>gi|26553536|ref|NP_757470.1| hypothetical protein MYPE835 [Mycoplasma penetrans HF-2] >gi|26453542|dbj|BAC43874.1| hypothetical protein [Mycoplasma penetrans HF-2] (71 aa)
Score = 237, Expect = 7.4e-19, Identities = 71/71 (100%), Positives = 71/71 (100%)
  Q:     1 MGFIYKIRKPQRIKETKSADVLILESVNRNYNNKFHMKYIEKQMLILKIKLIYLVMMLIYQFTIVINIKNS 71
           MGFIYKIRKPQRIKETKSADVLILESVNRNYNNKFHMKYIEKQMLILKIKLIYLVMMLIYQFTIVINIKNS
  S:     1 MGFIYKIRKPQRIKETKSADVLILESVNRNYNNKFHMKYIEKQMLILKIKLIYLVMMLIYQFTIVINIKNS 71