+  EYF    +   ++QP  +TDT   +DV     GGG TGQAGA+RLGIARALL A+   R  LK +  LTRDPR KER+KYGL  AR++PQF+KR
  S:     3 AQLQYQGTGRRKNAVARVRLIPGEGKVTINKRELAEYFGKKTLEMIVQQPFGVTDTAGKYDVVALAHGGGTTGQAGALRLGIARALLKADPSLRPALKRAGFLTRDPRMKERRKYGLKKARKAPQFSKR 131
>gi|46199402|ref|YP_005069.1| 30S ribosomal protein S9 [Thermus thermophilus HB27] >gi|50401233|sp|P62669|RS9_THET2 30S ribosomal protein S9 >gi|10835593|pdb|1FJG|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin >gi|13096402|pdb|1HR0|I Chain I, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit >gi|13399800|pdb|1HNW|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline >gi|13399822|pdb|1HNX|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin >gi|13399844|pdb|1HNZ|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B >gi|14278018|pdb|1GIX|L Chain L, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|14278064|pdb|1IBK|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin >gi|14278085|pdb|1IBL|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin >gi|14278109|pdb|1IBM|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site >gi|14278538|pdb|1I94|I Chain I, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 >gi|14278559|pdb|1I95|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine >gi|14278580|pdb|1I96|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) >gi|14278602|pdb|1I97|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline >gi|15826128|pdb|1JGO|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826153|pdb|1JGP|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|15826178|pdb|1JGQ|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy >gi|20663894|pdb|1J5E|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit >gi|27065884|pdb|1N32|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin >gi|27065911|pdb|1N33|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin >gi|27065938|pdb|1N34|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position >gi|27065964|pdb|1N36|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position >gi|28373707|pdb|1ML5|L Chain L, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 >gi|58177408|pdb|1XMO|I Chain I, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The Decoding Center >gi|58177431|pdb|1XMQ|I Chain I, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The Decoding Center >gi|58177472|pdb|1XNQ|I Chain I, Structure Of An Inosine-Adenine Wobble Base Pair Complex In The Context Of The Decoding Center >gi|58177495|pdb|1XNR|I Chain I, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair In The Context Of The Decoding Center >gi|66361062|pdb|1YL4|L Chain L, Crystal Structure Of 70s Ribosome With Thrs Operator And Trnas. 30s Subunit. The Coordinates For The 50s Subunit Are In The Pdb Entry 1yl3 >gi|88192244|pdb|2B64|I Chain I, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Subunit, Trnas, Mrna And Release Factor Rf1 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf1 And Is Described In Remark 400. >gi|88192307|pdb|2B9M|I Chain I, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex. This File Contains The 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2 From A Crystal Structure Of The Whole Ribosomal Complex". The Entire Crystal Structure Contains One 70s Ribosome, Trnas, Mrna And Release Factor Rf2 And Is Described In Remark 400. >gi|88192363|pdb|2B9O|I Chain I, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site. This File Contains The 30s Subunit, Trnas And Mrna From A Crystal Structure Of The Whole Ribosomal Complex With A Stop Codon In The A-Site And Is Described In Remark 400. >gi|110591331|pdb|2F4V|I Chain I, 30s Ribosome + Designer Antibiotic >gi|116667662|pdb|2HHH|I Chain I, Crystal Structure Of Kasugamycin Bound To The 30s Ribosomal Subunit >gi|116668205|pdb|2J00|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, A-, P- And E- Site Trnas And Paromomycin For Molecule I. >gi|116668266|pdb|2J02|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4) This File Contains The 30s Subunit, Mrna, A-, P- And E- Site Trnas And Paromomycin For Molecule Ii. >gi|149241283|pdb|2E5L|I Chain I, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via The Shine- Dalgarno Interaction >gi|149242716|pdb|2OW8|JJ Chain j, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 2ow8, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsa. >gi|149243846|pdb|2UXC|I Chain I, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Ucgu In The Context Of The Thermus Thermophilus 30s Subunit. >gi|157836416|pdb|2UXB|I Chain I, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Gggu In The Context Of The Thermus Thermophilus 30s Subunit. >gi|157836493|pdb|2V46|I Chain I, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 1. >gi|157836549|pdb|2V48|I Chain I, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 3 Of 4). This File Contains The 30s Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For Molecule 2. >gi|158430908|pdb|2UXD|I Chain I, Crystal Structure Of An Extended Trna Anticodon Stem Loop In Complex With Its Cognate Mrna Cggg In The Context Of The Thermus Thermophilus 30s Subunit. >gi|160285947|pdb|2QNH|JJ Chain j, Interactions And Dynamics Of The Shine-Dalgarno Helix In The 70s Ribosome. This File, 2qnh, Contains The 30s Ribosome Subunit, Two Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1vsp. >gi|186972857|pdb|2VQE|I Chain I, Modified Uridines With C5-Methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-G Wobble Pairing During Decoding >gi|186972880|pdb|2VQF|I Chain I, Modified Uridines With C5-Methylene Substituents At The First Position Of The Trna Anticodon Stabilize U-G Wobble Pairing During Decoding >gi|13446668|emb|CAC35063.1| ribosomal protein S9 [Thermus thermophilus HB27] >gi|46197027|gb|AAS81442.1| SSU ribosomal protein S9P [Thermus thermophilus HB27] (128 aa)
Score = 266, Expect = 3.9e-22, Identities = 62/126 (49%), Positives = 79/126 (62%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK +VA V L PG GK+ +N +  NEYF   +      +PL   D    FD ++ V GGG +GQ  AI+LGIARAL+  N D+R  LK    LTRD R  ERKKYG + ARR+PQ++KR
  S:     3 QYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR 128
>gi|34811537|pdb|1PNS|I Chain I, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. >gi|34811593|pdb|1PNX|I Chain I, Crystal Structure Of The Wild Type Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx, Contains Only Molecules Of The 30s Ribosomal Subunit. The 50s Subunit Is In The Pdb File 1pny. >gi|56966331|pdb|1VOQ|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966384|pdb|1VOS|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966437|pdb|1VOV|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966490|pdb|1VOX|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966543|pdb|1VOZ|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|170292338|pdb|2R1G|G Chain G, Coordinates Of The Thermus Thermophilus 30s Components Neighboring Rbfa As Obtained By Fitting Into The Cryo-Em Map Of A 30s-Rbfa Complex (127 aa)
Score = 265, Expect = 4.1e-22, Identities = 62/126 (49%), Positives = 79/126 (62%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK +VA V L PG GK+ +N +  NEYF   +      +PL   D    FD ++ V GGG +GQ  AI+LGIARAL+  N D+R  LK    LTRD R  ERKKYG + ARR+PQ++KR
  S:     2 QYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR 127
>gi|28871560|ref|NP_794179.1| 30S ribosomal protein S9 [Pseudomonas syringae pv. tomato str. DC3000] >gi|66047346|ref|YP_237187.1| 30S ribosomal protein S9 [Pseudomonas syringae pv. syringae B728a] >gi|71733718|ref|YP_276247.1| 30S ribosomal protein S9 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|81307943|sp|Q4ZNX3|RS9_PSEU2 30S ribosomal protein S9 >gi|123635228|sp|Q48EE1|RS9_PSE14 30S ribosomal protein S9 >gi|38258310|sp|Q87WW8|RS9_PSESM 30S ribosomal protein S9 >gi|28854811|gb|AAO57874.1| ribosomal protein S9 [Pseudomonas syringae pv. tomato str. DC3000] >gi|63258053|gb|AAY39149.1| Ribosomal protein S9 [Pseudomonas syringae pv. syringae B728a] >gi|71554271|gb|AAZ33482.1| ribosomal protein S9 [Pseudomonas syringae pv. phaseolicola 1448A] (130 aa)
Score = 265, Expect = 4.3e-22, Identities = 61/130 (46%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTG I IN R  + +F        + QPL +T+T + FD++V V+GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGNISINNRSLDNFFGRETARMVVRQPLELTETVEKFDIYVTVIGGGVSGQAGAIRHGITRALMQYDETLRGALRKAGFVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|146305937|ref|YP_001186402.1| 30S ribosomal protein S9 [Pseudomonas mendocina ymp] >gi|166229590|sp|A4XQQ4|RS9_PSEMY 30S ribosomal protein S9 >gi|145574138|gb|ABP83670.1| SSU ribosomal protein S9P [Pseudomonas mendocina ymp] (130 aa)
Score = 265, Expect = 4.3e-22, Identities = 61/130 (46%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTG I IN R  + +F        + QPL +T+T + FD++V V+GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGNISINNRSLDTFFGRETARMVVRQPLELTETTEKFDIYVTVIGGGVSGQAGAIRHGITRALIEYDETLRSPLRKAGYVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|162462388|ref|NP_001105916.1| lethal embryo mutant1 [Zea mays] >gi|13242064|gb|AAK16543.1|AF332374_1 9S ribosomal protein [Zea mays] >gi|13242066|gb|AAK16544.1|AF332375_1 9S ribosomal protein [Zea mays] (221 aa)
Score = 265, Expect = 4.5e-22, Identities = 63/121 (52%), Positives = 80/121 (66%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK+++A V L  GTGK+ IN R   EY   N + ++  + PL+     KN+DVFVKV GGG +GQA AI LG+ARAL+  +N  R  LK   +LTRD R  ERKK GL  AR+ PQF+KR
  S:   100 GRRKTAIARVVLQEGTGKVFINFRDAKEYLQGNPMWMEYCKVPLMTLGFEKNYDVFVKVHGGGLSGQAQAICLGVARALVKISNANRVPLKSEGLLTRDTRIVERKKAGLKKARKRPQFSKR 221
>gi|119946499|ref|YP_944179.1| ribosomal protein S9 [Psychromonas ingrahamii 37] >gi|119865103|gb|ABM04580.1| SSU ribosomal protein S9P [Psychromonas ingrahamii 37] (129 aa)
Score = 265, Expect = 4.6e-22, Identities = 60/126 (47%), Positives = 80/126 (63%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKSSVA V +  G+G+I IN+R  ++YF        + QPL +      FD+ + V GGG TGQ+GAIRLGI RAL+  +   R  L+ +  +TRD R  ERKK GL+ AR+ PQF+KR
  S:     4 QYYGTGRRKSSVARVFVKAGSGQITINKRNIDQYFGRETACMVVRQPLELIGVTDKFDLNITVKGGGSTGQSGAIRLGITRALMQYDETLRSELRAAGYVTRDAREVERKKVGLHKARKRPQFSKR 129
>gi|83648541|ref|YP_436976.1| ribosomal protein S9 [Hahella chejuensis KCTC 2396] >gi|123530823|sp|Q2S9X3|RS9_HAHCH 30S ribosomal protein S9 >gi|83636584|gb|ABC32551.1| Ribosomal protein S9 [Hahella chejuensis KCTC 2396] (130 aa)
Score = 264, Expect = 5.3e-22, Identities = 65/130 (50%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK+S A V L PG+GKI +NQ   + YF        + QPL +  +  NFDVFV V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQF+KR
  S:     1 MSVTQYYGTGRRKTSTARVFLRPGSGKITVNQTDLDSYFGRETARMVVRQPLELLGSIGNFDVFVTVKGGGPSGQAGAIRHGITRALIQYDEANRSPLRKAGYVTRDAREVERKKVGLRKARKRPQFSKR 130
>gi|162146356|ref|YP_001600815.1| 30S ribosomal protein S9 [Gluconacetobacter diazotrophicus PAl 5] >gi|187595696|ref|ZP_02981960.1| ribosomal protein S9 [Gluconacetobacter diazotrophicus PAl 5] >gi|161784931|emb|CAP54474.1| 30S ribosomal protein S9 [Gluconacetobacter diazotrophicus PAl 5] >gi|187492531|gb|EDU30468.1| ribosomal protein S9 [Gluconacetobacter diazotrophicus PAl 5] (166 aa)
Score = 264, Expect = 5.3e-22, Identities = 59/121 (48%), Positives = 73/121 (60%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +VA V + PG G I +N R    YF   ++   + QP ++ D    FDV+  V GGG +GQAGA+R GI+RAL       R  LK +  LTRDPR  ERKKYG   ARRS QF+KR
  S:    46 GRRKDAVARVWIKPGKGDITVNGRSVGTYFARPVLRMLITQPFLVADRYNQFDVYCTVTGGGLSGQAGAVRHGISRALTHYEPTLRGILKAAGFLTRDPRVVERKKYGRAKARRSFQFSKR 166
>gi|153006279|ref|YP_001380604.1| ribosomal protein S9 [Anaeromyxobacter sp. Fw109-5] >gi|152029852|gb|ABS27620.1| ribosomal protein S9 [Anaeromyxobacter sp. Fw109-5] (131 aa)
Score = 264, Expect = 5.5e-22, Identities = 63/122 (51%), Positives = 77/122 (63%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK SVA V+LVPGTG I IN R  + YF        + +PL + D     DV V   GGG +GQAGAIR GI+RAL   N ++R  LK +  +TRD RA ERKKYG  GAR+  QF+KR
  S:    10 VGRRKESVARVRLVPGTGNITINGRTMDVYFGRETSKMILVEPLKLVDQMGKLDVLVTARGGGLSGQAGAIRHGISRALCDLNPEYRPILKKAGFMTRDARAVERKKYGRPGARKRFQFSKR 131
>gi|118586189|ref|ZP_01543659.1| ribosomal protein S9 [Oenococcus oeni ATCC BAA-1163] >gi|118433375|gb|EAV40071.1| ribosomal protein S9 [Oenococcus oeni ATCC BAA-1163] (130 aa)
Score = 264, Expect = 5.5e-22, Identities = 73/130 (56%), Positives = 87/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+N +Y G GRRK SVA V+L PG+GKI IN R   EY P + +   + QP  +T T   +DV V VVGGGF GQAGA R GIARALL  + DFR  LK + +LTRD R  ERKK GL  ARR+ QF+KR
  S:     1 MANTQYAGTGRRKVSVARVRLTPGSGKITINNRSFEEYIPAANLRAVVTQPFAVTSTDGTYDVNVNVVGGGFAGQAGATRHGIARALLQVDPDFRPALKSAGLLTRDSRMVERKKPGLKKARRASQFSKR 130
>gi|94967593|ref|YP_589641.1| SSU ribosomal protein S9P [Acidobacteria bacterium Ellin345] >gi|94549643|gb|ABF39567.1| SSU ribosomal protein S9P [Acidobacteria bacterium Ellin345] (131 aa)
Score = 264, Expect = 5.7e-22, Identities = 61/127 (48%), Positives = 80/127 (62%)
  Q:     4 VEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           V+Y G GRRKS+VA V L PG+G+  +N +   EYF      Q  + PLV+T+T   F+V   V GGG  GQA A+++G+ARAL   N + R  +K    +TRD R KERKKYG  GAR+  QF+KR
  S:     5 VQYYGTGRRKSAVARVFLRPGSGEFKVNGKGFEEYFVTEAQRQSAKSPLVLTETIATFNVVANVSGGGVNGQADAVKMGLARALQEFNAELRGKMKAEGFMTRDARMKERKKYGQKGARKRFQFSKR 131
>gi|118590325|ref|ZP_01547728.1| 30S ribosomal protein S9 [Stappia aggregata IAM 12614] >gi|118437297|gb|EAV43935.1| 30S ribosomal protein S9 [Stappia aggregata IAM 12614] (158 aa)
Score = 264, Expect = 5.9e-22, Identities = 56/121 (46%), Positives = 80/121 (66%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK ++A V + PGTGKI+IN++   EYF   ++   ++QP+++TD    +DV   V GGG +GQAGA+R G+++AL     + R  LK +  LTRD R  ERKK+G   ARRS QF+KR
  S:    38 GKRKDAIARVWIKPGTGKIVINKKDYTEYFARPVLQMILQQPIMLTDRAGQYDVIATVTGGGLSGQAGAVRHGLSKALTHYEPELRGVLKKNGFLTRDSRVVERKKFGKRKARRSFQFSKR 158
>gi|149370956|ref|ZP_01890551.1| 30S ribosomal protein S9 [unidentified eubacterium SCB49] >gi|149355742|gb|EDM44300.1| 30S ribosomal protein S9 [unidentified eubacterium SCB49] (128 aa)
Score = 264, Expect = 6.1e-22, Identities = 59/122 (48%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V L  G G I +N+R+   YF    +   ++QPL++T+    FD+ V V GGG TGQA AIRL IARA+   N++ R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYLTEGKGNITVNKRELANYFTTPTLQYKVKQPLMLTENETTFDINVNVFGGGITGQAEAIRLAIARAMCTLNDENRGILKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|163868611|ref|YP_001609820.1| 30S ribosomal protein S9 [Bartonella tribocorum CIP 105476] >gi|189045687|sp|A9IVX6|RS9_BART1 30S ribosomal protein S9 >gi|161018267|emb|CAK01825.1| 30S ribosomal protein S9 [Bartonella tribocorum CIP 105476] (161 aa)
Score = 264, Expect = 6.2e-22, Identities = 58/121 (47%), Positives = 78/121 (64%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GKI+IN ++ ++YF   ++   + QP+V T+    FD+   V GGG +GQAGAIR GI++AL     + R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    41 GKRKDAVARVWIKPGSGKIIINNKEFDKYFARPVLRMILRQPIVATNRDTQFDIVATVAGGGLSGQAGAIRHGISKALTYYEPELRPILKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 161
>gi|116671463|ref|YP_832396.1| SSU ribosomal protein S9P [Arthrobacter sp. FB24] >gi|166228551|sp|A0JZ26|RS9_ARTS2 30S ribosomal protein S9 >gi|116611572|gb|ABK04296.1| SSU ribosomal protein S9P [Arthrobacter sp. FB24] (168 aa)
Score = 264, Expect = 6.3e-22, Identities = 63/123 (51%), Positives = 84/123 (68%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALL---VANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK +VA V++VPG+GK +IN R+   YFPN L  QD+ +P  I D    +DV  ++ GGG +GQAGA+RLGIAR+L    + NN  R  LK +  LTRD R  ERKK GL  AR++ Q++KR
  S:    45 AVGRRKEAVARVRVVPGSGKWIINGRELANYFPNKLHQQDVNEPFKILDLDGAYDVIARIHGGGPSGQAGALRLGIARSLNEIDIENN--RAILKKAGYLTRDARVIERKKAGLKKARKAQQYSKR 168
>gi|50955534|ref|YP_062822.1| 30S ribosomal protein S9 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|81692576|sp|Q6AD27|RS9_LEIXX 30S ribosomal protein S9 >gi|50952016|gb|AAT89717.1| 30S ribosomal protein S9 [Leifsonia xyli subsp. xyli str. CTCB07] (168 aa)
Score = 264, Expect = 6.4e-22, Identities = 59/123 (47%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARAL-LVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK ++A V+LVPG G + +N R   +YFPN L  Q +  P  + D   ++DV  ++ GGG +GQAGA+RL IARAL  +   + R TLK +  LTRD R  ERKK GL  AR++ QF+KR
  S:    45 AVGRRKEAIARVRLVPGAGAVTVNGRAFADYFPNKLHQQLITDPFKVLDLVGSYDVIARITGGGPSGQAGALRLAIARALNEIDRENNRPTLKKAGFLTRDARVTERKKAGLKKARKASQFSKR 168
>gi|90416993|ref|ZP_01224922.1| Ribosomal protein S9 [marine gamma proteobacterium HTCC2207] >gi|90331340|gb|EAS46584.1| Ribosomal protein S9 [marine gamma proteobacterium HTCC2207] (130 aa)
Score = 264, Expect = 6.7e-22, Identities = 62/130 (47%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++ ++ G GRRK+S A V L  G+G I IN R  + YF   +    + QP  I D    FD+ + V GGG  GQAGAIR GIARALL  + + R  L+ +  LTRD R  ERKK GL+ AR+ PQF+KR
  S:     1 MADTQFYGTGRRKTSAARVFLTAGSGNISINDRSIDVYFGREVARMIVRQPFEIVDMVNKFDMKITVNGGGNFGQAGAIRHGIARALLQYDENLRSPLRKAGFLTRDARQVERKKVGLHKARKRPQFSKR 130
>gi|194700998|gb|ACF84583.1| unknown [Zea mays] (224 aa)
Score = 263, Expect = 6.8e-22, Identities = 63/121 (52%), Positives = 80/121 (66%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK+++A V L  GTGK+ IN R   EY   N + ++  + PL+     KN+DVFVKV GGG +GQA AI LG+ARAL+  +N  R  LK   +LTRD R  ERKK GL  AR+ PQF+KR
  S:   103 GRRKTAIARVVLQEGTGKVFINFRDAKEYLQGNPMWMEYCKVPLMTLGFEKNYDVFVKVHGGGLSGQAQAICLGVARALVKISNANRVPLKSEGLLTRDTRIVERKKAGLKKARKRPQFSKR 224
>gi|58038926|ref|YP_190890.1| 30S ribosomal protein S9 [Gluconobacter oxydans 621H] >gi|58001340|gb|AAW60234.1| SSU ribosomal protein S9P [Gluconobacter oxydans 621H] (163 aa)
Score = 263, Expect = 6.8e-22, Identities = 59/121 (48%), Positives = 73/121 (60%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +VA V + PG G I++N R    YF   ++   + QP +I D    FDV+  V GGG +GQAGA+R GI+RAL       R  LK +  LTRD R  ERKKYG   ARRS QF+KR
  S:    43 GRRKDAVARVWIKPGKGDIIVNGRPVTTYFARPVLRMLLTQPFLIADRYNQFDVYCTVTGGGLSGQAGAVRHGISRALTYYEPSLRGILKAAGFLTRDSRIVERKKYGRAKARRSFQFSKR 163
>gi|83942337|ref|ZP_00954798.1| 30S ribosomal protein S9 [Sulfitobacter sp. EE-36] >gi|83953556|ref|ZP_00962277.1| 30S ribosomal protein S9 [Sulfitobacter sp. NAS-14.1] >gi|83841501|gb|EAP80670.1| 30S ribosomal protein S9 [Sulfitobacter sp. NAS-14.1] >gi|83846430|gb|EAP84306.1| 30S ribosomal protein S9 [Sulfitobacter sp. EE-36] (166 aa)
Score = 263, Expect = 6.9e-22, Identities = 56/121 (46%), Positives = 78/121 (64%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+++N +  NEYF   ++   + QP  IT T   FDV   V GGG +GQAGA++ G+++AL + +   R  LK +  LTRD R  ERKKYG   AR+S QF+KR
  S:    46 GKRKDAVARVWIKPGSGKVIVNGKAQNEYFARPVLQMILAQPFTITGTDGQFDVVATVKGGGLSGQAGAVKHGVSKALQLYDPSLRGALKAAGFLTRDSRVVERKKYGRAKARKSFQFSKR 166
>gi|149203852|ref|ZP_01880821.1| 30S ribosomal protein S9P [Roseovarius sp. TM1035] >gi|149142969|gb|EDM31011.1| 30S ribosomal protein S9P [Roseovarius sp. TM1035] (163 aa)
Score = 263, Expect = 7.2e-22, Identities = 56/121 (46%), Positives = 79/121 (65%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+++N +  NEYF   ++   ++QP  I+ T   FDV   V GGG +GQAGA++ G+++AL + +   R  LK +  LTRD R  ERKKYG   ARRS QF+KR
  S:    43 GKRKDAVARVWIKPGSGKVVVNGKPMNEYFARPVLQMILKQPFTISGTEGQFDVMATVAGGGLSGQAGAVKHGVSKALQLYDPSLRGALKAAGFLTRDSRVVERKKYGKRKARRSFQFSKR 163
>gi|196235608|ref|ZP_03134410.1| ribosomal protein S9 [Thermus aquaticus Y51MC23] >gi|196220352|gb|EDY14969.1| ribosomal protein S9 [Thermus aquaticus Y51MC23] (128 aa)
Score = 263, Expect = 7.4e-22, Identities = 61/126 (48%), Positives = 79/126 (62%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRK +VA V L PG+GKI +N     +YF   +      +PL + D    FD ++ V GGG +GQ  AI+LG+ARALL  N D+R  LK    LTRD R  ERKKYG + ARR+PQ++KR
  S:     3 QYYGTGRRKEAVARVFLRPGSGKITVNGLDFGDYFQGLVRAVAALEPLRVVDALGRFDAYITVRGGGKSGQIDAIKLGVARALLQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR 128
>gi|113460896|ref|YP_718963.1| 30S ribosomal protein S9 [Haemophilus somnus 129PT] >gi|170717446|ref|YP_001784544.1| ribosomal protein S9 [Haemophilus somnus 2336] >gi|122945225|sp|Q0I2N2|RS9_HAES1 30S ribosomal protein S9 >gi|189045700|sp|B0UTU5|RS9_HAES2 30S ribosomal protein S9 >gi|401048|sp|P31782|RS9_HAESO 30S ribosomal protein S9 >gi|7240281|gb|AAB20821.2| ribosomal protein S9 homolog [Haemophilus somnus] >gi|112822939|gb|ABI25028.1| SSU ribosomal protein S9P [Haemophilus somnus 129PT] >gi|168825575|gb|ACA30946.1| ribosomal protein S9 [Haemophilus somnus 2336] (130 aa)
Score = 263, Expect = 7.6e-22, Identities = 61/130 (46%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +  G GRRKSS A V + PG+GKI+INQR+ + YF        + QPL + +     D++V V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     1 MAENQNYGTGRRKSSSARVFIKPGSGKIVINQRELDVYFGRETSRMIVRQPLELVELTDKLDLYVTVKGGGISGQAGAIRHGITRALIEYDETLRPALRAAGFVTRDARRVERKKIGLHKARRRPQYSKR 130
>gi|194684960|emb|CAR47160.1| 30S ribosomal protein S9 [Proteus mirabilis HI4320] (130 aa)
Score = 263, Expect = 7.7e-22, Identities = 61/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++ +Y G GRRKSS A V + PG+G I+IN+R    YF        + QPL + D     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R+ ERKK GL  ARR PQF+KR
  S:     1 MADNQYYGTGRRKSSSARVFIKPGSGNIVINKRSLEVYFGRETARMVVRQPLELVDMLGKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSDLRKAGFVTRDARSVERKKVGLRKARRRPQFSKR 130
>gi|163725123|ref|ZP_02132648.1| ribosomal protein S9 [Desulfatibacillum alkenivorans AK-01] >gi|161401520|gb|EDQ25763.1| ribosomal protein S9 [Desulfatibacillum alkenivorans AK-01] (131 aa)
Score = 263, Expect = 7.7e-22, Identities = 61/125 (48%), Positives = 79/125 (63%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +   G+RKS++A   L PG+G I +N +  ++YF     I+   Q L +T+ + + DV V V GGGFTGQAGAIR GI +ALL    D R  LK +  +TRDPR KERKKYG  GAR   QF+KR
  S:     7 FYATGKRKSAIARAWLRPGSGNITVNNQPIDKYFTVESAIKRTLQALTLTNLQDSVDVNVTVKGGGFTGQAGAIRHGITKALLEYQPDLRGVLKKAGYITRDPRVKERKKYGQKGARARFQFSKR 131
>gi|116490692|ref|YP_810236.1| SSU ribosomal protein S9P [Oenococcus oeni PSU-1] >gi|122277124|sp|Q04G51|RS9_OENOB 30S ribosomal protein S9 >gi|116091417|gb|ABJ56571.1| SSU ribosomal protein S9P [Oenococcus oeni PSU-1] (130 aa)
Score = 263, Expect = 7.8e-22, Identities = 73/130 (56%), Positives = 87/130 (66%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+N +Y G GRRK SVA V+L PG+GKI IN R   EY P + +   + QP  +T T   +DV V VVGGGF GQAGA R GIARALL  + DFR  LK + +LTRD R  ERKK GL  ARR+ QF+KR
  S:     1 MANTQYAGTGRRKVSVARVRLTPGSGKITINNRSFEEYIPAANLRAVVIQPFAVTSTDGTYDVNVNVVGGGFAGQAGATRHGIARALLQVDPDFRPALKSAGLLTRDSRMVERKKPGLKKARRASQFSKR 130
>gi|171060125|ref|YP_001792474.1| ribosomal protein S9 [Leptothrix cholodnii SP-6] >gi|170777570|gb|ACB35709.1| ribosomal protein S9 [Leptothrix cholodnii SP-6] (130 aa)
Score = 263, Expect = 8.1e-22, Identities = 60/123 (48%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V +  GTGKI++N +   EYF     I   +QPL +T+  + FD+ V V GGG +GQAGA+R G+ RAL+  +   +  L  +  +TRD R  ERKK GL+GARR  QF+KR
  S:     8 GTGRRKSSVARVFIKKGTGKIIVNGKTVEEYFGRQTSIMICKQPLFLTNNAEAFDIKVNVHGGGESGQAGAVRHGVTRALIDYDAALKPELSNAGFVTRDAREVERKKVGLHGARRRKQFSKR 130
>gi|15602386|ref|NP_245458.1| RpS9 [Pasteurella multocida subsp. multocida str. Pm70] >gi|20139922|sp|Q9CNB1|RS9_PASMU 30S ribosomal protein S9 >gi|12720782|gb|AAK02605.1| RpS9 [Pasteurella multocida subsp. multocida str. Pm70] (130 aa)
Score = 263, Expect = 8.1e-22, Identities = 62/130 (47%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +  G GRRKSS A V + PG+GKI INQR  + YF        + QPL + +  +  D++V V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQNYGTGRRKSSSARVFIKPGSGKITINQRDLDVYFGRETARMIVRQPLELVEMTEKLDLYVTVKGGGISGQAGAIRHGITRALIEYDESLRSVLRAAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|114321390|ref|YP_743073.1| SSU ribosomal protein S9P [Alkalilimnicola ehrlichei MLHE-1] >gi|122311090|sp|Q0A6F4|RS9_ALHEH 30S ribosomal protein S9 >gi|114227784|gb|ABI57583.1| SSU ribosomal protein S9P [Alkalilimnicola ehrlichei MLHE-1] (130 aa)
Score = 263, Expect = 8.1e-22, Identities = 62/130 (47%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V L PG+G I +N R  +EYF        + QPL + D  + FDV V V GGG +GQAGAIR GI RAL+  +   ++ L  +  +TRD R  ERKK GL+ ARR+ QF+KR
  S:     1 MAEQQYYGTGRRKTSSARVFLRPGSGDIKVNGRSLDEYFGRETARMIVRQPLELVDATEQFDVQVTVAGGGPSGQAGAIRHGITRALVQYDEALKQPLSKAGYVTRDARMVERKKIGLHKARRATQFSKR 130
>gi|189461537|ref|ZP_03010322.1| hypothetical protein BACCOP_02196 [Bacteroides coprocola DSM 17136] >gi|189431743|gb|EDV00728.1| hypothetical protein BACCOP_02196 [Bacteroides coprocola DSM 17136] (128 aa)
Score = 263, Expect = 8.3e-22, Identities = 61/123 (49%), Positives = 85/123 (69%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            LGRRKS+VA V +  GTGKI IN+R   +YFP++++   ++QPL   +  + +D+ V + GGGFTGQ+ A+RL IARAL+  N + +KTL+    +TRDPR+ ERKK G   ARR  QF+KR
  S:     6 ALGRRKSAVARVFVSEGTGKITINKRDLAQYFPSTILQYVVKQPLNKLEVAEKYDIKVNLCGGGFTGQSQALRLAIARALVKINPEDKKTLRAEGFMTRDPRSVERKKPGRPKARRRFQFSKR 128
>gi|108796927|ref|YP_636227.1| ribosomal protein S9 [Pseudendoclonium akinetum] >gi|122217863|sp|Q3ZJ40|RR9_PSEAK Chloroplast 30S ribosomal protein S9 >gi|56159625|gb|AAV80649.1| ribosomal protein S9 [Pseudendoclonium akinetum] (141 aa)
Score = 262, Expect = 9.3e-22, Identities = 59/121 (48%), Positives = 79/121 (65%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPN-SLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK+S+A V+L PG G+  IN     EY      +I  +++PL     +  F++ +KV GGG  GQ  AI+LGIARAL   +  +R +LK+   LTRDPR KERKKYGL  AR++PQF+KR
  S:    20 GRRKTSIATVQLFPGNGEFTINGISGIEYMQQKEELIFAIQEPLHFLKLKNEFNLIIKVKGGGLVGQVNAIKLGIARALCEFDLTYRNSLKLKGFLTRDPRCKERKKYGLKKARKAPQFSKR 141
>gi|126663060|ref|ZP_01734058.1| 30S ribosomal protein S9 [Flavobacteria bacterium BAL38] >gi|126624718|gb|EAZ95408.1| 30S ribosomal protein S9 [Flavobacteria bacterium BAL38] (128 aa)
Score = 262, Expect = 9.9e-22, Identities = 59/122 (48%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK +VA V +  GTGKI +N+R+   YFP + +   + QP+ +T+   NFDV V V GGG TGQA A+R+ IARA+     + R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKCAVARVYVSEGTGKITVNKREFTNYFPTATLQYKVMQPMSMTENASNFDVKVNVYGGGSTGQAEAVRMAIARAMCEVEAENRAILKPEGLLTRDPRMVERKKFGQKKARKRFQFSKR 128
>gi|188532461|ref|YP_001906258.1| 30S ribosomal protein S9 [Erwinia tasmaniensis] >gi|188027503|emb|CAO95350.1| 30S ribosomal protein S9 [Erwinia tasmaniensis] (130 aa)
Score = 262, Expect = 1.0e-21, Identities = 62/130 (47%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +  G GRRKSS A V + PG+G I+INQR   +YF        + QPL + D    FD+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQNYGTGRRKSSSARVFIKPGSGNIVINQRSLEQYFGRETARMVVRQPLELLDMVGKFDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|177671982|ref|ZP_02944904.1| ribosomal protein S9 [Micrococcus luteus NCTC 2665] >gi|172071238|gb|EDT57283.1| ribosomal protein S9 [Micrococcus luteus NCTC 2665] (162 aa)
Score = 262, Expect = 1.0e-21, Identities = 59/123 (47%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDF-RKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK +VA V+LVPG+G+  IN R    YFPN L  Q++  P  + +    +DV  ++ GGG +GQAGA+RLGI+RAL   + +  R  LK +  LTRD R  ERKK GL  AR++ QF+KR
  S:    39 AVGRRKEAVARVRLVPGSGQWTINGRALENYFPNKLHQQEVSDPFTLLELTGAYDVIARIHGGGPSGQAGALRLGISRALNEIDREHNRPALKKAGFLTRDARVIERKKAGLKKARKASQFSKR 162
>gi|189501516|ref|YP_001957233.1| ribosomal protein S9 [Candidatus Amoebophilus asiaticus 5a2] >gi|189496957|gb|ACE05504.1| ribosomal protein S9 [Candidatus Amoebophilus asiaticus 5a2] (128 aa)
Score = 262, Expect = 1.1e-21, Identities = 60/123 (48%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK+S+A + L  G G I IN+    +YFP+  +I  ++QPL   +    +D+ + V GGGF GQA A+RLGIARAL   N  FR +LK    LTRD R  ERKKYG   AR+S QF+KR
  S:     6 AVGRRKTSIARIYLSNGKGDISINKTSLEKYFPSEAIITLVKQPLQQIEAIDQYDIKINVKGGGFKGQAEAVRLGIARALCEVNPSFRPSLKKEGFLTRDSRMVERKKYGHKKARKSFQFSKR 128
>gi|117617920|ref|YP_858343.1| ribosomal protein S9 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166228548|sp|A0KPZ2|RS9_AERHH 30S ribosomal protein S9 >gi|117559327|gb|ABK36275.1| ribosomal protein S9 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (130 aa)
Score = 262, Expect = 1.1e-21, Identities = 59/130 (45%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V +  G+GKI+INQR   +YF        + QPL + +  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ AR+ PQ++KR
  S:     1 MAENQYYGTGRRKSSTARVFIKAGSGKIVINQRSLEQYFGRPTARMVVRQPLELVEMTEKLDLYITVNGGGISGQAGAIRHGITRALMQYDETLRSELRKAGFVTRDARKVERKKVGLHKARKRPQYSKR 130
>gi|37527869|ref|NP_931214.1| 30S ribosomal protein S9 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|39932031|sp|Q7N079|RS9_PHOLL 30S ribosomal protein S9 >gi|36787305|emb|CAE16386.1| 30S ribosomal protein S9 [Photorhabdus luminescens subsp. laumondii TTO1] (130 aa)
Score = 262, Expect = 1.1e-21, Identities = 61/130 (46%), Positives = 79/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V + PG+G I+IN+R    YF        + QPL + D     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSSARVFIKPGSGNIVINKRSLEVYFGRETARMVVRQPLELVDMLGKLDLYITVKGGGISGQAGAIRHGITRALMAYDETLRSDLRKAGFVTRDAREVERKKVGLRKARRRPQFSKR 130
>gi|167730807|emb|CAO81719.1| 30S ribosomal subunit protein S9 [Candidatus Cloacamonas acidaminovorans] (128 aa)
Score = 262, Expect = 1.1e-21, Identities = 61/125 (48%), Positives = 80/125 (64%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +  +GRRK++VA V+L+PGTGK +IN  +  +Y     +   +EQPL       NFDV+V V GGG +GQAGAIR GI+RAL+  + + R  LK    LTRDPR  ERKK G   AR+  QF+KR
  S:     4 FDAVGRRKNAVARVRLMPGTGKRIINNIQMKKYLQRETLEMIVEQPLQTVGLSDNFDVYVNVYGGGLSGQAGAIRHGISRALVEYDENLRPVLKTRGFLTRDPRMVERKKSGRPKARKRFQFSKR 128
>gi|163812181|ref|ZP_02203859.1| ribosomal protein S9 [Dehalococcoides sp. VS] >gi|157404217|gb|EDO70259.1| ribosomal protein S9 [Dehalococcoides sp. VS] (132 aa)
Score = 262, Expect = 1.1e-21, Identities = 63/128 (49%), Positives = 84/128 (65%)
  Q:     3 NVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           N  + G+GRRK++VA VKL  G G I+I+ +   E F        +  P+++TDT   F+  VKV+GGG TGQ+GAI  GIARAL   ++  R TLK + +LTRD R KERKK GL  AR++PQ+TKR
  S:     5 NTYFIGVGRRKTAVATVKLTSGNGVIVIDGKPIEERFTRIQERNVILNPMMVTDTMGKFNAVVKVLGGGVTGQSGAIAHGIARALEKTDDKLRATLKSNGLLTRDDRTKERKKPGLKRARKAPQYTKR 132
>gi|118411082|ref|YP_874477.1| 30S ribosomal protein S9 [Phaeodactylum tricornutum] >gi|125987769|sp|A0T0K2|RR9_PHATR Chloroplast 30S ribosomal protein S9 >gi|116739829|gb|ABK20700.1| 30S ribosomal protein S9 [Phaeodactylum tricornutum] (138 aa)
Score = 262, Expect = 1.1e-21, Identities = 62/126 (49%), Positives = 80/126 (63%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           E  GLG+RK S+A V L+PG GKI+IN+   N+Y   N   +  +  PL   +  K FD+   V GGG TGQA AI+LG+AR L   + + R  LK    LTRD R KERKKYGL  AR++PQ++KR
  S:    12 ENIGLGKRKQSIARVFLLPGDGKIIINKTSGNKYLQYNDNYLNTVWSPLEKLNLEKQFDIVALVQGGGLTGQAQAIQLGVARLLCTMDKENRSILKPFGFLTRDSRIKERKKYGLRKARKAPQYSKR 138
>gi|153208231|ref|ZP_01946641.1| ribosomal protein S9 [Coxiella burnetii 'MSU Goat Q177'] >gi|120576136|gb|EAX32760.1| ribosomal protein S9 [Coxiella burnetii 'MSU Goat Q177'] (139 aa)
Score = 261, Expect = 1.2e-21, Identities = 64/123 (52%), Positives = 82/123 (66%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND------FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+GRRK+S A V L  GTG+I+IN    +EYF        + QPLV  D +  FDV+  V GGG +GQAGAIR GI RAL+  + +      +R TL+ +  +TRDPR  ERKK GL+GARR  QF+KR
  S:    11 GMGRRKTSSARVFLRSGTGQIIINGLPLDEYFGRETARMVVRQPLVKLDVQSRFDVYATVQGGGDSGQAGAIRHGITRALIQYDEEGGEGGTWRSTLRKAGFVTRDPRMVERKKVGLHGARRGTQFSKR 139
>gi|145297424|ref|YP_001140265.1| 30S ribosomal subunit protein S9 [Aeromonas salmonicida subsp. salmonicida A449] >gi|166228549|sp|A4SHZ5|RS9_AERS4 30S ribosomal protein S9 >gi|142850196|gb|ABO88517.1| 30S ribosomal subunit protein S9 [Aeromonas salmonicida subsp. salmonicida A449] (130 aa)
Score = 261, Expect = 1.2e-21, Identities = 59/130 (45%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V +  G+GKI+INQR   +YF        + QPL + +  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ AR+ PQ++KR
  S:     1 MAENQYYGTGRRKSSTARVFIKAGSGKIVINQRSLEQYFGRPTARMVVRQPLELVEMTEKLDLYITVNGGGISGQAGAIRHGITRALMQYDETLRAELRKAGFVTRDARKVERKKVGLHKARKRPQYSKR 130
>gi|24375427|ref|NP_719470.1| 30S ribosomal protein S9 [Shewanella oneidensis MR-1] >gi|113971600|ref|YP_735393.1| 30S ribosomal protein S9 [Shewanella sp. MR-4] >gi|114046188|ref|YP_736738.1| 30S ribosomal protein S9 [Shewanella sp. MR-7] >gi|117919145|ref|YP_868337.1| 30S ribosomal protein S9 [Shewanella sp. ANA-3] >gi|120600222|ref|YP_964796.1| 30S ribosomal protein S9 [Shewanella sp. W3-18-1] >gi|124547919|ref|ZP_01706726.1| ribosomal protein S9 [Shewanella putrefaciens 200] >gi|126175846|ref|YP_001051995.1| ribosomal protein S9 [Shewanella baltica OS155] >gi|146291850|ref|YP_001182274.1| 30S ribosomal protein S9 [Shewanella putrefaciens CN-32] >gi|149115214|ref|ZP_01841960.1| ribosomal protein S9 [Shewanella baltica OS223] >gi|152999242|ref|YP_001364923.1| 30S ribosomal protein S9 [Shewanella baltica OS185] >gi|160873855|ref|YP_001553171.1| 30S ribosomal protein S9 [Shewanella baltica OS195] >gi|123131746|sp|Q0HYX4|RS9_SHESR 30S ribosomal protein S9 >gi|123324695|sp|Q0HF31|RS9_SHESM 30S ribosomal protein S9 >gi|166229601|sp|A3D8R3|RS9_SHEB5 30S ribosomal protein S9 >gi|166229602|sp|A6WJ71|RS9_SHEB8 30S ribosomal protein S9 >gi|166229604|sp|A4Y3E2|RS9_SHEPC 30S ribosomal protein S9 >gi|166229605|sp|A0KT12|RS9_SHESA 30S ribosomal protein S9 >gi|166229606|sp|A1RNJ7|RS9_SHESW 30S ribosomal protein S9 >gi|189045713|sp|A9L112|RS9_SHEB9 30S ribosomal protein S9 >gi|39932200|sp|Q8EAG3|RS9_SHEON 30S ribosomal protein S9 >gi|24350268|gb|AAN56914.1|AE015825_13 ribosomal protein S9 [Shewanella oneidensis MR-1] >gi|113886284|gb|ABI40336.1| ribosomal protein S9 [Shewanella sp. MR-4] >gi|113887630|gb|ABI41681.1| ribosomal protein S9 [Shewanella sp. MR-7] >gi|117611477|gb|ABK46931.1| ribosomal protein S9 [Shewanella sp. ANA-3] >gi|120560315|gb|ABM26242.1| ribosomal protein S9 [Shewanella sp. W3-18-1] >gi|124508895|gb|EAY52983.1| ribosomal protein S9 [Shewanella putrefaciens 200] >gi|125999051|gb|ABN63126.1| ribosomal protein S9 [Shewanella baltica OS155] >gi|145563540|gb|ABP74475.1| ribosomal protein S9 [Shewanella putrefaciens CN-32] >gi|146865027|gb|EDK50386.1| ribosomal protein S9 [Shewanella baltica OS223] >gi|151363860|gb|ABS06860.1| ribosomal protein S9 [Shewanella baltica OS185] >gi|160859377|gb|ABX47911.1| ribosomal protein S9 [Shewanella baltica OS195] (130 aa)
Score = 261, Expect = 1.3e-21, Identities = 60/130 (46%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V    G+G I++NQR  ++YF        + QPL + +     D++V V GGG TGQAGAIR GI RAL+  +   R +L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAATQYYGTGRRKTSTARVFAKAGSGNIVVNQRPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALMQLDEALRPSLRSAGFVTRDARKVERKKVGLRKARRKPQFSKR 130
>gi|42629472|ref|ZP_00155018.1| COG0103: Ribosomal protein S9 [Haemophilus influenzae R2846] >gi|42631744|ref|ZP_00157282.1| COG0103: Ribosomal protein S9 [Haemophilus influenzae R2866] >gi|68250026|ref|YP_249138.1| 30S ribosomal protein S9 [Haemophilus influenzae 86-028NP] >gi|145629445|ref|ZP_01785243.1| 30S ribosomal protein S9 [Haemophilus influenzae 22.1-21] >gi|145630750|ref|ZP_01786528.1| 30S ribosomal protein S9 [Haemophilus influenzae 22.4-21] >gi|145634980|ref|ZP_01790687.1| 30S ribosomal protein S9 [Haemophilus influenzae PittAA] >gi|145636154|ref|ZP_01791824.1| 30S ribosomal protein S9 [Haemophilus influenzae PittHH] >gi|145638941|ref|ZP_01794549.1| 30S ribosomal protein S9 [Haemophilus influenzae PittII] >gi|145641604|ref|ZP_01797181.1| 30S ribosomal protein S9 [Haemophilus influenzae R3021] >gi|148825985|ref|YP_001290738.1| 30S ribosomal protein S9 [Haemophilus influenzae PittEE] >gi|148826945|ref|YP_001291698.1| 30S ribosomal protein S9 [Haemophilus influenzae PittGG] >gi|81335550|sp|Q4QKG9|RS9_HAEI8 30S ribosomal protein S9 >gi|166229561|sp|A5UC54|RS9_HAEIE 30S ribosomal protein S9 >gi|166229562|sp|A5UEV9|RS9_HAEIG 30S ribosomal protein S9 >gi|68058225|gb|AAX88478.1| 30S ribosomal protein S9 [Haemophilus influenzae 86-028NP] >gi|144978288|gb|EDJ88052.1| 30S ribosomal protein S9 [Haemophilus influenzae 22.1-21] >gi|144983632|gb|EDJ91092.1| 30S ribosomal protein S9 [Haemophilus influenzae R3021] >gi|145267846|gb|EDK07843.1| 30S ribosomal protein S9 [Haemophilus influenzae PittAA] >gi|145270676|gb|EDK10609.1| 30S ribosomal protein S9 [Haemophilus influenzae PittHH] >gi|145271913|gb|EDK11822.1| 30S ribosomal protein S9 [Haemophilus influenzae PittII] >gi|145273651|gb|EDK13520.1| 30S ribosomal protein S9 [Haemophilus influenzae 22.4-21] >gi|148716145|gb|ABQ98355.1| 30S ribosomal protein S9 [Haemophilus influenzae PittEE] >gi|148718187|gb|ABQ99314.1| 30S ribosomal protein S9 [Haemophilus influenzae PittGG] (130 aa)
Score = 261, Expect = 1.3e-21, Identities = 60/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +  G GRRKSS A V + PG+GKI INQR+ + YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     1 MAENQNYGTGRRKSSSARVFIKPGSGKITINQRELDVYFGRETARMVVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFVTRDARRVERKKVGLHKARRRPQYSKR 130
>gi|163749293|ref|ZP_02156542.1| ribosomal protein S9 [Shewanella benthica KT99] >gi|161331012|gb|EDQ01938.1| ribosomal protein S9 [Shewanella benthica KT99] (130 aa)
Score = 261, Expect = 1.3e-21, Identities = 60/130 (46%), Positives = 79/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V    GTG I++NQ   ++YF        + QPL + +     D++V V GGG TGQAGAIR GI RALL  +   R +L+ +  +TRD R  ERKK GL  AR+ PQF+KR
  S:     1 MAATQYYGTGRRKTSTARVFAKAGTGNIVVNQLPLDQYFGRETARMVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALLELDETLRPSLRAAGFVTRDARKVERKKVGLRKARKKPQFSKR 130
>gi|159901455|ref|YP_001547702.1| ribosomal protein S9 [Herpetosiphon aurantiacus ATCC 23779] >gi|159894494|gb|ABX07574.1| ribosomal protein S9 [Herpetosiphon aurantiacus ATCC 23779] (132 aa)
Score = 261, Expect = 1.4e-21, Identities = 60/125 (48%), Positives = 87/125 (69%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDM-EQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++G GRRK++VA V+L PGTG+ ++N R   E+F    + Q +  QPL+  +   +F+V +KV GGG TG+A A+R GIARAL+ A+  F+  ++ + +LTRD R KERKK GL  ARR+ Q+TKR
  S:     7 FQGTGRRKTAVARVRLYPGTGEFVVNGRTSEEFFGGRALYQQLIRQPLLAANQLGSFNVLIKVRGGGDTGRAEAVRHGIARALVDADPAFKPIMRAAGLLTRDARKKERKKPGLVKARRAKQYTKR 132
>gi|91204593|emb|CAJ70821.1| strongly similar to 30S ribosomal protein S9 [Candidatus Kuenenia stuttgartiensis] (131 aa)
Score = 261, Expect = 1.4e-21, Identities = 61/123 (49%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK+SVA V++  GTGK+ +N+R  NEYFP       +  P   T T   +DV V V GGG +GQAGA+ +GIARA+   ++     L+ + +LTRD R KERKKYG  GAR+S Q+TKR
  S:     9 GTGRRKTSVASVRIKKGTGKVTVNKRDINEYFPVDRHKGVVLNPFKATKTLGGYDVLVNVRGGGISGQAGAVCMGIARAMTKIDSALADDLRENGLLTRDSRMKERKKYGRKGARKSFQWTKR 131
>gi|84494732|ref|ZP_00993851.1| putative ribosomal protein S9 [Janibacter sp. HTCC2649] >gi|84384225|gb|EAQ00105.1| putative ribosomal protein S9 [Janibacter sp. HTCC2649] (172 aa)
Score = 261, Expect = 1.4e-21, Identities = 57/121 (47%), Positives = 80/121 (66%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDF-RKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK ++A V++VPGTG+  +N R    YFPN +  Q + +P  I +    +DV V+V GGG +GQAGA+RLG+AR+L   + +  R  LK +  L RD R  ERKK GL  AR++PQ++KR
  S:    51 GRRKQAIARVRIVPGTGEWKVNGRTLEAYFPNKVHQQIVNEPFTILELADAYDVLVRVHGGGPSGQAGAVRLGVARSLNGIDEELNRPALKKAGFLKRDSRVPERKKAGLKKARKAPQYSKR 172
>gi|145219272|ref|YP_001129981.1| 30S ribosomal protein S9 [Prosthecochloris vibrioformis DSM 265] >gi|145205436|gb|ABP36479.1| SSU ribosomal protein S9P [Prosthecochloris vibrioformis DSM 265] (129 aa)
Score = 261, Expect = 1.4e-21, Identities = 56/122 (45%), Positives = 82/122 (67%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK+SVA V + PG G+++IN+    EYF + +  +   +PLV+ +  ++FD+ V V GGG +GQ+GA+ L IARAL   ++  R   K  ++LTRDPR  ERKK+G   AR+S QF+KR
  S:     8 VGRRKTSVARVFMTPGKGRVIINKLPAEEYFKDEVKCRVALRPLVLAEKTEDFDIKVNVHGGGISGQSGAVSLAIARALAETDDSVRAVFKPERLLTRDPRMVERKKFGRKKARKSFQFSKR 129
>gi|118602904|ref|YP_904119.1| SSU ribosomal protein S9P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567843|gb|ABL02648.1| SSU ribosomal protein S9P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (131 aa)
Score = 261, Expect = 1.5e-21, Identities = 61/125 (48%), Positives = 78/125 (62%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y   GRRK+SVA V +  G G  ++N+R  NEYF        + QPL + + R  FD  + V GGG TGQAGAIRLG+ RAL+V +ND R  L+ +  +TRD R  ERKK G   AR+S QF+KR
  S:     7 YYATGRRKTSVARVYMTKGKGIFMVNRRPMNEYFGRETSSMIINQPLDMVEMRDKFDFNIMVKGGGDTGQAGAIRLGVTRALMVYDNDLRSELRKAGFVTRDARIVERKKVGRKKARKSEQFSKR 131
>gi|163698854|ref|ZP_02117715.1| ribosomal protein S9 [Methylobacterium nodulans ORS 2060] >gi|162434705|gb|EDQ45288.1| ribosomal protein S9 [Methylobacterium nodulans ORS 2060] (162 aa)
Score = 261, Expect = 1.5e-21, Identities = 57/121 (47%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG G I +N R  + YF   ++   ++QPL + +    +D+ V V GGG +GQAGA+R G+ARAL     + R  LK    LTRDPR  ERKKYG   ARRS QF+KR
  S:    42 GKRKDAVARVWIKPGAGTITVNDRPVDTYFARPVLRMILQQPLHVANRVDQYDIVVTVTGGGLSGQAGAVRHGLARALTYYEPELRSPLKREGFLTRDPRVVERKKYGRKKARRSFQFSKR 162
>gi|59802333|ref|YP_209045.1| 30S ribosomal protein S9 [Neisseria gonorrhoeae FA 1090] >gi|194099701|ref|YP_002002836.1| 30S ribosomal protein S9 [Neisseria gonorrhoeae NCCP11945] >gi|75507275|sp|Q5F5A4|RS9_NEIG1 30S ribosomal protein S9 >gi|59719228|gb|AAW90633.1| putative 30S ribosomal protein S9 [Neisseria gonorrhoeae FA 1090] >gi|193934991|gb|ACF30815.1| 30S ribosomal protein S9 [Neisseria gonorrhoeae NCCP11945] (130 aa)
Score = 261, Expect = 1.5e-21, Identities = 63/130 (48%), Positives = 83/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+   Y G GRRKSSVA V L  GTG+I++N R  +E+F        + QPLV+T+  ++ D+ V VVGGG TGQ+GAIR GI RAL+  +   +  L  +  +TRD R  ERKK GL  ARR+ QF+KR
  S:     1 MNGKYYYGTGRRKSSVARVFLTKGTGQIIVNGRPVDEFFARETSRMVVRQPLVLTENAESLDIKVNVVGGGETGQSGAIRHGITRALIDFDAALKPALSQAGFVTRDAREVERKKPGLRKARRAKQFSKR 130
>gi|85858181|ref|YP_460383.1| SSU ribosomal protein S9P [Syntrophus aciditrophicus SB] >gi|85721272|gb|ABC76215.1| SSU ribosomal protein S9P [Syntrophus aciditrophicus SB] (134 aa)
Score = 260, Expect = 1.5e-21, Identities = 58/130 (44%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M    +   GRRKS+VA V +  G G + +N+R  ++YFP   +   + QP  +   + +FD +V V GGG +GQAGA++  IARAL   + + R  +K    LTRDPRAKERKKYG  GAR+  QF+KR
  S:     5 MLEKRFYATGRRKSAVARVYMKEGNGVLTVNKRDFDDYFPRESLKMLIRQPFEVVGKQNHFDCYVNVSGGGISGQAGAVKHAIARALQEYDAELRSVMKKEGFLTRDPRAKERKKYGQPGARKRFQFSKR 134
>gi|90022805|ref|YP_528632.1| SSU ribosomal protein S9P [Saccharophagus degradans 2-40] >gi|122995920|sp|Q21FV9|RS9_SACD2 30S ribosomal protein S9 >gi|89952405|gb|ABD82420.1| SSU ribosomal protein S9P [Saccharophagus degradans 2-40] (130 aa)
Score = 260, Expect = 1.5e-21, Identities = 61/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V L  G GKI +N +  +EYF   +    + QP+ +TD  + FD+ V V GGG  GQAGAIR G+ RAL+  +   R TL+ +  +TRD R  ERKK GL  AR+ PQF+KR
  S:     1 MAAEQYYGTGRRKTSTARVFLTLGGGKITVNGKTLDEYFGREVARMIVRQPIELTDNVEKFDINVTVKGGGSFGQAGAIRHGLTRALMAYDEAMRPTLRAAGYVTRDAREVERKKVGLRKARKKPQFSKR 130
>gi|163731888|ref|ZP_02139335.1| 30S ribosomal protein S9 [Roseobacter litoralis Och 149] >gi|161395342|gb|EDQ19664.1| 30S ribosomal protein S9 [Roseobacter litoralis Och 149] (165 aa)
Score = 260, Expect = 1.6e-21, Identities = 55/121 (45%), Positives = 77/121 (63%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+ +N +  NEYF   ++   + QP  I+ T   FDV   V GGG +GQAGA++ G+++AL + +   R  LK +  LTRD R  ERKKYG   AR+S QF+KR
  S:    45 GKRKDAVARVWIKPGSGKVTVNGKAQNEYFARPVLQMILAQPFSISGTEGQFDVVATVKGGGLSGQAGAVKHGVSKALQLYDPSLRGALKAAGFLTRDSRVVERKKYGKAKARKSFQFSKR 165
>gi|88704081|ref|ZP_01101796.1| 30S ribosomal protein S9 [gamma proteobacterium KT 71] >gi|88701908|gb|EAQ99012.1| 30S ribosomal protein S9 [Congregibacter litoralis KT71] (130 aa)
Score = 260, Expect = 1.6e-21, Identities = 63/130 (48%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK+S A V L  G G I +NQR  ++YF   +    + QPL + D  + FD+ V V GGG  GQAGAIR GI RAL+  +   R TL+ +  +TRD R  ERKK GL  AR+ PQF+KR
  S:     1 MSATQYYGTGRRKTSTARVFLRSGGGDITVNQRPLDQYFGREVARMIVRQPLELVDLVEKFDIKVTVEGGGSFGQAGAIRHGITRALMEYDEALRGTLRGAGFVTRDAREVERKKVGLRKARKRPQFSKR 130
>gi|119776202|ref|YP_928942.1| 30S ribosomal protein S9 [Shewanella amazonensis SB2B] >gi|166229600|sp|A1SA66|RS9_SHEAM 30S ribosomal protein S9 >gi|119768702|gb|ABM01273.1| ribosomal protein S9 [Shewanella amazonensis SB2B] (130 aa)
Score = 260, Expect = 1.6e-21, Identities = 60/130 (46%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V    G+G I++N+R  + YF        + QPL + +  +  D++V V GGG TGQAGAIR GI RAL+  +   R TL+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAATQYYGTGRRKTSTARVFAKVGSGNIIVNKRPLDVYFGRETARMVVRQPLELVEMTEKLDIYVTVKGGGITGQAGAIRHGITRALMELDESLRPTLRAAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|49475551|ref|YP_033592.1| 30S ribosomal protein S9 [Bartonella henselae str. Houston-1] >gi|81696166|sp|Q6G3I7|RS9_BARHE 30S ribosomal protein S9 >gi|49238357|emb|CAF27581.1| 30S ribosomal protein s9 [Bartonella henselae str. Houston-1] (161 aa)
Score = 260, Expect = 1.7e-21, Identities = 57/121 (47%), Positives = 77/121 (63%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GKI IN ++ ++YF   ++   + QP+V T+    FD+   V GGG +GQAGA+R GI++AL     + R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    41 GKRKDAVARVWIKPGSGKITINNKEFDKYFARPVLRMILRQPIVATNRDTQFDIIATVAGGGLSGQAGAVRHGISKALTYYEPELRTILKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 161
>gi|147669128|ref|YP_001213946.1| 30S ribosomal protein S9 [Dehalococcoides sp. BAV1] >gi|189045697|sp|A5FRV9|RS9_DEHSB 30S ribosomal protein S9 >gi|146270076|gb|ABQ17068.1| SSU ribosomal protein S9P [Dehalococcoides sp. BAV1] (132 aa)
Score = 260, Expect = 1.7e-21, Identities = 62/128 (48%), Positives = 84/128 (65%)
  Q:     3 NVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           N  + G+GRRK++VA VKL+ G G I+I+ +   E F        +  P+++TDT   F+  +KV+GGG TGQ+GAI  GIARAL   +   R TLK + +LTRD R KERKK GL  AR++PQ+TKR
  S:     5 NTYFIGVGRRKTAVATVKLMSGNGVIVIDGKPIEERFTRIQERNVILNPMMVTDTMGKFNAVIKVLGGGVTGQSGAIAHGIARALEKTDEKLRATLKSNGLLTRDDRTKERKKPGLKRARKAPQYTKR 132
>gi|89898283|ref|YP_515393.1| 30S ribosomal protein S9 [Chlamydophila felis Fe/C-56] >gi|123483385|sp|Q254P0|RS9_CHLFF 30S ribosomal protein S9 >gi|89331655|dbj|BAE81248.1| 30S ribosomal protein S9 [Chlamydophila felis Fe/C-56] (133 aa)
Score = 260, Expect = 1.8e-21, Identities = 60/121 (49%), Positives = 79/121 (65%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +V+ V+L PGTGKI +N +  +EYFP  +    +  PL +    + FD+ +++ GGG  GQ  A RLG+ARALL  N D ++ LK    LTRDPR KERKKYG   AR+S QF+KR
  S:    13 GRRKQAVSSVRLRPGTGKIDVNGKAFDEYFPLEIQRATILSPLKVLGHTEEFDLIIRINGGGIQGQVIATRLGLARALLKKNGDSKQELKSRGFLTRDPRKKERKKYGHKKARKSFQFSKR 133
>gi|78357650|ref|YP_389099.1| 30S ribosomal protein S9 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|123551908|sp|Q30Y42|RS9_DESDG 30S ribosomal protein S9 >gi|78220055|gb|ABB39404.1| SSU ribosomal protein S9P [Desulfovibrio desulfuricans G20] (130 aa)
Score = 260, Expect = 1.8e-21, Identities = 60/123 (48%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK++ A  +L  GTGKI++N R  +EYFP   +   + QPL +T   ++FD+ V V GGG  GQA A+R GI+RALL  + + R +LK +  LTRD R KERKKYG   AR   Q++KR
  S:     8 GTGRRKTATARTRLYSGTGKIVVNGRPYDEYFPRKSLQMIIRQPLALTKNVESFDIHVNVQGGGVRGQAEAVRHGISRALLEVDVEMRSSLKRAGFLTRDARKKERKKYGQRAARARFQYSKR 130
>gi|85058195|ref|YP_453897.1| 30S ribosomal protein S9 [Sodalis glossinidius str. 'morsitans'] >gi|123520248|sp|Q2NWI3|RS9_SODGM 30S ribosomal protein S9 >gi|84778715|dbj|BAE73492.1| 30S ribosomal protein S9 [Sodalis glossinidius str. 'morsitans'] (130 aa)
Score = 260, Expect = 1.9e-21, Identities = 61/130 (46%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRKSS A V +  G+G I+INQR  ++YF        + QPL + D     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAENQYYGTGRRKSSSARVFVKAGSGNIVINQRSLDQYFGRETARMVVRQPLELVDMVGKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRADLRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130
>gi|163753796|ref|ZP_02160919.1| 30S ribosomal protein S9 [Kordia algicida OT-1] >gi|161326010|gb|EDP97336.1| 30S ribosomal protein S9 [Kordia algicida OT-1] (128 aa)
Score = 260, Expect = 2.0e-21, Identities = 57/122 (46%), Positives = 78/122 (63%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V + PGTG I +N++    YFP   +   ++QP  +T+T   +DV V V GGG TGQA A+RL I+R L   + + R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYVTPGTGNITVNKKAFETYFPTPTLQYKVKQPFALTETVDTYDVNVNVYGGGATGQAEAVRLAISRVLCEIDAENRAALKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|157373887|ref|YP_001472487.1| 30S ribosomal protein S9 [Shewanella sediminis HAW-EB3] >gi|170728546|ref|YP_001762572.1| ribosomal protein S9 [Shewanella woodyi ATCC 51908] >gi|189045716|sp|A8FR86|RS9_SHESH 30S ribosomal protein S9 >gi|157316261|gb|ABV35359.1| ribosomal protein S9 [Shewanella sediminis HAW-EB3] >gi|169813893|gb|ACA88477.1| ribosomal protein S9 [Shewanella woodyi ATCC 51908] (130 aa)
Score = 259, Expect = 2.0e-21, Identities = 61/130 (46%), Positives = 79/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V    GTG I++NQ   ++YF        + QPL + +     D+FV V GGG TGQAGAIR GI RAL+  +   R +L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAATQYYGTGRRKTSTARVFAKVGTGNIVVNQLPLDQYFGRETSRMVVRQPLELVEMTDKLDIFVTVKGGGNTGQAGAIRHGITRALMELDESLRPSLRAAGFVTRDARKVERKKVGLRKARRKPQFSKR 130
>gi|86135104|ref|ZP_01053686.1| 30S ribosomal protein S9 [Tenacibaculum sp. MED152] >gi|85821967|gb|EAQ43114.1| 30S ribosomal protein S9 [Polaribacter dokdonensis MED152] (128 aa)
Score = 259, Expect = 2.1e-21, Identities = 57/122 (46%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA + L  G G I +N++    YF    +   ++QPL++T+  +++D+ V V GGG TGQA AIRL I RAL+  N D R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARIYLSEGKGNITVNKKDYKSYFTTGTLQYKVQQPLMLTENLESYDIKVNVYGGGVTGQAEAIRLAITRALVSINEDHRAVLKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|78186290|ref|YP_374333.1| 30S ribosomal protein S9 [Pelodictyon luteolum DSM 273] >gi|123583447|sp|Q3B5U1|RS9_PELLD 30S ribosomal protein S9 >gi|78166192|gb|ABB23290.1| SSU ribosomal protein S9P [Pelodictyon luteolum DSM 273] (129 aa)
Score = 259, Expect = 2.3e-21, Identities = 59/122 (48%), Positives = 83/122 (68%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK+SVA V + PG G+++IN+    EYF + +      +PLV+T+  ++FD+ V V GGG +GQ+GA+ LGIARAL   +   R  LK  ++LTRDPR  ERKK+G   AR+S QF+KR
  S:     8 VGRRKTSVARVFMTPGKGRVIINKLPVEEYFRDEVKRLHALRPLVLTEKTEDFDIKVNVKGGGLSGQSGAVSLGIARALTEFDEAARAVLKQERLLTRDPRMVERKKFGRKKARKSFQFSKR 129
>gi|114706905|ref|ZP_01439805.1| 30S ribosomal protein S9 [Fulvimarina pelagi HTCC2506] >gi|114537853|gb|EAU40977.1| 30S ribosomal protein S9 [Fulvimarina pelagi HTCC2506] (158 aa)
Score = 259, Expect = 2.6e-21, Identities = 59/121 (48%), Positives = 73/121 (60%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GKI IN +   EYF   ++   + QP+V  D    FD+   V GGG +GQAGA+R GI+RAL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    38 GKRKDAVARVWVKPGSGKITINDKDFAEYFARPVLQMVLRQPIVAADRDGQFDIVATVAGGGLSGQAGAVRHGISRALTFYEPGLRPVLKKGGFLTRDSRTVERKKYGRAKARRSFQFSKR 158
>gi|29655036|ref|NP_820728.1| ribosomal protein S9 [Coxiella burnetii RSA 493] >gi|154706290|ref|YP_001423676.1| ribosomal protein S9 [Coxiella burnetii Dugway 5J108-111] >gi|161830339|ref|YP_001597569.1| ribosomal protein S9 [Coxiella burnetii RSA 331] >gi|165924219|ref|ZP_02220051.1| ribosomal protein S9 [Coxiella burnetii RSA 334] >gi|189045695|sp|A9KBY1|RS9_COXBN 30S ribosomal protein S9 >gi|189045696|sp|A9NAB0|RS9_COXBR 30S ribosomal protein S9 >gi|39932161|sp|Q83AX9|RS9_COXBU 30S ribosomal protein S9 >gi|29542305|gb|AAO91242.1| ribosomal protein S9 [Coxiella burnetii RSA 493] >gi|154355576|gb|ABS77038.1| ribosomal protein S9 [Coxiella burnetii Dugway 5J108-111] >gi|161762206|gb|ABX77848.1| ribosomal protein S9 [Coxiella burnetii RSA 331] >gi|165916333|gb|EDR34937.1| ribosomal protein S9 [Coxiella burnetii RSA 334] (139 aa)
Score = 258, Expect = 2.6e-21, Identities = 64/123 (52%), Positives = 81/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANND------FRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK+S A V L  GTG+I+IN    +EYF        + QPLV  D +  FDV+  V GGG +GQAGAIR GI RAL+  + +      +R TL+ +  +TRDPR  ERKK GL+GARR  QF+KR
  S:    11 GTGRRKTSSARVFLRSGTGQIIINGLPLDEYFGRETARMVVRQPLVKLDVQSRFDVYATVQGGGDSGQAGAIRHGITRALIQYDEEGGEGGTWRSTLRKAGFVTRDPRMVERKKVGLHGARRGTQFSKR 139
>gi|189463708|ref|ZP_03012493.1| hypothetical protein BACINT_00041 [Bacteroides intestinalis DSM 17393] >gi|189438658|gb|EDV07643.1| hypothetical protein BACINT_00041 [Bacteroides intestinalis DSM 17393] (128 aa)
Score = 258, Expect = 2.7e-21, Identities = 58/123 (47%), Positives = 82/123 (66%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            LGRRKS++A + +  GTGKI IN+R   EYFP++++   ++QPL      + +D+ V + GGGFTGQ+ A+RL IARAL+  N + +  L+    +TRDPR+ ERKK G   ARR  QF+KR
  S:     6 ALGRRKSAIARIFVTEGTGKITINKRDLAEYFPSTILQYVVKQPLSKLGVAEKYDIKVNLCGGGFTGQSQALRLAIARALVKMNAEDKAALRAEGFMTRDPRSVERKKPGQPKARRRFQFSKR 128
>gi|148244977|ref|YP_001219671.1| 30S ribosomal protein S9 [Candidatus Vesicomyosocius okutanii HA] >gi|146326804|dbj|BAF61947.1| 30S ribosomal protein S9 [Candidatus Vesicomyosocius okutanii HA] (131 aa)
Score = 258, Expect = 2.7e-21, Identities = 61/125 (48%), Positives = 77/125 (61%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y   GRRK+SVA V +  G G  ++N+R  NEYF        + QPL  +D +  FD  + V GGG TGQAGAIRLG+ RAL+  NND R  L+ +  +TRD R  ERKK G   AR+S QF+KR
  S:     7 YYATGRRKTSVARVYMSKGKGVFIVNKRPMNEYFGRETSSMIINQPLDTSDMKDKFDFNIIVKGGGDTGQAGAIRLGVTRALIAYNNDLRGVLRKAGFVTRDARIVERKKVGRKKARKSEQFSKR 131
>gi|49474263|ref|YP_032305.1| 30S ribosomal protein S9 [Bartonella quintana str. Toulouse] >gi|81696035|sp|Q6FZQ5|RS9_BARQU 30S ribosomal protein S9 >gi|49239767|emb|CAF26154.1| 30s ribosomal protein s9 [Bartonella quintana str. Toulouse] (161 aa)
Score = 258, Expect = 2.7e-21, Identities = 58/121 (47%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V L PG GKI IN ++ ++YF   ++   + QP+V  +    FD+   V GGG +GQAGA+R GI++AL     +FR  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    41 GKRKGAVARVWLKPGFGKITINNKEFDKYFARPVLRMILRQPIVAINRDTQFDIIATVTGGGLSGQAGAVRHGISKALTYYEPEFRTILKKRGFLTRDSRVVERKKYGKAKARRSFQFSKR 161
>gi|149072032|ref|YP_001293603.1| ribosomal protein S9 [Rhodomonas salina] >gi|134302983|gb|ABO70787.1| ribosomal protein S9 [Rhodomonas salina] (133 aa)
Score = 258, Expect = 2.7e-21, Identities = 63/125 (50%), Positives = 75/125 (60%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNS-LVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G G RK SVA V++VPG+GKI+IN      Y   S   I+  + PL        +DV V   GGG TGQ  AIRLG+ARAL   N + R  LK    LTRD R  ERKKYGL  AR++PQF+KR
  S:     8 YLGTGHRKESVARVRIVPGSGKIIINGISSESYLQFSPTYIRIAKSPLSTLGLDNKYDVHVNAHGGGLTGQTEAIRLGLARALCKVNPENRTALKFEGYLTRDARTIERKKYGLRKARKAPQFSKR 133
>gi|170720109|ref|YP_001747797.1| ribosomal protein S9 [Pseudomonas putida W619] >gi|169758112|gb|ACA71428.1| ribosomal protein S9 [Pseudomonas putida W619] (130 aa)
Score = 258, Expect = 2.7e-21, Identities = 60/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTG I IN R  + +F        + QPL +T++ + FD++V V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGNISINNRPLDTFFGRETARMVVRQPLELTESTEKFDIYVTVAGGGVSGQAGAIRHGITRALMEYDETLRGALRRAGYVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|118053938|ref|ZP_01522480.1| ribosomal protein S9 [Comamonas testosteroni KF-1] >gi|117998732|gb|EAV12894.1| ribosomal protein S9 [Comamonas testosteroni KF-1] (130 aa)
Score = 258, Expect = 2.8e-21, Identities = 60/123 (48%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V L  G+GKI +N +   +YF     I   +QPLV+T+  + FD+ V V GGG +GQAGA R GI RAL+  +   +  L  +  +TRD R  ERKK GL+ ARR+ QF+KR
  S:     8 GTGRRKSSVARVFLKKGSGKITVNGKDIQQYFGRETSIMIAKQPLVLTENLETFDIQVNVHGGGESGQAGATRHGITRALIDYDAALKPALSQAGFVTRDAREVERKKVGLHSARRAKQFSKR 130
>gi|62185145|ref|YP_219930.1| 30S ribosomal protein S9 [Chlamydophila abortus S26/3] >gi|81312691|sp|Q5L5W2|RS9_CHLAB 30S ribosomal protein S9 >gi|62148212|emb|CAH63970.1| 30s ribosomal protein s9 [Chlamydophila abortus S26/3] (133 aa)
Score = 258, Expect = 2.9e-21, Identities = 60/121 (49%), Positives = 79/121 (65%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +V+ V+L PGTGKI +N +  +EYFP  +    +  PL +     +FD+ +++ GGG  GQ  A RLG+ARALL  N D ++ LK    LTRDPR KERKKYG   AR+S QF+KR
  S:    13 GRRKQAVSSVRLRPGTGKIDVNGKAFDEYFPLEIQRVTILSPLKVLGYSNDFDLVIRINGGGIQGQVIATRLGLARALLKKNVDSKQELKSHGFLTRDPRKKERKKYGHKKARKSFQFSKR 133
>gi|104783474|ref|YP_609972.1| 30S ribosomal protein S9 [Pseudomonas entomophila L48] >gi|167035524|ref|YP_001670755.1| 30S ribosomal protein S9 [Pseudomonas putida GB-1] >gi|122401950|sp|Q1I597|RS9_PSEE4 30S ribosomal protein S9 >gi|189045707|sp|B0KFU7|RS9_PSEPG 30S ribosomal protein S9 >gi|95112461|emb|CAK17188.1| 30S ribosomal protein S9 [Pseudomonas entomophila L48] >gi|166862012|gb|ABZ00420.1| ribosomal protein S9 [Pseudomonas putida GB-1] (130 aa)
Score = 258, Expect = 2.9e-21, Identities = 61/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTG I IN R  + +F        + QPL +T+T + FD++V V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGNISINNRSLDVFFGRETARMVVRQPLELTETVEKFDIYVTVSGGGVSGQAGAIRHGITRALMEYDETLRGALRRAGYVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|16273349|ref|NP_439594.1| 30S ribosomal protein S9 [Haemophilus influenzae Rd KW20] >gi|1173284|sp|P44388|RS9_HAEIN 30S ribosomal protein S9 >gi|1574282|gb|AAC23092.1| ribosomal protein S9 (rpS9) [Haemophilus influenzae Rd KW20] (130 aa)
Score = 258, Expect = 3.0e-21, Identities = 60/130 (46%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +  G GRRKSS A V + PG+GKI INQR+ + YF        + QPL +       D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     1 MAENQNYGTGRRKSSSARVFIKPGSGKITINQRELDVYFGRETARMVVRQPLELVXLTDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFVTRDARRVERKKVGLHKARRRPQYSKR 130
>gi|89899532|ref|YP_522003.1| ribosomal protein S9 [Rhodoferax ferrireducens T118] >gi|122479958|sp|Q220T1|RS9_RHOFD 30S ribosomal protein S9 >gi|89344269|gb|ABD68472.1| SSU ribosomal protein S9P [Rhodoferax ferrireducens T118] (130 aa)
Score = 258, Expect = 3.0e-21, Identities = 57/123 (46%), Positives = 80/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V L  G+G+I++N +   ++F  +  I   +QPL++T+  + FD+ V V GGG +GQAGA+R GI RAL+  +   +  L  +  +TRD R  ERKK G +GARR  QF+KR
  S:     8 GTGRRKSSVARVFLKKGSGQIVVNGKAIEKFFGRATSIMICKQPLLLTNHAETFDIMVNVAGGGESGQAGAVRHGITRALIDYDATLKPELSKAGFVTRDAREVERKKVGFHGARRRKQFSKR 130
>gi|32476449|ref|NP_869443.1| 30S ribosomal protein S9 [Rhodopirellula baltica SH 1] >gi|39932071|sp|Q7UEY4|RS9_RHOBA 30S ribosomal protein S9 >gi|32446994|emb|CAD78900.1| 30S ribosomal protein S9 [Rhodopirellula baltica SH 1] (137 aa)
Score = 258, Expect = 3.1e-21, Identities = 59/123 (47%), Positives = 77/123 (62%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V++ PG+GKI IN +   EYF N      + + L      ++ D+ ++V GGG TGQAGA+R+G+ARAL   +      ++    LTRD R KERKK GL GARR  QF+KR
  S:    15 GTGRRKSSVARVRVRPGSGKITINGKSIEEYFVNDQHRYAITETLEAAGLTESVDLLIRVSGGGMTGQAGAVRMGLARALCSHDEALHDPMREGSFLTRDSRMKERKKPGLRGARRGVQFSKR 137
>gi|120612689|ref|YP_972367.1| SSU ribosomal protein S9P [Acidovorax avenae subsp. citrulli AAC00-1] >gi|166228545|sp|A1TUF5|RS9_ACIAC 30S ribosomal protein S9 >gi|120591153|gb|ABM34593.1| SSU ribosomal protein S9P [Acidovorax avenae subsp. citrulli AAC00-1] (130 aa)
Score = 258, Expect = 3.1e-21, Identities = 60/123 (48%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V L  G+GKI +N +   +YF     I   +QPLV+T+  + FD+ V V GGG +GQAGA R GI RAL+  +   +  L  +  +TRD R  ERKK GL+ ARR+ QF+KR
  S:     8 GTGRRKSSVARVFLKKGSGKITVNGKDIQQYFGRETSIMIAKQPLVLTNHVETFDIQVNVHGGGESGQAGATRHGITRALIDYDATLKSALSQAGFVTRDAREVERKKVGLHSARRAKQFSKR 130
>gi|52425337|ref|YP_088474.1| RpsI protein [Mannheimia succiniciproducens MBEL55E] >gi|81691377|sp|Q65T21|RS9_MANSM 30S ribosomal protein S9 >gi|52307389|gb|AAU37889.1| RpsI protein [Mannheimia succiniciproducens MBEL55E] (131 aa)
Score = 258, Expect = 3.1e-21, Identities = 60/123 (48%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSS A V + PG+GKI INQR+ + YF        + QPL + +  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     9 GTGRRKSSSARVFIKPGSGKITINQRELDVYFGRETSRMIVRQPLELVEMTEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRPVLRAAGFVTRDARRVERKKVGLRKARRRPQFSKR 131
>gi|167765412|ref|ZP_02437525.1| hypothetical protein BACSTE_03800 [Bacteroides stercoris ATCC 43183] >gi|167697040|gb|EDS13619.1| hypothetical protein BACSTE_03800 [Bacteroides stercoris ATCC 43183] (128 aa)
Score = 258, Expect = 3.1e-21, Identities = 59/123 (47%), Positives = 82/123 (66%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            LGRRKS++A + +  GTGKI IN+R   EYFP+S++   ++QPL      + +D+ V + GGGFTGQ+ A+RL IARAL+  N + +  L+    +TRDPR+ ERKK G   ARR  QF+KR
  S:     6 ALGRRKSAIARIFVSEGTGKITINKRDLAEYFPSSILQYVVKQPLNKLGVAEKYDIKVNLCGGGFTGQSQALRLAIARALVKINAEDKAALRAEGFMTRDPRSVERKKPGQPKARRRFQFSKR 128
>gi|144898332|emb|CAM75196.1| 30S ribosomal protein S9 [Magnetospirillum gryphiswaldense MSR-1] (155 aa)
Score = 258, Expect = 3.3e-21, Identities = 57/121 (47%), Positives = 74/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK+++A V + PG+GKI++N R    YF   ++   + QP         FDV   V GGG +GQAGA+R GI+RAL   +   R  LK    LTRDPR  ERKKYG + ARRS QF+KR
  S:    35 GKRKNAIARVWVKPGSGKIVVNGRDVTTYFARPVLRMLINQPFQTARCEGQFDVMCTVNGGGLSGQAGALRHGISRALTFFDPAMRPALKAGGFLTRDPRVVERKKYGKHKARRSTQFSKR 155
>gi|83312655|ref|YP_422919.1| 30S ribosomal protein S9 [Magnetospirillum magneticum AMB-1] >gi|82947496|dbj|BAE52360.1| Ribosomal protein S9 [Magnetospirillum magneticum AMB-1] (156 aa)
Score = 257, Expect = 3.4e-21, Identities = 58/121 (47%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK++VA V + PG+GKI++N R+   YF   ++   + QP         FDV   V GGG +GQAGA+R GI+RAL   +   R  LK    LTRDPR  ERKKYG + ARRS QF+KR
  S:    36 GKRKNAVARVWIKPGSGKIIVNGRELPVYFARPVLRMIINQPFEAARVEGQFDVNCTVTGGGLSGQAGALRHGISRALTYFDPGHRPALKAGGFLTRDPRVVERKKYGKHKARRSTQFSKR 156
>gi|114800252|ref|YP_761010.1| 30S ribosomal protein S9 [Hyphomonas neptunium ATCC 15444] >gi|122942283|sp|Q0BZT3|RS9_HYPNA 30S ribosomal protein S9 >gi|114740426|gb|ABI78551.1| ribosomal protein S9 [Hyphomonas neptunium ATCC 15444] (160 aa)
Score = 257, Expect = 3.9e-21, Identities = 60/123 (48%), Positives = 73/123 (59%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK +VA V + PG+GKI+IN R    YF   ++   + QPL+       FDV   V G G  GQAGA+R GI+RAL+      R  LK    +TRDPR  ERKKYG   ARRS QF+KR
  S:    38 GTGRRKEAVARVWIKPGSGKIIINGRDQETYFARPVLRMVIAQPLIEAGRATEFDVIATVKGSGLMGQAGAVRHGISRALVAYEPGLRAVLKPFGFMTRDPRVVERKKYGKAKARRSFQFSKR 160
>gi|91214954|ref|ZP_01251926.1| 30S ribosomal protein S9 [Psychroflexus torquis ATCC 700755] >gi|91186559|gb|EAS72930.1| 30S ribosomal protein S9 [Psychroflexus torquis ATCC 700755] (128 aa)
Score = 257, Expect = 4.3e-21, Identities = 57/122 (46%), Positives = 80/122 (65%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V L  G G+I +N++K +EYF    ++  + Q L++T     FD+ V V GGG TGQA AIRL ++RA+   + + R TLK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYLSEGKGEITVNKKKVSEYFTTGPLLYKINQALILTGNEDRFDINVNVFGGGITGQAEAIRLALSRAMCELDPENRTTLKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|189345966|ref|YP_001942495.1| ribosomal protein S9 [Chlorobium limicola DSM 245] >gi|189340113|gb|ACD89516.1| ribosomal protein S9 [Chlorobium limicola DSM 245] (129 aa)
Score = 257, Expect = 4.3e-21, Identities = 59/122 (48%), Positives = 80/122 (65%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK+SVA V + PG G+++IN+    EYF + +      +PL +T+  + FD+ V V GGG TGQ+GA+ LGIARAL   +   R  LK  K+LTRDPR  ERKK+G   AR+  QF+KR
  S:     8 VGRRKTSVARVFMTPGKGRVIINKLPVEEYFKDEVRRSKALRPLALTERTEEFDIKVNVQGGGITGQSGAVSLGIARALTEFDETVRPILKTEKLLTRDPRMVERKKFGRKKARKRFQFSKR 129
>gi|118594138|ref|ZP_01551485.1| 30S ribosomal protein S9 [Methylophilales bacterium HTCC2181] >gi|118439916|gb|EAV46543.1| 30S ribosomal protein S9 [Methylophilales bacterium HTCC2181] (130 aa)
Score = 257, Expect = 4.4e-21, Identities = 60/125 (48%), Positives = 77/125 (61%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y G GRRKSSVA V + PG G I+IN +  +EYF        ++QPL +TD    FD+ V V+GGG +GQAGA+R GI RAL+  +   +  L  +  +TRD R  ERKK G   ARR  QF+KR
  S:     6 YYGTGRRKSSVARVFIQPGKGAIVINNKPVDEYFSRYTSQMILKQPLELTDNTSTFDIKVNVIGGGESGQAGAVRHGITRALMDYDLSLKPDLSKAGYVTRDSREVERKKVGFRKARRKKQFSKR 130
>gi|163786579|ref|ZP_02181027.1| ribosomal protein S9 [Flavobacteriales bacterium ALC-1] >gi|159878439|gb|EDP72495.1| ribosomal protein S9 [Flavobacteriales bacterium ALC-1] (128 aa)
Score = 256, Expect = 4.4e-21, Identities = 56/122 (45%), Positives = 80/122 (65%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V +  G G I +N++   +YF  + +   + QP+V+T+   NFD+ V V GGG TGQA AIRLG++RA+   + + R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYVAKGKGNITVNKKDMTDYFSTATLQYKVNQPIVMTNNDGNFDITVNVYGGGITGQAEAIRLGLSRAMCELDPENRAILKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|149185233|ref|ZP_01863550.1| 30S ribosomal protein S9P [Erythrobacter sp. SD-21] >gi|148831344|gb|EDL49778.1| 30S ribosomal protein S9P [Erythrobacter sp. SD-21] (174 aa)
Score = 256, Expect = 4.4e-21, Identities = 58/121 (47%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK + A V LVPG+GKI IN +    YF    +   ++QP  IT+ +  +DV   V GGG +GQAGA++ GI++AL       R T+K +  LTRD R  ERKKYG   ARRS QF+KR
  S:    54 GRRKDATARVWLVPGSGKITINGKDQEVYFARPTLRLVIDQPFAITERQGQYDVVATVKGGGLSGQAGAVKHGISQALAKYEPALRSTVKAAGFLTRDSRVVERKKYGRAKARRSFQFSKR 174
>gi|85702780|ref|ZP_01033884.1| 30S ribosomal protein S9 [Roseovarius sp. 217] >gi|85671708|gb|EAQ26565.1| 30S ribosomal protein S9 [Roseovarius sp. 217] (163 aa)
Score = 256, Expect = 4.5e-21, Identities = 53/121 (43%), Positives = 78/121 (64%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+++N +   EYF   ++   ++QP  ++ T   FDV   V GGG +GQAGA++ G+++AL + +   R  LK +  LTRD R  ERKKYG   AR+S QF+KR
  S:    43 GKRKDAVARVWIKPGSGKVVVNGKPMKEYFARPVLQMILKQPFTVSGTEDQFDVMATVAGGGLSGQAGAVKHGVSKALQLYDPSLRGALKAAGFLTRDSRVVERKKYGRAKARKSFQFSKR 163
>gi|160890597|ref|ZP_02071600.1| hypothetical protein BACUNI_03042 [Bacteroides uniformis ATCC 8492] >gi|156859596|gb|EDO53027.1| hypothetical protein BACUNI_03042 [Bacteroides uniformis ATCC 8492] (128 aa)
Score = 256, Expect = 4.5e-21, Identities = 59/123 (47%), Positives = 82/123 (66%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            LGRRKS++A + +  GTGKI IN+R   EYFP+S++   ++QPL      + +D+ V + GGGFTGQ+ A+RL IARAL+  N + +  L+    +TRDPR+ ERKK G   ARR  QF+KR
  S:     6 ALGRRKSAIARIFVSEGTGKITINKRDLAEYFPSSILQYVVKQPLNKLGVAEKYDIKVNLCGGGFTGQSQALRLAIARALVKINAEDKAALRSEGFMTRDPRSVERKKPGQPKARRRFQFSKR 128
>gi|73748348|ref|YP_307587.1| 30S ribosomal protein S9 [Dehalococcoides sp. CBDB1] >gi|123620209|sp|Q3ZZP2|RS9_DEHSC 30S ribosomal protein S9 >gi|73660064|emb|CAI82671.1| ribosomal protein S9 [Dehalococcoides sp. CBDB1] (132 aa)
Score = 256, Expect = 5.2e-21, Identities = 61/128 (47%), Positives = 83/128 (64%)
  Q:     3 NVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           N  + G+GRRK++VA VKL+ G G I+I+ +   E F        +  P+++TDT   F+  +KV+GGG TGQ+GAI  GIARAL   +   R  LK + +LTRD R KERKK GL  AR++PQ+TKR
  S:     5 NTYFIGVGRRKTAVATVKLMSGNGVIVIDGKPIEERFTRIQERNVILNPMMVTDTMGKFNAVIKVLGGGVTGQSGAIAHGIARALEKTDEKLRAALKSNGLLTRDDRTKERKKPGLKRARKAPQYTKR 132
>gi|153886241|ref|ZP_02007396.1| ribosomal protein S9 [Ralstonia pickettii 12D] >gi|187927470|ref|YP_001897957.1| ribosomal protein S9 [Ralstonia pickettii 12J] >gi|151577206|gb|EDN41607.1| ribosomal protein S9 [Ralstonia pickettii 12D] >gi|187724360|gb|ACD25525.1| ribosomal protein S9 [Ralstonia pickettii 12J] (130 aa)
Score = 256, Expect = 5.5e-21, Identities = 59/123 (47%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKS+VA V +  G G I++N +  NEYF     +  + QPL +T+    FD+ V VVGGG TGQAGA+R GI RAL+  +   +  L  + ++TRD R  ERKK GL  ARR+ QF+KR
  S:     8 GTGRRKSAVARVFIKSGKGDIIVNGKAINEYFARETSLMIVRQPLELTNHAATFDIKVNVVGGGETGQAGAVRHGITRALIDYDATLKPALSKAGLVTRDAREVERKKVGLRKARRAKQFSKR 130
>gi|170742730|ref|YP_001771385.1| ribosomal protein S9 [Methylobacterium sp. 4-46] >gi|168197004|gb|ACA18951.1| ribosomal protein S9 [Methylobacterium sp. 4-46] (162 aa)
Score = 256, Expect = 5.6e-21, Identities = 56/121 (46%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+G I +N R    YF   ++   ++QPL + +    +D+ V V GGG +GQAGA+R G+A+AL     + R  LK    LTRDPR  ERKKYG   ARRS QF+KR
  S:    42 GKRKDAVARVWIKPGSGVITVNDRPVETYFARPVLRMILQQPLQVANRADQYDIVVTVTGGGLSGQAGAVRHGLAKALTHYEPELRSPLKREGFLTRDPRVVERKKYGRKKARRSFQFSKR 162
>gi|15828967|ref|NP_326327.1| 30S ribosomal protein S9 [Mycoplasma pulmonis UAB CTIP] >gi|20139912|sp|Q98Q72|RS9_MYCPU 30S ribosomal protein S9 >gi|14089910|emb|CAC13669.1| 30S RIBOSOMAL PROTEIN S9 [Mycoplasma pulmonis] (136 aa)
Score = 256, Expect = 5.6e-21, Identities = 70/125 (56%), Positives = 89/125 (71%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           ++GLGRRKSSVA V L+ G+GK  IN+R+  EY  + + I+D  QP  +T T   FD+ V V GGG  GQAGAIRLGIARALL  + D+R  LK +KMLTR+ + KERKK GL  AR++ QF+KR
  S:    12 FRGLGRRKSSVARVILLKGSGKFTINKREAKEYLKSDIYIKDALQPFDLTQTNNTFDIRVTVRGGGLAGQAGAIRLGIARALLEISADYRSVLKEAKMLTRNTKVKERKKPGLRKARKARQFSKR 136
>gi|83858246|ref|ZP_00951768.1| 30S ribosomal protein S9 [Oceanicaulis alexandrii HTCC2633] >gi|83853069|gb|EAP90921.1| 30S ribosomal protein S9 [Oceanicaulis alexandrii HTCC2633] (167 aa)
Score = 256, Expect = 5.6e-21, Identities = 58/121 (47%), Positives = 71/121 (58%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK + A V + PG+GKI++N R    YF   ++   + QP    D    FDV+  V GGG +GQAGA+R GI+RAL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    47 GRRKDATARVWIKPGSGKIIVNGRDQEVYFARPVLRMMIAQPFEAADRADAFDVYCTVKGGGLSGQAGAVRHGISRALTYFEPSLRGVLKAGGFLTRDSRVVERKKYGRKKARRSFQFSKR 167
>gi|196185170|gb|EDX80146.1| ribosomal protein S9 [Brevundimonas sp. BAL3] (164 aa)
Score = 255, Expect = 5.8e-21, Identities = 57/121 (47%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK+++A V + PGTGKI IN +   +YF   ++   + QPL ++D    +DV   V G G +GQAGAIR G++ AL     + RK LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    44 GKRKNAIARVWVKPGTGKITINGKDQEQYFARPVLRMMIAQPLTVSDRATQYDVVCTVEGSGLSGQAGAIRHGLSHALTHFEPELRKVLKPHGFLTRDSRVVERKKYGRAKARRSFQFSKR 164
>gi|15675735|ref|NP_269909.1| 30S ribosomal protein S9 [Streptococcus pyogenes M1 GAS] >gi|19746845|ref|NP_607981.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS8232] >gi|21911199|ref|NP_665467.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS315] >gi|28896576|ref|NP_802926.1| 30S ribosomal protein S9 [Streptococcus pyogenes SSI-1] >gi|50915000|ref|YP_060972.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS10394] >gi|56808041|ref|ZP_00365841.1| COG0103: Ribosomal protein S9 [Streptococcus pyogenes M49 591] >gi|71904296|ref|YP_281099.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS6180] >gi|71911459|ref|YP_283009.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS5005] >gi|94989277|ref|YP_597378.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS9429] >gi|94991223|ref|YP_599323.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS10270] >gi|94993166|ref|YP_601265.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS2096] >gi|94995136|ref|YP_603234.1| 30S ribosomal protein S9 [Streptococcus pyogenes MGAS10750] >gi|139474422|ref|YP_001129138.1| 30S ribosomal protein S9 [Streptococcus pyogenes str. Manfredo] >gi|123639210|sp|Q48RB6|RS9_STRPM 30S ribosomal protein S9 >gi|166229609|sp|Q1J9U0|RS9_STRPB 30S ribosomal protein S9 >gi|166229610|sp|Q1JJY9|RS9_STRPC 30S ribosomal protein S9 >gi|166229611|sp|Q1JEY0|RS9_STRPD 30S ribosomal protein S9 >gi|166229612|sp|Q1J4P6|RS9_STRPF 30S ribosomal protein S9 >gi|166229613|sp|A2RGF8|RS9_STRPG 30S ribosomal protein S9 >gi|54039563|sp|P66649|RS9_STRP3 30S ribosomal protein S9 >gi|54039564|sp|P66650|RS9_STRP8 30S ribosomal protein S9 >gi|54041999|sp|P66648|RS9_STRP1 30S ribosomal protein S9 >gi|73919125|sp|Q5X9X4|RS9_STRP6 30S ribosomal protein S9 >gi|13622955|gb|AAK34630.1| ribosomal protein S9 [Streptococcus pyogenes M1 GAS] >gi|19749085|gb|AAL98480.1| ribosomal protein S9 [Streptococcus pyogenes MGAS8232] >gi|21905411|gb|AAM80270.1| ribosomal protein S9 [Streptococcus pyogenes MGAS315] >gi|28811830|dbj|BAC64759.1| 30S ribosomal protein S9 [Streptococcus pyogenes SSI-1] >gi|50904074|gb|AAT87789.1| SSU ribosomal protein S9P [Streptococcus pyogenes MGAS10394] >gi|71803391|gb|AAX72744.1| SSU ribosomal protein S9P [Streptococcus pyogenes MGAS6180] >gi|71854241|gb|AAZ52264.1| SSU ribosomal protein S9P [Streptococcus pyogenes MGAS5005] >gi|94542785|gb|ABF32834.1| SSU ribosomal protein S9P [Streptococcus pyogenes MGAS9429] >gi|94544731|gb|ABF34779.1| SSU ribosomal protein S9P [Streptococcus pyogenes MGAS10270] >gi|94546674|gb|ABF36721.1| SSU ribosomal protein S9P [Streptococcus pyogenes MGAS2096] >gi|94548644|gb|ABF38690.1| SSU ribosomal protein S9P [Streptococcus pyogenes MGAS10750] >gi|134272669|emb|CAM30940.1| 30S ribosomal protein S9 [Streptococcus pyogenes str. Manfredo] (130 aa)
Score = 255, Expect = 5.8e-21, Identities = 70/130 (53%), Positives = 94/130 (72%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK++VA V+LVPGTGKI +N++   EY P++ +   + QP  +T T  ++DVFV VVGGG+ GQ+GAIR GIARALL  + DFR +LK + +LTRD R  ERKK GL  AR++ QF+KR
  S:     1 MAQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLIINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130
>gi|57234740|ref|YP_181250.1| 30S ribosomal protein S9 [Dehalococcoides ethenogenes 195] >gi|123618891|sp|Q3Z949|RS9_DEHE1 30S ribosomal protein S9 >gi|57225188|gb|AAW40245.1| ribosomal protein S9 [Dehalococcoides ethenogenes 195] (132 aa)
Score = 255, Expect = 6.1e-21, Identities = 60/128 (46%), Positives = 84/128 (65%)
  Q:     3 NVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           N  + G+GRRK++VA VKL  G G I+I+ +   E F        +  P+++TDT   ++  +KV+GGG  GQ+GAI  GIARAL  +++  R TLK + +LTRD R KERKK GL  AR++PQ+TKR
  S:     5 NTYFIGVGRRKTAVATVKLTSGNGVIVIDGKPIEERFTRVQERNVILNPMMVTDTMGKYNAVIKVLGGGVAGQSGAIAHGIARALEKSDDKLRATLKSNGLLTRDDRTKERKKPGLKRARKAPQYTKR 132
>gi|152979157|ref|YP_001344786.1| 30S ribosomal protein S9 [Actinobacillus succinogenes 130Z] >gi|171704355|sp|A6VPF4|RS9_ACTSZ 30S ribosomal protein S9 >gi|150840880|gb|ABR74851.1| ribosomal protein S9 [Actinobacillus succinogenes 130Z] (131 aa)
Score = 255, Expect = 6.4e-21, Identities = 59/123 (47%), Positives = 75/123 (60%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSS A V + PG GKI INQR    YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     9 GTGRRKSSSARVFIKPGNGKITINQRSLEVYFGRETSRMIVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRPALRAAGFVTRDARRVERKKVGLHKARRRPQYSKR 131
>gi|84686848|ref|ZP_01014732.1| 30S ribosomal protein S9 [Rhodobacterales bacterium HTCC2654] >gi|84665045|gb|EAQ11525.1| 30S ribosomal protein S9 [Rhodobacterales bacterium HTCC2654] (164 aa)
Score = 255, Expect = 6.4e-21, Identities = 54/121 (44%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+ +N ++ ++YF   ++   + QP  +      FDV   VVGGG +GQAGA++ GI++AL +     R  LK +  LTRD R  ERKKYG   ARRS QF+KR
  S:    44 GKRKDAVARVWIKPGSGKVTVNGKEMDKYFARPVLQMILRQPFTVAGVEGEFDVMATVVGGGLSGQAGAVKHGISKALQLYEPSLRPALKAAGFLTRDSRVVERKKYGRAKARRSFQFSKR 164
>gi|146278211|ref|YP_001168370.1| 30S ribosomal protein S9 [Rhodobacter sphaeroides ATCC 17025] >gi|145556452|gb|ABP71065.1| SSU ribosomal protein S9P [Rhodobacter sphaeroides ATCC 17025] (160 aa)
Score = 255, Expect = 6.4e-21, Identities = 54/121 (44%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+ +N +  +EYF   ++   + QP  + +    FDV   V GGG +GQAGA++ GI++AL +     R  LK +  LTRD R  ERKKYG   ARRS QF+KR
  S:    40 GKRKDAVARVWIKPGSGKVTVNGKPMDEYFARPVLQMILRQPFTVANVTGQFDVMATVAGGGLSGQAGAVKHGISKALQLYEPSLRAALKAAGFLTRDSRVVERKKYGKAKARRSFQFSKR 160
>gi|26988051|ref|NP_743476.1| 30S ribosomal protein S9 [Pseudomonas putida KT2440] >gi|148549612|ref|YP_001269714.1| 30S ribosomal protein S9 [Pseudomonas putida F1] >gi|166229591|sp|A5W8S0|RS9_PSEP1 30S ribosomal protein S9 >gi|38258323|sp|Q88N96|RS9_PSEPK 30S ribosomal protein S9 >gi|24982773|gb|AAN66940.1|AE016322_7 ribosomal protein S9 [Pseudomonas putida KT2440] >gi|148513670|gb|ABQ80530.1| SSU ribosomal protein S9P [Pseudomonas putida F1] (130 aa)
Score = 255, Expect = 6.6e-21, Identities = 60/130 (46%), Positives = 81/130 (62%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK++ A V L PGTG I IN R  + +F        + QPL +T++ + FD++V V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSATQNYGTGRRKTATARVFLRPGTGNISINNRSLDVFFGRETARMVVRQPLELTESVEKFDIYVTVSGGGVSGQAGAIRHGITRALMEYDETLRGALRRAGYVTRDAREVERKKVGLRKARKRPQYSKR 130
>gi|171464167|ref|YP_001798280.1| ribosomal protein S9 [Polynucleobacter necessarius STIR1] >gi|171193705|gb|ACB44666.1| ribosomal protein S9 [Polynucleobacter necessarius STIR1] (133 aa)
Score = 255, Expect = 7.0e-21, Identities = 59/123 (47%), Positives = 77/123 (62%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V +  G G+I++N +  + YF          QPL +T     FD+ V V GGG TGQAGA+R G+ RAL+  +N  + TL  + ++TRD R  ERKK GL+GARR  QF+KR
  S:    11 GTGRRKSSVARVFIKSGKGEIIVNGKPIDAYFARETSRMIARQPLALTAHLTTFDIKVNVSGGGETGQAGAVRHGVTRALINYDNALKPTLSKAGLVTRDAREVERKKVGLHGARRRKQFSKR 133
>gi|94987002|ref|YP_594935.1| 30S ribosomal protein S9 [Lawsonia intracellularis PHE/MN1-00] >gi|166229568|sp|Q1MQW3|RS9_LAWIP 30S ribosomal protein S9 >gi|94731251|emb|CAJ54614.1| ribosomal protein S9 [Lawsonia intracellularis PHE/MN1-00] (130 aa)
Score = 255, Expect = 7.2e-21, Identities = 60/121 (49%), Positives = 74/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK++VA  +L PG G I IN R    YFP   +   + QPLV T     +D+ + V GGG +GQA A+R GI+RALL  N + R  LK    LTRD R KERKKYGL  AR   Q++KR
  S:    10 GRRKTAVARTRLYPGNGTIKINGRPLENYFPRKSLQMIIRQPLVHTKLLDKYDIKINVSGGGVSGQAEAVRHGISRALLEVNPELRSLLKPVGFLTRDARQKERKKYGLRAARAKYQYSKR 130
>gi|110679841|ref|YP_682848.1| 30S ribosomal protein S9 [Roseobacter denitrificans OCh 114] >gi|109455957|gb|ABG32162.1| ribosomal protein S9, putative [Roseobacter denitrificans OCh 114] (163 aa)
Score = 254, Expect = 7.5e-21, Identities = 54/121 (44%), Positives = 77/121 (63%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK ++A V + PG+GK+ +N +  NEYF   ++   + QP  ++ T   FDV   V GGG +GQAGA++ GI++AL + +   R  LK +  LTRD R  ERKKYG   AR+S QF+KR
  S:    43 GKRKDAIARVWIKPGSGKVTVNGKPQNEYFARPVLQMILAQPFSVSGTDGQFDVVATVKGGGLSGQAGAVKHGISKALQLYDPSLRGALKAAGFLTRDSRVVERKKYGKAKARKSFQFSKR 163
>gi|7799378|emb|CAB90994.1| 30S ribosomal protein S9 [Buchnera aphidicola] (130 aa)
Score = 254, Expect = 7.5e-21, Identities = 60/130 (46%), Positives = 78/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M   +  G GRRKSS A V L  G G+I++N+R  NEYF        + QPL + D    F++++ V GGG +GQAGAIR GI RAL+  N   R  L+ +  +TRD R  ERKK G   AR+ PQF+KR
  S:     1 MIQTQNYGTGRRKSSSARVFLRSGNGEIVVNKRSLNEYFGRETSCMIVRQPLELVDMVDKFNIYITVKGGGISGQAGAIRQGITRALIKYNQTLRFELRKAGFITRDSRQVERKKVGFRKARKRPQFSKR 130
>gi|88802061|ref|ZP_01117589.1| 30S ribosomal protein S9 [Polaribacter irgensii 23-P] >gi|88782719|gb|EAR13896.1| 30S ribosomal protein S9 [Polaribacter irgensii 23-P] (128 aa)
Score = 254, Expect = 7.6e-21, Identities = 56/122 (45%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA + L  G G I +N++    YF    +   ++QPL++T+  +++D+ V V GGG TGQA AIRL I RAL+  + D R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARIYLTEGKGDITVNKKDYKSYFTTGTLQYKVQQPLMLTENLESYDIKVNVYGGGITGQAEAIRLAITRALVHIDADHRIILKPEGLLTRDPRMVERKKFGQKKARKKFQFSKR 128
>gi|120434505|ref|YP_860202.1| 30S ribosomal protein S9 [Gramella forsetii KT0803] >gi|166229560|sp|A0LXM9|RS9_GRAFK 30S ribosomal protein S9 >gi|117576655|emb|CAL65124.1| 30S ribosomal protein S9 [Gramella forsetii KT0803] (128 aa)
Score = 254, Expect = 7.8e-21, Identities = 54/122 (44%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V +  G G I +N++   +YF    ++  + QP+++T+   NFDV + V GGG TGQA AIRL ++RA++  + +    LK   +LTRDPR  ERKKYG   AR+  QF+KR
  S:     7 IGRRKTAVARVYVSEGKGNITVNKKDLKDYFTTGTLLYKVNQPMMLTENEGNFDVKINVYGGGITGQAEAIRLALSRAMVALDEENHGALKPEGLLTRDPRMVERKKYGQKKARKKFQFSKR 128
>gi|42526365|ref|NP_971463.1| 30S ribosomal protein S9 [Treponema denticola ATCC 35405] >gi|41816477|gb|AAS11344.1| ribosomal protein S9 [Treponema denticola ATCC 35405] (124 aa)
Score = 254, Expect = 7.9e-21, Identities = 57/123 (46%), Positives = 77/123 (62%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK+SVA V +  G G++ +N +  NEYF     +Q  ++PL++T     +D+ + V GGG TGQAGA   GIARAL   +     +LK + +LTRD R  ERKK+G  GARR  QF+KR
  S:     2 GTGRRKTSVARVYIRDGKGQLTVNDKDINEYFATPEQVQKAKEPLMVTAGESKYDIIITVRGGGLTGQAGACSHGIARALAQVDASNHASLKANGLLTRDSRMVERKKFGQRGARRRFQFSKR 124
>gi|154253378|ref|YP_001414202.1| ribosomal protein S9 [Parvibaculum lavamentivorans DS-1] >gi|171769664|sp|A7HXB2|RS9_PARL1 30S ribosomal protein S9 >gi|154157328|gb|ABS64545.1| ribosomal protein S9 [Parvibaculum lavamentivorans DS-1] (162 aa)
Score = 254, Expect = 8.2e-21, Identities = 59/121 (48%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK++VA V + PG+G++ IN R    YF   ++   + QPLV+    K +D+   VVGGG +GQAGAIR GI+RAL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    42 GKRKNAVARVWIKPGSGRVKINGRDLEVYFARPVLRMILNQPLVVAAREKQYDITATVVGGGLSGQAGAIRHGISRALTYFEPSLRGVLKKEGFLTRDSRVVERKKYGKAKARRSFQFSKR 162
>gi|157963408|ref|YP_001503442.1| 30S ribosomal protein S9 [Shewanella pealeana ATCC 700345] >gi|189045715|sp|A8H8M0|RS9_SHEPA 30S ribosomal protein S9 >gi|157848408|gb|ABV88907.1| ribosomal protein S9 [Shewanella pealeana ATCC 700345] (130 aa)
Score = 254, Expect = 8.6e-21, Identities = 60/130 (46%), Positives = 79/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V    GTG I++N+   +EYF        + QPL + +  +  D+ V V GGG TGQAGAIR GI RAL+  +   R +L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAATQYYGTGRRKTSTARVFAKVGTGNIIVNKLPLDEYFGRETSRMVVRQPLELVEMTEKLDIMVTVKGGGNTGQAGAIRHGITRALMELDESLRPSLRAAGFVTRDARKVERKKVGLRKARRKPQFSKR 130
>gi|193214249|ref|YP_001995448.1| ribosomal protein S9 [Chloroherpeton thalassium ATCC 35110] >gi|193087726|gb|ACF13001.1| ribosomal protein S9 [Chloroherpeton thalassium ATCC 35110] (130 aa)
Score = 254, Expect = 8.8e-21, Identities = 58/130 (44%), Positives = 82/130 (63%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M++      GRRK+SVA   + PGTG++L+N +   EYF       +  +PL++TD+ + FDV V V GGG +GQ GA+ L IARA++  +   R  L+  ++LTRDPR  ERKKYG   AR+  QF+KR
  S:     1 MNDEMISATGRRKTSVARAFVRPGTGRVLVNGKDVKEYFAEKRYSDNAVRPLMLTDSLEKFDVKVSVYGGGLSGQVGAVSLAIARAIVEYDEANRVALRPERLLTRDPRMVERKKYGQKKARKRFQFSKR 130
>gi|153093606|gb|EDN74574.1| ribosomal protein S9 [Mannheimia haemolytica PHL213] (131 aa)
Score = 254, Expect = 8.8e-21, Identities = 58/123 (47%), Positives = 75/123 (60%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSS A V + PG+G I INQR    YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     9 GTGRRKSSSARVFIKPGSGNITINQRSLEVYFGRETARMIVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFVTRDARRVERKKVGLHKARRRPQYSKR 131
>gi|145590064|ref|YP_001156661.1| ribosomal protein S9 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048470|gb|ABP35097.1| SSU ribosomal protein S9P [Polynucleobacter sp. QLW-P1DMWA-1] (133 aa)
Score = 254, Expect = 9.0e-21, Identities = 59/123 (47%), Positives = 76/123 (61%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V +  G G I++N +  + YF          QPL +T     FD+ V V GGG TGQAGA+R G+ RAL+  +N  + TL  + ++TRD R  ERKK GL+GARR  QF+KR
  S:    11 GTGRRKSSVARVFIKSGKGDIIVNGKPIDAYFARETSRMIARQPLALTAHLTTFDIKVNVSGGGETGQAGAVRHGVTRALIDYDNALKPTLSKAGLVTRDAREVERKKVGLHGARRRKQFSKR 133
>gi|108773382|ref|YP_635844.1| ribosomal protein S9 [Oltmannsiellopsis viridis] >gi|122195148|sp|Q20F01|RR9_OLTVI Chloroplast 30S ribosomal protein S9 >gi|82541964|gb|ABB82005.1| ribosomal protein S9 [Oltmannsiellopsis viridis] (125 aa)
Score = 254, Expect = 9.2e-21, Identities = 61/123 (49%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYF-PNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK +VA VKLV G GK++IN +   +Y   N+  I  ++ P  +   +K FD  VKV GGG + QA AI+LG+ARAL   N   R  LK +  LTRD R  ERKK GL  AR++PQF+KR
  S:     2 GTGRRKRAVAQVKLVAGEGKLIINGKPGFDYLHNNATAILSIQGPFQLFKLQKKFDTIVKVHGGGLSAQADAIKLGVARALCEINTSHRPVLKSNGYLTRDARIVERKKAGLKKARKAPQFSKR 125
>gi|15616994|ref|NP_240207.1| 30S ribosomal protein S9 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387056|sp|P57470|RS9_BUCAI 30S ribosomal protein S9 >gi|25294621|pir||E84975 ribosomal protein S9 [similarity] - Buchnera sp. (strain APS) >gi|10039059|dbj|BAB13093.1| 30S ribosomal protein S9 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (130 aa)
Score = 254, Expect = 9.3e-21, Identities = 60/130 (46%), Positives = 78/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M   +  G GRRKSS A V L  G G+I++N+R  NEYF        + QPL + D    F++++ V GGG +GQAGAIR GI RAL+  N   R  L+ +  +TRD R  ERKK G   AR+ PQF+KR
  S:     1 MIQTQNYGTGRRKSSSARVFLRSGNGEIVVNKRSLNEYFGRETSCMIVRQPLELVDMVDKFNIYITVKGGGISGQAGAIRQGITRALIKYNQTLRFELRKAGFVTRDSRQVERKKVGFRKARKRPQFSKR 130
>gi|119477352|ref|ZP_01617543.1| Ribosomal protein S9 [marine gamma proteobacterium HTCC2143] >gi|119449278|gb|EAW30517.1| Ribosomal protein S9 [marine gamma proteobacterium HTCC2143] (130 aa)
Score = 253, Expect = 9.8e-21, Identities = 60/130 (46%), Positives = 79/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V L  G+G+I IN+R  ++YF   +    + QPL + +    FD+ V V GGG  GQAGAIR GI RAL+  +   R  L+    +TRD R  ERKK GL  AR+ PQF+KR
  S:     1 MAATQYYGTGRRKTSTARVFLKSGSGEITINKRSIDQYFGREVARMIVRQPLELVEMIDKFDLNVTVAGGGSFGQAGAIRHGITRALMEYDETLRGPLRAEGYVTRDSREVERKKVGLRKARKKPQFSKR 130
>gi|114766410|ref|ZP_01445379.1| 30S ribosomal protein S9 [Roseovarius sp. HTCC2601] >gi|114541351|gb|EAU44399.1| 30S ribosomal protein S9 [Roseovarius sp. HTCC2601] (162 aa)
Score = 253, Expect = 9.9e-21, Identities = 54/121 (44%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V L PG+GK+ +N ++ N YF   ++   + QP  +      FDV+  V GGG +GQAGA++ GI++AL + +   R  LK +  LTRD R  ERKK+G   ARRS QF+KR
  S:    42 GKRKDAVARVWLKPGSGKVSVNGKELNTYFARPVLQMILRQPFSVAGVEDQFDVYATVKGGGLSGQAGAVKHGISKALQLYDPSLRSALKAAGFLTRDSRVVERKKFGKRKARRSFQFSKR 162
>gi|149927679|ref|ZP_01915931.1| 30S ribosomal protein S9 [Limnobacter sp. MED105] >gi|149823505|gb|EDM82735.1| 30S ribosomal protein S9 [Limnobacter sp. MED105] (130 aa)
Score = 253, Expect = 1.0e-20, Identities = 60/123 (48%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V +  GTG+ ++N +   EYF          QPLV+T+  + FD+ V V GGG TGQAGA+R G+ RAL+  + + + TL  + ++TRD R  ERKK GL GARR  QF+KR
  S:     8 GTGRRKSSVARVFIKKGTGQFIVNGKPLTEYFARETGQMVARQPLVLTENVETFDIKVNVRGGGETGQAGAVRHGLTRALIDLDAELKPTLSKAGLVTRDAREVERKKVGLRGARRRKQFSKR 130
>gi|125545843|gb|EAY91982.1| hypothetical protein OsI_013215 [Oryza sativa (indica cultivar-group)] (223 aa)
Score = 253, Expect = 1.1e-20, Identities = 60/121 (49%), Positives = 79/121 (65%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK++VA V L  GTG++ IN R   EY   N + ++  + PLV      ++DVFVKV GGG +GQA AI LG+ARAL+  +   + TL+   +LTRD R  ERKK GL  AR+ PQF+KR
  S:   102 GRRKTAVARVVLQEGTGRVFINFRDAKEYLQGNPMWMEYCKVPLVTLGFENSYDVFVKVHGGGLSGQAQAICLGVARALVKISTANKVTLRGEGLLTRDTRIVERKKAGLKKARKRPQFSKR 223
>gi|121601811|ref|YP_989187.1| 30S ribosomal protein S9 [Bartonella bacilliformis KC583] >gi|166228555|sp|A1UT84|RS9_BARBK 30S ribosomal protein S9 >gi|120613988|gb|ABM44589.1| ribosomal protein S9 [Bartonella bacilliformis KC583] (161 aa)
Score = 253, Expect = 1.1e-20, Identities = 58/121 (47%), Positives = 74/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PGTGKI +N ++  +YF   ++   + QP+VI      +DV   V GGG +GQAGAIR GI++AL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    41 GKRKDAVARVWIKPGTGKITVNNKEFEQYFARPVLRMILRQPIVIAKRDTQYDVVATVAGGGLSGQAGAIRHGISKALTYYEPALRTILKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 161
>gi|187735729|ref|YP_001877841.1| ribosomal protein S9 [Akkermansia muciniphila ATCC BAA-835] >gi|187425781|gb|ACD05060.1| ribosomal protein S9 [Akkermansia muciniphila ATCC BAA-835] (131 aa)
Score = 253, Expect = 1.1e-20, Identities = 59/125 (47%), Positives = 76/125 (60%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y   GRRK+++AH  L  G+G+I IN+R   EY P   +   + QP  +T+T   FDV V   GGG  GQ GAIR+ IARAL+  +   R  L+   +LTRD R KERKK G  GAR+  QF+KR
  S:     7 YNATGRRKTAIAHAWLTEGSGRITINRRGFEEYLPTVQLQNAVLQPFQVTNTMNKFDVNVVTKGGGIHGQVGAIRMAIARALVQVDEASRSQLREFGLLTRDSRMKERKKPGRPGARKRYQFSKR 131
>gi|153009823|ref|YP_001371038.1| 30S ribosomal protein S9 [Ochrobactrum anthropi ATCC 49188] >gi|166229582|sp|A6X1V5|RS9_OCHA4 30S ribosomal protein S9 >gi|151561711|gb|ABS15209.1| ribosomal protein S9 [Ochrobactrum anthropi ATCC 49188] (158 aa)
Score = 253, Expect = 1.1e-20, Identities = 56/121 (46%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PGTGKI +N ++  +YF   ++   ++QP+V ++    FD+   V GGG +GQAGA+R GI++AL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    38 GKRKDAVARVWVKPGTGKITVNDKEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEPGLRTVLKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 158
>gi|167625588|ref|YP_001675882.1| 30S ribosomal protein S9 [Shewanella halifaxensis HAW-EB4] >gi|189045714|sp|B0TUV6|RS9_SHEHH 30S ribosomal protein S9 >gi|167355610|gb|ABZ78223.1| ribosomal protein S9 [Shewanella halifaxensis HAW-EB4] (130 aa)
Score = 253, Expect = 1.2e-20, Identities = 60/130 (46%), Positives = 78/130 (60%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           M+  +Y G GRRK+S A V    GTG I++N+   +EYF        + QPL + +     D+ V V GGG TGQAGAIR GI RAL+  +   R +L+ +  +TRD R  ERKK GL  ARR PQF+KR
  S:     1 MAATQYYGTGRRKTSTARVFAKVGTGNIIVNKLPLDEYFGRETSRMVVRQPLELVEMTDKLDIMVTVKGGGNTGQAGAIRHGITRALMELDESLRPSLRAAGFVTRDARKVERKKVGLRKARRKPQFSKR 130
>gi|23501677|ref|NP_697804.1| 30S ribosomal protein S9 [Brucella suis 1330] >gi|148559299|ref|YP_001258771.1| 30S ribosomal protein S9 [Brucella ovis ATCC 25840] >gi|161618754|ref|YP_001592641.1| 30S ribosomal protein S9 [Brucella canis ATCC 23365] >gi|163843063|ref|YP_001627467.1| 30S ribosomal protein S9 [Brucella suis ATCC 23445] >gi|166200239|sp|A5VPX4|RS9_BRUO2 30S ribosomal protein S9 >gi|189045688|sp|A9MAG7|RS9_BRUC2 30S ribosomal protein S9 >gi|189045689|sp|B0CLB7|RS9_BRUSI 30S ribosomal protein S9 >gi|38258389|sp|Q8G1C9|RS9_BRUSU 30S ribosomal protein S9 >gi|23347598|gb|AAN29719.1| ribosomal protein S9 [Brucella suis 1330] >gi|148370556|gb|ABQ60535.1| ribosomal protein S9 [Brucella ovis ATCC 25840] >gi|161335565|gb|ABX61870.1| 30S ribosomal protein S9 [Brucella canis ATCC 23365] >gi|163673786|gb|ABY37897.1| 30S ribosomal protein S9 [Brucella suis ATCC 23445] (158 aa)
Score = 253, Expect = 1.2e-20, Identities = 56/121 (46%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PGTGKI +N ++  +YF   ++   ++QP+V ++    FD+   V GGG +GQAGA+R GI++AL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    38 GKRKDAVARVWVKPGTGKITVNDKEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEPGLRTVLKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 158
>gi|17987452|ref|NP_540086.1| 30S ribosomal protein S9 [Brucella melitensis 16M] >gi|20139887|sp|Q8YGJ0|RS9_BRUME 30S ribosomal protein S9 >gi|17983146|gb|AAL52350.1| SSU ribosomal protein S9P [Brucella melitensis 16M] (158 aa)
Score = 253, Expect = 1.2e-20, Identities = 56/121 (46%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PGTGKI +N ++  +YF   ++   ++QP+V ++    FD+   V GGG +GQAGA+R GI++AL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    38 GKRKDAVARVWVKPGTGKITVNDKEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTYYEPGLRTVLKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 158
>gi|83952139|ref|ZP_00960871.1| 30S ribosomal protein S9 [Roseovarius nubinhibens ISM] >gi|83837145|gb|EAP76442.1| 30S ribosomal protein S9 [Roseovarius nubinhibens ISM] (162 aa)
Score = 253, Expect = 1.2e-20, Identities = 55/121 (45%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+ +N R+ N YF   ++   + QP  +      FDV   V GGG +GQAGA++ GI++AL + +   R  LK +  LTRD R  ERKKYG   ARRS QF+KR
  S:    42 GKRKDAVARVWIKPGSGKVSVNGREINVYFARPVLQMILRQPFTVAGVEDQFDVVATVKGGGLSGQAGAVKHGISKALQLYDPSLRGALKAAGFLTRDSRVVERKKYGKRKARRSFQFSKR 162
>gi|223001|prf||0401169A protein S9 (128 aa)
Score = 252, Expect = 1.3e-20, Identities = 60/126 (47%), Positives = 79/126 (62%)
  Q:     5 EYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +Y G GRRKSS A V + PG GKI+INQR   +YF        + QPL + +  +  D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL  ARR P+F+KR
  S:     4 QYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVNMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARR-PEFSKR 128
>gi|99034835|ref|ZP_01314749.1| hypothetical protein Wendoof_01000425 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (151 aa)
Score = 252, Expect = 1.4e-20, Identities = 58/121 (47%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKP-NEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK SVA V + PG+GK  +N++     YF    V Q ++ P V T T   +DVF  V GGG +GQAGA+  GI+RAL   + D    L+ S+ LTRD R  ERKKYG + AR+  QF+KR
  S:    30 GRRKESVARVWIKPGSGKFSVNKKGDLISYFKRESVCQIVKMPFVATSTLDKYDVFATVKGGGLSGQAGALAHGISRALSSVSQDLHSILRNSEFLTRDSRVVERKKYGQHKARKKCQFSKR 151
>gi|15618170|ref|NP_224455.1| 30S ribosomal protein S9 [Chlamydophila pneumoniae CWL029] >gi|15835781|ref|NP_300305.1| 30S ribosomal protein S9 [Chlamydophila pneumoniae J138] >gi|16752792|ref|NP_445060.1| 30S ribosomal protein S9 [Chlamydophila pneumoniae AR39] >gi|33241588|ref|NP_876529.1| 30S ribosomal protein S9 [Chlamydophila pneumoniae TW-183] >gi|7388228|sp|Q9Z8T8|RS9_CHLPN 30S ribosomal protein S9 >gi|4376521|gb|AAD18399.1| S9 Ribosomal Protein [Chlamydophila pneumoniae CWL029] >gi|7189433|gb|AAF38343.1| ribosomal protein S9 [Chlamydophila pneumoniae AR39] >gi|8978619|dbj|BAA98456.1| S9 ribosomal protein [Chlamydophila pneumoniae J138] >gi|33236096|gb|AAP98186.1| ribosomal protein S9 [Chlamydophila pneumoniae TW-183] (134 aa)
Score = 252, Expect = 1.4e-20, Identities = 60/121 (49%), Positives = 80/121 (66%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLV-ITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +V+ V+L PG+GKI +N +   +YFP  +    +  PL  IT+ +  +D+ ++V GGG  GQ  A RLG+ARALL  N + R+ LK    LTRDPR KERKKYG   AR+S QF+KR
  S:    13 GRRKQAVSSVRLRPGSGKIDVNGKSFEDYFPLEIQRTTILSPLKKITEDQSQYDLIIRVSGGGIQGQVIATRLGLARALLKENEENRQDLKSCGFLTRDPRKKERKKYGHKKARKSFQFSKR 134
>gi|167854976|ref|ZP_02477751.1| 30S ribosomal protein S9 [Haemophilus parasuis 29755] >gi|167853933|gb|EDS25172.1| 30S ribosomal protein S9 [Haemophilus parasuis 29755] (131 aa)
Score = 252, Expect = 1.4e-20, Identities = 58/123 (47%), Positives = 74/123 (60%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSS A V + PG G I INQR    YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     9 GTGRRKSSSARVFIKPGNGNITINQRSLEVYFGRETARMIVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALIEYDETLRPALRAAGFVTRDARRVERKKVGLHKARRRPQYSKR 131
>gi|77463586|ref|YP_353090.1| 30S ribosomal protein S9 [Rhodobacter sphaeroides 2.4.1] >gi|126462418|ref|YP_001043532.1| 30S ribosomal protein S9 [Rhodobacter sphaeroides ATCC 17029] >gi|77388004|gb|ABA79189.1| SSU ribosomal protein S9P [Rhodobacter sphaeroides 2.4.1] >gi|126104082|gb|ABN76760.1| SSU ribosomal protein S9P [Rhodobacter sphaeroides ATCC 17029] (160 aa)
Score = 252, Expect = 1.4e-20, Identities = 54/121 (44%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+ +N +  +EYF   ++   + QP  + +    FDV   V GGG +GQAGA++ GI++AL +     R  LK +  LTRD R  ERKKYG   ARRS QF+KR
  S:    40 GKRKDAVARVWIKPGSGKVTVNGKPMDEYFARPVLQMILRQPFKVANVEGQFDVMATVAGGGLSGQAGAVKHGISKALQLYEPALRAALKAAGFLTRDSRVVERKKYGKAKARRSFQFSKR 160
>gi|171741283|ref|ZP_02917090.1| hypothetical protein BIFDEN_00358 [Bifidobacterium dentium ATCC 27678] >gi|171276897|gb|EDT44558.1| hypothetical protein BIFDEN_00358 [Bifidobacterium dentium ATCC 27678] (163 aa)
Score = 252, Expect = 1.4e-20, Identities = 70/123 (56%), Positives = 84/123 (68%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDF-RKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK +VA V+LVPGTGK  IN R   EYFP  L+ +++  P+V+      FD  V V GGG TGQAGAIRLG+ARAL   + D  R TLK +  LTRD R  ERKK GL+ ARR+PQF+KR
  S:    40 GTGRRKEAVARVRLVPGTGKWTINGRTLEEYFPAKLLQREVNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRATLKKAGFLTRDARVVERKKAGLHKARRAPQFSKR 163
>gi|126729686|ref|ZP_01745499.1| 30S ribosomal protein S9 [Sagittula stellata E-37] >gi|126709805|gb|EBA08858.1| 30S ribosomal protein S9 [Sagittula stellata E-37] (164 aa)
Score = 252, Expect = 1.4e-20, Identities = 54/121 (44%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+++N +  + YF   ++   + QP  +      FDV   V GGG TGQAGA++ GI++AL + N + R  LK +  LTRD R  ERKK+G   ARRS QF+KR
  S:    44 GKRKDAVARVWIKPGSGKVIVNGKDQDVYFARPVLQLILRQPFQVAGVEGEFDVMATVKGGGLTGQAGAVKHGISKALQLYNPELRSALKAAGFLTRDSRVVERKKFGKRKARRSFQFSKR 164
>gi|119357803|ref|YP_912447.1| 30S ribosomal protein S9 [Chlorobium phaeobacteroides DSM 266] >gi|119355152|gb|ABL66023.1| SSU ribosomal protein S9P [Chlorobium phaeobacteroides DSM 266] (129 aa)
Score = 252, Expect = 1.4e-20, Identities = 58/122 (47%), Positives = 80/122 (65%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK+SVA V + PG G+++IN+    EYF + +  Q   +PL +T+  ++FD+ V V GGG +GQ GA+ L IARAL   +   R  LK  K+LTRDPR  ERKK+G   AR+  QF+KR
  S:     8 VGRRKTSVARVFMSPGKGRVIINKLPAEEYFRDEVKRQQALRPLALTEKMEDFDIKVNVHGGGVSGQTGAVSLAIARALTEFDESARAVLKKEKLLTRDPRMVERKKFGRKKARKRFQFSKR 129
>gi|196478535|gb|ACG78063.1| ribosomal protein S9 [Phenylobacterium zucineum HLK1] (161 aa)
Score = 252, Expect = 1.5e-20, Identities = 60/121 (49%), Positives = 73/121 (60%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK++VA V + PG GK+ IN R    YF   ++   + QPL + D    FDV V V G G +GQAGA+R GIA+AL       R  LK    LTRDPR  ERKKYG   ARRS QF+KR
  S:    41 GKRKNAVARVWIKPGKGKVTINGRDQEVYFARPVLRMMIAQPLQVADRLGQFDVDVTVEGSGLSGQAGAVRHGIAKALTYYEPGLRAVLKPHGFLTRDPRVVERKKYGKAKARRSFQFSKR 161
>gi|169182855|ref|ZP_02843368.1| ribosomal protein S9 [Thauera sp. MZ1T] >gi|169010059|gb|EDS56828.1| ribosomal protein S9 [Thauera sp. MZ1T] (130 aa)
Score = 252, Expect = 1.5e-20, Identities = 58/123 (47%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK++VA V + PGTG I++N +  +E+F        + QPLV+T     FD+ V VVGGG +GQAGA+R GI RAL+  +   +  L+ +  +TRD R  ERKK GL  ARR+ QF+KR
  S:     8 GTGRRKTAVARVFIKPGTGNIVVNGKPVDEFFSRETGRMIVRQPLVLTGNEGRFDIMVNVVGGGESGQAGAVRHGITRALVDYDAGLKGDLRAAGFVTRDAREVERKKVGLRKARRAKQFSKR 130
>gi|93006572|ref|YP_581009.1| 30S ribosomal protein S9 [Psychrobacter cryohalolentis K5] >gi|92394250|gb|ABE75525.1| SSU ribosomal protein S9P [Psychrobacter cryohalolentis K5] (128 aa)
Score = 252, Expect = 1.5e-20, Identities = 58/123 (47%), Positives = 77/123 (62%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK+S A V L  GTG I++N +  +EYF        + QPL + DT   +D+++ V GGG +GQAGAIR GI RAL+  +   +  LK +  +TRD R  ERKK GL  AR+ PQF+KR
  S:     6 GTGRRKTSTARVFLAKGTGSIVVNGKPLDEYFSRETSRMVVRQPLELLDTPTAYDLYITVKGGGISGQAGAIRHGITRALIELDESNKPALKAAGFVTRDSRQVERKKLGLRKARKRPQFSKR 128
>gi|115455587|ref|NP_001051394.1| Os03g0769100 [Oryza sativa (japonica cultivar-group)] >gi|5456938|dbj|BAA82395.1| ribosomal protein S9 [Oryza sativa Japonica Group] >gi|40539060|gb|AAR87317.1| ribosomal protein S9 [Oryza sativa (japonica cultivar-group)] >gi|50872448|gb|AAT85048.1| putative 9S ribosomal protein [Oryza sativa (japonica cultivar-group)] >gi|108711276|gb|ABF99071.1| 30S ribosomal protein S9, chloroplast precursor, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|113549865|dbj|BAF13308.1| Os03g0769100 [Oryza sativa (japonica cultivar-group)] (223 aa)
Score = 252, Expect = 1.5e-20, Identities = 59/121 (48%), Positives = 79/121 (65%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK+++A V L  GTG++ IN R   EY   N + ++  + PLV      ++DVFVKV GGG +GQA AI LG+ARAL+  +   + TL+   +LTRD R  ERKK GL  AR+ PQF+KR
  S:   102 GRRKTAIARVVLQEGTGRVFINFRDAKEYLQGNPMWMEYCKVPLVTLGFENSYDVFVKVHGGGLSGQAQAICLGVARALVKISTANKVTLRGEGLLTRDTRIVERKKAGLKKARKRPQFSKR 223
>gi|32035250|ref|ZP_00135268.1| COG0103: Ribosomal protein S9 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|165976016|ref|YP_001651609.1| 30S ribosomal protein S9 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149916|ref|YP_001968441.1| 30S ribosomal protein S9 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165876117|gb|ABY69165.1| 30S ribosomal protein S9 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915047|gb|ACE61299.1| 30S ribosomal protein S9 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (131 aa)
Score = 252, Expect = 1.6e-20, Identities = 58/123 (47%), Positives = 75/123 (60%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSS A V + PG G I INQR  + YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     9 GTGRRKSSSARVFIKPGNGNITINQRSLDVYFGRETSRMVVRQPLELVELLDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFVTRDARRVERKKVGLHKARRRPQYSKR 131
>gi|33152549|ref|NP_873902.1| 30S ribosomal protein S9 [Haemophilus ducreyi 35000HP] >gi|39932103|sp|Q7VLF7|RS9_HAEDU 30S ribosomal protein S9 >gi|33148773|gb|AAP96291.1| 30S ribosomal protein S9 [Haemophilus ducreyi 35000HP] (131 aa)
Score = 252, Expect = 1.6e-20, Identities = 58/123 (47%), Positives = 75/123 (60%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSS A V + PG+G I INQR    YF        + QPL + +     D+++ V GGG +GQAGAIR GI RAL+  +   R  L+ +  +TRD R  ERKK GL+ ARR PQ++KR
  S:     9 GTGRRKSSSARVFIKPGSGNITINQRSLEVYFGRETSRMVVRQPLELVELLDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFVTRDARRVERKKVGLHKARRRPQYSKR 131
>gi|192359611|ref|YP_001983245.1| ribosomal protein S9 [Cellvibrio japonicus Ueda107] >gi|190685776|gb|ACE83454.1| ribosomal protein S9 [Cellvibrio japonicus Ueda107] (130 aa)
Score = 252, Expect = 1.6e-20, Identities = 60/130 (46%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +Y G GRRK+S A V +  G+G I +N R  +EYF   +    + QPL + D  + FDV V V GGG  GQAGAIR G+ RAL+  + + R  L+ +  +TRD R  ERKK GL  AR+ PQ++KR
  S:     1 MSVTQYYGTGRRKTSTARVFIKAGSGVITVNDRPLDEYFGRPVARMVVRQPLELVDLVEKFDVNVTVSGGGSFGQAGAIRHGLTRALMEYDENLRSELRKAGYVTRDSREVERKKVGLRKARKRPQYSKR 130
>gi|121593053|ref|YP_984949.1| ribosomal protein S9 [Acidovorax sp. JS42] >gi|166228546|sp|A1W3P8|RS9_ACISJ 30S ribosomal protein S9 >gi|120605133|gb|ABM40873.1| ribosomal protein S9 [Acidovorax sp. JS42] (130 aa)
Score = 252, Expect = 1.6e-20, Identities = 58/123 (47%), Positives = 77/123 (62%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V L  G+GKI +N +   +YF     I   +QPL +T+  + FD+ + V GGG +GQAGA R GI RAL+  +   +  L  +  +TRD R  ERKK GL+ ARR+ QF+KR
  S:     8 GTGRRKSSVARVFLKKGSGKITVNGKDIQQYFGRETSIMIAKQPLALTNHVETFDIQINVHGGGESGQAGAARHGITRALIDYDATLKPALSQAGFVTRDAREVERKKVGLHSARRAKQFSKR 130
>gi|146299371|ref|YP_001193962.1| 30S ribosomal protein S9 [Flavobacterium johnsoniae UW101] >gi|146153789|gb|ABQ04643.1| SSU ribosomal protein S9P [Flavobacterium johnsoniae UW101] (128 aa)
Score = 251, Expect = 1.7e-20, Identities = 57/122 (46%), Positives = 79/122 (64%)
  Q:     9 LGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           +GRRK++VA V +  GTG I +N+++   YFP + +   + QPL +T+   NFDV V V GGG TGQA A+R+ +AR +   N + R  LK   +LTRDPR  ERKK+G   AR+  QF+KR
  S:     7 IGRRKTAVARVYVSEGTGNITVNKKEFATYFPTATLQYKVLQPLSMTENVNNFDVKVNVYGGGTTGQAEAVRMALARVMCEVNAENRGILKPEGLLTRDPRMVERKKFGQKKARKRFQFSKR 128
>gi|29349284|ref|NP_812787.1| 30S ribosomal protein S9 [Bacteroides thetaiotaomicron VPI-5482] >gi|29341192|gb|AAO78981.1| 30S ribosomal protein S9 [Bacteroides thetaiotaomicron VPI-5482] (128 aa)
Score = 251, Expect = 1.7e-20, Identities = 58/123 (47%), Positives = 81/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            LGRRK ++A V +  GTGKI IN+R   EYFP++++   ++QPL      + +D+ V + GGGFTGQ+ A+RL IARAL+  N + +  L+    +TRDPR+ ERKK G   ARR  QF+KR
  S:     6 ALGRRKRAIARVFVSEGTGKITINKRDLAEYFPSTILQYVVKQPLNKLGAAEKYDIKVNLCGGGFTGQSQALRLAIARALIKMNAEDKAALRAEGFMTRDPRSVERKKPGQPKARRRFQFSKR 128
>gi|42522100|ref|NP_967480.1| 30S ribosomal subunit protein S9 [Bdellovibrio bacteriovorus HD100] >gi|39574631|emb|CAE78473.1| 30S ribosomal subunit protein S9 [Bdellovibrio bacteriovorus HD100] (132 aa)
Score = 251, Expect = 1.7e-20, Identities = 61/125 (48%), Positives = 76/125 (60%)
  Q:     6 YKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           Y   GRRK+S A V L PG G I IN +K  +Y         + QPL + +    FD  + V GGG +GQAGAIRLGI RAL+  N +F+  LK +  +TRDPR  ERKKYG  GARR  Q++KR
  S:     8 YYATGRRKTSAARVFLKPGKGTITINGKKSEDYLTRMQSRMVIVQPLDLLNQIGKFDAKITVAGGGESGQAGAIRLGITRALIAFNPEFKGILKKAGFVTRDPRMVERKKYGKAGARRRFQYSKR 132
>gi|11467765|ref|NP_050816.1| ribosomal protein S9 [Nephroselmis olivacea] >gi|20139957|sp|Q9TL29|RR9_NEPOL Chloroplast 30S ribosomal protein S9 >gi|5880694|gb|AAD54787.1|AF137379_10 ribosomal protein S9 [Nephroselmis olivacea] (134 aa)
Score = 251, Expect = 1.8e-20, Identities = 61/129 (47%), Positives = 81/129 (62%)
  Q:     2 SNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFP-NSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           S+V  +  GRRK +VA V+++ GTG++ INQR    Y   N   +   +  L +T+    +D  VK  GGG TGQA AI+LG+ARAL   +   RK LK    LTR+P  KERKKYGL  AR++PQF+KR
  S:     5 SSVGLRKTGRRKCAVAQVRIIEGTGQLTINQRPGVPYLQYNPAYLLAAQGALDVTELTNRYDTIVKTKGGGLTGQAEAIKLGLARALCSLHIKHRKALKPQGYLTRNPLRKERKKYGLKKARKAPQFSKR 134
>gi|167564073|ref|ZP_02356989.1| 30S ribosomal protein S9 [Burkholderia oklahomensis EO147] >gi|167571217|ref|ZP_02364091.1| 30S ribosomal protein S9 [Burkholderia oklahomensis C6786] (130 aa)
Score = 251, Expect = 1.8e-20, Identities = 57/123 (46%), Positives = 77/123 (62%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKS+VA V +  G G I++N +   +YF     +  + QPL +T   + FD+ V V GGG TGQAGA+R GI RAL+  +   + TL  +  +TRD R  ERKK GL+ ARR+ QF+KR
  S:     8 GTGRRKSAVARVFIKAGKGDIIVNGKPIADYFSRETSLMIVRQPLELTSHSQTFDIKVNVSGGGETGQAGAVRHGITRALIDYDATLKPTLSSAGFVTRDAREVERKKVGLHKARRAKQFSKR 130
>gi|194334610|ref|YP_002016470.1| ribosomal protein S9 [Prosthecochloris aestuarii DSM 271] >gi|194312428|gb|ACF46823.1| ribosomal protein S9 [Prosthecochloris aestuarii DSM 271] (131 aa)
Score = 251, Expect = 1.8e-20, Identities = 59/123 (47%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            +GRRK+SVA V L PG G I +N+    EYF  +    +  +PLV+ +  ++ DV V V GGG TGQAGA+ L IARAL+  + + R T +  ++LTRDPR  ERKKYG   AR+  QF+KR
  S:     9 AVGRRKTSVARVFLAPGKGNITVNKLPVEEYFREASKRHEAVRPLVLAEKMEDVDVKVNVHGGGMTGQAGAVCLAIARALVEMDEENRLTFRKERLLTRDPRMVERKKYGQKKARKRFQFSKR 131
>gi|62289740|ref|YP_221533.1| 30S ribosomal protein S9 [Brucella abortus bv. 1 str. 9-941] >gi|82699669|ref|YP_414243.1| 30S ribosomal protein S9 [Brucella melitensis biovar Abortus 2308] >gi|189023988|ref|YP_001934756.1| Ribosomal protein S9 [Brucella abortus S19] >gi|75505307|sp|Q57DW2|RS9_BRUAB 30S ribosomal protein S9 >gi|123546625|sp|Q2YND9|RS9_BRUA2 30S ribosomal protein S9 >gi|62195872|gb|AAX74172.1| RpsI, ribosomal protein, S9 [Brucella abortus biovar 1 str. 9-941] >gi|82615770|emb|CAJ10766.1| Ribosomal protein S9 [Brucella melitensis biovar Abortus 2308] >gi|189019560|gb|ACD72282.1| Ribosomal protein S9 [Brucella abortus S19] (158 aa)
Score = 251, Expect = 1.8e-20, Identities = 56/121 (46%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PGTGKI +N ++  +YF   ++   ++QP+V ++    FD+   V GGG +GQAGA+R GI++AL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    38 GKRKDAVARVWVKPGTGKITVNDKEFEKYFARPVLQMILQQPIVASNRAGQFDIVATVAGGGLSGQAGAVRHGISKALTDYEPGLRTVLKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 158
>gi|163736327|ref|ZP_02143746.1| ribosomal protein S9 [Phaeobacter gallaeciensis BS107] >gi|163741137|ref|ZP_02148529.1| 30S ribosomal protein S9 [Phaeobacter gallaeciensis 2.10] >gi|161385490|gb|EDQ09867.1| 30S ribosomal protein S9 [Phaeobacter gallaeciensis 2.10] >gi|161390197|gb|EDQ14547.1| ribosomal protein S9 [Phaeobacter gallaeciensis BS107] (161 aa)
Score = 251, Expect = 1.9e-20, Identities = 54/121 (44%), Positives = 76/121 (62%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PG+GK+ +N ++ N YF   ++   + QP  +      FDV+  V GGG +GQAGA++ GI++AL + N   R  LK +  LTRD R  ERKK+G   ARRS QF+KR
  S:    41 GKRKDAVARVWIKPGSGKVSVNGKELNTYFARPVLQMILRQPFQVAGVEGEFDVYATVKGGGLSGQAGAVKHGISKALQLYNPSLRGALKAAGFLTRDSRVVERKKFGRRKARRSFQFSKR 161
>gi|90418053|ref|ZP_01225965.1| small ribosomal subunit protein S9 [Aurantimonas sp. SI85-9A1] >gi|90337725|gb|EAS51376.1| small ribosomal subunit protein S9 [Aurantimonas sp. SI85-9A1] (158 aa)
Score = 251, Expect = 1.9e-20, Identities = 59/121 (48%), Positives = 71/121 (58%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK +VA V + PGTGKI IN R    YF   ++   + QP+V       FDV   V GGG +GQAGA+R GI++AL       R  LK    LTRD R  ERKKYG   ARRS QF+KR
  S:    38 GKRKDAVARVWVKPGTGKITINDRDFTAYFARPVLQMVLRQPIVAAARDGQFDVVATVAGGGLSGQAGAVRHGISKALTYYEPGLRAVLKKGGFLTRDSRTVERKKYGKAKARRSFQFSKR 158
>gi|17545210|ref|NP_518612.1| 30S ribosomal protein S9 [Ralstonia solanacearum GMI1000] >gi|20139885|sp|Q8Y245|RS9_RALSO 30S ribosomal protein S9 >gi|17427501|emb|CAD14019.1| probable 30s ribosomal protein s9. [Ralstonia solanacearum] (130 aa)
Score = 251, Expect = 2.0e-20, Identities = 58/123 (47%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKS+VA V +  G G I++N +   +YF     +  + QPL +T+    FD+ V VVGGG TGQAGA+R GI RAL+  +   + TL  + ++TRD R  ERKK GL+ ARR  QF+KR
  S:     8 GTGRRKSAVARVFIKSGKGDIIVNGKPVADYFARETSLMMVRQPLELTNHGATFDIKVNVVGGGETGQAGAVRHGITRALIDYDATLKPTLSKAGLVTRDAREVERKKVGLHKARRRKQFSKR 130
>gi|115350020|ref|YP_764410.1| ribosomal protein S9 [Stigeoclonium helveticum] >gi|122165138|sp|Q06SF6|RR9_STIHE Chloroplast 30S ribosomal protein S9 >gi|98990234|gb|ABF60201.1| ribosomal protein S9 [Stigeoclonium helveticum] (142 aa)
Score = 251, Expect = 2.0e-20, Identities = 62/124 (50%), Positives = 85/124 (68%)
  Q:     7 KGLGRRKSSVAHVKLVPGTGKILINQRKPNEYF---PNSLVIQDME-QPLVI-----TDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           KG+GRRK +VA V+L+ G+G+ +IN    N Y    P S++  D   + L +      D+ +  D  VKV GGG  GQA AI+LG+ARAL   N ++RK+LK S  LT+D R KER+KYGL  AR++PQ+ KR
  S:    10 KGIGRRKEAVAQVQLLAGSGQFIINGLPANLYLQEDPRSILAIDAPFKQLHVDHSADKDSLQTLDTIVKVQGGGKIGQANAIKLGVARALCEFNGEYRKSLKDSGFLTQDSRIKERRKYGLKKARKAPQYHKR 142
>gi|152980472|ref|YP_001351985.1| small subunit ribosomal protein S9 [Janthinobacterium sp. Marseille] >gi|166229565|sp|A6SUN8|RS9_JANMA 30S ribosomal protein S9 >gi|151280549|gb|ABR88959.1| small subunit ribosomal protein S9 [Janthinobacterium sp. Marseille] (130 aa)
Score = 251, Expect = 2.2e-20, Identities = 57/123 (46%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKS+VA V +  G+G+I++N +  NEYF     +  + QPL +T+  + FD+ V V GGG +GQAGA+R GI RAL+  +   +  L  +  +TRD R  ERKK GL  ARR+ QF+KR
  S:     8 GTGRRKSAVARVFIKSGSGQIVVNGKPANEYFSRETGLMVIRQPLELTNNVETFDIMVNVNGGGESGQAGAVRHGITRALIDYDATLKSELSKAGFVTRDAREVERKKVGLRKARRAKQFSKR 130
>gi|83749314|ref|ZP_00946311.1| SSU ribosomal protein S9P [Ralstonia solanacearum UW551] >gi|83723992|gb|EAP71173.1| SSU ribosomal protein S9P [Ralstonia solanacearum UW551] (130 aa)
Score = 250, Expect = 2.3e-20, Identities = 58/123 (47%), Positives = 78/123 (63%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKS+VA V +  G G I++N +   +YF     +  + QPL +T+    FD+ V VVGGG TGQAGA+R GI RAL+  +   + TL  + ++TRD R  ERKK GL+ ARR  QF+KR
  S:     8 GTGRRKSAVARVFIKSGKGDIVVNGKPVADYFARETSLMMIRQPLELTNHGATFDIKVNVVGGGETGQAGAVRHGITRALIDYDATLKPTLSKAGLVTRDSREVERKKVGLHKARRRKQFSKR 130
>gi|99081225|ref|YP_613379.1| 30S ribosomal protein S9 [Silicibacter sp. TM1040] >gi|99037505|gb|ABF64117.1| SSU ribosomal protein S9P [Silicibacter sp. TM1040] (161 aa)
Score = 250, Expect = 2.3e-20, Identities = 52/121 (42%), Positives = 77/121 (63%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G+RK ++A V + PG+GK+ +N ++ N+YF   ++   + QP  +      FDV+  V GGG +GQAGA++ GI++AL + +   R  LK +  LTRD R  ERKK+G   ARRS QF+KR
  S:    41 GKRKDAIARVWIKPGSGKVEVNGKEINKYFARPVLQMILRQPFTVAGVEDQFDVYATVKGGGLSGQAGAVKHGISKALQLYDPSLRGALKAAGFLTRDSRVVERKKFGRRKARRSFQFSKR 161
>gi|91774412|ref|YP_544168.1| SSU ribosomal protein S9P [Methylobacillus flagellatus KT] >gi|91708399|gb|ABE48327.1| SSU ribosomal protein S9P [Methylobacillus flagellatus KT] (130 aa)
Score = 250, Expect = 2.3e-20, Identities = 58/123 (47%), Positives = 76/123 (61%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V L  G+G I++N +  +EYF        + QPL +T+   +FD+ V V GGG +GQAGA+R GI RAL+  +   +  L  +  +TRD R  ERKK GL  ARR  QF+KR
  S:     8 GTGRRKSSVARVFLKSGSGNIVVNDKPADEYFSRVTSRMILRQPLALTENEGSFDILVNVTGGGESGQAGAVRHGITRALIDYDAALKSALSKAGFVTRDAREVERKKVGLRKARRRKQFSKR 130
>gi|56551779|ref|YP_162618.1| 30S ribosomal protein S9 [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543353|gb|AAV89507.1| ribosomal protein S9 [Zymomonas mobilis subsp. mobilis ZM4] (182 aa)
Score = 250, Expect = 2.4e-20, Identities = 57/121 (47%), Positives = 75/121 (61%)
  Q:    10 GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           GRRK +VA V + PG+GKI +N R    YF    +   + QP  +T+ R  +DV   V GGG +GQAGA++ GI++AL       R ++K +  LTRD RA ERKKYG   ARRS QF+KR
  S:    62 GRRKDAVARVWIKPGSGKITVNGRDQEVYFARPTLRLVINQPFDVTERRGQYDVVATVTGGGLSGQAGAVKHGISQALTRYEPALRSSVKAAGFLTRDSRAVERKKYGRAKARRSFQFSKR 182
>gi|148652606|ref|YP_001279699.1| 30S ribosomal protein S9 [Psychrobacter sp. PRwf-1] >gi|148571690|gb|ABQ93749.1| SSU ribosomal protein S9P [Psychrobacter sp. PRwf-1] (128 aa)
Score = 250, Expect = 2.4e-20, Identities = 57/123 (46%), Positives = 77/123 (62%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK+S A V L  GTG I++N +  +EYF        + QPL + D+ + +D++  V GGG  GQAGAIR GI RAL+ ++   +  LK +  +TRD R  ERKK GL  AR+ PQF+KR
  S:     6 GTGRRKTSTARVFLSKGTGNIVVNGKPLDEYFGRETSRMVVRQPLELLDSAETYDIYATVKGGGINGQAGAIRHGITRALIESDETLKPALKEAGFVTRDSRQVERKKLGLRKARKRPQFSKR 128
>gi|126665265|ref|ZP_01736248.1| 30S ribosomal protein S9 [Marinobacter sp. ELB17] >gi|126630635|gb|EBA01250.1| 30S ribosomal protein S9 [Marinobacter sp. ELB17] (130 aa)
Score = 250, Expect = 2.4e-20, Identities = 59/130 (45%), Positives = 80/130 (61%)
  Q:     1 MSNVEYKGLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           MS  +  G GRRK+S A V + PG+G I IN R   E+F    +   + QPLV+ ++   FD+ V V GGG +GQAGAIR G+ RAL+  +   R  ++ +  +TRD R  ERKK GL  AR+ PQF+KR
  S:     1 MSVAQNYGTGRRKTSTARVFIKPGSGSISINGRTIEEFFGRETLRMIVRQPLVVAESVDRFDINVTVKGGGISGQAGAIRHGLTRALMEYDETLRPAMRKAGYVTRDAREVERKKVGLRKARKRPQFSKR 130
>gi|121609593|ref|YP_997400.1| ribosomal protein S9 [Verminephrobacter eiseniae EF01-2] >gi|166229618|sp|A1WL75|RS9_VEREI 30S ribosomal protein S9 >gi|121554233|gb|ABM58382.1| SSU ribosomal protein S9P [Verminephrobacter eiseniae EF01-2] (130 aa)
Score = 250, Expect = 2.6e-20, Identities = 59/123 (47%), Positives = 75/123 (60%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKSSVA V L  G+GKI IN +    YF     I    QPL +T+  + FD+ + V GGG +GQAGA R GI RAL+  +   +  L  +  +TRD R  ERKK GL+ ARR+ QF+KR
  S:     8 GTGRRKSSVARVFLKKGSGKITINGKDIQSYFGRETSIMIARQPLALTNHVETFDIRINVYGGGESGQAGAARHGITRALIDYDAALKPALSQAGFVTRDAREVERKKVGLHSARRAKQFSKR 130
>gi|153809096|ref|ZP_01961764.1| hypothetical protein BACCAC_03406 [Bacteroides caccae ATCC 43185] >gi|149128429|gb|EDM19648.1| hypothetical protein BACCAC_03406 [Bacteroides caccae ATCC 43185] (128 aa)
Score = 250, Expect = 2.7e-20, Identities = 57/123 (46%), Positives = 81/123 (65%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
            LGRRK ++A + +  GTGKI IN+R   EYFP++++   ++QPL      + +D+ V + GGGFTGQ+ A+RL IARAL+  N + +  L+    +TRDPR+ ERKK G   ARR  QF+KR
  S:     6 ALGRRKRAIARIFVSEGTGKITINKRDLAEYFPSTILQYVVKQPLNKIGAAEKYDIKVNLCGGGFTGQSQALRLAIARALVKINAEDKAALRAEGFMTRDPRSVERKKPGQPKARRRFQFSKR 128
>gi|134093524|ref|YP_001098599.1| 30S ribosomal protein S9 [Herminiimonas arsenicoxydans] >gi|166229564|sp|A4G1T3|RS9_HERAR 30S ribosomal protein S9 >gi|133737427|emb|CAL60470.1| 30S ribosomal protein S9 [Herminiimonas arsenicoxydans] (130 aa)
Score = 250, Expect = 2.7e-20, Identities = 57/123 (46%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRKS+VA V +  G+G+I++N +  NEYF     +  + QPL +T+  + FD+ V V GGG +GQAGA+R GI RAL+  +   +  L  +  +TRD R  ERKK GL  ARR+ QF+KR
  S:     8 GTGRRKSAVARVFIKSGSGQIVVNGKPANEYFSRETGLMVIRQPLELTNNVETFDIMVNVNGGGESGQAGAVRHGITRALIDYDATLKPELSKAGFVTRDAREVERKKVGLRKARRAKQFSKR 130
>gi|119899049|ref|YP_934262.1| 30S ribosomal protein S9 [Azoarcus sp. BH72] >gi|166228552|sp|A1K970|RS9_AZOSB 30S ribosomal protein S9 >gi|119671462|emb|CAL95375.1| 30S ribosomal protein S9 [Azoarcus sp. BH72] (130 aa)
Score = 250, Expect = 2.7e-20, Identities = 56/123 (45%), Positives = 79/123 (64%)
  Q:     8 GLGRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRKNFDVFVKVVGGGFTGQAGAIRLGIARALLVANNDFRKTLKVSKMLTRDPRAKERKKYGLYGARRSPQFTKR 130
           G GRRK++VA V + PG+G I++N +  +E+F        + QPLV+T     FD+ V V GGG +GQAGA+R GI RAL+  + + +  L+ +  +TRD R  ERKK GL  ARR+ QF+KR
  S:     8 GTGRRKTAVARVFIKPGSGNIVVNGKPVDEFFSRETGRMIVRQPLVLTGNEGRFDIMVNVTGGGESGQAGAVRHGITRALIDYSAELKSELRAAGFVTRDAREVERKKVGLRKARRAKQFSKR 130