>gi|26553535|ref|NP_757469.1| hypothetical protein MYPE830 [Mycoplasma penetrans HF-2] >gi|26453541|dbj|BAC43873.1| hypothetical protein [Mycoplasma penetrans HF-2] (72 aa)
Score = 230, Expect = 5.3e-18, Identities = 72/72 (100%), Positives = 72/72 (100%)
  Q:     1 MELKNKTRKPLNNEKLHGKPKKEKIDINKGFPNNEIKDEFIEWFIESVRNGKVKIDDEETLKEFLKKTKFSS 72
           MELKNKTRKPLNNEKLHGKPKKEKIDINKGFPNNEIKDEFIEWFIESVRNGKVKIDDEETLKEFLKKTKFSS
  S:     1 MELKNKTRKPLNNEKLHGKPKKEKIDINKGFPNNEIKDEFIEWFIESVRNGKVKIDDEETLKEFLKKTKFSS 72