>gi|26554280|ref|NP_758214.1| hypothetical protein MYPE8260 [Mycoplasma penetrans HF-2] >gi|26454289|dbj|BAC44618.1| hypothetical protein [Mycoplasma penetrans HF-2] (50 aa)
Score = 157, Expect = 1.5e-09, Identities = 50/50 (100%), Positives = 50/50 (100%)
  Q:     1 MFNNHYMTPTLPDTESANHQSIVLNHSLTNYSFKSSATKSSGYLAFYSFD 50
           MFNNHYMTPTLPDTESANHQSIVLNHSLTNYSFKSSATKSSGYLAFYSFD
  S:     1 MFNNHYMTPTLPDTESANHQSIVLNHSLTNYSFKSSATKSSGYLAFYSFD 50