>gi|26553537|ref|NP_757471.1| haloacid dehalogenase-like hydrolase [Mycoplasma penetrans HF-2] >gi|26453543|dbj|BAC43875.1| predicted haloacid dehalogenase-like hydrolase [Mycoplasma penetrans HF-2] (273 aa)
Score = 1335, Expect = 1.2e-145, Identities = 273/273 (100%), Positives = 273/273 (100%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK
  S:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
>gi|167755390|ref|ZP_02427517.1| hypothetical protein CLORAM_00904 [Clostridium ramosum DSM 1402] >gi|167704329|gb|EDS18908.1| hypothetical protein CLORAM_00904 [Clostridium ramosum DSM 1402] (296 aa)
Score = 590, Expect = 3.4e-59, Identities = 129/269 (47%), Positives = 180/269 (66%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           ++ IK V+ D+DGTLL+    V  +++ AIKKI+EKG+LFGL TGRD +++   L+  W I   VD I+G GGA+ Y+ + N  K +  L G+ IKDII H++ +DLNF IP  G LY PK++ +   L+  D +  K  D DV+L EP++K++IVC  +YM  VI +SK+F +       L T  IL+EYM P VSKT+GL+  +    + + ++  FGDADNDYDM LN+ +GV M NGS+KTKSVA +IT+ DNN+DGI NFI KY
  S:    28 LTNIKAVMCDVDGTLLNQDGIVSPATVEAIKKIREKGILFGLSTGRDVHSV-KTLLTVWGISGLVDAIVGTGGAEIYDYQLNIDKSSYPLDGELIKDIIKHHEGMDLNFAIPYEGTLYAPKDDDYIRDLARDDRVPYKVVDFDVFLNEPRAKLIIVCAPDYMDKVIEKSKTFSNPNYKSASLKTASILYEYMDPRVSKTHGLQEVMAMHKIEMTDLCTFGDADNDYDMTLNAGVGVVMANGSEKTKSVADFITD-DNNHDGIANFINKY 294
>gi|167766122|ref|ZP_02438175.1| hypothetical protein CLOSS21_00615 [Clostridium sp. SS2/1] >gi|167712202|gb|EDS22781.1| hypothetical protein CLOSS21_00615 [Clostridium sp. SS2/1] (293 aa)
Score = 541, Expect = 1.6e-53, Identities = 117/270 (43%), Positives = 175/270 (64%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +  IKV++ D+DGTLL+    V   +I AIKK++E+G+LFG+ TGRD  ++   L  KW I   VD ++G  G + Y+ KT+  ++   L G+ I +I+ HY+D+D+NF I  +G LY PKE+     LS+ D +  +  D D YL E + K++IVC  E MP VI R+K+FK++      L T   LFE+M P +SK+ GL+  ++    T++N+  FGDADNDYDM L++ +GV M NGS+KTKSVA +IT +DN++DGI  F+ ++ 
  S:    22 MKNIKVIMCDIDGTLLNSKGIVTSKTIDAIKKVREQGILFGISTGRDVPSVKR-LFGKWGIGGLVDMVVGSNGGEIYDYKTDYYEENFALPGNLIANIMEHYKDMDVNFAIHGDGVLYTPKEDELIKILSKGDQLPYEVIDFDEYLKEDRLKLLIVCKPETMPAVIERAKTFKNERFKCASLQTTQHLFEFMDPRISKSFGLQKLMEMHGFTMENLCTFGDADNDYDMTLHAGVGVVMANGSEKTKSVADHIT-KDNDHDGIGVFLQEHL 289
>gi|139438233|ref|ZP_01771786.1| Hypothetical protein COLAER_00775 [Collinsella aerofaciens ATCC 25986] >gi|133776430|gb|EBA40250.1| Hypothetical protein COLAER_00775 [Collinsella aerofaciens ATCC 25986] (273 aa)
Score = 456, Expect = 1.3e-43, Identities = 101/269 (37%), Positives = 149/269 (55%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSF-LSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           S IK V  D+DGTLL     V   ++ AI+ ++E+G+LFGLCTGRDA+     + + W I+  VD ++GCGGA+  + + ++  + S+ L G+ I  I  H  DL      P +G  Y P+ N     LS  D +  +  D   +L EP+ KVM     E MP VI R+ +F         L T   L+E+M P VSKT GL    +  ++ L ++  FGDADND  M+ ++ +GVAM NGSD T++ A ++    N+ DGI  FI ++ 
  S:     6 SHIKAVFCDIDGTLLTSQHTVSPRTVAAIRALRERGVLFGLCTGRDAH-ATEAMYELWGIEGLVDVLVGCGGAEVID-RAHDINELSYPLPGETIARICKHMADLPATPVCPRDGVFYVPESNACVEHLSRVDGVPYQVVDFAEFLHEPQPKVMFTMAPEVMPQVIERASTFADNTVKAAALQTTQRLYEFMDPRVSKTRGLVRVAELNDMELQDICVFGDADNDTCMVADAGVGVAMANGSDATRAAADFVAAS-NDEDGIAIFIEEHL 272
>gi|119945569|ref|YP_943249.1| Cof-like hydrolase [Psychromonas ingrahamii 37] >gi|119864173|gb|ABM03650.1| Cof-like hydrolase [Psychromonas ingrahamii 37] (268 aa)
Score = 259, Expect = 8.6e-21, Identities = 78/265 (29%), Positives = 131/265 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV-----DVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+VV DMDGTLL+  K + E    AI   K+ G+   L +GR  + M+  L +   +    D+++ C  +   N  + E  ++ FL+G   +D+ +    L +  G+  N + Y  K+   + + S+Y    A    +     D    EP     K+M++ + + +   INR   S + KY +     + P  +E+M     K NG+         T + V+  GDA ND +MI  + +G+AM N +D  K+VA YIT   N+ DG+ +   K+
  S:     3 KLVVLDMDGTLLNSQKEITERVRKAINAAKDIGIKVVLASGRPIDGMSPAL-EALSLTTVDDYVLTCNASLTLNAGSREVIRSEFLTGQDARDLYH----LSVKLGV--NTHAYSAKQGLITPKTSKYTEHEADINQIKINICDFTTLEPDHEMLKIMMIDEADLLTAAINRLPDSLQEKYSMAQ---SAPFFYEFMSKKSGKANGVIALAAYLGFTQEEVICVGDAGNDLEMIQYAGLGIAMANATDDVKAVADYIT-LSNDQDGVAHVFEKF 265
>gi|194016517|ref|ZP_03055131.1| phosphatase YidA [Bacillus pumilus ATCC 7061] >gi|194011990|gb|EDW21558.1| phosphatase YidA [Bacillus pumilus ATCC 7061] (270 aa)
Score = 246, Expect = 2.9e-19, Identities = 79/253 (31%), Positives = 125/253 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDV---DVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDN 259
           K+V  DMDGTLL+D   V +    AI++ K +G+   LCTGR    + N  +D  ++ +  D++I   GA   N  TNE      LS + +  +    ++LD      D+ +LY P  +   +++  S    +  KY  V   D  +  PK  +M +   E +   I    S  K KY +   + +     E +HP VSK N +K+  K+  +  + V+A GD  ND  M+  +  GVAM N  D  K+VA  +T+ +N
  S:     3 KLVAIDMDGTLLNDQHMVPDEVFEAIQQAKAEGVKIVLCTGRPIGGV-NRYLDDLQLNQEGDYVIAYNGALVQNSHTNEVVSELTLSYEDLTSLYKLSRELDTPMHYFDSAHLYTPNRDISEYTVLESYLTKLPLKYLPVEEADPSMRLPK--MMYIDQPERLEKTIQAIPSEVKDKYMM---VKSTDFFLEILHPEVSKGNAVKLLAKELGIAREEVMAIGDNGNDVSMLEFAGCGVAMGNAIDDVKAVADVVTKSNN 255
>gi|157694337|ref|YP_001488799.1| HAD family hydrolase [Bacillus pumilus SAFR-032] >gi|157683095|gb|ABV64239.1| possible HAD family hydrolase [Bacillus pumilus SAFR-032] (270 aa)
Score = 244, Expect = 3.9e-19, Identities = 79/253 (31%), Positives = 124/253 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDV---DVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDN 259
           K+V  DMDGTLL+D   V +    AI++ K +G+   LCTGR    +   L D  ++ +  D++I   GA   N  TNE      LS + +  +    ++LD      D+ +LY P  +   +++  S    +  KY  V   D  +  PK  +M +   E +   I    S  K KY +   + +     E +HP VSK N +K+  K+  +  + V+A GD  ND  M+  +  GVAM N  D  K+VA  +T+ +N
  S:     3 KLVAIDMDGTLLNDQHMVPDEVFEAIQQAKAEGVKIVLCTGRPIGGVHRYL-DDLQLNQEGDYVIAYNGALVQNSHTNEVVSELTLSYEDLTSLYKLSRELDTPMHYFDSAHLYTPNRDISEYTVLESYLTKLPLKYLPVEEADPSMRLPK--MMYIDQPERLEKTIQAIPSEVKEKYMM---VKSTDFFLEILHPEVSKGNAVKLLAKELGIAREEVMAIGDNGNDVSMLEFAGCGVAMGNAIDDVKAVADVVTKSNN 255
>gi|54303457|ref|YP_133450.1| hypothetical protein PBPRB1791 [Photobacterium profundum SS9] >gi|46916887|emb|CAG23650.1| conserved hypothetical protein [Photobacterium profundum SS9] (269 aa)
Score = 239, Expect = 1.5e-18, Identities = 72/265 (27%), Positives = 136/265 (51%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY-----LYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLL+    + E +   I   +EKG++  L +GR    M + L ++  +    D+++   G+    +++    ++  L G   K+I +    L  +FG+  +G+     L  P+ N ++   +  + +     D  ++   E   KVM++ + E +   I +  +  + Y+  T + + P   E+M+ N +K  G+K   +   +    V+  GDA ND+ M+  + +G+AM N +D TK++A YIT+  NN+DG+   I K+
  S:     3 KLVALDMDGTLLNSQGKISEKTKQTIAAAREKGIVVVLASGRPLEGMTDAL-NELNMTSNDDYVLCYNGSLVQRVESQSVIRSQLLLGSDAKNIAS----LSHDFGVHVHGFSRRQGLITPENNHYTQHEATINGLAITEIDFAELDNNEEILKVMMIDEPELLSKAIAQLPA--ALYDQYTIVQSAPFFLEFMNKNSNKGAGVKALAEHLGIDASEVICMGDAGNDHHMLEYAGLGIAMGNATDDTKAIANYITDS-NNDDGVATAIEKF 265
>gi|90410056|ref|ZP_01218073.1| hypothetical protein P3TCK_04796 [Photobacterium profundum 3TCK] >gi|90329409|gb|EAS45666.1| hypothetical protein P3TCK_04796 [Photobacterium profundum 3TCK] (269 aa)
Score = 233, Expect = 7.7e-18, Identities = 73/265 (27%), Positives = 138/265 (52%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY-----LYFPKEN---RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLL+    + + +   I   +EKG++  L +GR    M + L ++  +    D+++   G+    +++    ++  L G   K+I +    L  +FG+  +G+     L  P+ N   +H   ++  D     + ++D    E   KVM++ + E +   I +  +  + Y+  T + + P   E+M+ N +K  G+K   +   +    V+  GDA ND+ M+  + +G+AM N +D TK++A YIT+ +NN+DG+   I K+
  S:     3 KLVALDMDGTLLNSQGKISKKTKQTIAAAREKGVVVVLASGRPLEGMTDAL-NELGMTSNDDYVLCYNGSLVQRVESQSVIRSQLLLGSDAKNIAS----LSHDFGVHVHGFSRRQGLITPENNHYTQHEATINGLDITEIDFAELDN--NEEILKVMMIDEPELLSKAIAQLPA--ALYDQYTIVQSAPFFLEFMNKNSNKGAGVKALAEHLGIDASEVICMGDAGNDHHMLEYAGLGIAMGNATDDTKAIANYITD-NNNDDGVAKAIEKF 265
>gi|154688049|ref|YP_001423210.1| YxeH [Bacillus amyloliquefaciens FZB42] >gi|154353900|gb|ABS75979.1| YxeH [Bacillus amyloliquefaciens FZB42] (270 aa)
Score = 229, Expect = 2.6e-17, Identities = 80/262 (30%), Positives = 122/262 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE----PKS----KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++  DMDGTLL+D   V      A+   K +G+   LCTGR    +   L ++  ++E  DF+I   GA   N  TN       L  + +K +      LD      D   LY P  +     +SEY    +    V ++       PK     KVM + D + +   I    +SFK  Y   T + + P   E +HP VSK N +K+ ++   +   +V+A GD  ND  MI  +  GVAM N   + + +A + T + NN  G+ + I
  S:     3 KLIAIDMDGTLLNDHHEVTAEVRGALDAAKAEGVNIVLCTGRPIGGVRRYL-EELNLQEEGDFVIAYNGALVQNTYTNGVVAEQSLGFEDLKSLYELSLQLDTPMHYFDTANLYTPNRD-----ISEYTVYESYITKVPLHFRTIDEVPKDILIPKVMFIDDPDKLEKAIASIPESFKETY---TMVKSAPFFHEILHPKVSKGNAVKLLVEKLGIEQKDVMAIGDNGNDMSMIQWAGCGVAMANAIPEVREIADFET-KSNNEHGVAHAI 263
>gi|187932824|ref|YP_001887102.1| phosphatase YidA [Clostridium botulinum B str. Eklund 17B] >gi|187720977|gb|ACD22198.1| phosphatase YidA [Clostridium botulinum B str. Eklund 17B] (267 aa)
Score = 228, Expect = 2.9e-17, Identities = 82/265 (30%), Positives = 133/265 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD-VYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL   K V E +  AIK  +EKG+   L +GR +  +   L +  ++ +  D+++   G    N K+ E    + L G  +K I N  + L++N     +   L  PK ++++   +E + +     D D +  TE   K+MI+  +E +   I +    K  YE    L + P   E+M+  V K  GLK   +   +  + V+A GDA ND  M+  + +GVAM NG  + K  AQ+IT + N+ DG+   I K+
  S:     3 KLIALDMDGTLLTSDKKVSERNKKAIKAAEEKGVKVVLASGRPSEGLRQYLEEL-ELLKEDDYVLSFNGGVAQNAKSGEIISRTVLKGKDLKYINNIAKKLNVNIHAFSEKLGLITPKISKYTEVEAEINGIGISIVDFDNIDDTENIIKIMIIDPEEVLEEAIKKLP--KEVYEKYNVLRSTPFFLEFMNNEVDKGEGLKRLAETLGIKQEEVIAMGDAGNDLSMVKYAGLGVAMENGFAEVKENAQFIT-KSNDEDGVAYAIEKF 265
>gi|182416923|ref|ZP_02948307.1| phosphatase YidA [Clostridium butyricum 5521] >gi|182379221|gb|EDT76722.1| phosphatase YidA [Clostridium butyricum 5521] (268 aa)
Score = 228, Expect = 3.0e-17, Identities = 77/265 (29%), Positives = 133/265 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL   K + E +   +K+ + KG+   L +GR    +   L ++  + +  D+++   G    N KT E   +S L G  +K+I    ++LD+N   F + +   L  PK ++++    + + + A   D  ++   E   KVM++  +E +   I +    K  YE  +   + P   E+ +  V K  GLK   +   +  D ++A GDA ND  M+  + +GVAM N +D  K+ A YIT   N+ DGI + + K+
  S:     3 KLIALDMDGTLLTSEKKISEKTKSVLKEAERKGVKVVLASGRPLTGITRYL-EELDLFKGDDYVLSFNGGIVINSKTEEIITSSLLKGSDLKEIFKTAKELDINIHAFSVKEG--LITPKMSQYTQHECDINGIKATIKDFNEIEDDEDIVKVMMIDPQEKLDEAIKKLP--KDLYEKYSVFKSTPFFLEFTNKEVDKGKGLKKLGEYLGIKQDEIIACGDAGNDLSMVEYAGLGVAMENATDDVKNAANYIT-LSNDEDGIVHVVEKF 265
>gi|52082539|ref|YP_081330.1| HAD family hydrolase YxeH [Bacillus licheniformis ATCC 14580] >gi|52005750|gb|AAU25692.1| HAD-superfamily hydrolase YxeH [Bacillus licheniformis ATCC 14580] (270 aa)
Score = 227, Expect = 4.5e-17, Identities = 77/255 (30%), Positives = 118/255 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKY-------FDVDVYLTEPKSKVMIVCDKEYMP-TVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           K++  DMDGTLL+D   V E    A+   K++G+   LCTGR    ++  L ++  + E  D++I   GA   N  T E      L  D +K +    Q LD      D+ YLY P  NR     + Y+    K         ++   L  PK+  M + + E +  T+    +  K +Y   T + + P  +E +HP  SK N ++       +  + V+  GD  ND  MI  +  GVAM N   + K+ A Y T  +N N
  S:     3 KLIAIDMDGTLLNDLHEVTEEVRNALHAAKKQGVKIVLCTGRPLGGVSRYL-EELNLNEDGDYVIAYNGALVQNTHTQEVVSELTLGYDDVKSLYELSQKLDTPMHFFDSAYLYTP--NREISPYTVYESYVTKVPLRFRTIEEIPQDLLAPKA--MYIDEPEKLDRTIAAIPEDVKERY---TMVKSSPFFYEILHPAASKGNAVQQLADILGIAQEEVMCIGDNGNDMSMIEWAGCGVAMGNAIPEVKASADYETRTNNEN 257
>gi|118586352|ref|ZP_01543803.1| hydrolase, HAD superfamily [Oenococcus oeni ATCC BAA-1163] >gi|118433204|gb|EAV39919.1| hydrolase, HAD superfamily [Oenococcus oeni ATCC BAA-1163] (267 aa)
Score = 227, Expect = 4.7e-17, Identities = 80/268 (29%), Positives = 127/268 (47%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV------DVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +IK++  D+D TLL+    +   +   +K +  KGL   L TGR    +    ID+ ++K+  D+ I   G    N  + +   + FL+ + +  I     DL      P +G       +   IR S Y     K  D       D+   E   K +   D E +  +  ++    + Y   T + + P L E++   V+K+ GL   +K F  T DNV+AFGD +ND  MI ++ IGVAM N   + K  AQ +T+  N  DG+  ++VKYF
  S:     2 EIKLIALDLDNTLLNADSEISRRNQEVLKLLHNKGLKVVLTTGRPIKGILP-FIDQLELKQPEDYSINFNGGVIQNNLSKKIISSKFLTKEDVVPI----NDLANQMRFPLDGVAIDRAYSIIDIRKSGYQSFIGKLMDFTDLSFHDLPADEHYYKFISQTDPEQVAKIQEKA----ADYPTFTIVKSRPNLLEFLPKGVNKSFGLGQLIKHFGWTFDNVMAFGDEENDLPMIKSAGIGVAMGNAIKEVKEAAQAVTKL-NTEDGVAAYLVKYF 265
>gi|52787935|ref|YP_093764.1| YxeH [Bacillus licheniformis ATCC 14580] >gi|52350437|gb|AAU43071.1| YxeH [Bacillus licheniformis DSM 13] (282 aa)
Score = 226, Expect = 5.5e-17, Identities = 77/255 (30%), Positives = 118/255 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKY-------FDVDVYLTEPKSKVMIVCDKEYMP-TVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           K++  DMDGTLL+D   V E    A+   K++G+   LCTGR    ++  L ++  + E  D++I   GA   N  T E      L  D +K +    Q LD      D+ YLY P  NR     + Y+    K         ++   L  PK+  M + + E +  T+    +  K +Y   T + + P  +E +HP  SK N ++       +  + V+  GD  ND  MI  +  GVAM N   + K+ A Y T  +N N
  S:    15 KLIAIDMDGTLLNDLHEVTEEVRNALHAAKKQGVKIVLCTGRPLGGVSRYL-EELNLNEDGDYVIAYNGALVQNTHTQEVVSELTLGYDDVKSLYELSQKLDTPMHFFDSAYLYTP--NREISPYTVYESYVTKVPLRFRTIEEIPQDLLAPKA--MYIDEPEKLDRTIAAIPEDVKERY---TMVKSSPFFYEILHPAASKGNAVQQLADILGIAQEEVMCIGDNGNDMSMIEWAGCGVAMGNAIPEVKASADYETRTNNEN 269
>gi|116490708|ref|YP_810252.1| HAD superfamily hydrolase [Oenococcus oeni PSU-1] >gi|116091433|gb|ABJ56587.1| Predicted hydrolase of the HAD superfamily [Oenococcus oeni PSU-1] (267 aa)
Score = 225, Expect = 6.2e-17, Identities = 81/268 (30%), Positives = 128/268 (47%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV------DVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +IK++  D+D TLL+ +  +   +   +K +  KGL   L TGR    +    ID+ ++K+  D+ I   G    N  + +   + FL+ + I  I     DL      P +G       +   IR S Y     K  D       D+   E   K +   D E +  +  ++    + Y   T + + P L E++   V+K+ GL   +K F  T DNV+AFGD +ND  MI ++ IGVAM N   + K  AQ +T+  N  DG+  ++VKYF
  S:     2 EIKLIALDLDNTLLNANSEISSRNREVLKLLHNKGLKVVLTTGRPIKGILP-FIDQLELKQPEDYSINFNGGVIQNNLSKKIIFSKFLTKEDIVPI----NDLANQMRFPLDGVAIDRAYSIIDIRKSGYQSFIGKLMDFTDLSFHDLPADEHYYKFISQTDPEQVAKIQEKA----ADYPTFTIVKSRPNLLEFLPKGVNKSFGLGQLIKHFGWTFDNVMAFGDEENDLPMIKSAGIGVAMGNAIKEVKEAAQAVTKL-NTEDGVAAYLVKYF 265
>gi|71894690|ref|YP_278798.1| hypothetical protein MS53_0680 [Mycoplasma synoviae 53] >gi|71851478|gb|AAZ44087.1| conserved hypothetical protein [Mycoplasma synoviae 53] (447 aa)
Score = 225, Expect = 7.1e-17, Identities = 84/268 (31%), Positives = 146/268 (54%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEY--VDFIIGCGGAQF-YNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK-------ENRHSIRLSEYDHMTAKYFDVDV-----YLTEPKS-KVMIVCDK---EYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           ++I++I+  + DMDGT+LDD K + + +I AIK +++      + TGR       + I+K   ++    DF+IG  GA    N + N+ +  S+L  D  + ++ +  +  ++F      +LY          ENR   ++ + +    KY++ ++     YL + K  K++I+ DK   E +   +N   SF   Y     L +   + + M    SK   +      +NL L+  +AFGD +ND +M+ N K G+AM+N  +  K V +YITE+DNN+ GI +FI
  S:     4 VNINEIESFIFDMDGTILDDKKQLSQENISAIKFLQDNNKKVIIATGRP------IFINKEYFEKLNISDFVIGINGAIVSLNWRKNKNEIISYLPKDTFQKLVLYLHENKIDFLTYTEKFLYGFNFNNPIWFENRIYSQIQKDNPYKFKYYENNLEKLFSYLEKEKFLKILILKDKTSQEKLDNFLNYLLSFDDIY----CLQSQSDVIDIMAKGTSKGKTIIEFFSKYNLDLNKTMAFGDENNDIEMLQNVKYGIAMLNAHNNLKKVTKYITEKDNNSSGIADFI 280
>gi|59714139|ref|YP_206914.1| hydrolase [Vibrio fischeri ES114] >gi|59482387|gb|AAW88026.1| predicted hydrolase [Vibrio fischeri ES114] (273 aa)
Score = 223, Expect = 1.2e-16, Identities = 71/271 (26%), Positives = 130/271 (47%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           M +   K++  DMDGTLL+  K +   +  AI   +EKG++  L +GR  N M   L ++  +    D+++    +    +K  E  ++  ++G   K I    Q+L +N         L  P  + ++   S+   M     D +    + +  K M++ + E +   I +    ++ Y+  T + + P   E+++PN +K  G++   +   +T D V+  GDA ND+ MI  + +GVAM N +D  K +A +IT   NN  G+   I ++
  S:     1 MVMMMYKLIALDMDGTLLNSDKQISAENKAAIAAAREKGVVVVLASGRPLNGMKPQL-EELGMTTENDYVLSYNASLVQKVKNEEVIRSQIITGADAKAIAKLAQELGVNVHAFSQEKGLITPALSHYTEHESKITGMPITVIDFEELADDEQILKAMMIDEPELLSAAIKQLP--EALYKQFTIVQSAPFFLEFLNPNSNKGVGVEALAEHLGITADEVICMGDAGNDWHMIKYAGLGVAMANATDDVKEIANHIT-VSNNEHGVAKVIEEF 269
>gi|167461914|ref|ZP_02327003.1| HAD-superfamily hydrolase, subfamily IIB [Paenibacillus larvae subsp. larvae BRL-230010] (277 aa)
Score = 222, Expect = 1.5e-16, Identities = 75/258 (29%), Positives = 124/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN---RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL D+  + E+S  AI++ +E+G+   L TGR    +   L +   I E  ++ I   G+   N  T E      L+G  +  +     +L +N        L  PK +   RH   L+  D   A +  +     E   K+M V ++E +   I+R  +S K  Y   T + + P   E+++    K  G+K   +   ++ + ++  GDA ND  MI  + +GVAM N  ++ K  A +IT + NN DG+
  S:     3 KLIAVDMDGTLLGDNHAISEASKKAIQEAREQGVQVVLATGRPLVGIEKFLEELDLISEQ-NYAICYNGSVVQNTGTGEVIAKQILNGQDLHQLYGLSLELGVNIHAFSRSGLITPKASKYTRHEADLNGIDFQVADFKKIGA--DEDIIKIMFVDEEERLSRAISRLPQSVKEAY---TIVQSSPFFLEFLNKRAHKGEGVKKLAEHLGISREEIICVGDAGNDLHMIEYAGLGVAMGNAFNEIKHAANFIT-KTNNEDGV 257
>gi|116496154|ref|YP_807888.1| HAD superfamily hydrolase [Lactobacillus casei ATCC 334] >gi|116106304|gb|ABJ71446.1| Predicted hydrolase of the HAD superfamily [Lactobacillus casei ATCC 334] (273 aa)
Score = 221, Expect = 2.1e-16, Identities = 75/268 (27%), Positives = 127/268 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKY--FDVDVYLTEPKS----KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +K +  DMD TLL+  K +  ++   ++ +  KG+   LC+GR    +   L D+  + +  D  I   G     ++ +   K+S L+   I+ + +  ++   +  +     +Y   E       S Y+ M  K   F    +   P      KV+I  D    P +++ +       E  T   +   L E M PNV+K NGLK AL  + +  + + AFGD +ND DM+  + IG+AM N   + K +A  IT Q N+ DG+  F++ YF+
  S:     2 LKAIALDMDNTLLNSQKEISVTNQDVLRYLSRKGIRVILCSGRPFATLKPFL-DQLHLTKNDDVCICFNGGLVRLVRDHTVIKSSTLTKSQIQPVYDLVKEKGFHLDVVAEDQVYSLTE----FGKSSYESMIPKQMPFTDTTFAKVPAKLSIFKVVIAGD----PEMVDAASEAAQSLEGVTVTRSRRTLLEIMPPNVNKKNGLKAALNFYRIPREQLAAFGDEENDQDMLDYAGIGIAMGNAIPEIKKIAD-ITTQSNDEDGVAKFLIDYFQ 265
>gi|90961317|ref|YP_535233.1| HAD superfamily hydrolase [Lactobacillus salivarius UCC118] >gi|90820511|gb|ABD99150.1| Hydrolase, HAD superfamily [Lactobacillus salivarius UCC118] (273 aa)
Score = 221, Expect = 2.2e-16, Identities = 80/269 (29%), Positives = 133/269 (49%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYF--PKENRHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVI-NRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +S+IK++ +D+DGTL+DD+KN+   +I  +KK +  G+   LCTGR  + +AN L+ +  +    +F+I   GAQ  + K+ +      L     K +    ++L +N   I  +  L+   P  N +S+  + Y HM  +Y  V +V      +K+M     E +   + N  K    K++    + +    FE+M+P  +K N      K   +    +L  GD +ND  MI      +AM N  D  K  A Y+T+  NNNDG+   I K+
  S:     1 MSKIKMIATDIDGTLVDDAKNLSPKTIEVLKKARANGIYVVLCTGRPLSGVAN-LLTQLGLDNDDNFVITHNGAQAVSAKSGKAIFKHLLDFSDFKRLDAISKELKVNMQTITTDSQLFVTSPDINYYSVLDTFYTHMQLRYRPVTEVPEDIEIAKIMWADYPENIDNALPNLPKDLLDKFDC---IRSEKWFFEFMNPLATKGNAAIELGKHLGIDASEILTAGDQNNDLSMIEKGGFSIAMGNAIDTIKEKADYVTDT-NNNDGLAKAIEKF 269
>gi|164686905|ref|ZP_02210933.1| hypothetical protein CLOBAR_00501 [Clostridium bartlettii DSM 16795] >gi|164604295|gb|EDQ97760.1| hypothetical protein CLOBAR_00501 [Clostridium bartlettii DSM 16795] (271 aa)
Score = 220, Expect = 3.0e-16, Identities = 80/267 (29%), Positives = 135/267 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDL----DLNFGIPDNGYLYFPKE-NRHSIRLSEY----DHMTAKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           + K++  D+DGTLL+ S  + ++   AIKK KEKG+   LCTGR    + + L ++  +KE  D++    GA   +  T          G  I  +   Y DL    +L+  I    + Y  K     ++ +S+Y     ++T  + +V      PK    SK M++   E +   I +    +  YE  T + + P   E ++ N +K  G+ +  +   +  D V+  GDA ND  MI  + +GVAM N +D+ K +A Y+T + N+ DG+ + I K+
  S:     2 EYKLIALDIDGTLLNSSNQITDNVKEAIKKSKEKGVKVVLCTGRPLKGVEDFL-EELNLKEEGDYVTTFNGALVQDAYT----------GKPISHLTLDYNDLCDLYNLSLKIGSRSHFYDTKTVYTFNLDVSDYTILESYLTGAHLNVTTLDKVPKDIGMSKFMMIDHPEILDECIKKIP--EEYYEKYTIVRSTPFFLEILNKNANKGAGINLLSQRLGIKQDEVICVGDAGNDKHMIEYAGLGVAMGNATDEIKEIANYVT-RTNDEDGVAHVIDKF 267
>gi|84387074|ref|ZP_00990097.1| hypothetical protein V12B01_24694 [Vibrio splendidus 12B01] >gi|84378149|gb|EAP95009.1| hypothetical protein V12B01_24694 [Vibrio splendidus 12B01] (269 aa)
Score = 219, Expect = 3.1e-16, Identities = 74/265 (27%), Positives = 134/265 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY---------LYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + + +  AI K +  G+   L +GR    M + L D+  I    DF++   G+   N+ T E   +   +G A K+I      L +  G    GY         L  P+ N ++   +  + +    FD      + +  K MIV +   +  +I +  +  K+++   T + + P   E+++PN +K  G++   K   +T + V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++ G+   I K+
  S:     3 KLIALDMDGTLLNSDKVISQENKYAIAKARAAGVKVVLASGRPLEGMQSKL-DELSINGEDDFVLFYNGSMVQNVSTKELIHSEISNGKAAKEI----AALAVQLG----GYVHAFSKIHGLITPENNEYTAIEARINGLEITEFDFSQLEDDHEIIKTMIVAEPSKLTEIIGKLPQELKTQF---TIVQSAPFFLEFLNPNSNKGVGIEAIAKHLGITAEEVICMGDAENDHHMLEYAGLGIAMENAMEETKKLADHITAS-NDDHGVAVAIEKF 265
>gi|29375041|ref|NP_814194.1| HAD superfamily hydrolase [Enterococcus faecalis V583] >gi|29342500|gb|AAO80265.1| hydrolase, haloacid dehalogenase-like family [Enterococcus faecalis V583] (277 aa)
Score = 219, Expect = 3.9e-16, Identities = 70/259 (27%), Positives = 119/259 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKY------------FDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           IK +V D+DGTLL   K +   +  A+   +++GL   L +GR  N M   L D+ ++  Y   ++   GA   +  + +      +S    + I+ H +  D+   I D  ++Y      +++ L   D    +Y             D+   L  P +K++I  +  Y+         +    E  T   + P  FE+   N+ K   L+       +  + V+AFGD  NDY M+  +  G+AM N  D+ KS+A  +T   N+NDGI
  S:     3 IKAIVMDIDGTLLTSEKKISPKTRQALVAAQKQGLSLILASGRPTNGM-RPLADELEMAHYNGHLLSYNGACVTHHGSQQQLFNQTISKSLSQQILEHLKQFDVIPMINDETFMYVNDVFHNTLHLETGDFNIIEYESRGGNFQLCEWRDLAARLNFPLNKILIAGEPAYLQKY--HEAIYAPFKETVTAAFSAPFYFEFTAKNIDKARSLEKLTLQLGIAAEEVIAFGDGHNDYTMLEWAGTGIAMENAVDELKSIATEVT-LSNDNDGI 269
>gi|77414522|ref|ZP_00790668.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 515] >gi|77159420|gb|EAO70585.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 515] (286 aa)
Score = 218, Expect = 4.2e-16, Identities = 80/266 (30%), Positives = 134/266 (50%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFL-----SGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFDVDVYLTEPKS--KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV----TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK V  D+DGTLL+D KNV +S+I AI+ +K++G+L GL TGR  + +   L +       +DF +   G   Y+    + TN+  KT+       +G   ++I      L    G+  +G +         I  S    ++     + F   +   +P++   +MI+  +     V+  ++    + +   P V    + P   + +    SK  G++   + +   L  V+AFGD+DND +M+    IGVAM N S + K  A+Y T  DNN+DGI   +  Y
  S:     3 IKAVFFDIDGTLLNDRKNVQKSTIKAIRNLKDQGILVGLATGRGPSFVQPFLENLG-----LDFAVTYNGQYIYSRSEIIYTNQLSKTTVYRLIRYAGARRREI-----SLGTASGLLGSGIIGLGTSRLGQIVSSLVPRKWAKAIERSFKHFIRRIKPQNIDSLMIILREPIYQVVLVATEGESERIQKQFPRVKLTRSSPYSMDVISEEQSKVKGIERVGQRYGFDLSEVIAFGDSDNDIEMLSQVGIGVAMGNASQQVKENARYTT-ADNNDDGISKALAHY 276
>gi|167745727|ref|ZP_02417854.1| hypothetical protein ANACAC_00420 [Anaerostipes caccae DSM 14662] >gi|167654758|gb|EDR98887.1| hypothetical protein ANACAC_00420 [Anaerostipes caccae DSM 14662] (277 aa)
Score = 218, Expect = 4.5e-16, Identities = 81/270 (30%), Positives = 132/270 (48%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRH---SIRLSEYD----HMT-AKYFDVDVYLTE----PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPIL--FEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           M   +IK++  DMDGTLL  SK + E +I  ++   ++G+     TGR  N +   L    +++    + I   GA+ Y+L   +    +    D +  ++   +       I  +G +Y  KE      S  L EY     H +     D+  Y+ +     +   +   D+E       R+K+ K   E G   V   +    E    + +K + L   ++  +L  +NV+A GDA+NDY+MIL + IGV M NGSD  K++A YIT+ D+N DG+   I K
  S:     1 MKKREIKLIAMDMDGTLLTSSKEITEHTIEVLEAAMDRGIQIVPATGRSVNGLPKKLTALKRMR----YCILSNGARVYDLHKKKSIYKNQFETDQVLKLLEDVRPYHAFRSIAKDGEVYCYKEELDRLGSFHLGEYSEEMIHASRTPVEDLKDYIIQEGGTSEKMTLFFEDQE------ERAKARKELTESGLYTVVASLKNNLEISLDSCNKGDALAHLMEHLDLKKENVMACGDAENDYEMILAAGIGVVMENGSDDMKAIADYITD-DHNRDGVAKAIEK 273
>gi|90577307|ref|ZP_01233118.1| hypothetical protein VAS14_09689 [Vibrio angustum S14] >gi|90440393|gb|EAS65573.1| hypothetical protein VAS14_09689 [Vibrio angustum S14] (269 aa)
Score = 218, Expect = 4.6e-16, Identities = 70/265 (26%), Positives = 131/265 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLT-EPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLL     + + +  AI   +E+G+   L +GR    M   L ++  +    DF++    +    +   E  ++  L+G   K+I +   DL ++         L  P+ N ++   ++ + +     D       E   KVMI+ + + +   I  ++  K+ Y+  T + + P   E+M+PN +K  G++   +  ++    V+  GDA ND+ MI  + +GVAM N +++TK++A +IT+  NNN G+   I ++
  S:     3 KLVALDMDGTLLSSDGTISQENKAAISAAREQGVSIVLASGRPLEGMTWAL-NELDMTGSNDFVLSYNASLVQRVSNKEVIRSETLTGLDAKNIASLAHDLGVHVHAFTRRQGLITPENNYYTDHEAKINGLAITIEDFATLENDEEVMKVMIIDEPDRLSAAI--AQLPKALYQSYTIVQSAPFFLEFMNPNSNKGVGVEALAEYLDIKQSEVICMGDAGNDHHMIEYAGLGVAMGNATEETKAIANFITDT-NNNAGVAKVIQQF 265
>gi|191639650|ref|YP_001988816.1| Putative uncharacterized protein STY3947 [Lactobacillus casei] >gi|190713952|emb|CAQ67958.1| Putative uncharacterized protein STY3947 [Lactobacillus casei BL23] (273 aa)
Score = 218, Expect = 4.7e-16, Identities = 74/268 (27%), Positives = 128/268 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKY--FDVDVYLTEPKS----KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +K +  DMD TLL+  K +  ++   ++ +  KG+   LC+GR    +   L D+  + +  D  I   G     ++ +   K+S L+   I+ + +  ++   +  +     +Y   E       S Y+ M  K   F    +   P      KV+I  D    P +++ +       E  T   +   L E M PNV+K NGLK AL  + +  + + AFGD +ND DM+  + IG+AM N   + K +A  IT + N++DG+  F++ YF+
  S:     2 LKAIALDMDNTLLNSQKEISVTNQDVLRYLSRKGIRVILCSGRPFATLKPFL-DQLHLTKNDDVCICFNGGLVRLVRDHTVIKSSTLTKSQIQPVYDLVKEKGFHLDVVAEDQVYSLTE----FGKSSYESMIPKQMPFTDTTFAKVPAKLSIFKVVIAGD----PEMVDAASEAAQSLEGVTVTRSRRTLLEIMPPNVNKKNGLKAALNFYRIPREQLAAFGDEENDQDMLDYAGIGIAMGNAIPEIKKIAD-ITTESNDDDGVAKFLIDYFQ 265
>gi|116871666|ref|YP_848447.1| HAD superfamily hydrolase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740544|emb|CAK19664.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (270 aa)
Score = 218, Expect = 5.1e-16, Identities = 82/265 (30%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L D  +++E  D++I   GA   +  T E      L  D +K+I     D +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SFK KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  D  K +A Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKIKGVKVVLCTGRPLVGVENYLTD-LELREEGDYVISFNGAFVQDTYTKEVISHLTLGIDDLKEIYQVSLDSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIFKEIENVPEDFIMSKAMFIEEAPELEAGIAKMPESFKEKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPDHIKELADYTTAS-NNDSGVAKAIQKF 266
>gi|28898414|ref|NP_798019.1| hypothetical protein VP1640 [Vibrio parahaemolyticus RIMD 2210633] >gi|28806631|dbj|BAC59903.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] (269 aa)
Score = 217, Expect = 5.5e-16, Identities = 77/265 (29%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE----------PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI K +E G+   L +GR    M   L D+  I    DF++   G+   N+ TNE      + G A K +    ++L          +     EN      + Y  + A    +DV  TE          P  K M+V +   +  VI    S     E  T + + P   E+++P  +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YITE  N++ G+   I K+
  S:     3 KLIALDMDGTLLNSDKAISEENKHAIAKAREAGVTVVLASGRPLEGMQAKL-DELNIHSEKDFVLFYNGSMVKNVGTNEIIHQQIIDGKAAKLVARKAKELGAYVHAFSQVHGLITNEN------NPYTDIEANINGLDV--TEMNFESLEDDHPIIKAMMVAEPSKLTEVIAALPS--EMREEFTVVQSAPFFLEFLNPASNKGIGVAAIAEYLGIQPEEVICMGDAENDHHMLKYAGLGIAMANAMEETKKIADYITES-NDDHGVAKAIEKF 265
>gi|163727702|ref|ZP_02135188.1| hydrolase (HAD superfamily) protein [Vibrio fischeri MJ11] >gi|161399504|gb|EDQ23787.1| hydrolase (HAD superfamily) protein [Vibrio fischeri MJ11] (269 aa)
Score = 216, Expect = 6.8e-16, Identities = 69/265 (26%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K +   +  AI   +EKG++  L +GR  N M   L ++  +    D+++    +    +K  E  ++  ++G   K I     +L +N         L  P  + ++   S+   M     D +    + +  K M++ + E +   I +    ++ Y+  T + + P   E+++PN +K  G++      ++T D V+  GDA ND+ MI  + +GVAM N +D  K +A +IT   NN  G+   I ++
  S:     3 KLIALDMDGTLLNSDKQISAENKAAIAAAREKGVVVVLASGRPLNGMKPQL-EELGMTTENDYVLSYNASLVQKVKNEEVIRSQIITGADAKAIAKLAHELGVNVHAFSQEKGLITPALSHYTEHESKITGMPITVIDFEELADDEQILKAMMIDEPELLSAAIKQLP--EALYKQFTIVQSAPFFLEFLNPNSNKGVGVEALADHLSITADEVICMGDAGNDWHMIKYAGLGVAMANATDDVKEIANHIT-VSNNEHGVAKVIEEF 265
>gi|37679723|ref|NP_934332.1| hydrolase [Vibrio vulnificus YJ016] >gi|37198468|dbj|BAC94303.1| predicted hydrolase [Vibrio vulnificus YJ016] (269 aa)
Score = 216, Expect = 7.1e-16, Identities = 70/265 (26%), Positives = 130/265 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY-----LYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE-PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI++ +  G+   L +GR    M + L ++ +I    DF++   G+   N+ T E      + G A K I      L  N G+  + +     L  P+ N ++   +  + +     + D    + P  K MIV +   +   I    +  + ++  T + + P   E+++P  +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YIT+  NN+ G+   I K+
  S:     3 KLIALDMDGTLLNSDKQISEPNKEAIRQARAAGVTVVLASGRPLEGMQSKL-EELQIDSDKDFVLFYNGSMVKNVATGEIIHEQIIDGKAAKKIAR----LADNLGVFVHAFSKEFGLITPQNNPYTDIEANINGLNITEMNFDALADDHPIIKTMIVAEPSELTKAIAALPA--TLHDEFTIVQSAPFFLEFLNPASNKGIGVAAIAEYLGIRAEEVICMGDAENDHHMLKYAGLGIAMANAMEETKQIADYITDS-NNDHGVATAIEKF 265
>gi|153165305|ref|ZP_01926256.1| hypothetical protein LMHG_01157 [Listeria monocytogenes FSL N1-017] >gi|167213644|ref|ZP_02283951.1| hydrolase, haloacid dehalogenase-like family protein [Listeria monocytogenes FSL R2-503] >gi|133728338|gb|EBA30036.1| hypothetical protein LMHG_01157 [Listeria monocytogenes FSL N1-017] (270 aa)
Score = 216, Expect = 7.2e-16, Identities = 80/265 (30%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L D  +++E  D++I   GA   +  T E      L  D +K+I     D +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K +A Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTD-LELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQMSLDSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEVGIAKIPESFREKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPERIKQLADYTTAS-NNDSGVAKAIQKF 266
>gi|139437296|ref|ZP_01771456.1| Hypothetical protein COLAER_00435 [Collinsella aerofaciens ATCC 25986] >gi|133776943|gb|EBA40763.1| Hypothetical protein COLAER_00435 [Collinsella aerofaciens ATCC 25986] (309 aa)
Score = 216, Expect = 7.8e-16, Identities = 71/259 (27%), Positives = 126/259 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDL--------NFGIPDNGY--LYFPKENRHSIRLSEYDHMTAKYFDVD----VYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           IK +  D+DGTL +D K +   +   +   +E G+   L +GR A  + + L  +  ++ +   ++   GA   + +T+E      +  D +  +I+H Q+ D+        +  + D+ +  +  P  ++ +I   E D    K  +V+    V  T P  K++   D  Y+    +  + +    +  + + T    FEY  P + K   L+ AL    +    V++FGD  ND  MI  +  GVAM N  D+ K+VAQ +T  +NN DGI
  S:    32 IKAIAMDIDGTLTNDQKVISPRTREKLLAAQESGIKLILASGRPAWGL-HALAQELDLQNHDGLLVAFNGAHVVDAQTDEVLFDQAMPADELHRLIDHLQNYDVIPMISLGRDLHVEDSYHCMITLPDGSQKNIVKYERDACDLKIREVESLHEVVDTYPVDKLLTAGDPAYLQA--HYEEMYAPFKQTLSGMFTADWYFEYTAPGIDKARALEGALPKLGIDASEVVSFGDGQNDKSMIEWAGTGVAMGNAVDEVKAVAQMVT-ANNNEDGI 300
>gi|16799375|ref|NP_469643.1| hypothetical protein lin0298 [Listeria innocua Clip11262] >gi|16412727|emb|CAC95531.1| lin0298 [Listeria innocua] (270 aa)
Score = 216, Expect = 7.8e-16, Identities = 80/265 (30%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L D  +++E  D++I   GA   +  T E      L  D +K+I     D +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K +A Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTD-LELREEGDYVISFNGAFVQDTYTKEVISHLTLGIDDLKEIYQVSLDSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEAGIAKMPESFREKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPERIKQLADYTTAS-NNDSGVAKAIQKF 266
>gi|167342618|ref|ZP_02288548.1| hydrolase, haloacid dehalogenase-like family protein [Listeria monocytogenes FSL J1-208] (270 aa)
Score = 215, Expect = 9.1e-16, Identities = 80/265 (30%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L +  +++E  D++I   GA   +  T E      L  D +K+I     D +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ N SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K +A Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTE-LELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQVSLDSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEAGIAKIPESFREKYHL---VRSTPFYLEILNRNASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPERIKQLADYTTAS-NNDSGVAKAIQKF 266
>gi|29375718|ref|NP_814872.1| HAD superfamily hydrolase [Enterococcus faecalis V583] >gi|29343179|gb|AAO80942.1| hydrolase, haloacid dehalogenase-like family [Enterococcus faecalis V583] (270 aa)
Score = 215, Expect = 9.4e-16, Identities = 79/265 (29%), Positives = 124/265 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           IK+V  D+DGTLL+    +      A++K  E+G+   LCTGR    +   L D+  +    DF+I   G+     K N       LS +   +I  + + +  +    D+  +Y    N  +++I  +   +M  KY  VD    E    K+M++ + E + P +      F  KY   T + + P  +E M+ N SK N L        L  D V+A GD +ND  MI  + IGVAM N ++  K++A   T   N+ DG+   I K
  S:     3 IKLVAIDIDGTLLNSQHKITPRVKEALQKANEQGVRIVLCTGRPLPGVKEQL-DELALYGENDFVITYNGSLVQATKDNTIISRYTLSYEDFLEIEMYSRKVGAHLHTIDDSAIYTANRNIGKYTIHEASLVNMPLKYRTVDEMTPEMNIIKMMMIDEPEVLDPAIAKLPLHFTEKY---TTVKSTPFYYEIMNKNASKGNALAKLADHLGLNKDEVMAIGDNENDLSMIDYAGIGVAMGNATENVKTIADVHT-TSNDEDGVAQIIEK 266
>gi|27366012|ref|NP_761540.1| HAD superfamily hydrolase [Vibrio vulnificus CMCP6] >gi|27362212|gb|AAO11067.1|AE016806_57 Predicted hydrolase of the HAD superfamily [Vibrio vulnificus CMCP6] (269 aa)
Score = 214, Expect = 1.2e-15, Identities = 68/265 (25%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY-LYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE-PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI++ +  G+   L +GR    M + L ++ +I    DF++   G+   N+ T E      + G A K I      L +        + L  P+ N ++   +  + ++    + D    + P  K MIV +   +   I    +  + ++  T + + P   E+++P  +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YIT+  NN+ G+   I K+
  S:     3 KLIALDMDGTLLNSDKQISEPNKEAIRQARAAGVTVVLASGRPLEGMQSKL-EELQIDSDKDFVLFYNGSMVKNVATGEIIHEQIIDGKAAKKIARLADKLGVFVHAFSKEFGLITPQNNPYTDIEANINGLSITEMNFDALADDHPIIKTMIVAEPSELTKAIAALPA--TLHDEFTIVQSAPFFLEFLNPASNKGIGVAAIAEYLGIRAEEVICMGDAENDHHMLKYAGLGIAMANAMEETKQIADYITDS-NNDHGVATAIEKF 265
>gi|46906513|ref|YP_012902.1| HAD superfamily hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47091409|ref|ZP_00229206.1| hydrolase, haloacid dehalogenase-like family [Listeria monocytogenes str. 4b H7858] >gi|153200739|ref|ZP_01942820.1| hypothetical protein LMSG_01543 [Listeria monocytogenes HPB2262] >gi|167013727|ref|ZP_02276260.1| hydrolase, haloacid dehalogenase-like family protein [Listeria monocytogenes FSL J1-194] >gi|167216551|ref|ZP_02286187.1| hydrolase, haloacid dehalogenase-like family protein [Listeria monocytogenes FSL J1-175] >gi|167452982|ref|ZP_02319205.1| hydrolase, haloacid dehalogenase-like family protein [Listeria monocytogenes FSL J2-064] >gi|46879778|gb|AAT03079.1| hydrolase, haloacid dehalogenase-like family [Listeria monocytogenes str. 4b F2365] >gi|47020086|gb|EAL10822.1| hydrolase, haloacid dehalogenase-like family [Listeria monocytogenes str. 4b H7858] >gi|133736481|gb|EBA38179.1| hypothetical protein LMSG_01543 [Listeria monocytogenes HPB2262] (270 aa)
Score = 214, Expect = 1.2e-15, Identities = 80/265 (30%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L D  +++E  D++I   GA   +  T E      L  D +K+I     D +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K +A Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTD-LELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQVSLDSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEVGIAKIPESFREKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPERIKQLADYTTAS-NNDSGVAKAIQKF 266
>gi|25011762|ref|NP_736157.1| hypothetical protein gbs1722 [Streptococcus agalactiae NEM316] >gi|24413302|emb|CAD47381.1| Unknown [Streptococcus agalactiae NEM316] (460 aa)
Score = 214, Expect = 1.2e-15, Identities = 78/266 (29%), Positives = 129/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFDVDVYLTEPKS--KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV----TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK V  D+DGTLL+D KNV +S+I AI+ +K++G+L GL TGR  + +   L +       +DF +   G   Y+    + TN+  KT+                L    G+  +G +         I  S    ++     + F   +   +P++   +MI+  +     V+  ++    + +   P V    + P   + +    SK  G++   + +   L  V+AFGD+DND +M+    IGVAM N S + K  A+Y T  DNN+DGI   +  Y
  S:     3 IKAVFFDIDGTLLNDRKNVQKSTIKAIRNLKDQGILVGLATGRGPSFVQPFLENLG-----LDFAVTYNGQYIYSRSEIIYTNQLSKTTVYRLIRYAGARRREISLGTASGLLGSGIIGLGTSRLGQIVSSLVPRKWAKAIERSFKHFIRRIKPQNIDSLMIILREPIYQVVLVATEGESERIQKQFPRVKLTRSSPYSMDVISEEQSKVKGIERVGQRYGFDLSEVIAFGDSDNDIEMLSQVGIGVAMGNASQQVKENARYTT-ADNNDDGISKALAHY 276
>gi|77409001|ref|ZP_00785721.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae COH1] >gi|77172385|gb|EAO75534.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae COH1] (460 aa)
Score = 214, Expect = 1.3e-15, Identities = 81/266 (30%), Positives = 132/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKT---------------------SFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK V  D+DGTLL+D KNV +S+I AI+ +K++G+L GL TGR  + +   L +       +DF +   G   Y+    + TN+  KT                     S L G  I  +        ++  +P        +  +H IR  +  ++ +    + V L EP  +V++V  +         S+  + ++       + P   + +    SK  G++   + +   L  V+AFGD+DND +M+    IGVAM N S + K  A+Y T  DNN+DGI   +  Y
  S:     3 IKAVFFDIDGTLLNDRKNVQKSTIKAIRNLKDQGILVGLATGRGPSFVQPFLENLG-----LDFAVTYNGQYIYSRSEIIYTNQLSKTTVYRLIRYAGARRREISLGTASGLLGSGIIGLGTSRLGQIVSSLVPRKWAKAIERSFKHFIRRIKPQNIDS----LMVILREPIYQVVLVATE-------GESERIQKQFPRVKLTRSSPYSMDVISEGQSKVKGIERVGQCYGFDLSEVIAFGDSDNDIEMLSQVGIGVAMGNASQQVKENARYTT-ADNNDDGISKALAHY 276
>gi|86145927|ref|ZP_01064255.1| hypothetical protein MED222_14045 [Vibrio sp. MED222] >gi|85836382|gb|EAQ54512.1| hypothetical protein MED222_14045 [Vibrio sp. MED222] (269 aa)
Score = 214, Expect = 1.5e-15, Identities = 78/265 (29%), Positives = 136/265 (51%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-FPKENRHSIRLSEYDHMTA--------KYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + + +  AI K +  G+   L +GR    M + L D+  I    DF++   G+   N+ T E   +   +G A K+I      L +  G    GY++ F K   H +   E +  TA        K  ++D    E      K MIV +   +  +I++  +  K+++   T + + P   E+++PN +K  G++   K   +T   V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++ G+   I K+
  S:     3 KLIALDMDGTLLNSEKVISQENKDAIAKARAAGVKVVLASGRPLEGMQSKL-DELSINGEDDFVLFYNGSMVQNVSTRELIHSEISNGKAAKEI----AALAVQLG----GYVHAFSKV--HGLITPENNEYTAIEARINGLKITELDFSQLEDDHEIIKTMIVAEPSKLTEIISKLPQELKTQF---TIVQSAPFFLEFLNPNSNKGVGIEAIAKHLGITAKEVICMGDAENDHHMLEYAGMGIAMENAMEETKKLADHITAS-NDDHGVAVAIEKF 265
>gi|22537818|ref|NP_688669.1| HAD superfamily hydrolase [Streptococcus agalactiae 2603V/R] >gi|76788674|ref|YP_330292.1| Cof-like hydrolase family protein [Streptococcus agalactiae A909] >gi|77406425|ref|ZP_00783483.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae H36B] >gi|77412457|ref|ZP_00788761.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae CJB111] >gi|22534712|gb|AAN00542.1|AE014268_2 hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 2603V/R] >gi|76563731|gb|ABA46315.1| Cof-like hydrolase family protein [Streptococcus agalactiae A909] >gi|77161495|gb|EAO72502.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae CJB111] >gi|77174958|gb|EAO77769.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae H36B] (460 aa)
Score = 214, Expect = 1.5e-15, Identities = 80/266 (30%), Positives = 132/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKT---------------------SFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK V  D+DGTLL+D KNV +S+I AI+ +K++G+L GL TGR  + +   L +       +DF +   G   Y+    + TN+  KT                     S L G  I  +        ++  +P        +  +H IR  +  ++ +    + V L EP  +V++V  +         S+  + ++       + P   + +    SK  G++   + +   L  V+AFGD+DND +M+    IGVAM N S + +  A+Y T  DNN+DGI   +  Y
  S:     3 IKAVFFDIDGTLLNDRKNVQKSTIKAIRNLKDQGILVGLATGRGPSFVQPFLENLG-----LDFAVTYNGQYIYSRSEIIYTNQLSKTTVYRLIRYAGARRREISLGTASGLLGSGIIGLGTSRLGQIVSSLVPRKWAKAIERSFKHFIRRIKPQNIDS----LMVILREPIYQVVLVATE-------GESERIQKQFPRVKLTRSSPYSMDVISEGQSKVKGIERVGQRYGFDLSEVIAFGDSDNDIEMLSQVGIGVAMGNASQQVRENARYTT-ADNNDDGISKALAHY 276
>gi|90408426|ref|ZP_01216587.1| hypothetical protein PCNPT3_09344 [Psychromonas sp. CNPT3] >gi|90310460|gb|EAS38584.1| hypothetical protein PCNPT3_09344 [Psychromonas sp. CNPT3] (269 aa)
Score = 213, Expect = 1.5e-15, Identities = 73/266 (27%), Positives = 125/266 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  DMDGTLL+  K +       I++ KEKG+   L +GR    M   L     +    D  +    +    + + E   ++ L  D    +    + LD+N         L  PK N+++   +E + +    FD   +   +   KVM++ + E +   I +   S + KY +   +   P  FE+M+   +K NG+++      L+ + ++  GDA ND +MI  + +GVAM N +D  K+ A YIT+  N+NDG+     KY 
  S:     3 KLIALDMDGTLLNSQKELTPRVHDVIRRAKEKGIKVVLASGRPFEGMLPTL-KALGLDSDDDITLTYNASLILKVASKEIISSALLDVDDALQLYELAKKLDVNVLAYSMQHGLITPKHNKYTHYEAELNKIEVTEFDFYKLSKDDTILKVMMIDEPEVLTRAIEKLPISLQDKYSMAKSM---PFFFEFMNKKSNKGNGMQVLATYLGLSSEQIICVGDAANDLEMIKFAGLGVAMKNATDDVKAHANYITDS-NDNDGVAKVFEKYL 266
>gi|69246107|ref|ZP_00603813.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Enterococcus faecium DO] >gi|68195402|gb|EAN09849.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Enterococcus faecium DO] (269 aa)
Score = 213, Expect = 1.6e-15, Identities = 77/266 (28%), Positives = 129/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGI-PDNGYLYFP----KENRHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL++ K + + +  A+ + K++G+   LCTGR    MA+ L +   + E  D+ I   G       T E  +   +    I+ +    Q LDL   +  DN  L  P    K++ +++         A   D+ D ++    +K +I  D+E + P +      F   YE+   + T  +L E+M   V+K  G+ +  KD  L  + ++A GD +ND  MI  + +GVAM N     K  A ++T   N  +G+   I K+
  S:     2 IKLVAIDLDGTLLNEQKLISDENKQALAQAKQQGVKIVLCTGRPLAAMAHYLQELGLVDEG-DYSITFNGGLVQKNDTGEIMEKKVMEVSDIQRLYKLAQQLDLPLDVLSDNVVLQLPSAPRKQSLYNVLNKLLQFQPADISDITDEFVL---NKAVIAYDQEELDPKIKEIPAEFHEMYEI---IKTRSMLLEFMPKGVTKAYGISLLAKDLGLKQEEIMAIGDEENDLPMIQYAGLGVAMENAVPFVKEAADFVTAS-NEENGVAKVIQKF 266
>gi|148982370|ref|ZP_01816735.1| hypothetical protein VSWAT3_24254 [Vibrionales bacterium SWAT-3] >gi|145960506|gb|EDK25872.1| hypothetical protein VSWAT3_24254 [Vibrionales bacterium SWAT-3] (269 aa)
Score = 212, Expect = 2.3e-15, Identities = 72/265 (27%), Positives = 134/265 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY---------LYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + + +  AI K +  G+   L +GR    M + L D+  I    DF++   G+   N+ T E   +   +G A K+I    + L         GY         L  P+ N ++   +  + +    FD      + +  K MIV +   +  +I++  +  K+++   T + + P   E+++PN +K  G+++  K   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++ G+   I K+
  S:     3 KLIALDMDGTLLNSDKVISQENKDAIAKARAAGVKVVLASGRPLEGMQSKL-DELSINGEDDFVLFYNGSMVQNVSTKEIIHSEISNGKAAKEIAALAEQL--------GGYVHAFSKVHGLITPENNEYTGIEARINGLDITEFDFSQLEDDHEIIKTMIVAEPTKLTDIISKLPQQLKNQF---TIVQSAPFFLEFLNPNSNKGVGIEVIAKHLGIKAEEVICMGDAENDHHMLEYAGLGIAMENAMEETKKIANHITAS-NDDHGVAVAIEKF 265
>gi|55821419|ref|YP_139861.1| hypothetical protein stu1433 [Streptococcus thermophilus LMG 18311] >gi|55737404|gb|AAV61046.1| conserved hypothetical protein, Cof family [Streptococcus thermophilus LMG 18311] (271 aa)
Score = 211, Expect = 2.6e-15, Identities = 76/269 (28%), Positives = 129/269 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +++IK++  D+DGTL    K V   +  A+K  + KG+   + TGR    + +VL D   + +    +   GG    N      KK   ++ D +K I   ++ L L   +  +G +Y  P +  HS  L    + T  + DVD     P+    +KV+ VC+++++ + I +       Y+      +  I+ E M   V K  GL++      L    V+A GD +ND  M+  + +GVAM NG  + K+VA+ +T + N   G+   I KY
  S:     1 MAEIKLLALDLDGTLFTKDKQVTAENRAALKAAEAKGIHVVITTGRPLPAINHVLGDLGLLDDKHYSVTFNGGLVQRNNGDILIKKE--MTRDDLKQIYAVFEPLGLPMDVLSDGIVYGVPSKGNHS--LYRQANPTLTFVDVDSIDDIPQDIVYNKVVTVCERDFLDSQIGKLPD--HLYQAFEIFKSREIILEVMPKGVHKAAGLRLLTDYLALDRSQVMAMGDEENDLSMLEWAGLGVAMANGVPQVKAVAKAVTTKTNEESGVAEAIHKY 268
>gi|149191048|ref|ZP_01869308.1| predicted hydrolase [Vibrio shilonii AK1] >gi|148835076|gb|EDL52053.1| predicted hydrolase [Vibrio shilonii AK1] (267 aa)
Score = 211, Expect = 2.6e-15, Identities = 70/265 (26%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL   K +   +  AI+  K++G+   L +GR  N M + L ++  +    D++I   G     + + +      + G   K++ N  + L L+         L   + N ++   +E + +    +D +    + +  K MIV +   +   I +     ++Y     +V + P   E+++P  +K  G+K+     N+  +  + FGDA+ND+ MI  +  GVAM N   +TKS+A YIT+  N++DG+   I K+
  S:     3 KLIAIDMDGTLLTSDKKISPRTKQAIQSAKQQGVQVVLASGRPLNGMLDAL-NELGLNGEEDYVIHFNGTFVQKVVSGDILHQQIIDGRRAKEVANLAKQLGLHCHAFSRELGLIATEANPYTDHEAEINKLDITIYDFNKLEDDHEIIKAMIVGEPAQLTEGIGK---IPARYHDDYTIVQSAPFFLEFLNPLSNKGEGVKVIADHLNIPYEQTMCFGDAENDHHMIKFAGKGVAMANAMPETKSIADYITDS-NDDDGVAKAIEKF 265
>gi|167755030|ref|ZP_02427157.1| hypothetical protein CLORAM_00534 [Clostridium ramosum DSM 1402] >gi|167705080|gb|EDS19659.1| hypothetical protein CLORAM_00534 [Clostridium ramosum DSM 1402] (288 aa)
Score = 211, Expect = 2.7e-15, Identities = 79/270 (29%), Positives = 142/270 (52%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDII--------NHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE---PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTP-----LVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +++IK++V D+DGTL +  K +  ++I  + K++E G    L TGR    +    I++ ++++Y  ++I C G + Y+L  N+C+  SFL    I +++        N   + D  + +  N +LYF       IR+      T +Y D+  Y      P +K+  +C    + +   + K F++  +   P       T     E +   V+K   +K   +  NL L+NVLAFGD+ ND +++ N+ IG+ M NG    K  A Y+T ++N ++G+ N +   F
  S:     8 LNKIKMIVCDLDGTLFNHKKEISSATITYLIKLQENGYTLVLATGRFFYEL-KPYIEQLQLEKYHGYVICCNGIEIYDLTHNKCRSFSFLEQIEINELLQLSLYYRLNIRANFDHKYQMILNNWLYFLIP---LIRI-----FTKRYPDLTFYKNTAVVPWNKLGKIC----LLSSPRKLKLFEAAAQTKFPGLYQYYYTNRYCVEVVKAEVNKCYAVKYLCQLNNLNLENVLAFGDSGNDEELLNNAGIGIIMKNGLSSLKKKATYLTFKNNRHEGVLNMLEYLF 280
>gi|167760759|ref|ZP_02432886.1| hypothetical protein CLOSCI_03144 [Clostridium scindens ATCC 35704] >gi|167661646|gb|EDS05776.1| hypothetical protein CLOSCI_03144 [Clostridium scindens ATCC 35704] (271 aa)
Score = 211, Expect = 2.7e-15, Identities = 75/267 (28%), Positives = 131/267 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIK---DIINHYQD--LDLNFGIPDNGYLYFPKENRHSIRLSEYDHM-TAKYFDVDVYLTEPKSKVMIVCDKEYMPTV----INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +++  D+DGTL + SK + E ++ A+ +I+E+G    L +GR  N +A  L ++ ++ +Y  +I+   G +  N +T E      L  D  K   D++  Y+D  LDL    PD   +     N+++   S  +HM   +  D   ++ E  +K +I  D   +  +    I R +S+ S Y       + P   E M   + K + L   L    LT D ++  GD  ND  MI  + +GVAM N        A ++T + N+ DG+ + I ++ +
  S:     4 QILALDLDGTLTNSSKEISEPTLKALIEIQEQGKKVVLASGRPTNGVAP-LAEQLRLGDYGSYILSFNGGRITNCQTKEIIYNKTLPMDCAKPIYDMVLEYKDQGLDLVTYTPD-ALISGICPNKYTELESRINHMPIIRVDDFLSHIKEAPNKFLITGDSAVISKIQKKIIARFRSYLSVY------CSDPFFLEIMPSGIDKAHSLLRLLTSSGLTADEMICCGDGYNDITMIETAGLGVAMANAQPAVLEKADFVT-KSNDEDGVLHVINQFMR 271
>gi|194468208|ref|ZP_03074194.1| Cof-like hydrolase [Lactobacillus reuteri 100-23] >gi|194453061|gb|EDX41959.1| Cof-like hydrolase [Lactobacillus reuteri 100-23] (268 aa)
Score = 211, Expect = 3.0e-15, Identities = 72/267 (26%), Positives = 130/267 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDII---NHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK+V  D+D TLL+ +K + + +   +K++ ++G+   LCTGR  N +    I++  + +  D+ I   G    N   NE ++  F  G    D++   ++ +   +   I D   +Y   +   SI  +   ++  +   + DV        VM +  ++  P +       K+ Y     + + P++ E++   ++K  GLK  L  F     N++ FGDADND +MI  +  G+ M NG    K+VA  IT+  N+NDG+  +  +YF
  S:     2 IKMVALDLDNTLLNSNKEISQRNERVLKQLHQQGIKVVLCTGRPINAIWP-YIEQLGLTDPEDYTITFNGGLVIN---NESREHLFELGMKKSDLLPLFSYVKSKKIPLNILDFERVYELNDYPGSIYRTVLKNIEFQALPMSDVPEITYSKAVMAITPEKLSPIIKELPAELKAHYHA---VQSQPMIMEFLPKKLNKAVGLKALLDHFGDDFSNLMTFGDADNDLEMIKAAAQGIVMENGLPNVKAVATAITDT-NDNDGVARYCERYF 264
>gi|16799273|ref|NP_469541.1| hypothetical protein lin0196 [Listeria innocua Clip11262] >gi|16412615|emb|CAC95429.1| lin0196 [Listeria innocua] (270 aa)
Score = 211, Expect = 3.1e-15, Identities = 73/262 (27%), Positives = 123/262 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVI-NRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++  D+DGTLL+D+  +  +   AIK  K+KG+   LCTGR    +   LI+   + +  D+ I   GA      T E      L+   +++I       D+N    D   +Y P      I   +   +    + + V         SKVM++   E +  VI N  ++ K  + V   + + P   E++   V+K + L++ +    ++   V++ GD +ND  MI  + +GVAM N ++  K +A Y T   NN DG+ N I
  S:     3 KIIAIDIDGTLLNDAHEITPAVREAIKAAKQKGVKVVLCTGRPLAGIKKSLIE-LDLLDIGDYAITFNGAVILETATEEPLADITLNKSELEEIYAFCHAQDVNVTYFDGKNMYVPSRKITEITCQDALLLQTPLYHLPVEEAPESIHVSKVMLLDTPEKITDVIKNLPETIKENFYV---VRSVPYNLEFLQKGVNKGSALELLVNKLGISQGEVMSIGDQENDITMIEYAGMGVAMGNATEHIKEIANYTTTT-NNEDGVANAI 263
>gi|110004068|emb|CAK98407.1| hypothetical haloacid dehalogenase-like hydrolase protein [Spiroplasma citri] (276 aa)
Score = 211, Expect = 3.1e-15, Identities = 77/265 (29%), Positives = 135/265 (50%)
  Q:     6 IKVVVSDMDGTLL-DDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIP--DNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKE----YMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALK------DFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           +K++V D+DGTL+ D  K +  ++I  +KK +  G+L  + +GR  +++++       I E+  ++IG  G    NLKT E      +S       IN  ++   +F +   +    Y  + +     L  + +   K   +D        KV+I C  E    ++   I  SK+ +++       VTG    E +  NV+K  G+   ++      + +L  D ++ FGD  NDY+MI NSK G+A+ N + + K VA  +TE+DNN  GI +++ K
  S:     3 VKMIVCDIDGTLVTDKEKKIPTANIEVLKKAQAMGILVTIASGRVPSSLSDYAT-TLGILEHCPYVIGSNGGAVLNLKTKEYVYDEIISYQDTLWAINIVREFGHDFYLAPLNEQEAYVSQASIIKDDLFLFRNTDIKAIVLDWNEIPQMRKVVISCHDEQKQNWLRQQIAVSKTLRTE-------VTGYGFIEIIPKNVNKWQGILKLIEVLKHKENCHLDSDEIMCFGDQMNDYEMIKNSKYGIALANATPQLKEVAFAVTEKDNNAAGIADYLYK 272
>gi|153172959|ref|ZP_01928894.1| hypothetical protein LMIG_01816 [Listeria monocytogenes FSL N3-165] >gi|153198177|ref|ZP_01942310.1| hypothetical protein LMRG_02604 [Listeria monocytogenes 10403S] >gi|167403415|ref|ZP_02308244.1| hydrolase, haloacid dehalogenase-like family protein [Listeria monocytogenes FSL J2-003] >gi|168264915|ref|ZP_02686880.1| hydrolase, haloacid dehalogenase-like family protein [Listeria monocytogenes FSL J2-071] >gi|127632189|gb|EBA21894.1| hypothetical protein LMRG_02604 [Listeria monocytogenes 10403S] >gi|133731266|gb|EBA32964.1| hypothetical protein LMIG_01816 [Listeria monocytogenes FSL N3-165] (270 aa)
Score = 211, Expect = 3.2e-15, Identities = 79/265 (29%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L +  +++E  D++I   GA   +  T E      L  D +K+I     D +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K +A Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTE-LELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQVSLDSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEVGIAKIPESFREKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPERIKQLADYTTAS-NNDSGVAKAIQKF 266
>gi|148543650|ref|YP_001271020.1| Cof-like hydrolase [Lactobacillus reuteri F275] >gi|184153064|ref|YP_001841405.1| hydrolase [Lactobacillus reuteri F275] >gi|148530684|gb|ABQ82683.1| Cof-like hydrolase [Lactobacillus reuteri F275] >gi|183224408|dbj|BAG24925.1| hydrolase [Lactobacillus reuteri F275] (268 aa)
Score = 209, Expect = 4.6e-15, Identities = 70/267 (26%), Positives = 133/267 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDII---NHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK++  D+D TLL+ +K + + +   +K++ ++G+   LCTGR  N +    I++  + +  D+ I   G    N   NE ++  F  G    D++   ++ +   +   + D   +Y   +   SI  +   ++  +   +     +  SK ++    E + T+I     + K++Y     + + P++ E++   ++K  GLK  L  F     N++ FGDADND +MI  +  G+ M NG    K+VA  IT+  N+NDG+  +  +YF
  S:     2 IKMIALDLDNTLLNSNKEISQRNEHVLKQLHQEGIKVVLCTGRPINAIWP-YIEQLGLTDSDDYTITFNGGLVIN---NESREHLFELGMKKSDLLPLFSYVKRKKIPLNVLDFERVYELNDYPGSIYRTVLKNIEFQSLPMSDMPEKTYSKAVMAITPEKLSTIIGELPANLKAQYHA---VQSQPMIMEFLPKKLNKAVGLKALLDHFGDDFSNLMTFGDADNDLEMIKAAAQGIVMENGLPNVKAVATAITDT-NDNDGVARYCERYF 264
>gi|153212709|ref|ZP_01948366.1| conserved hypothetical protein [Vibrio cholerae 1587] >gi|124116359|gb|EAY35179.1| conserved hypothetical protein [Vibrio cholerae 1587] (273 aa)
Score = 209, Expect = 4.8e-15, Identities = 64/258 (24%), Positives = 130/258 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE--------PKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+  K +   +  AI + +++G+   L +GR  + M + L ++  +    D+++   G+   N+ T E      + G A K +    Q+    FG+  N + +       + + S+Y  + A   D+++   +        P  K MIV + E +   I +    ++ ++ V   + + P   E+++   +K  G++   +   +    V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++DG+
  S:     3 KLIALDMDGTLLNSQKQISPRTKQAIAQARQQGIQVVLASGRPLDGMRSKL-EELHLTTEDDYVLYYNGSMVANVGTGEIIHQQIIDGKAAKRVATLAQE----FGL--NTHAFSQIHGLITPKTSQYTEVEASINDLNITEMDFAQLADDHPIIKAMIVGEPEKLTQAIAQLPAQWREEFTV---VQSAPFFLEFLNTGSNKGIGVQAIAEHLGIQASEVICMGDAENDHHMLQYAGLGIAMANAMEETKHIADHIT-LSNDHDGV 258
>gi|188589645|ref|YP_001922037.1| phosphatase YidA [Clostridium botulinum E3 str. Alaska E43] >gi|188499926|gb|ACD53062.1| phosphatase YidA [Clostridium botulinum E3 str. Alaska E43] (269 aa)
Score = 209, Expect = 5.4e-15, Identities = 82/265 (30%), Positives = 134/265 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD-VYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL   K V E +  AIK  ++KG+   L +GR +  +   L +  ++ +  D+++   G    N K+ E    + L G  +K I N  ++L++N     +   L  PK ++++   +E + +     D D +  TE   KVMI+  +E +   I +    K  YE    L + P   E+M+  V K  GLK   +   +  + V+A GDA ND  M+  + +GVAM NG  + K  AQ+IT + N+ DG+   I K+
  S:     3 KLIALDMDGTLLTSDKKVSERNKKAIKAAEKKGVKVVLASGRPSEGLRQYLEEL-ELLKEDDYVLSFNGGVAQNAKSGEIISRTVLKGKDLKYINNIAKELNVNIHAFSEKLGLITPKISKYTEVEAEINGIGISIVDFDNIDDTENIIKVMIIDPEEVLEEAIKKLP--KEVYEKYNVLRSTPFFLEFMNNEVDKGEGLKRLAETLGIKQEEVIAMGDAGNDLSMVKYAGLGVAMENGFAEVKENAQFIT-KSNDEDGVAYAIEKF 265
>gi|153836319|ref|ZP_01988986.1| phosphatase YidA [Vibrio parahaemolyticus AQ3810] >gi|149750594|gb|EDM61339.1| phosphatase YidA [Vibrio parahaemolyticus AQ3810] (269 aa)
Score = 209, Expect = 5.4e-15, Identities = 76/265 (28%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE----------PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI K +E G+   L +GR    M   L D+  I    DF++   G+   N+ TNE      + G A K +    ++L          +     EN      + Y  + A    +DV  TE          P  K M+V +   +  VI  +       E  T + + P   E+++P  +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YITE  N++ G+   I K+
  S:     3 KLIALDMDGTLLNSDKAISEENKHAIAKAREAGVTVVLASGRPLEGMQAKL-DELNIHSDKDFVLFYNGSMVKNVGTNEIIHQQVIDGKAAKLVARKAKELGAYVHAFSQVHGLITNEN------NPYTDIEANINGLDV--TEMNFESLEDDHPIIKAMMVAEPSKLTEVI--AALPPEMREEFTVVQSAPFFLEFLNPASNKGIGVAAIAEFLGIQPEEVICMGDAENDHHMLKYAGLGIAMENAMEETKKIADYITES-NDDHGVAKAIEKF 265
>gi|157368285|ref|YP_001476274.1| sugar phosphatase [Serratia proteamaculans 568] >gi|157320049|gb|ABV39146.1| Cof-like hydrolase [Serratia proteamaculans 568] (271 aa)
Score = 209, Expect = 5.7e-15, Identities = 80/266 (30%), Positives = 127/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIP----DNGYLYFPKEN--RHSIRLSEYDHMTAKYFDV---DVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +  +   AI + + KG+   L TGR    + + L  +  I+   DF I   GA         C     L     +D + H++ +   FG+     D   LY P ++  ++++  SE   +  KY  V   D  +  PK  VM+V + E +   I R     + +Y   T L + P   E +H  V K  G+K+      +  +NV+  GD  ND  MI  + +GVAM N   + K+VAQ++T   N  DG+   I K+
  S:     3 IELIAIDMDGTLLNPQHQITPAVKQAITEARRKGVHVVLATGRPYVGVQDYL-RQLDIQGPGDFCITYNGALVLKAVDGACILQETL---GFEDYL-HFEKMAREFGVHFQAFDFDTLYTPNKDIGKYTVHESEMTGIPLKYRSVEEMDPSIRFPK--VMMVDEPELLDRAIARIPAETRERY---TILKSAPYYLEILHQKVDKGAGVKMLADHLGIARENVMTLGDQANDTAMIEYAGLGVAMGNAIPELKAVAQFVTST-NTEDGVARAIEKF 267
>gi|116628141|ref|YP_820760.1| HAD superfamily hydrolase [Streptococcus thermophilus LMD-9] >gi|116101418|gb|ABJ66564.1| Predicted hydrolase of the HAD superfamily [Streptococcus thermophilus LMD-9] (272 aa)
Score = 208, Expect = 6.4e-15, Identities = 76/269 (28%), Positives = 128/269 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +++IK++  D+DGTL    K V   +  A+K  + KG+   + TGR    + +VL D   + +    +   GG    N      KK   ++ D +K I   ++ L L   +  +G +Y  P +  HS  L    + T  + DVD     P+    +KV+ VC+ +++ + I +       Y+      +  I+ E M   V K  GL++      L    V+A GD +ND  M+  + +GVAM NG  + K+VA+ +T + N   G+   I KY
  S:     1 MAEIKLLALDLDGTLFTKDKQVTAENRAALKAAEAKGIHVVITTGRPLPAINHVLGDLGLLDDKHYSVTFNGGLVQRNNGDILIKKE--MTRDDLKQIYAVFEPLGLPMDVLSDGIVYGVPSKGNHS--LYRQANPTLTFVDVDSIDDIPQDIVYNKVVTVCEGDFLDSQIGKLPD--HLYQAFEVFKSREIILEVMPKGVHKAAGLRLLTDYLALDRSQVMAMGDEENDLSMLEWAGLGVAMANGVPQVKAVAKAVTTKTNEESGVAEAIHKY 268
>gi|121588021|ref|ZP_01677773.1| conserved hypothetical protein [Vibrio cholerae 2740-80] >gi|121547762|gb|EAX57853.1| conserved hypothetical protein [Vibrio cholerae 2740-80] (273 aa)
Score = 207, Expect = 7.9e-15, Identities = 63/258 (24%), Positives = 126/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+  K +   +  AI + +++G+   L +GR  + M + L ++  +    D+++   G+   N+ T E      + G A K +    Q+  LN         L  PK ++++   +  + +     D   +    P  K MIV + E +   I +    ++ ++ V   + + P   E+++   +K  G++   +   +    V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++DG+
  S:     3 KLIALDMDGTLLNSQKQISPRTKQAIAQARQQGIQVVLASGRPLDGMRSKL-EELHLTTENDYVLYYNGSMVANVGTGEIIHQQIIDGKAAKRVATLAQEFGLNTHAFSQIHGLITPKTSQYTEVEASINGLNITEMDFAQLADDHPIIKAMIVGEPEKLTQAIAQLPAQWREEFTV---VQSAPFFLEFLNTGSNKGIGVQAIAEHLGIQASEVICMGDAENDHHMLQYAGLGIAMANAMEETKHIADHIT-LSNDHDGV 258
>gi|153825300|ref|ZP_01977967.1| conserved hypothetical protein [Vibrio cholerae MZO-2] >gi|183179362|ref|ZP_02957573.1| conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|149741128|gb|EDM55187.1| conserved hypothetical protein [Vibrio cholerae MZO-2] >gi|150423853|gb|EDN15794.1| conserved hypothetical protein [Vibrio cholerae AM-19226] >gi|183012773|gb|EDT88073.1| conserved hypothetical protein [Vibrio cholerae MZO-3] (273 aa)
Score = 207, Expect = 8.6e-15, Identities = 63/258 (24%), Positives = 126/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+  K +   +  AI + +++G+   L +GR  + M + L ++  +    D+++   G+   N+ T E      + G A K +    Q+  LN         L  PK ++++   +  + +     D   +    P  K MIV + E +   I +    ++ ++ V   + + P   E+++   +K  G++   +   +    V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++DG+
  S:     3 KLIALDMDGTLLNSQKQISPRTKQAIAQARQQGIQVVLASGRPLDGMRSKL-EELHLTTEDDYVLYYNGSMVANVGTGEIIHQQIIDGKAAKRVATLAQEFGLNTHAFSQIHGLITPKTSQYTEVEASINGLNITEMDFAQLADDHPIIKAMIVGEPEKLTQAIAQLPAQWREEFTV---VQSAPFFLEFLNTGSNKGIGVQAIAEHLGIQASEVICMGDAENDHHMLQYAGLGIAMANAMEETKHIADHIT-LSNDHDGV 258
>gi|91224503|ref|ZP_01259765.1| hypothetical protein V12G01_17737 [Vibrio alginolyticus 12G01] >gi|91190845|gb|EAS77112.1| hypothetical protein V12G01_17737 [Vibrio alginolyticus 12G01] (269 aa)
Score = 207, Expect = 8.9e-15, Identities = 74/265 (27%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMT---AKYFDVDVYLTE----------PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI + +E G+   L +GR    M + L D+  I    DF++   G+   N+ TN+      + G A K +    ++L         G         H +  +E++  T   AK   ++V  TE          P  K M+V +   +  VI    +     E  T + + P   E+++P  +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YIT   N+  G+   I K+
  S:     3 KLIALDMDGTLLNSDKAISEENKQAIARAREAGVTVVLASGRPLEGMQDKL-DELNIHSDRDFVLYYNGSMVKNVGTNDIIHQQIIDGKAAKLVARKAEEL---------GAYVHAFSQVHGLITNEHNSYTDIEAKINGLNV--TEMNFESLEDDHPIIKAMMVAEPSKLTEVIAALPA--EMREAFTVVQSAPFFLEFLNPASNKGIGVAAIAEYLGIKPEEVICMGDAENDHHMLKYAGLGIAMANAMEETKQIADYITAS-NDEHGVAKAIEKF 265
>gi|24379206|ref|NP_721161.1| hypothetical protein SMU.743 [Streptococcus mutans UA159] >gi|24377117|gb|AAN58467.1|AE014916_8 conserved hypothetical protein [Streptococcus mutans UA159] (273 aa)
Score = 206, Expect = 9.9e-15, Identities = 76/269 (28%), Positives = 130/269 (48%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-FPKENRHSIRLSEYDHMTAKYFD--VDVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +++IK++  D+DGTL +  K V   +  A+K ++EKG+   + TGR    + ++L +   + +    I   GG       T E  + S LS   ++ I    + L L   +  +G +Y    +N HS+       +T +  D    + L    +KV+IVCD +++   I +  + F  K+EV     +  I+ E M   V K  GL +  K   +    V+A GD +ND  M+  + + VAM NG+   K  A  +T++ N+  G+   I KY
  S:     1 MTEIKLLALDLDGTLFNTKKEVSLENKEALKAVREKGIKVVITTGRPLKAIEHLLEELDLLSKDNYLITFNGG--LVQKTTGEILEKSALSRKQVETIQTEMEHLALPVDVLSDGIVYSISNQNNHSLYPIANPMLTFREIDGLPQLPLDIIYNKVVIVCDADFLDQQIEKIPAYFYEKFEV---FKSRDIILEIMPKGVHKAVGLNLLTKHLAIDQSEVMAMGDEENDLSMLEWAGLSVAMANGAPIAKETADAVTKKTNDESGVAEAIKKY 268
>gi|167767382|ref|ZP_02439435.1| hypothetical protein CLOSS21_01901 [Clostridium sp. SS2/1] >gi|167711357|gb|EDS21936.1| hypothetical protein CLOSS21_01901 [Clostridium sp. SS2/1] (270 aa)
Score = 206, Expect = 1.0e-14, Identities = 68/258 (26%), Positives = 117/258 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTP-------LVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTL +D   +   ++ A+ + +E G+   L +GR    + +   D  K+ E+   ++   G +  +  TNE     ++  D   +++ H +D  +N  I D   LY   +N + ++    +       D   Y+  P     +      + T ++  K++     +G P       + T P   E +    SK +GL    K   +    V+AFGDA+ND +MI  +  GVAM N  D  K  A  +T   NN DGI
  S:     4 KLIAVDLDGTLYNDQLKITSDTLNAMIEAQEMGIRIALASGRPLPGLFHAR-DLLKLNEHHGMLVAYNGGKVVDTTTNEVLYDKYIQDDLAMELLEHLKDYPVNPIIDDGKVLYVTDKNGYRVKEEALN-------DSMEYVEVPSLTEHLDFHLNKILTAVDPQKTYDVLETIGMPFRDQVTFVRTAPYYIEAIPVGTSKASGLSNVCKGLGIDPSEVIAFGDAENDLEMIQFAGHGVAMGNACDALKDAADEVT-LTNNEDGI 259
>gi|194536137|ref|YP_002071299.1| conserved hypothetical protein [Vibrio cholerae RC385] >gi|150420931|gb|EDN13217.1| conserved hypothetical protein [Vibrio cholerae RC385] (273 aa)
Score = 206, Expect = 1.0e-14, Identities = 63/258 (24%), Positives = 126/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+  K +   +  AI + +++G+   L +GR  + M + L ++  +    D+++   G+   N+ T E      + G A K +    Q+  LN         L  PK ++++   +  + +     D   +    P  K MIV + E +   I +    ++ ++ V   + + P   E+++   +K  G++   +   +    V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++DG+
  S:     3 KLIALDMDGTLLNSQKQISPRTKQAIAQARQQGIQVVLASGRPLDGMRSKL-EELHLTTENDYVLYYNGSMVANVGTGEIIHQQIIDGKAAKRVATLAQEFGLNTHAFSQIHGLITPKTSQYTEVEASINGLNITEMDFTQLADDHPIIKAMIVGEPEKLTQAIAQLPAQWREEFTV---VQSAPFFLEFLNTGSNKGIGVQAIAEHLGIQAGEVICMGDAENDHHMLQYAGLGIAMANAMEETKHIADHIT-LSNDHDGV 258
>gi|16802318|ref|NP_463803.1| hypothetical protein lmo0272 [Listeria monocytogenes EGD-e] >gi|16409637|emb|CAD00799.1| lmo0272 [Listeria monocytogenes] (270 aa)
Score = 206, Expect = 1.2e-14, Identities = 78/265 (29%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L +  +++E  D++I   GA   +  T E      L  + +KDI     + +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K +A Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTE-LELREEGDYVISFNGAFVQDTFTKEVISHLTLGIEDLKDIYEVSLNSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEVGIAKIPESFREKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPERIKQLADYTTAS-NNDSGVAKAIQKF 266
>gi|154483406|ref|ZP_02025854.1| hypothetical protein EUBVEN_01109 [Eubacterium ventriosum ATCC 27560] >gi|149735658|gb|EDM51544.1| hypothetical protein EUBVEN_01109 [Eubacterium ventriosum ATCC 27560] (269 aa)
Score = 206, Expect = 1.2e-14, Identities = 76/265 (28%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH----------YQDLDLNFGIPDNGYL----YFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           KV+  D+DGTL +D K V   ++ A+K+I E+G +  L +GR    +A V     ++ +Y  +++   G +  N KT E    + LS + I +++++          Y D  +  G P + Y+    +  K       L EY      Y      LT P     I  + E +      SK F+ +  +     + P   E +   + K + +++ +    +  +N +A GD  ND  MI  + +GVAM N +D  K  A YIT + NN DGI + I K+
  S:     4 KVLFLDLDGTLTNDDKKVTPKTLKALKQIMEEGHIVALASGRPTPGVAQV-AKTLELDKYGGYVLSFNGGKVINWKTKEVIYENALSKEYIPELVDYATGNKIGLITYDDDSIVVGTPIDEYIELESFINKLPLKEKNLVEY----VDYNPNKCLLTAPGE---IAAEHEKI-----LSKKFEGRISI---YRSEPFFIEALPMGIDKAHSIEVLINHLGIPKENTIACGDGFNDLTMIKYAHVGVAMANATDVVKENADYIT-KSNNEDGIAHVIEKF 265
>gi|15641376|ref|NP_231008.1| hypothetical protein VC1364 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121728535|ref|ZP_01681558.1| conserved hypothetical protein [Vibrio cholerae V52] >gi|153221134|ref|ZP_01952169.1| conserved hypothetical protein [Vibrio cholerae MAK 757] >gi|153819359|ref|ZP_01972026.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|153821336|ref|ZP_01974003.1| conserved hypothetical protein [Vibrio cholerae B33] >gi|194531180|ref|YP_002066693.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|9655858|gb|AAF94522.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121629199|gb|EAX61639.1| conserved hypothetical protein [Vibrio cholerae V52] >gi|124119838|gb|EAY38581.1| conserved hypothetical protein [Vibrio cholerae MAK 757] >gi|125618297|gb|EAZ46838.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|126510104|gb|EAZ72698.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|126521154|gb|EAZ78377.1| conserved hypothetical protein [Vibrio cholerae B33] (273 aa)
Score = 206, Expect = 1.2e-14, Identities = 63/258 (24%), Positives = 125/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+  K +   +  AI + +++G+   L +GR  + M + L ++  +    D+++   G+   N+ T E      + G A K +    Q+  LN         L  PK ++++   +  + +     D   +    P  K MIV + E +   I +    ++ ++ V   + + P   E+++   +K  G++       +    V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++DG+
  S:     3 KLIALDMDGTLLNSQKQISPRTKQAIAQARQQGIQVVLASGRPLDGMRSKL-EELHLTTENDYVLYYNGSMVANVGTGEIIHQQIIDGKAAKRVATLAQEFGLNTHAFSQIHGLITPKTSQYTEVEASINGLNITEMDFAQLADDHPIIKAMIVGEPEKLTQAIAQLPAQWREEFTV---VQSAPFFLEFLNTGSNKGIGVQAIAAHLGIQASEVICMGDAENDHHMLQYAGLGIAMANAMEETKHIADHIT-LSNDHDGV 258
>gi|194540783|ref|YP_002075819.1| conserved hypothetical protein, putative [Vibrio sp. Ex25] >gi|151939338|gb|EDN58167.1| conserved hypothetical protein, putative [Vibrio sp. Ex25] (270 aa)
Score = 205, Expect = 1.4e-14, Identities = 74/265 (27%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD-VYLTE----------PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI K +E G+   L +GR    M   L D+  I    DF++   G+   N+ TNE      + G A K +    ++L         G         H +  +E +  T    +++ + +TE          P  K M+V +   +  VI    S     E  T + + P   E+++P  +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YIT   N+  G+   I K+
  S:     4 KLIALDMDGTLLNSDKAISEENKQAIAKAREAGVTVVLASGRPLEGMQGKL-DELNIHSDKDFVLFYNGSMVKNVGTNEIIHQQIIDGKAAKLVARKAKEL---------GAYVHAFSQVHGLITNEKNPYTDIEANINGLNVTEINFESLEDDHPIIKAMMVAEPSKLTEVIAALPS--EMREEFTVVQSAPFFLEFLNPASNKGIGVAAIAEYLGIQPEEVICMGDAENDHHMLKYAGLGIAMENAMEETKQIADYITAS-NDEHGVAKAIEKF 266
>gi|146318001|ref|YP_001197713.1| HAD superfamily hydrolase [Streptococcus suis 05ZYH33] >gi|146320182|ref|YP_001199893.1| HAD superfamily hydrolase [Streptococcus suis 98HAH33] >gi|145688807|gb|ABP89313.1| Predicted hydrolase of the HAD superfamily [Streptococcus suis 05ZYH33] >gi|145690988|gb|ABP91493.1| Predicted hydrolase of the HAD superfamily [Streptococcus suis 98HAH33] (284 aa)
Score = 205, Expect = 1.4e-14, Identities = 82/266 (30%), Positives = 131/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQD--LDLNFG-------------------------IPDN--GYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK V  D+DGTLL D++ V  S+ILAI  +KEKG+L GL TGRD        + ++     +D  I   G   Y     E   +  L    I+ I+ + Q    DL+FG                         IP++  G + F   NR    +S       K F     L +P  ++M++       T    ++S +  +   +   + P   + +    SK +G+      +   LD V+ FGD++ND++M+   +  VAM NG+ K K  A ++T+  NN DGIY  ++ +
  S:     6 IKAVFFDIDGTLLTDNRMVSSSTILAINALKEKGILVGLATGRDPR-----FVLQYMASLGLDLAIAYNGQ--YIFSREEVIYSQSLEPKQIEQIMEYAQTHHKDLSFGTAKGIFGSKIMSAGTGNFAYRVTRMIPESWAGIINFIF-NRLVRWISPQQETNLKGF-----LFQPIYQLMLL-------TTERETQSLEVLFPNLSFTRSSPYATDIISKGNSKLSGIVKVADRYGFELDEVMVFGDSNNDFEMLNEIQHSVAMGNGTKKVKHAASFVTDT-NNRDGIYKALIHF 279
>gi|15639282|ref|NP_218731.1| hypothetical protein TP0290 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025524|ref|YP_001933296.1| hypothetical protein TPASS_0290 [Treponema pallidum subsp. pallidum SS14] >gi|7514566|pir||E71344 conserved hypothetical protein TP0290 - syphilis spirochete >gi|3322557|gb|AAC65271.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018099|gb|ACD70717.1| hypothetical protein TPASS_0290 [Treponema pallidum subsp. pallidum SS14] (277 aa)
Score = 205, Expect = 1.4e-14, Identities = 66/271 (24%), Positives = 128/271 (47%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLS---EYDHMTAK-------YFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           M  +Q+++VV+DMDGT LD   N+   +  A+K + EK + F + TGR    M  ++ +  +  + V  ++G  G     +KT +       + +A   ++ +     L++ +  +  +Y P    +S+R+    EY+ +  +        F ++    + + +VM +  + + P+ +  +  F           + P L + M   V K N L I  + + ++L+ V  FGD  ND  M   + +   M NG ++ K  A YI E  N++ G    + +Y
  S:     1 MSGAQVRLVVTDMDGTFLDSENNIPPENKQAVKCLHEKNIPFVIATGR----MLPMVQEYVRQLQLVGPVVGYNGGMIREIKTGKTIFQKCFAAEAFARVLEYGMAHRLDYLVYTSDSVYAPD---YSVRIRAFHEYNRLARRGGSALIPIFPIEALSGDRQRQVMKILVQNFSPSDLETAAEFIGSLHGVHCEHSMPHLIDVMPEGVDKGNALHILCQYYGISLEQVCVFGDQRNDIVMFKAAGVSFCMRNGHEEAKKHATYIAES-NDDAGFAQALKRY 273
>gi|145300556|ref|YP_001143397.1| HAD superfamily hydrolase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142853328|gb|ABO91649.1| hydrolase, HAD superfamily [Aeromonas salmonicida subsp. salmonicida A449] (269 aa)
Score = 205, Expect = 1.6e-14, Identities = 70/265 (26%), Positives = 123/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK-SKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+    +   +  AI   + KG+   L +GR    M+  L++   +    D++I   GA    +      ++  L+G     I     +L++N  G   +  L  P+ + ++   S    M     D      + +  KVM++ +   +   I R  +    YE  T + + P   E+M+   +K  G+    +   L    V+A GDA ND+ MI  + +GVAM N +D  K++AQ+IT + N+ DG+   I ++
  S:     3 KLIALDMDGTLLNPQGQISPRTHAAIAAARAKGVTVVLASGRPLEGMSRYLVE-LGLTGQDDYVICYNGALVQQVADQRIIRSQLLTGSDASAIARLADELEVNVHGFSVSQGLISPRVSTYTEHESRLIGMPINLIDFATLAADEQIMKVMMIDEPPQLSRAIERLPA--ELYERYTVVQSAPFFLEFMNKQSNKGTGVAALAEHLGLDASQVIAVGDAGNDHHMIEYAGLGVAMGNATDDIKALAQHITGR-NDEDGVAQVIERF 265
>gi|163790808|ref|ZP_02185233.1| hydrolase, haloacid dehalogenase-like family protein [Carnobacterium sp. AT7] >gi|159873876|gb|EDP67955.1| hydrolase, haloacid dehalogenase-like family protein [Carnobacterium sp. AT7] (269 aa)
Score = 205, Expect = 1.6e-14, Identities = 76/266 (28%), Positives = 129/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK--ENRHSI-----RLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL+    + + +   IKK KE+G+   LCTGR    M + L ++  ++E  D+ I   G       T E      L+   I++I    +++++     D   +Y P   E R S+     R   Y  +  ++   D+ +    +K +   ++  +   I +    F  KY   T + + P+L E M   V K +G+ +           V++ GD  ND  MI  + +GVAM N +D+ K++AQYIT + N   G+ + I K+
  S:     2 IKLVAIDLDGTLLNREHIISDENKEVIKKAKEQGVKVVLCTGRPLLGMISYL-EELNLREVGDYGITYNGGLVQRTDTGEVLSKKTLTKVEIEEIFALSKEINVPCNFIDLEKIYEPPYPEGRDSLYPTVMRALPYVPIEMEHVSEDIAI----NKTVFCYEQTSLDEAIKKIPVHFHEKY---TIMKSRPVLLELMPKGVDKGSGIAVLADLLGFEASEVMSLGDEANDAAMIEYAGMGVAMGNATDEIKAMAQYIT-KTNEEHGVAHAIQKF 266
>gi|55823344|ref|YP_141785.1| hypothetical protein str1433 [Streptococcus thermophilus CNRZ1066] >gi|55739329|gb|AAV62970.1| conserved hypothetical protein, Cof family [Streptococcus thermophilus CNRZ1066] (271 aa)
Score = 205, Expect = 1.6e-14, Identities = 76/269 (28%), Positives = 127/269 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +++IK++  D+DGTL    K V   +  A+K  + KG+   + TGR    + +VL D   + +    +   GG    N      KK   ++ D +K I   ++ L L   +  +G +Y  P +  HS  L    + T  + DVD     P+    +KV+ VC+  ++ + I +       Y+      +  I+ E M   V K  GL++      L    V+A GD +ND  M+  + +GVAM NG  + K+VA+ +T + N   G+   I KY
  S:     1 MAEIKLLALDLDGTLFTKDKQVTAENRAALKAAEAKGIHVVITTGRPLPAINHVLGDLGLLDDKHYSVTFNGGLVQRNNGDILIKKE--MNRDDLKQIYAVFEPLGLPMDVLSDGIVYGVPSKGNHS--LYRQANPTLTFVDVDSIDDIPQDIVYNKVVTVCEGAFLDSQIGKLPD--HLYQAFEVFKSREIILEVMPKGVHKAAGLRLLTDYLALDRSQVMAIGDEENDLSMLEWAGLGVAMANGVPQVKAVAKAVTTKTNEESGVAEAIHKY 268
>gi|150016157|ref|YP_001308411.1| Cof-like hydrolase [Clostridium beijerinckii NCIMB 8052] >gi|149902622|gb|ABR33455.1| Cof-like hydrolase [Clostridium beijerinckii NCIMB 8052] (270 aa)
Score = 204, Expect = 1.7e-14, Identities = 75/265 (28%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYL--------TEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL   K V +++  AIK  +EKG+   L +GR  + + N  +++  +K+  D+++   G    N +     K   L G  +K I    + L++N       + +  K+   + + S+Y    A    +D+ +         E   KVM++  +E +   I    S    YE  +   + P   E+ H  V K  GLK   +   +  + ++A GDA ND  M+  + +GVAM N +++ K  A +IT+  N+ DGI   I K+
  S:     3 KLLALDMDGTLLTTDKKVSKNTEAAIKAAEEKGVKIVLASGRPLDGL-NRYLEELDLKKGEDYVLSFNGGLVQNTRGKIVSKVC-LKGSDLKYIYEISKRLNVNV------HAFSAKDGLIAPKTSQYTEYEAAMNGIDITIKDFNEVDDNEDIIKVMMIDPQEILDPAIKELPS--EIYEKYSVFKSAPYFLEFTHKEVDKGLGLKKLGEYLGIKQEEIIACGDAGNDLSMVKYAGLGVAMGNATEEIKQAANFITDS-NDEDGIVKVIKKF 264
>gi|81096406|ref|ZP_00874751.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Streptococcus suis 89/1591] >gi|80977545|gb|EAP41083.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Streptococcus suis 89/1591] (281 aa)
Score = 204, Expect = 1.9e-14, Identities = 82/266 (30%), Positives = 131/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQD--LDLNFG-------------------------IPDN--GYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK V  D+DGTLL D++ V  S+ILAI  +KEKG+L GL TGRD        + ++     +D  I   G   Y     E   +  L    I+ I+ + Q    DL+FG                         IP++  G + F   NR    +S       K F     L +P  ++M++       T    ++S +  +   +   + P   + +    SK +G+      +   LD V+ FGD++ND++M+   +  VAM NG+ K K  A ++T+  NN DGIY  ++ +
  S:     3 IKAVFFDIDGTLLTDNRMVSSSTILAINALKEKGILVGLATGRDPR-----FVLQYMASLGLDLAIAYNGQ--YIFSREEVIYSQSLEPKQIEQIMEYAQTHHKDLSFGTAKGIFGSKIMSAGTGNFAYRVTRMIPESWAGIINFIF-NRLVRWISPQQETNLKGF-----LFQPIYQLMLL-------TTERETQSLEMLFPNLSFTRSSPYATDIISKGNSKLSGIVKVADRYGFELDEVMVFGDSNNDFEMLNEIQHSVAMGNGTKKVKQAASFVTDT-NNRDGIYKALIHF 276
>gi|167755448|ref|ZP_02427575.1| hypothetical protein CLORAM_00962 [Clostridium ramosum DSM 1402] >gi|167704387|gb|EDS18966.1| hypothetical protein CLORAM_00962 [Clostridium ramosum DSM 1402] (287 aa)
Score = 204, Expect = 2.1e-14, Identities = 73/268 (27%), Positives = 121/268 (45%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKE--------NRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRS-KSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           S+ K+++ D+DGTL +  K V   +  A+ K +E G+   L +GR  + +   L  + ++ +Y    +   G++  + +T E      LS +  K ++ H +  D    + D G   F           N     + EY+     Y      D+  +     +K++   D EY+        + FK        + TGP  FE+    + K   L   LK    + D ++AFGD  ND  M+  +  GVAM N     K ++QYIT   N+ DGI   + KY
  S:     5 SKFKIIIMDVDGTLTNSQKIVTPKTKAALMKAQELGIKLILASGRPTSGLIG-LGHELQMDKYHGLFVCYNGSKVVDCQTKEELFNQPLSIEEGKAVLEHMKKFDRVRPMIDKGEYMFVNNVYDNYINFNGAPFNVIEYESRGGNYKLCEIDDLAAFADFEINKILTTSDPEYLQEHYQEMMEPFKDSLSC---MFTGPFYFEFTAQGIDKAKALDTVLKPMGYSQDEMIAFGDGHNDASMVKYAGTGVAMANAVQDLKDISQYIT-LSNDEDGIAEALYKY 281
>gi|147675343|ref|YP_001216923.1| hypothetical protein VC0395_A0977 [Vibrio cholerae O395] >gi|146317226|gb|ABQ21765.1| conserved hypothetical protein [Vibrio cholerae O395] (273 aa)
Score = 204, Expect = 2.1e-14, Identities = 66/258 (25%), Positives = 128/258 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHS--------IRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+  K +   +  AI + +++G+   L +GR  + M + L ++  +    D+++   G+   N+ T E      + G A K +    Q+  LN         L  PK ++++        + ++E D   A+  D       P  K MIV + E +   I +    ++ ++ V   + + P   E+++   +K  G++       +    V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++DG+
  S:     3 KLIALDMDGTLLNSQKQISPRTKQAIAQARQQGIQVVLASGRPLDGMRSKL-EELHLTTENDYVLYYNGSMVANVGTGEIIHQQIIDGKAAKRVATLAQEFGLNTHAFSQIHGLITPKTSQYTEVEACINGLNITEMDF--AQLAD-----DHPIIKAMIVGEPEKLTQAIAQLPAQWREEFTV---VQSAPFFLEFLNTGSNKGIGVQAIAAHLGIQASEVICMGDAENDHHMLQYAGLGIAMANAMEETKHIADHIT-LSNDHDGV 258
>gi|47096361|ref|ZP_00233956.1| hydrolase, haloacid dehalogenase-like family [Listeria monocytogenes str. 1/2a F6854] >gi|153178031|ref|ZP_01931696.1| hypothetical protein LMMG_02538 [Listeria monocytogenes F6900] >gi|153185703|ref|ZP_01936217.1| hypothetical protein LMOG_02159 [Listeria monocytogenes J0161] >gi|153189531|ref|ZP_01937115.1| hypothetical protein LMPG_01704 [Listeria monocytogenes J2818] >gi|47015235|gb|EAL06173.1| hydrolase, haloacid dehalogenase-like family [Listeria monocytogenes str. 1/2a F6854] >gi|126941607|gb|EBA19490.1| hypothetical protein LMOG_02159 [Listeria monocytogenes J0161] >gi|127766706|gb|EBA27036.1| hypothetical protein LMPG_01704 [Listeria monocytogenes J2818] >gi|133733799|gb|EBA35497.1| hypothetical protein LMMG_02538 [Listeria monocytogenes F6900] (270 aa)
Score = 203, Expect = 2.2e-14, Identities = 77/265 (29%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L +  +++E  D++I   GA   +  T E      L  + +KDI     + +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K ++ Y T   NN+ G+   I K+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTE-LELREEGDYVISFNGAFVQDTFTKEVISHLTLGIEDLKDIYEVSLNSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEVGIAKIPESFREKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVMCIGDQENDVTMLEFAGLGIAMGNAPERIKQLSDYTTAS-NNDSGVAKAIQKF 266
>gi|153828790|ref|ZP_01981457.1| conserved hypothetical protein [Vibrio cholerae 623-39] >gi|148875743|gb|EDL73878.1| conserved hypothetical protein [Vibrio cholerae 623-39] (273 aa)
Score = 203, Expect = 2.4e-14, Identities = 63/258 (24%), Positives = 124/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+  K +   +  AI + +++G+   L +GR  + M + L ++  +    D+++   G+   N+ T E      + G A K +    Q+  LN         L  PK ++++   +  + +     D   +    P  K MIV + E +   I +    ++ ++ V   + + P   E+++   +K  G+        +    V+  GDA+ND+ M+  + +G+AM N  ++TK +A +IT   N++DG+
  S:     3 KLIALDMDGTLLNSQKQISPRTKQAIAQARQQGIQVVLASGRPLDGMRSKL-EELHLTTEDDYVLYYNGSMVANVGTGEIIHQQIIDGKAAKRVATLAQEFGLNTHAFSQIHGLITPKTSQYTEVEASINGLNITEMDFAQLADDHPIIKAMIVGEPEKLTQAIAQLPAQWREEFTV---VQSAPFFLEFLNTGSNKGIGVHAIAAHLGIQASEVICMGDAENDHHMLQYAGLGIAMANAMEETKHIADHIT-LSNDHDGV 258
>gi|167211297|ref|ZP_02281604.1| hypothetical protein LmonL_02264 [Listeria monocytogenes LO28] (283 aa)
Score = 203, Expect = 2.7e-14, Identities = 76/258 (29%), Positives = 125/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---------------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTLL D   V +    AI++ K KG+   LCTGR    + N L +  +++E  D++I   GA   +  T E      L  + +KDI     + +L+    D+  LY P  NR             KY  V+ YLT  +               SK M + +   +   I +  +SF+ KY +   + + P   E ++ + SK N +K   +   +    V+  GD +ND  M+  + +G+AM N  ++ K +A Y T   NN+ G+
  S:     3 KLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRPLVGVENYLTE-LELREEGDYVISFNGAFVQDTFTKEVISHLTLGIEDLKDIYEVSLNSNLHMHFFDDKALYTP--NRE----------IGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELEVGIAKIPESFREKYHL---VRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQENDVTMLEFAGLGIAMGNAPERIKQLADYTTAS-NNDSGV 259
>gi|28212036|ref|NP_782980.1| HAD superfamily hydrolase [Clostridium tetani E88] >gi|28204479|gb|AAO36917.1| hydrolase (HAD superfamily) [Clostridium tetani E88] (320 aa)
Score = 202, Expect = 3.0e-14, Identities = 78/265 (29%), Positives = 130/265 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE--------PKSKVMIVCDKEYMPTVI-NRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLLDDSK +   +I AIK+   KG+   L TGR    + N L +   +    +F I   GA   N    +      L+ D +     ++ +L   F I  N    F K++  + +L +Y  + AK+ ++DV + +          +KV+   + E +  ++ N      SKY +     + P   E+ +  ++K   +K      N+  + ++  GDA ND +MI  + +G+AM N   + K+VA YIT   N N G+ + I K+
  S:    54 KLVAIDMDGTLLDDSKTIPNENIRAIKEASNKGIKIALATGRPLTGIKNYL-NVLGLNSPDNFSIIYNGALIQNNTNKKIISQCLLNYDDLM----YFHNLSRKFHIHMN---VFTKDSCITSKLGKYTTLEAKWSNIDVKIVDFNNLDKNIEITKVIFADEPELISKIMDNLDDDVYSKYAMAR---SAPYFLEFFNKEINKGIAVKKYADSLNIHKEEIICIGDAGNDIEMIKFAGLGIAMENAFPEIKNVANYIT-LSNENAGVAHAIDKF 315
>gi|16081006|ref|NP_391834.1| hypothetical protein BSU39550 [Bacillus subtilis subsp. subtilis str. 168] >gi|1731308|sp|P54947|YXEH_BACSU Uncharacterized protein yxeH >gi|1408493|dbj|BAA08324.1| yxeH [Bacillus subtilis] >gi|2636501|emb|CAB15991.1| yxeH [Bacillus subtilis subsp. subtilis str. 168] (270 aa)
Score = 202, Expect = 3.5e-14, Identities = 81/262 (30%), Positives = 120/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIP----DNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE----PKS----KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++  DMDGTLL+D   V E    A+   K +G+   LCTGR    +   L D+  + E  D++I   GA   N  TNE      L  D   D+ + Y DL L    P    D+  LY P  +     +SE+    +    V ++  +    PK     KVM +   E +  VI    K  + KY   T + + P  +E +H   SK N ++   +   +    V+  GD  ND  MI  +  GVAM N   +    A + T + NN  G+ + I
  S:     3 KLIAIDMDGTLLNDHHEVTEEVRDALHAAKAEGVKIVLCTGRPIGGVQRYL-DELNLIEEGDYVIAYNGALVQNTHTNEVVSELSLGYD---DLTSLY-DLSLELKTPMHFFDSSNLYTPNRD-----ISEFTVYESYVTQVPLHFRKIDEVPKDILIPKVMFIDKPENLSRVITSIPKDVREKY---TMVRSAPFFYEILHSEASKGNAVRQLAQLLGIEQAEVMCIGDNGNDLTMIEWAGCGVAMANAIPEVLEAANFQT-RSNNEHGVAHAI 263
>gi|116334388|ref|YP_795915.1| HAD superfamily hydrolase [Lactobacillus brevis ATCC 367] >gi|116099735|gb|ABJ64884.1| Predicted hydrolase of the HAD superfamily [Lactobacillus brevis ATCC 367] (271 aa)
Score = 202, Expect = 3.7e-14, Identities = 76/267 (28%), Positives = 124/267 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI-----INHYQ----DLDLNFGIPDNGYLYFPKENRHSIRLSEYDHM--TAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK++  D+D TLL+  K + E +  A++++ E G+   LCTGR  N + + L ++  +    D+ I   GA      T E    S LS +  + +      NHY     D D  + I D             +  S Y+ M      F    +   P    SK ++  D   +  V+ + +      Y V   + + P + E++  ++ K  GL   L  F     +++AFGDA+ND  MI  +  GVAM NG    K+ A + T  DNN+ G+  ++   F
  S:     2 IKMIALDLDETLLNTDKTISEENATALRQLHEAGIKIVLCTGRPINAIWHYL-EQLGLTTDDDYTITFNGALVIQNSTKEALAQSGLSRNDFEPLHAFAAANHYPMDVLDFDQVYPIAD-------------LTPSVYEQMLKAPMKFIPTAFADLPDQLFSKAVMATDAAILDQVVAKLTPELTKLYHV---VRSQPKILEFLAADMDKAVGLGQLLTHFGWDFSDLMAFGDAENDLGMIKAAGDGVAMQNGQPAVKAAANHQTPVDNNHAGVAAYLQHVF 266
>gi|22536890|ref|NP_687741.1| HAD superfamily hydrolase [Streptococcus agalactiae 2603V/R] >gi|25010803|ref|NP_735198.1| hypothetical protein gbs0748 [Streptococcus agalactiae NEM316] >gi|76787088|ref|YP_329474.1| Cof-like hydrolase [Streptococcus agalactiae A909] >gi|76798187|ref|ZP_00780438.1| Cof family protein [Streptococcus agalactiae 18RS21] >gi|77406412|ref|ZP_00783471.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae H36B] >gi|77410816|ref|ZP_00787174.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae CJB111] >gi|22533740|gb|AAM99613.1|AE014224_16 hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 2603V/R] >gi|23095157|emb|CAD46392.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562145|gb|ABA44729.1| Cof-like hydrolase [Streptococcus agalactiae A909] >gi|76586450|gb|EAO62957.1| Cof family protein [Streptococcus agalactiae 18RS21] >gi|77163195|gb|EAO74148.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae CJB111] >gi|77174976|gb|EAO77786.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae H36B] (274 aa)
Score = 201, Expect = 4.8e-14, Identities = 78/269 (28%), Positives = 127/269 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMT---AKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +S IK++  D+DGTL    K V E + +A+K  +EKG+   + TGR    + N+L D   + +  D+ I   G       T +    + ++   ++DI      + L   I   G +Y      H    S+Y H+     ++ +VD     PK    +K++ V D  Y+   I +     K  YE+     +  I+ E M   V K  GL++  K   L    V+A GD  ND  M+  + +GVAM NG  + K++A+  T  +N+  G+   I KY
  S:     1 MSDIKILALDLDGTLFTTDKKVSEENKVALKAAREKGIKVVITTGRPLKAIGNLLEDLELVSDE-DYSITFNGG-LVQQNTGKILAKTAMTRQEVEDIHEELYQVGLPTDILSEGTVYSIANKGHH---SQY-HLANPLLEFIEVDDLEQVPKDVVYNKIVSVIDATYLDQQIAKLPDRLKVDYEM---FKSRDIILELMPKGVHKAVGLELLTKHLGLDSSQVMAMGDEANDLSMLEWAGLGVAMANGIPEAKAIAKATTICNNDESGVAEAIGKY 268
>gi|77413088|ref|ZP_00789289.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 515] >gi|77160881|gb|EAO71991.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 515] (274 aa)
Score = 200, Expect = 6.1e-14, Identities = 77/269 (28%), Positives = 127/269 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMT---AKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +S IK++  D+DGTL    K V E + +A+K  +EKG+   + TGR    + N+L D   + +  D+ I   G       T +    + ++   ++DI      + L   I   G +Y      H    S+Y H+     ++ +VD     PK    +K++ V D  Y+   I +     K  YE+     +  I+ E M   V K  GL++  K   L    V+A GD  ND  M+  + +GVAM NG  + K++A+  T  +N+  G+   + KY
  S:     1 MSDIKILALDLDGTLFTTDKKVSEENKVALKAAREKGIKVVITTGRPLKAIGNLLEDLELVSDE-DYSITFNGG-LVQQNTGKILAKTAMTRQEVEDIHEELYQVGLPTDILSEGMVYSIANKGHH---SQY-HLANPLLEFIEVDDLEQVPKDVVYNKIVSVIDATYLDQQIAKLPDRLKVDYEM---FKSRDIILELMPKGVHKAVGLELLTKHLGLDSSQVMAMGDEANDLSMLEWAGLGVAMANGIPEAKAIAKATTICNNDESGVAEAVGKY 268
>gi|187776750|ref|ZP_02993223.1| hypothetical protein CLOSPO_00265 [Clostridium sporogenes ATCC 15579] >gi|187775409|gb|EDU39211.1| hypothetical protein CLOSPO_00265 [Clostridium sporogenes ATCC 15579] (268 aa)
Score = 199, Expect = 6.4e-14, Identities = 77/265 (29%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+D K +   +  AIK     G    L TGR    +   L  +  +    D+ I   GA     KT +    + ++ + +K +    ++LD++      G  Y PK N +S   +  +++     D D    + K  K+M V  KE +  +I    K  + KY V   + T  I  E+++ + SK  G++      N+    V+  GDA+ND  MI  + +GVAM N   + K VA YIT ++N + G+   I K+
  S:     3 KLIALDMDGTLLNDKKTISRENKEAIKAAISNGSKVVLATGRPLKGIEKYL-KELNLINNGDYAIAFNGALVQETKTGKVLYENNMTKEDLKILYKLSKELDVDIHFLTIGECYTPKFNVYSQIETTLNNIPLNIIDFDNIPEDLKIIKIMFVGSKEKITEIIKLVPKELQEKYNV---VRTASIYLEFLNKDTSKGYGIEKLCNILNIDKKEVICAGDAENDIHMIEYAGLGVAMENAYPQVKKVANYIT-KNNEDHGVAQVINKF 264
>gi|77975793|ref|ZP_00831327.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia frederiksenii ATCC 33641] (268 aa)
Score = 198, Expect = 8.4e-14, Identities = 71/258 (27%), Positives = 131/258 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKS--------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTLL+    +   +I AIK++ +   +  LC+ R  N MA V+ +  +++  + + I   GA  Y+    +  +   LSG  ++ I      L      P +   +F ++     S  ++ Y    ++ FD+++ ++EP +        KV IV   +++ +V ++  + F  +Y +     T    +E M   +SK  GL    +  N+  ++V++ GD +ND  M   S++GVAM N SD  KS A  ++  DNN  G+
  S:     3 KLLALDLDGTLLNKENKISPQNISAIKQVIDGNGIVVLCSARPVNAMAAVICNT-ELEHLIRYFISFNGAWIYDCIEKKDLRFIPLSGHDVQVI----TPLLTGRKFPHH---FFTRDKIISSSKDINYYTKYESELFDMEILISEPVNISQRDDIVKVSIVGSTDFIASVADKIDQKFHQQYSLSK---TSNHYYEIMSHGISKGRGLHYLCQYLNINAESVVSMGDQENDISMFQFSEVGVAMGNASDFVKSCADRVS-LDNNQHGV 259
>gi|149911292|ref|ZP_01899913.1| hypothetical protein PE36_13319 [Moritella sp. PE36] >gi|149805607|gb|EDM65609.1| hypothetical protein PE36_13319 [Moritella sp. PE36] (269 aa)
Score = 197, Expect = 1.4e-13, Identities = 67/258 (25%), Positives = 119/258 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLT-EPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  DMDGTLL+    +   +  AI     +G    L +GR    M N  +++  +    D++    G+  Y +   +  ++  ++G   K +      L ++      N  L  PK N ++   ++ + +     D       E   KVM++ + E +   I +  +  S YE    L + P   E++H +  K  G+K   + F +  D V+  GDA ND  M+  + +GVAM N SD  K++A +IT   +N+DG+
  S:     3 KLIALDMDGTLLNSQGAISPRNKQAILAAIAQGTRVVLASGRPLEGM-NWALEELGMTGKDDYVACYNGSLVYQVADKQLLRSQTVTGADAKKLAELANKLGVHVHAFSVNAGLITPKHNYYTDHEAKINGLPITEVDFSTLSDDEAMLKVMMIDEPEKLSAAIAQLPA--SLYEQYNILQSAPFFLEFLHTDSHKGIGVKAIAQQFGINADEVICMGDAGNDKQMLEYAGLGVAMANASDDIKAIANHITAS-HNDDGV 258
>gi|116493303|ref|YP_805038.1| HAD superfamily hydrolase [Pediococcus pentosaceus ATCC 25745] >gi|116103453|gb|ABJ68596.1| Predicted hydrolase of the HAD superfamily [Pediococcus pentosaceus ATCC 25745] (270 aa)
Score = 196, Expect = 1.5e-13, Identities = 86/266 (32%), Positives = 131/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVL--IDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSE--YDHMTAKYF---DVDVYLTEPKSKVMIVCDKEYMPTVINRSK-----SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+DGTLL+D+K + E++I AI    + G+   LCTGR    +   L  +D    KEY    +   GA    L T E      LS +         + + ++F +    ++Y   +N  +  + E     M  +Y    ++D  L  PK  VM + D    P V+++++      F+  + V   + + P   E M  NVSK N +       NLTLD V+A GD  ND  MI  +  GVAM N  D+ K  AQ+IT  +NN  G+   I K+
  S:     3 IKLIAIDLDGTLLNDNKQLTEANIAAINAASKIGINVVLCTGRPITGIQRYLTQLDLTNEKEYA---VTYNGALAQTL-TGETLIKHTLSFEDYLTAEAFSRKIGVHFHVDGKNHIYTANKNISTYTVGESFLVEMGLRYRAVNEMDPNLEMPK--VMFIDD----PKVLSKARDQIFAKFQDNFSV---VQSEPYFIELMPQNVSKGNAVTELAARLNLTLDQVMAIGDQGNDLSMIKAAGTGVAMENAIDEVKQNAQFIT-ANNNESGVAKAIQKF 266
>gi|49483523|ref|YP_040747.1| haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241652|emb|CAG40340.1| haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MRSA252] (267 aa)
Score = 196, Expect = 1.6e-13, Identities = 69/262 (26%), Positives = 120/262 (45%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG-PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           ++  KVVV DMD TLL+    + E +   +  I+++G    L +GR    M     D  K+ E+  +II   G++  N+   E + +  +      +I+++ +D         +G + +  E+ +    +E   +  K  D +  Y+ +   KVM V   +Y+  +          +       T  P   E+M  +VSK N +K        ++D V+AFGD+ ND  M   + + +AM N SD+ K  A  IT  D+N +GI
  S:     1 MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARD-LKLPEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDSEHEYMNIEAELTGLPMKRVDDIKAYIQDDVPKVMGV---DYVANITEARIDLNGVFNDNVDATTSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNASDELKQYADEIT-LDHNENGI 259
>gi|163800816|ref|ZP_02194716.1| hypothetical protein AND4_01098 [Vibrio campbellii AND4] >gi|159175165|gb|EDP59962.1| hypothetical protein AND4_01098 [Vibrio campbellii AND4] (270 aa)
Score = 196, Expect = 1.7e-13, Identities = 73/265 (27%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS--------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI K +E G+   L +GR    M N L D   I    DF++   G+   N+ T +      + G A K I    ++L          +    +EN      + Y  + AK   ++V +    +        K M+V +   +  VI       K+++ V   + + P   E+++P+ +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YITE  N++ G+   I K+
  S:     3 KLIALDMDGTLLNSDKVISEENKQAIAKAREAGVTVVLASGRPLEGMQNKL-DDLNIDSDKDFVLYYNGSMVKNIGTGDIIHEQIIDGKAAKKIARKARELGAYVHAFSKVHGLITEEN------NPYTDIEAKINGLEVTVMNFDALEDDHGIIKAMMVAEPSKLTEVIAALPAELKAEFTV---VQSAPFFLEFLNPSSNKGIGVSAIAEYLGIKAEEVICMGDAENDHHMLEYAGLGIAMANAMEETKRIADYITES-NDDHGVAKAIEKF 265
>gi|82750926|ref|YP_416667.1| hypothetical protein SAB1189 [Staphylococcus aureus RF122] >gi|82656457|emb|CAI80878.1| conserved hypothetical protein [Staphylococcus aureus RF122] (267 aa)
Score = 196, Expect = 1.7e-13, Identities = 69/262 (26%), Positives = 120/262 (45%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG-PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           ++  KVVV DMD TLL+    + E +   +  I+++G    L +GR    M     D  K+ E+  +II   G++  N+   E + +  +      +I+++ +D         +G + +  E+ +    +E   +  K  D +  Y+ +   KVM V   +Y+  +          +       T  P   E+M  +VSK N +K        ++D V+AFGD+ ND  M   + + +AM N SD+ K  A  IT  D+N +GI
  S:     1 MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARD-LKLPEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDSEHEYMNIEAELTGLPMKRVDDIKAYIQDDVHKVMGV---DYVANITEARIDLNGVFNDNVDATTSKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNASDELKQYADEIT-LDHNENGI 259
>gi|171780113|ref|ZP_02921017.1| hypothetical protein STRINF_01901 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281461|gb|EDT46896.1| hypothetical protein STRINF_01901 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (273 aa)
Score = 196, Expect = 1.8e-13, Identities = 70/269 (26%), Positives = 128/269 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY----------FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS----KVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           ++ IK++  D+DGTL +  K V   + LA++  ++ G+   + TGR    ++  L+++  +    D++I   G       T E    S LS   ++ +  H + L L F +  +G +Y          +P+ N            T ++  VD +   P++    KV+ V   E++   ++   K     +E+     +  I+ E M   + K  GL   +K   L+ +NV+A GD +ND  M+  + + VAM NG    K  A  +T + N+  G+   + KY
  S:     1 MADIKLLALDLDGTLFNRQKVVTRENKLALRAARDMGVKVVITTGRPLKAISG-LLEELDLISDEDYLITFNGG-LVQKTTGEILAKSELSRSQLQLLYRHLEPLALPFDVLSDGIVYSLACRGNESHYPQANP-----------TLEFVTVDSFADIPENVIYNKVVSVTKPEFLDQQLLKLPKELHQYFEI---FKSRDIIVEMMPKGIHKAAGLNQLVKHLGLSSENVMAMGDEENDLSMLKWAGLSVAMANGVSIAKETADAVTSRTNDESGVAEAVKKY 268
>gi|145952770|ref|ZP_01801778.1| hypothetical protein CdifQ_04002730 [Clostridium difficile QCD-32g58] (277 aa)
Score = 196, Expect = 1.8e-13, Identities = 70/271 (25%), Positives = 132/271 (48%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKE--NRHSIRLSEYDHMTAKYFDVDVYLTEPK-SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           M++   K++  D+DGT+L+  K +      +I++ K  G    + TGR    +   L+++  + +  D++I   GA    +K+ +      ++ D    I N+  +       I     L  P E   ++++  ++ +++  KY   D      K  K+MIV + E +  +I +  K+  +KY   T + + P   E++    +K   LK    + N+ ++N +A GD +ND  MI  + +GVAM N  +  K +A Y+T+  NN +G+   I KY
  S:     1 MEVDMYKLIALDIDGTILNTQKRITPEVFESIQEAKRAGAKVVITTGRPLPGVKE-LLNQLNLTDEGDYVICFNGAIIQEVKSEKIIHDVEMTLDDFDFIYNNVCKKYKTKIHINTMTNLITPNEAPGKYTLHEAKLNNIEVKYIQKDKIDESIKICKIMIVDEPERLEEIIQQLPKNLFNKY---TIVRSAPFYLEFLGKTTNKGTALKTLCTNLNIPIENAIAVGDEENDQHMIKYAGLGVAMGNARNSIKEIADYVTDT-NNENGVAKVINKY 271
>gi|170755528|ref|YP_001782954.1| HAD family hydrolase [Clostridium botulinum B1 str. Okra] >gi|169120740|gb|ACA44576.1| HAD hydrolase, IIB family [Clostridium botulinum B1 str. Okra] (268 aa)
Score = 194, Expect = 2.6e-13, Identities = 76/265 (28%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++ K +   +  AIK    KG    L TGR    +   L  +  +    D+ I   GA     KT +    + ++ + +K +    ++LD++         Y PK N +S   +  +++     D D      K  K+M V  +E +  +I    K F+ KY V   + T  I  E+++ + SK  G++      N+    V+  GDA+ND  MI  + +GVAM N   + K VA YIT ++N + G+   I K+
  S:     3 KLIALDMDGTLLNNKKTISRENKEAIKAAISKGSKVVLATGRPLKGIEKYL-KELDLINNGDYAIAFNGALVQETKTGKVLYENNMTKEDLKILYKLSKELDVDIHFLTIDECYTPKLNVYSQIETTLNNIPLNIIDFDNVTDHLKIIKIMFVGSEEKITEIIKLVPKEFQEKYNV---VRTASIYLEFLNKDTSKGYGIERLCNILNIDKKEVICAGDAENDIHMIEYAGLGVAMENAYPQVKKVANYIT-KNNEDHGVAQVINKF 264
>gi|167768000|ref|ZP_02440053.1| hypothetical protein CLOSS21_02543 [Clostridium sp. SS2/1] >gi|167710329|gb|EDS20908.1| hypothetical protein CLOSS21_02543 [Clostridium sp. SS2/1] (277 aa)
Score = 194, Expect = 2.7e-13, Identities = 72/261 (27%), Positives = 121/261 (46%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYF--------DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           M  ++IK+V +DMDGTLL+  + + + +   IKK   +G+ F   TGR      N L  + K  E + + I   GA  Y+LK  +    +    D + ++++  +  DL   I  NG  Y  K+   +I   E D  T            D+++++ E  + V              R+    SK E      + P   E      +K +GL    K  N+  + +++ GDADND +++ ++ + V M NG D  K++A YIT  +  N
  S:     1 MGENRIKLVAADMDGTLLNRERKITKYTQNVIKKAMAQGVYFVPATGR----AVNALPPELKEMEGIRYGIFSNGATIYDLKEEKVIYKNHFEMDRVLELMDFLKQFDLMESISLNGQSYANKKEMENIDYYELDSNTKAIVQGSRVLVDDLEMFVKEQSTTVEKTTLLFKTMEERRRAADALSKIEDIQFSSSLPKNLEISKKGCNKGDGLFHLAKILNIQKEEIMSCGDADNDRELLESAGLAVVMENGLDSMKAIADYITVSNQEN 265
>gi|22536571|ref|NP_687422.1| HAD superfamily hydrolase [Streptococcus agalactiae 2603V/R] >gi|25010497|ref|NP_734892.1| hypothetical protein gbs0424 [Streptococcus agalactiae NEM316] >gi|76787344|ref|YP_329108.1| Cof-like hydrolase [Streptococcus agalactiae A909] >gi|76798040|ref|ZP_00780297.1| Cof family protein [Streptococcus agalactiae 18RS21] >gi|77406445|ref|ZP_00783502.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae H36B] >gi|77411637|ref|ZP_00787977.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae CJB111] >gi|22533406|gb|AAM99294.1|AE014209_7 hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 2603V/R] >gi|23094850|emb|CAD46068.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562401|gb|ABA44985.1| Cof-like hydrolase [Streptococcus agalactiae A909] >gi|76586599|gb|EAO63100.1| Cof family protein [Streptococcus agalactiae 18RS21] >gi|77162281|gb|EAO73252.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae CJB111] >gi|77174947|gb|EAO77759.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae H36B] (270 aa)
Score = 194, Expect = 2.8e-13, Identities = 78/266 (29%), Positives = 128/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAI---KDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVM--------IVCDKEYMPTVINRSKSFKSKYEVGTPLVTG----PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL+D K + + +I AIK+  + G+   LCTGR  + +     +    KE  ++II   G   Y+ K  +   ++ L+ D +   ++++  + ++ L              EN       E   + A  +D D+  T+ KS  +        IV    YM    + +   ++  E      +G      ++E M   V+K  GLK  +    L ++ V+A GDA ND +++      VAM N SD+ KS  +YIT  DNN  G+   I  Y
  S:     2 IKLIAIDMDGTLLNDEKKIPKENIQAIKEATQAGIKIVLCTGRPMSGILPYFNELGLTKE--EYIIMNNGCSTYSTKDWQLIDSATLTHDELIFLEEVVKEFPNVCLTL----------TAENTFYAVGEEVPEIVA--YDADLVFTKAKSTSLDALRNQEEIVFQAMYMGLDADVTAFQEAVEEALISKFSGVRSQDYIYEIMPQGVTKARGLKSLIAKLGLDINQVMAIGDAPNDIELLDLVPNSVAMGNASDEIKSRCKYIT-VDNNKAGVAKAIYDY 267
>gi|163789900|ref|ZP_02184336.1| hydrolase, haloacid dehalogenase-like family protein [Carnobacterium sp. AT7] >gi|159874840|gb|EDP68908.1| hydrolase, haloacid dehalogenase-like family protein [Carnobacterium sp. AT7] (279 aa)
Score = 194, Expect = 3.1e-13, Identities = 73/259 (28%), Positives = 127/259 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  D+DGTLL   + +       IK  K KG+   +CTGR    + N ++ +  ++E  D++I   GA        +      LS +    I    + +  +    D  Y+Y   ++   +S+R S   +M  ++  V ++  T   SK+M++ D + +   I  +K  KS Y+  T L + P   E ++ + SK   LK   +  ++  +N++A GD +ND DMI  + +GVAM N     K V+ YIT+  N  DG+
  S:     3 IELIAIDLDGTLLTPERKISTKVKETIKLAKTKGIKVVICTGRPLPGV-NSILAELNLEEEGDYVITYNGALVQQSHNGKAIAHHTLSFEDFLKIEEMSRQVGSHCHTIDEKYIYTANKDISPYSVRESFLVNMPIRFRTVAEMDPTIEISKMMMIDDPDVLDAAI--AKFPKSFYDDYTVLKSEPFYLEVLNKSASKGQALKDLAQILSIPRENIMAIGDNENDIDMIEYAGMGVAMGNAIASVKDVSDYITDT-NEQDGV 260
>gi|154503507|ref|ZP_02040567.1| hypothetical protein RUMGNA_01331 [Ruminococcus gnavus ATCC 29149] >gi|153795607|gb|EDN78027.1| hypothetical protein RUMGNA_01331 [Ruminococcus gnavus ATCC 29149] (269 aa)
Score = 194, Expect = 3.1e-13, Identities = 75/267 (28%), Positives = 125/267 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIK---DIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHM-TAKYFDVDVYLTEPKSKVMIVCD----KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +++V D+DGTL +  K + E +  A+ +I+E+G    L +GR  N +   L +K  + +Y  +++   GA+     T E      L  D I    +I + Y  LD+      N  L     N ++ + S  + M   +  D    LT P +K++I  +    +E MP +  +     + Y       + P   E M  N+ K   L+  L    LT D+++  GD  ND  MI  + +GVAM N     K  A +IT + N+ DGI + I  + +
  S:     4 QMLVLDLDGTLTNSRKELTEPTKQALIEIQEEGKKVVLASGRPINGIVP-LAEKLNLSKYGGYMLSFNGARITQCSTGEIIYNRTLPADVIAPIYEITSTYPGLDI-LTYDGNQILSGIASNEYTEKESFINKMEIVQVPDFVSRLTFPVNKLLIAGEPSILEELMPHLQQKFHKLLNIYR------SEPFFLEIMPQNIDKAYSLQKLLNSIGLTADSMICCGDGFNDISMIEYAGLGVAMENAQPIVKETADFIT-KSNDEDGILHVINTFLR 269
>gi|148381273|ref|YP_001255814.1| HAD hydrolase, IIB family [Clostridium botulinum A str. ATCC 3502] >gi|153932561|ref|YP_001385649.1| HAD family hydrolase [Clostridium botulinum A str. ATCC 19397] >gi|153935239|ref|YP_001389055.1| HAD family hydrolase [Clostridium botulinum A str. Hall] >gi|153941326|ref|YP_001392676.1| HAD family hydrolase [Clostridium botulinum F str. Langeland] >gi|148290757|emb|CAL84888.1| putative hydrolase [Clostridium botulinum A str. ATCC 3502] >gi|152928605|gb|ABS34105.1| HAD hydrolase, IIB family [Clostridium botulinum A str. ATCC 19397] >gi|152931153|gb|ABS36652.1| HAD hydrolase, IIB family [Clostridium botulinum A str. Hall] >gi|152937222|gb|ABS42720.1| HAD hydrolase, IIB family [Clostridium botulinum F str. Langeland] (268 aa)
Score = 193, Expect = 3.8e-13, Identities = 76/265 (28%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++ K +   +  AIK    KG    L TGR    +   L  +  +    D+ I   GA     KT +    + ++ + +K +    ++LD++         Y PK N +S   +  +++     D D      K  K+M V  +E +  +I    K F+ KY V   + T  I  E+++ + SK  G++      N+    V+  GDA+ND  MI  + +GVAM N   + K VA YIT ++N + G+   I K+
  S:     3 KLIALDMDGTLLNNKKTISRENKEAIKAAISKGSKVVLATGRPLKGIEKYL-KELDLINNGDYAIAFNGALVQETKTGKVLYENNMTKEDLKILYKLSKELDVDIHFLTIDECYTPKLNVYSQIETTLNNIPLNIIDFDNVPDHLKIIKIMFVGSEEKITEIIKLVPKEFQEKYNV---VRTASIYLEFLNKDTSKGYGIERLCNILNIDKKEVICAGDAENDIHMIEYAGLGVAMENAYPQVKKVANYIT-KNNEDHGVAQVINKF 264
>gi|168182045|ref|ZP_02616709.1| HAD hydrolase, IIB family [Clostridium botulinum Bf] >gi|182674916|gb|EDT86877.1| HAD hydrolase, IIB family [Clostridium botulinum Bf] (268 aa)
Score = 193, Expect = 3.9e-13, Identities = 76/265 (28%), Positives = 126/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++ K + + +  AIK    KG    L TGR    +   L  +  +    D+ I   GA     KT +    + ++ + +K +    ++LD++         Y PK N +S   +  +++     D D      K  K+M V  +E +  +I    K F+ KY V   + T  I  E+++ + SK  G++      N+    V+  GDA+ND  MI  + +GVAM N   + K VA YIT ++N + G+   I K+
  S:     3 KLIALDMDGTLLNNKKTISKENKEAIKAAISKGSKVVLATGRPLKGIEKYL-KELDLINNGDYAIAFNGALVQETKTGKVLYENNMTKEDLKILYKLSKELDVDIHFLTIDECYTPKLNVYSQIETTLNNIPLNIIDFDNVPDHLKIIKIMFVGSEEKITEIIKLVPKEFQEKYNV---VRTASIYLEFLNKDTSKGYGVERLCNILNIDKKEVICAGDAENDIHMIEYAGLGVAMENAYPQVKKVANYIT-KNNEDHGVAQVINKF 264
>gi|16588993|gb|AAL26979.1|AF380672_3 unknown [Streptococcus agalactiae] (274 aa)
Score = 193, Expect = 4.0e-13, Identities = 76/266 (28%), Positives = 125/266 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMT---AKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+DGTL    K V E + +A+K  +EKG+   + TGR    + N+L D   + +  D+ I   G       T +    + ++   ++DI      + L   I   G +Y      H    S+Y H+     ++ +VD     PK    +K++ V D  Y+   I +     K  YE+     +  I+ E M   V K  GL++  K   L    V+A GD  ND+ M+  + +GVAM NG  + K+ A+  T  +N+  G+   + KY
  S:     4 IKILALDLDGTLFTTDKKVSEENKVALKAAREKGIKVVITTGRPLKAIGNLLEDLELVSDE-DYSITFNGG-LVQQNTGKILAKTAMTRQEVEDIHEELYQVGLPTDILSEGTVYSIANKGHH---SQY-HLANPLLEFIEVDDLEQVPKDVVYNKIVSVIDATYLDQQIAKLPDRLKVDYEM---FKSRDIILELMPKGVHKAVGLELLTKHLGLDSSQVMAMGDEANDFIMLEWAGLGVAMANGIPEAKATAKATTICNNDESGVAEAVGKY 268
>gi|71894057|ref|YP_278165.1| hypothetical protein MS53_0032 [Mycoplasma synoviae 53] (450 aa)
Score = 193, Expect = 4.1e-13, Identities = 84/265 (31%), Positives = 136/265 (51%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGA----QFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF---------GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV------DVYLTEPKS----KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           ++I   + DMDGTLL+D   + ES++ AI  +        + TGR  N M +   D   +K   D IIG  GA     + NL  N+ K   +L  ++ K I ++  +  ++F         G   N   +F  ENR   ++   +     Y ++      D    +P      K++++  K+   T++ + K F +K+     L +   + + M  N+SK   L    KD NL+L+N LA GD +ND +M+ N    VAM+N   + K +A  +T  DNNN GI +FI
  S:     3 NKIHAFIFDMDGTLLNDKNQISESNLNAINFLHLNNKKVIIATGR-PNYMNHQYYDALNLK---DAIIGINGAMVDLNWRNL--NQTKVMGYLPKESFKKIASYLNENKIDFLTYHKNSMYGFNYNNPPWF--ENRIYPKIQSDNKYKWNYKEIALEKLYDFLEKKPGEFVFLKILVISQKQSEQTLL-KLKEFLNKFNDLYYLRSQSDVIDIMPLNISKGQTLLDISKDINLSLENALAIGDQENDIEMLKNVAYPVAMLNAKKELKKIAWKVTNLDNNNSGIADFI 281
>gi|77408758|ref|ZP_00785488.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae COH1] >gi|77413955|ref|ZP_00790129.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 515] >gi|77159991|gb|EAO71128.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae 515] >gi|77172603|gb|EAO75742.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae COH1] (270 aa)
Score = 193, Expect = 4.1e-13, Identities = 78/266 (29%), Positives = 128/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAI---KDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVM--------IVCDKEYMPTVINRSKSFKSKYEVGTPLVTG----PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL+D K + + +I AIK+  + G+   LCTGR  + +     +    KE  ++II   G   Y+ K  +   ++ L+ D +   ++++  + ++ L              EN       E   + A  +D D+  T+ KS  +        IV    YM    + +   ++  E      +G      ++E M   V+K  GLK  +    L ++ V+A GDA ND +++      VAM N SD+ KS  +YIT  DNN  G+   I  Y
  S:     2 IKLIAIDMDGTLLNDEKKIPKENIQAIKEATQAGIKIVLCTGRPMSGILPYFNELGLTKE--EYIIMNNGCSTYSTKDWQLIDSATLTHDELIFLEEVVKEFPNVCLTL----------TAENTFYAVGEEVPEIVA--YDADLVFTKAKSISLDALRNQEEIVFQAMYMGLDADVTAFQEAVEEALISKFSGVRSQDYIYEIMPQGVTKARGLKSLIAKLGLDINQVMAIGDAPNDIELLDLVPNSVAMGNASDEIKSRCKYIT-VDNNQAGVAKAIYDY 267
>gi|166032693|ref|ZP_02235522.1| hypothetical protein DORFOR_02408 [Dorea formicigenerans ATCC 27755] >gi|166027050|gb|EDR45807.1| hypothetical protein DORFOR_02408 [Dorea formicigenerans ATCC 27755] (285 aa)
Score = 192, Expect = 4.2e-13, Identities = 77/266 (28%), Positives = 132/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVD--FIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENR---HSIRLSEY--DHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKY----EVGTPLVTGPIL---------FEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+DGTL DD+  + ++SI A+ + KE G+     +GRD + +       W   + VD  ++I   G+  Y  KT +C    +L    +  I  +    ++   +  +G  Y P +      ++ L +Y   HM      ++  +   K+      D +     +N  K  K K     EV   L   P +          E+     +K +GLK+  +   +T+D V+A GD++ND +M+  + +G+AM N +D  KSVA  IT  DN ++G+   I KY
  S:    10 IKLLALDVDGTLFDDNGKISQASIDAMNQAKEAGIEVVPTSGRDYDGIP------WDQLKNVDINYVITTNGSAVYEAKTKKCLYEKYLDSGKMIPIFEYLLKKEIYINVFVDGVSYTPVQVYPYIDNLDLPDYVIQHMKENRKGINDLIEYLKNG-----DAKMQKATLNFQKQEKDKLLNREEVQEYLEECPDIKVVNGGFNNLEFTKAGTNKASGLKLLAEYLGMTMDEVMAVGDSENDIEMLREAGLGIAMGNATDDVKSVADDIT-LDNGHEGVAAAIEKY 283
>gi|21282947|ref|NP_646035.1| hypothetical protein MW1218 [Staphylococcus aureus subsp. aureus MW2] >gi|49486175|ref|YP_043396.1| haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650334|ref|YP_186218.1| HAD superfamily hydrolase [Staphylococcus aureus subsp. aureus COL] >gi|87161978|ref|YP_493926.1| HAD superfamily hydrolase [Staphylococcus aureus subsp. aureus USA300] >gi|88195053|ref|YP_499853.1| hypothetical protein SAOUHSC_01323 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221455|ref|YP_001332277.1| haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509509|ref|YP_001575168.1| HAD family phosphatase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727361|ref|ZP_02759638.1| HAD superfamily hydrolase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|21204386|dbj|BAB95083.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49244618|emb|CAG43049.1| haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284520|gb|AAW36614.1| hydrolase, haloacid dehalogenase-like family [Staphylococcus aureus subsp. aureus COL] >gi|87127952|gb|ABD22466.1| hydrolase, haloacid dehalogenase-like family [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202611|gb|ABD30421.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374255|dbj|BAF67515.1| haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368318|gb|ABX29289.1| HAD superfamily hydrolase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (267 aa)
Score = 192, Expect = 4.4e-13, Identities = 70/262 (26%), Positives = 124/262 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTV----INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           ++  KVVV DMD TLL+    + E +   +  I+++G    L +GR    M     D  K+ E+  +II   G++  N+   E + +  +      +I+++ +D         +G + +  E+ +    +E   +  K  D +  Y+     KVM V   +Y+  +    I+ +  F    +  T   + P   E+M  +VSK N +K        ++D V+AFGD+ ND  M   + + +AM N SD+ K  A  +T  D+N +GI
  S:     1 MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARD-LKLPEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDSEHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGV---DYVANITEARIDLNGVFNDNVDATT---SKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNASDELKQYANEVT-LDHNENGI 259
>gi|170758451|ref|YP_001788646.1| HAD family hydrolase [Clostridium botulinum A3 str. Loch Maree] >gi|169405440|gb|ACA53851.1| HAD hydrolase, IIB family [Clostridium botulinum A3 str. Loch Maree] (268 aa)
Score = 192, Expect = 4.6e-13, Identities = 76/265 (28%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++ K +   +  AIK    KG    L TGR    +   L  +  +    D+ I   GA     KT +    + ++ + +K +    ++LD++         Y PK N +S   +  +++     D D      K  K+M V  +E +  +I    K F+ KY V   + T  I  E+++ + SK  G++      N+    V+  GDA+ND  MI  + +GVAM N   + K VA YIT ++N + G+   I K+
  S:     3 KLIALDMDGTLLNNKKTISRENKEAIKAAISKGSKVVLATGRPLKGIEKYL-KELDLINNGDYAIAFNGALVQETKTGKVLYENNMTKEDLKILYKLSKELDVDIHFLTIDECYTPKLNVYSQIETTLNNIPLNIIDFDNVPDHLKIIKIMFVGSEEKITEIIKLVPKEFQEKYNV---VRTASIYLEFLNKDTSKGYGVERLCNILNIDKKEVICAGDAENDIHMIEYAGLGVAMENAYPQVKKVANYIT-KNNEDHGVAQVINKF 264
>gi|168267160|ref|ZP_02689125.1| Cof-like hydrolase [Listeria monocytogenes FSL J2-071] (270 aa)
Score = 192, Expect = 4.6e-13, Identities = 69/258 (26%), Positives = 120/258 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTLL+D+  +  +   +IK  KEKG+   LCTGR    +   LI+   + +  D+ I   GA      + +      L+   +++I       ++N    D   +Y P      I   +   +    + + V         SKVM++   E +  VI +  +S K K+ V   + + P   E++   V+K + L    +   ++   V++ GD +ND  MI  + +GVAM N ++  K +A Y T   NN DG+
  S:     3 KIIAIDIDGTLLNDAHEITPAVRDSIKAAKEKGVKVVLCTGRPLAGIKKSLIE-LDLLDVGDYAITFNGAVVLETASKKTLADITLNKTELEEIYAFCHAENVNVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPASIHVSKVMLLDSPEKITDVIKKLPESIKQKFYV---VRSVPYNLEFLQKGVNKGSALASLAEKLGVSQSEVMSIGDQENDITMIEYAGMGVAMGNATEHIKEIANYTTTT-NNEDGV 259
>gi|144574935|gb|AAZ43454.2| conserved hypothetical protein [Mycoplasma synoviae 53] (456 aa)
Score = 192, Expect = 4.6e-13, Identities = 84/265 (31%), Positives = 136/265 (51%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGA----QFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF---------GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV------DVYLTEPKS----KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           ++I   + DMDGTLL+D   + ES++ AI  +        + TGR  N M +   D   +K   D IIG  GA     + NL  N+ K   +L  ++ K I ++  +  ++F         G   N   +F  ENR   ++   +     Y ++      D    +P      K++++  K+   T++ + K F +K+     L +   + + M  N+SK   L    KD NL+L+N LA GD +ND +M+ N    VAM+N   + K +A  +T  DNNN GI +FI
  S:     9 NKIHAFIFDMDGTLLNDKNQISESNLNAINFLHLNNKKVIIATGR-PNYMNHQYYDALNLK---DAIIGINGAMVDLNWRNL--NQTKVMGYLPKESFKKIASYLNENKIDFLTYHKNSMYGFNYNNPPWF--ENRIYPKIQSDNKYKWNYKEIALEKLYDFLEKKPGEFVFLKILVISQKQSEQTLL-KLKEFLNKFNDLYYLRSQSDVIDIMPLNISKGQTLLDISKDINLSLENALAIGDQENDIEMLKNVAYPVAMLNAKKELKKIAWKVTNLDNNNSGIADFI 287
>gi|15672793|ref|NP_266967.1| hypothetical protein L22687 [Lactococcus lactis subsp. lactis Il1403] >gi|12723733|gb|AAK04909.1|AE006314_7 conserved hypothetical protein [Lactococcus lactis subsp. lactis Il1403] (269 aa)
Score = 192, Expect = 4.7e-13, Identities = 80/267 (29%), Positives = 129/267 (48%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIP----DNGYLYFPKENRHSIRLSEYDHMTA--KYFDVD---VYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +IK++  D+DGTLL+ SK + + + LAI   ++KG+   L TGR    +   L    ++ ++ DF I   G            K SF S D I +I    ++L  N GIP        +Y  K    S    +YD +     +  VD   V L    +K++   +KE +   +++  +S+  ++E+     T   L E+M   ++K  GL   +   NL  +NV+A GD  ND  MI  +  GVAM N     K  A+ I++  N+   + + I KY
  S:     4 EIKLIALDLDGTLLNSSKEISKENRLAINAARQKGVQVVLTTGRPLIAIQPFL-KTLEMLDFEDFSITFNGGLVQRNTGQILSKKSF-SHDEILEI----KELTSNLGIPCDVLSEEKVYMTKSKIDS----QYDTLNKLLTFIKVDFDQVPLDVVYNKIVSCTEKELLDASLDKIPESYFDQFEI---FKTQAKLLEFMPKGINKAYGLTQLINQLNLKPENVMAMGDEANDLSMISWAGYGVAMANAVPAVKEEARIISDLTNDQHAVAHIIEKY 267
>gi|171780071|ref|ZP_02920975.1| hypothetical protein STRINF_01859 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281419|gb|EDT46854.1| hypothetical protein STRINF_01859 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (269 aa)
Score = 192, Expect = 4.8e-13, Identities = 69/259 (26%), Positives = 124/259 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           IK+V  D+DGTLL + + V      A+++ K++G+   + TGR    +   L+++  ++E  D++I   G    +  T E   T  ++ +   DI    + LD++        +Y    N  ++++  S   +M   Y   +    +   K+M + + E +   I +  + F  KY   T + + P   E+M+   SK N +K   +   LT D  +A GDA+ND  M+      V M NG+ + K +A+YIT + N   G+
  S:     3 IKLVAVDIDGTLLTNDRKVTPEVFEAVQEAKKQGVKVIIATGRPIPGV-QPLLNELNLREEGDYVITFNGGLVQDTSTGENIITETMTYEDYLDIEFLSRKLDVHMHAITKKGIYTANRNIGKYTVHESSLVNMPIFYRTPEEMGDKEIIKMMFIDEPEILDAAIKKIPQEFFDKY---TIVKSTPFYLEFMNKKASKGNAIKHLAEKMGLTPDQTMAIGDAENDRTMLEAVGNPVVMENGTPELKEIAKYIT-KSNEESGV 259
>gi|15924321|ref|NP_371855.1| hypothetical protein SAV1331 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926912|ref|NP_374445.1| hypothetical protein SA1167 [Staphylococcus aureus subsp. aureus N315] >gi|148267819|ref|YP_001246762.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH9] >gi|150393881|ref|YP_001316556.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH1] >gi|156979651|ref|YP_001441910.1| hypothetical protein SAHV_1320 [Staphylococcus aureus subsp. aureus Mu3] >gi|13701129|dbj|BAB42424.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247102|dbj|BAB57493.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|147740888|gb|ABQ49186.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH9] >gi|149946333|gb|ABR52269.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH1] >gi|156721786|dbj|BAF78203.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (267 aa)
Score = 192, Expect = 4.8e-13, Identities = 70/262 (26%), Positives = 124/262 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTV----INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           ++  KVVV DMD TLL+    + E +   +  I+++G    L +GR    M     D  K+ E+  +II   G++  N+   E + +  +      +I+++ +D         +G + +  E+ +    +E   +  K  D +  Y+     KVM V   +Y+  +    I+ +  F    +  T   + P   E+M  +VSK N +K        ++D V+AFGD+ ND  M   + + +AM N SD+ K  A  +T  D+N +GI
  S:     1 MTNYKVVVLDMDDTLLNSDNVISEETANYLTAIQDEGYYVVLASGRPTEGMIPTARD-LKLPEHHSYIISYNGSKTINMTNEEVEVSKSIGKQDFDEIVDYCRDRGFFVLTYHDGQIIYDSEHEYMNIEAELTGLPMKRVDDIKAYIQGDVPKVMGV---DYVANITEARIDLNGVFNDNVDATT---SKPFFLEFMAKDVSKGNAIKALCHKLGYSVDQVIAFGDSMNDKSMFEVAGLAIAMGNASDELKQYADEVT-LDHNENGI 259
>gi|24380192|ref|NP_722147.1| hypothetical protein SMU.1830c [Streptococcus mutans UA159] >gi|24378197|gb|AAN59453.1|AE015010_2 conserved hypothetical protein [Streptococcus mutans UA159] (466 aa)
Score = 192, Expect = 5.1e-13, Identities = 76/263 (28%), Positives = 132/263 (50%)
  Q:     2 DISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFL------------------SGDAIKDIINHYQDLDLNFG------IPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           +I  IK V  D+DGTLL+D K V +S+  AI  +K++G+  G+ TGR    +A  + +       +DF I   G   +     L  N+  K++                    SG    +IIN        FG      +P        +  +H +R  +   + +    +   + +P  ++++V  KE    +   +K F       + L +  ++ + M    SK  G+    ++F++ ++ V+AFGD+DND +M+    I VAM N +++ K++A Y T   NNNDGI
  S:     4 NIVAIKAVFFDIDGTLLNDRKQVQKSTQDAIANMKKQGIFVGVATGRGPAFVAPFMENLG-----LDFAITYNGQYIFTRDRILYQNQLPKSTVYRLIKYASEQRREISLGTSSGLVGSNIINMGTS---RFGQWISRMVPKRWTKTITRSFKHVVRRVKPQSLNS----LMTIMRQPIFQIVLVATKEQSDII---AKKFPHLTITRSSLYSADLISKGM----SKIKGVLCVAREFDIEIEEVMAFGDSDNDLEMLSGVGISVAMGNATEQVKTIADYTTAS-NNNDGI 274
>gi|27467930|ref|NP_764567.1| hypothetical protein SE1012 [Staphylococcus epidermidis ATCC 12228] >gi|57866814|ref|YP_188479.1| HAD superfamily hydrolase [Staphylococcus epidermidis RP62A] >gi|27315475|gb|AAO04609.1|AE016747_106 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] >gi|57637472|gb|AAW54260.1| hydrolase, haloacid dehalogenase-like family [Staphylococcus epidermidis RP62A] (268 aa)
Score = 192, Expect = 5.2e-13, Identities = 72/262 (27%), Positives = 126/262 (48%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTA-KYFDVDVYLTEPKSKVMIVCDKEYMPTV----INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           ++Q K+VV DMD TL++    +   +   +  I+++G    L +GR    M      + ++ +Y  FII   G +  N+     +    +S +   +I+++ +D +      DNGY+     + +    S+   +   +  D+  Y+     KVM V   +Y+  +    I     F +  +V T   + P   E+M  NVSK N +K   K   ++L+ V+ FGD+ ND  M   +   VAM N SD+ K +A  +T  DNN++GI
  S:     1 MTQYKMVVLDMDDTLMNSDNKLSIETKSYLLDIQKRGYYVVLASGRPTEGMLPT-ARELELNKYNSFIISYNGGKTINMANENVEVDQPVSKEDFDNIVDYCRDKNFLVLTYDNGYIIHDSSHEYMNIESQLTGLPMNRVADLKEYINHSVPKVMGV---DYVGHITEARIELDGYFNNDIDVTT---SKPFFLEFMAKNVSKGNAIKALCKRLQISLEEVIVFGDSLNDKSMFEVAGYSVAMGNASDELKKIADEVT-LDNNSNGI 259
>gi|125624536|ref|YP_001033019.1| putative hydrolase [Lactococcus lactis subsp. cremoris MG1363] >gi|124493344|emb|CAL98318.1| putative hydrolase [Lactococcus lactis subsp. cremoris MG1363] (269 aa)
Score = 192, Expect = 5.3e-13, Identities = 80/267 (29%), Positives = 129/267 (48%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIP----DNGYLYFPKENRHSIRLSEYDHMTA--KYFDVD---VYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +IK++  D+DGTLL+ SK + + + LAI   ++KG+   L TGR    +   L    ++ ++ DF I   G            K SF S D I +I    ++L  N GIP        +Y  K    S    +YD +     +  VD   V L    +K++   +KE +   +++  +S+  ++E+     T   L E+M   ++K  GL   +   NL  +NV+A GD  ND  MI  +  GVAM N     K  A+ I++  N+   + + I KY
  S:     4 EIKLIALDLDGTLLNSSKEISKENRLAINAARQKGVHVVLTTGRPLIAIQPFL-KTLEMLDFEDFSITFNGGLVQRNTGQILSKKSF-SHDEILEI----KELTSNLGIPCDVLSEEKVYMTKSKIDS----QYDTLNKLLTFIKVDFDQVPLDVVYNKIVSCTEKELLDASLDKIPESYFDQFEI---FKTQAKLLEFMPKGINKAYGLTQLINQLNLKPENVMAMGDEANDLSMISWAGYGVAMANAVPAVKEEARIISDLTNDQHAVAHIIEKY 267
>gi|110799300|ref|YP_695047.1| HAD family hydrolase [Clostridium perfringens ATCC 13124] >gi|168206731|ref|ZP_02632736.1| phosphatase YidA [Clostridium perfringens E str. JGS1987] >gi|168211920|ref|ZP_02637545.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens B str. ATCC 3626] >gi|168214802|ref|ZP_02640427.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens CPE str. F4969] >gi|168217972|ref|ZP_02643597.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens NCTC 8239] >gi|182625756|ref|ZP_02953524.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens D str. JGS1721] >gi|110673947|gb|ABG82934.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens ATCC 13124] >gi|170661826|gb|EDT14509.1| phosphatase YidA [Clostridium perfringens E str. JGS1987] >gi|170710151|gb|EDT22333.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens B str. ATCC 3626] >gi|170713767|gb|EDT25949.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens CPE str. F4969] >gi|177909018|gb|EDT71500.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens D str. JGS1721] >gi|182380010|gb|EDT77489.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens NCTC 8239] (266 aa)
Score = 191, Expect = 5.5e-13, Identities = 71/258 (27%), Positives = 124/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI---RLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K+V  DMDGTLL + K V E +  AIKK +EK +   L TGR  + +   L ++  +    ++++   GA    +  +       L G  +K +    +++ +N     N     PK N+++    R++  +   A Y D+     E   K+M++ + E +   I +    +  YE  T + + P   E++    +K  G+K   +   +  + V+A GDA ND  MI  + +GVAM N  ++ K  A +IT + N  DG+
  S:     3 KLVAIDMDGTLLKEDKTVSEKTKEAIKKAREKNVKVVLATGRPVDGVKRYL-EELDLCHDDEYVLTFNGAIVKEVGPDRVICRDTLKGSDLKYLYEISKNVGVNIHAFSNFGCVTPKMNKYTELEGRINGIEVCEADYNDIKE--DEEIIKIMMIDEPEVLEEGIKKLP--EEVYEKYTVVRSAPYFLEFLSKTCNKGEGVKSLAESLGIKREEVIAIGDAGNDLHMIEYAGLGVAMGNAFEEVKEKADFIT-KSNEEDGV 257
>gi|77409105|ref|ZP_00785820.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae COH1] >gi|77172283|gb|EAO75437.1| hydrolase, haloacid dehalogenase-like family [Streptococcus agalactiae COH1] (274 aa)
Score = 191, Expect = 5.7e-13, Identities = 76/266 (28%), Positives = 124/266 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMT---AKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+DGTL    K V E + +A+K  +EKG+   + TGR    + N+L D   + +  D+ I   G       T +    + ++   ++DI      + L   I   G +Y      H    S+Y H+     ++ +VD     PK    +K++ V D  Y+   I +     K  YE+     +  I+ E M   V K  GL++  K   L    V+A GD  ND  M+  + +GVAM NG  + K+ A+  T  +N+  G+   + KY
  S:     4 IKILALDLDGTLFTTDKKVSEENKVALKAAREKGIKVVITTGRPLKAIGNLLEDLELVSDE-DYSITFNGG-LVQQNTGKILAKTAMTRQEVEDIHEELYQVGLPTDILSEGTVYSIANKGHH---SQY-HLANPLLEFIEVDDLEQVPKDVVYNKIVSVIDATYLDQQIAKLPDRLKVDYEM---FKSRDIILELMPKGVHKAVGLELLTKHLGLDSSQVMAMGDEANDLSMLEWAGLGVAMANGIPEAKATAKATTICNNDESGVAEAVGKY 268
>gi|126699975|ref|YP_001088872.1| putative hydrolase [Clostridium difficile 630] >gi|115251412|emb|CAJ69244.1| putative hydrolase [Clostridium difficile 630] (273 aa)
Score = 191, Expect = 6.0e-13, Identities = 70/265 (26%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPK-SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGT+L+  K +      +I++ K  G    + TGR    +   L+++  + +  D++I   GA    +K+ +      +S D    I N+  +       I     L  P E   ++++  ++ +++  KY   D      K  K+MIV + E +  +I +  K+  +KY   T + + P   E++    +K   LK    + N+ ++N +A GD +ND  MI  + +GVAM N  +  K +A Y+T+  NN +G+   I KY
  S:     3 KLIALDIDGTILNTQKRITPEVFESIQEAKRAGAKVVITTGRPLPGVKE-LLNQLNLTDEGDYVICFNGAIIQEVKSEKIIHDVEMSLDDFDFIYNNVCKKYKTKIHINTMTNLITPNETPGKYTLHEAKLNNIEVKYIQKDKIDESIKICKIMIVDEPERLEEIIQQLPKNLFNKY---TIVRSAPFYLEFLGKTTNKGTALKTLCTNLNIPIENAIAVGDEENDQHMIKYAGLGVAMGNARNSIKEIADYVTDT-NNENGVAKVINKY 267
>gi|156974668|ref|YP_001445575.1| hypothetical protein VIBHAR_02386 [Vibrio harveyi ATCC BAA-1116] >gi|156526262|gb|ABU71348.1| hypothetical protein VIBHAR_02386 [Vibrio harveyi ATCC BAA-1116] (268 aa)
Score = 191, Expect = 6.2e-13, Identities = 71/265 (26%), Positives = 126/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS--------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI K +E G+   L +GR    M + L D+  I    DF++   G+   N+ TNE      + G A K I    ++L          +    ++N      + Y  + AK   +++      +        K M+V +   +  VI       K ++ V   + + P   E+++P+ +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YI E  N+  G+   I K+
  S:     3 KLIALDMDGTLLNSEKVISEENKQAIAKAREAGVTVVLASGRPLEGMQDKL-DELNIDSDKDFVLYYNGSMVKNIGTNEIIHQQIIDGKAAKKIARKARELGAYVHAFSQEHGLITEDN------NPYTDIEAKINGLEITEMNFDALEDDHGIIKAMMVAEPSKLTEVIAALPAELKEEFTV---VQSAPFFLEFLNPSSNKGIGVSAIAEYLGIEAEEVICMGDAENDHHMLEYAGLGIAMANAMEETKRIANYIAES-NDEHGVAKSIEKF 265
>gi|117619343|ref|YP_855015.1| phosphatase YidA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117560750|gb|ABK37698.1| phosphatase YidA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (269 aa)
Score = 191, Expect = 6.3e-13, Identities = 72/265 (27%), Positives = 123/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF-GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS----KVMIVCDKEYM--PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+    +   +  AI   + KG+   L +GR    M+  L++   +    D++I   GA    +      ++  L+G     I     +L +N  G   +  L  P+ + ++   S    M  K  D   + T P      KVM++ D E +  P +         +Y V   + + P   E+M+   +K  G+    +   L    V+A GDA ND+ MI  + +GVAM N +D  K++AQ+ T + N+ DG+   I ++
  S:     3 KLIALDMDGTLLNSQGQISPRTHAAIAAARAKGVTVVLASGRPLEGMSRYLVE-LGLTGQDDYVICYNGALVQQVADQRIIRSQLLTGSDASAIAALADELGVNVHGFSVSRGLISPRVSPYTEHESRLIDMPIKLLD---FATLPADEQILKVMMI-DPEPLLSPAIAKLPAELYQRYTV---VRSAPYFLEFMNKQSNKGTGVAALAEHLGLDASQVIAVGDAGNDHHMIEYAGLGVAMGNATDDIKALAQHTTGR-NDEDGVAQVIERF 265
>gi|163791489|ref|ZP_02185896.1| Cof-like hydrolase [Carnobacterium sp. AT7] >gi|159873254|gb|EDP67351.1| Cof-like hydrolase [Carnobacterium sp. AT7] (297 aa)
Score = 191, Expect = 7.0e-13, Identities = 76/265 (28%), Positives = 130/265 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKI--KEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQ--DLDLNFGIPDNGYLYFPKEN-------RHSIRL-SEYDHMTAKY-FDVDVYLTEPK--------------SKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           IK +  DMDGTLL     +   +   + +++ KG+   L +GR   +   +L D  K+   E+   +I   G   YN++T +  +   L    I ++ + +    ++L +   D  Y Y P E        R  +RL  +Y  M   + +  D     P               +K+ +V D  YM  V +  K+    Y+    + +     E  + N++K N L + +++ N   D V+ FGD++ND  M  N K  VAM N  +  K  A Y T+  +N++GIYN +V+
  S:     3 IKAIACDMDGTLLTSDNKIAPKTFSKLLELQAKGIKLILASGR---SYIRLLPDALKLHMDEHAGLLIDVNGTSIYNVETAKRDRIGLLERSFINELNDFFSLFTVELQYSQDDTIYTYLPDEIYTIKRNIRGEMRLPDDYPWMGGMHGWLCDTRDGYPNQHMVRTLAGTPSFCNKMSVVQDPSYMSFVRDTLKN-HPIYDQYEYVFSDERKMEITNKNITKGNALDLIMEEQNFQQDEVVVFGDSENDISMFKNKKYSVAMGNALNYAKEQANYTTDS-HNHEGIYNMLVR 289
>gi|153833097|ref|ZP_01985764.1| phosphatase YidA [Vibrio harveyi HY01] >gi|148870665|gb|EDL69572.1| phosphatase YidA [Vibrio harveyi HY01] (268 aa)
Score = 190, Expect = 7.1e-13, Identities = 70/265 (26%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS--------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+  K + E +  AI K +E G+   L +GR    M + L D+  I    DF++   G+   N+ TNE      + G A K I    ++L          +    ++N      + Y  + AK   +++      +        K M+V +   +  VI       K ++ V   + + P   E+++P+ +K  G+    +   +  + V+  GDA+ND+ M+  + +G+AM N  ++TK +A YI E  N++ G+   I ++
  S:     3 KLIALDMDGTLLNSEKVISEENKQAIAKAREAGVTVVLASGRPLEGMQDKL-DELNIDSDKDFVLYYNGSMVKNIGTNEIIHQQIIDGKAAKKIARKARELGAYVHAFSQEHGLITEDN------NPYTDIEAKINGLEITEMNFDALEDDHGIIKAMMVAEPSKLTEVIAALPAELKEEFTV---VQSAPFFLEFLNPSSNKGIGVSAIAEYLGIEAEEVICMGDAENDHHMLEYAGLGIAMANAMEETKRIANYIAES-NDDHGVAKSIQRF 265
>gi|168713148|ref|ZP_02745425.1| putative hydrolase [Clostridium difficile QCD-63q42] (273 aa)
Score = 190, Expect = 7.1e-13, Identities = 70/265 (26%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPK-SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGT+L+  K +      +I++ K  G    + TGR    +   L+++  + +  D++I   GA    +K+ +      +S D    I N+  +       I     L  P E   ++++  ++ +++  KY   D      K  K+MIV + E +  +I +  K+  +KY   T + + P   E++    +K   LK    + N+ ++N +A GD +ND  MI  + +GVAM N  +  K +A Y+T+  NN +G+   I KY
  S:     3 KLIALDIDGTILNTQKRITPEVFESIQEAKRAGAKVVITTGRPLPGVKE-LLNQLNLTDEGDYVICFNGAIIQEVKSEKIIHDVEMSLDDFDFIYNNVCKKYKTKIHINTMTNLITPNETPGKYTLHEAKLNNIEVKYIQKDKIDESIKICKIMIVDEPERLEEIIQQLPKNLFNKY---TIVRSAPFYLEFLGKTTNKGTALKTLCMNLNIPIENAIAVGDEENDQHMIKYAGLGVAMGNARNSIKEIADYVTDT-NNENGVAKVINKY 267
>gi|12045121|ref|NP_072932.1| Cof-like hydrolase [Mycoplasma genitalium G37] >gi|66879882|ref|ZP_00404871.1| COG0561: Predicted hydrolases of the HAD superfamily [Mycoplasma genitalium G-37] >gi|1723138|sp|P47507|Y265_MYCGE Uncharacterized protein MG265 >gi|3844861|gb|AAC71487.1| Cof-like hydrolase [Mycoplasma genitalium G37] >gi|166078940|gb|ABY79558.1| Cof-like hydrolase [synthetic Mycoplasma genitalium JCVI-1.0] (278 aa)
Score = 190, Expect = 7.4e-13, Identities = 67/268 (25%), Positives = 128/268 (47%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRD---ANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGI------------PDNGYLYFPKENRHSIRLSEYDHMTAKY---FDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++K ++ D+DGTLL  ++  LE ++  +K +++KG+     +GR      N A  +     +       I   GA  Y+  + +      +    I  I+    +    F               D+  +   +     I L E +++  K+    D D         +++  ++E +P +  +    +    V +         + M  +V+K  GLK+ + ++NL  +  + FGDADND ++  + K  VA++NG+D  K  A++ITE DNN++GIY F+ K+ 
  S:     2 ELKNIIFDLDGTLLSSNQIPLEQTVEFLKDLQKKGIRITFASGRSHILIRNTATFITPNLPV-------ISSNGALVYDFASEKPVHIKPIDNKVIPAIMQMLLEFQETFYFYTDKKVFAFTHELDSAKILSTRSQIVGIDLIENNYIVNKFEKALDFDFKQHTITKILLVTKNREKVPFLAKQLDQIQDINYVSSMTFA----LDIMQKDVNKAYGLKVLVDNYNLDPEKTMVFGDADNDVEIFQSVKWPVALVNGTDLAKKNAKFITEYDNNHNGIYFFLKKFL 276
>gi|169190217|ref|ZP_02850191.1| Cof-like hydrolase [Paenibacillus sp. JDR-2] >gi|169003112|gb|EDS49985.1| Cof-like hydrolase [Paenibacillus sp. JDR-2] (268 aa)
Score = 190, Expect = 7.6e-13, Identities = 74/265 (27%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR---LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYM--------PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+D TLL+D   V E +  A++     G+   L TGR       +     KI + +     II   G+    L   E      +  DA K++    +   L+  +  +  LY  + N  +I+   L+   ++ A+  D +  L +P +K++I+ D  Y+        P + +R    KSK          P   E+MH   +K + L+   +     ++  +A GDA ND++MI  + +GVAM N + K K +A YIT   NN +G+ + I K+
  S:     3 KLIAIDVDDTLLNDDLIVTEGTKKAMEDAIALGVTVTLATGR-------MYASAKKIADQIQLNVPIITYQGSLVKTLLDGEVLYERCVPQDAAKELYAITEQRGLHLQLYADDILYVKEANEKAIKYSTLTNIPYVVAE--DFEALLDKPNNKMLIIDDPAYLDQLAEELKPIIGDRVHITKSK----------PHYLEFMHKEGTKGHALRFMAEHLGCGVEQTIAIGDAWNDHEMIEAAGLGVAMGNATPKLKEIADYIT-LTNNEEGVRHVIEKF 261
>gi|16804736|ref|NP_466221.1| hypothetical protein lmo2699 [Listeria monocytogenes EGD-e] >gi|167213321|ref|ZP_02283628.1| hypothetical protein LmonL_24128 [Listeria monocytogenes LO28] >gi|16412199|emb|CAD00912.1| lmo2699 [Listeria monocytogenes] (279 aa)
Score = 190, Expect = 7.7e-13, Identities = 64/258 (24%), Positives = 117/258 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   +E G+   L +GR    M +V  ++ +++++   ++   GA+  +  TNE      L+ +  K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    SK++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKQISPETKKALITAQENGVKLILASGRPTTGM-HVYAEQLEMEKHHGLLVSYNGAKVVDCATNEELFNQALTVEEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEEINIIQYESRGGNFKLCEKDDLAAFLDYRLSKILTAGDPAYMQK--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|81429247|ref|YP_396248.1| HAD superfamily hydrolase [Lactobacillus sakei subsp. sakei 23K] >gi|78610890|emb|CAI55942.1| Hydrolase, haloacid dehalogenase family [Lactobacillus sakei subsp. sakei 23K] (273 aa)
Score = 190, Expect = 8.3e-13, Identities = 73/266 (27%), Positives = 128/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVD-VYLTEPKSKVMIVCDKEYMPTVINRSKS-----FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDN-NNDGIYNFIVKY 271
           IK+V  DMDGTLL+++  +   +I  +K  K +G+   LCTGR    +   L  +  + +  D++I   GA   N  T E      L+     ++    + + ++    D+ ++Y    +   ++I  S   +M  K+  VD +   +  SKVM++ D    P V+   K+     F  +Y+    + + P   E ++    K NGL+      N+    V+A GD  ND  M+  + + VAM N   + K +A+ IT+ ++   DG+   I KY
  S:     3 IKLVAVDMDGTLLNENNVLSPKTIEVVKAAKAQGIKVVLCTGRPLTGVTPFL-HELGLTDSSDYVITFNGALVQNTATGEILVRHTLTHAQYLELETLSRTIGVHLHAEDDQFIYTANRDISPYTIGESALVNMPIKFRHVDEIAPDKAFSKVMLIDD----PEVLAEGKAKIPADFFDRYQF---VQSEPYFLEVLNTKAGKGNGLRDLANALNIDQSEVMAVGDQGNDLSMLAYAGLPVAMDNAIPELKKIAKVITKSNHLGQDGVAYAIEKY 269
>gi|169342357|ref|ZP_02863424.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens C str. JGS1495] >gi|169299582|gb|EDS81645.1| HAD-superfamily hydrolase, subfamily IIB [Clostridium perfringens C str. JGS1495] (266 aa)
Score = 190, Expect = 8.4e-13, Identities = 71/258 (27%), Positives = 123/258 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI---RLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K+V  DMDGTLL + K V E +  AIKK +EK +   L TGR  + +   L ++  +    ++++   GA    +  +       L G  +K +    ++  +N     N     PK N+++    R++  +   A Y D+     E   K+M++ + E +   I +    +  YE  T + + P   E++    +K  G+K   +   +  + V+A GDA ND  MI  + +GVAM N  ++ K  A +IT + N  DG+
  S:     3 KLVAIDMDGTLLKEDKTVSEKTKEAIKKAREKNVKVVLATGRPVDGVKRYL-EELDLCHDDEYVLTFNGAIVKEVGPDRVICRDTLKGSDLKYLYEVSKNAGVNIHAFSNFGCVTPKMNKYTELEGRINGIEVCEADYNDIKE--DEEIIKIMMIDEPEVLEEGIKKLP--EEVYEKYTVVRSAPYFLEFLSKTCNKGEGVKSLAESLGIKREEVIAIGDAGNDLHMIEYAGLGVAMGNAFEEVKEKADFIT-KSNEEDGV 257
>gi|116871554|ref|YP_848335.1| Cof-like hydrolase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740432|emb|CAK19552.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (270 aa)
Score = 190, Expect = 8.5e-13, Identities = 70/262 (26%), Positives = 119/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++  D+DGTLL+D+  +  +   +IK  KEKG+   LCTGR    +   LI+   + E  D+ I   GA      + +      L+   +++I       ++N    D   +Y P      I   +   +    + + V         SK+M++   E +  VI +   + K K+ V   + + P   E++   V+K + L        +    V++ GD +ND  MI  + +GVAM N ++  K +A Y T   NN DG+ N I
  S:     3 KIIAIDIDGTLLNDAHKITPAVRDSIKAAKEKGVKVVLCTGRPLAGIKKSLIE-LDLLEAGDYAITFNGAVVLETASEKTLADITLNKAELEEIYAFCHAENVNVTYFDGKNMYVPSRKITEITCQDSLLLQTPLYHLPVEEAPDSIHVSKIMLLDSPEKITDVIKKLPDTIKEKFYV---VRSVPYNLEFLQKGVNKGSALASLASKLGVKQSEVMSIGDQENDTTMIEYAGMGVAMGNATEHIKEIANYTTTT-NNEDGVANAI 263
>gi|70944030|ref|XP_741991.1| hypothetical protein PC000383.00.0 [Plasmodium chabaudi chabaudi] >gi|56520718|emb|CAH74869.1| conserved hypothetical protein [Plasmodium chabaudi] (290 aa)
Score = 190, Expect = 8.8e-13, Identities = 77/263 (29%), Positives = 131/263 (49%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE-----------------PKSKV---MIVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYN 266
           + IK+V  D+DGTLL+D     + +I ++ K + KG+   + TGR   + AN +I +   K  +  + G        +  N C       G   ++II++Y D  L   I +     F KEN    R+  Y    A  F+++ Y+ E                  K+K+   +I  DKE + +VI   +  F  +  V     T     E  HPN +K  G+K   K F+++L++ LA GD DND +M+   +  +++ N   + K  A+Y+    NN+D +++
  S:    21 NNIKIVFIDLDGTLLNDRHKASKLNIESLAKAQNKGIKIAISTGRPMFS-ANGVIGEDAKKNNLSLMPG--------IYLNGC----VTYGPNGENIIDNYMDEKLVMDIYN-----FSKENNLLRRMIWYSSEKAYAFEINEYIYEYLAVEPIMPDIIDEETLKKTKIYQILIRLDKENLSSVIKMYQDKFSDRISVANSFKT---YMELFHPNTNKFEGVKALCKHFDISLNDALAIGDGDNDIEMLQGVETSISVQNAPSEIKECAKYVAPS-NNDDAVHH 282
>gi|77973768|ref|ZP_00829313.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia frederiksenii ATCC 33641] (269 aa)
Score = 189, Expect = 9.7e-13, Identities = 72/266 (27%), Positives = 118/266 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    V      AI   +EKG+   L TGR    +   L  +  ++   D+ I   GA      T EC     +S D  +      +++ ++F   D   LY       K   H + L+          ++D  L  PK  VM++ + E +   +    +    +E  T + + P   E +   V K  G+K+  +   +   N++A GD  ND  M+  + +GVAM N   + K +AQ++T   N  DG+   I KY
  S:     3 IELIAIDMDGTLLNPQHEVTPRVKQAITAAREKGVCVVLATGRPYIGVQRYL-RELNMEGSGDYCITNNGALVQKAATGECILQETISFDDYRYFEALSREMGVSFQAFDFDTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPK--VMMIDEPEKLDRALEMMPA--EAFERFTIMKSAPFYLEILSKRVDKGTGVKMLAEHLGIAQANIMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQFVTGT-NTEDGVAMAIEKY 267
>gi|188589532|ref|YP_001922326.1| phosphatase YidA [Clostridium botulinum E3 str. Alaska E43] >gi|188499813|gb|ACD52949.1| phosphatase YidA [Clostridium botulinum E3 str. Alaska E43] (275 aa)
Score = 189, Expect = 1.0e-12, Identities = 80/265 (30%), Positives = 131/265 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQ--DLDLNFGIPDNGYLYFPKENRHSIRLSE---YDHMTAKYF---DVDVYLTEPKSKVM-IVC-DKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+   ++ E +  A+KK  +KG+   + TGR    A+  A ++  K  +       I C GA   N  TNE    + L+ + +  I N  +  +  + +   D   +  P    H+  L+     D    K+F   D++  L    +K++ ++C D       + + K    K+     + +G   FE M  +VSK +  KI  +   +  + V+  GD +ND  MI  + +GVAM NGSD  K +A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNGHSSISERNKDALKKAVDKGVQVAISTGRIFASADYFAELIGIKTDL-------ISCNGAYIKNRSTNEVIYNNTLTNEQVLKIHNSIKGHNFRIMYYTHDTAIVDSPFPENHTYNLTNKLVSDEKKVKFFVTSDINKILEIYSNKIIKVICIDDSDDKDTLFKVKDNLLKFSDIETVSSGDNNFEIMQKDVSKGHAAKILSEKLGIKPEEVICIGDNENDLSMIKFAGLGVAMGNGSDVVKKIANYITDT-NVNDGVAKVIEKF 273
>gi|116511627|ref|YP_808843.1| HAD superfamily hydrolase [Lactococcus lactis subsp. cremoris SK11] >gi|116107281|gb|ABJ72421.1| Predicted hydrolase of the HAD superfamily [Lactococcus lactis subsp. cremoris SK11] (281 aa)
Score = 189, Expect = 1.0e-12, Identities = 78/267 (29%), Positives = 129/267 (48%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIP----DNGYLYFPKENRHSIRLSEYDHMTA--KYFDVD---VYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +IK++  D+DGTLL+ SK + + + LAI   ++KG+   L TGR    +   L    ++ ++ DF I   G            K SF + D I +I    ++L    GIP        +Y  K +     +S+YD +     +  VD   V L    +K++   DKE +   +++  +S+  ++E+     T   L E+M   ++K  GL       NL  +NV+A GD  ND  MI  +  GVAM N     K  A+ I++  N+   + + I +Y
  S:    16 EIKLIALDLDGTLLNSSKEISKENRLAIDAARQKGVHVVLTTGRPLIAIQPFL-KTLEMLDFEDFSITFNGGLVQRNTGQILSKKSF-THDEILEI----KELTTKLGIPCDVLSEEKVYMTKSDV----VSQYDTLNKLLTFIKVDFDQVTLDVVYNKIVSCTDKELLDAQLSKIPESYFEEFEI---FKTQAKLLEFMPKGINKAYGLTQLTNQLNLGAENVMAMGDEANDLSMISWAGYGVAMANAVPAVKEEARIISDLTNDQHAVAHMIERY 279
>gi|168696961|ref|ZP_02729238.1| putative hydrolase [Clostridium difficile QCD-37x79] >gi|168723790|ref|ZP_02756067.1| putative hydrolase [Clostridium difficile QCD-76w55] >gi|168729904|ref|ZP_02762181.1| putative hydrolase [Clostridium difficile QCD-97b34] >gi|196159309|ref|ZP_03119870.1| putative hydrolase [Clostridium difficile CIP 107932] (273 aa)
Score = 189, Expect = 1.1e-12, Identities = 69/265 (26%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKE--NRHSIRLSEYDHMTAKYFDVDVYLTEPK-SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGT+L+  K +      +I++ K  G    + TGR    +   L+++  + +  D++I   GA    +K+ +      ++ D    I N+  +       I     L  P E   ++++  ++ +++  KY   D      K  K+MIV + E +  +I +  K+  +KY   T + + P   E++    +K   LK    + N+ ++N +A GD +ND  MI  + +GVAM N  +  K +A Y+T+  NN +G+   I KY
  S:     3 KLIALDIDGTILNTQKRITPEVFESIQEAKRAGAKVVITTGRPLPGVKE-LLNQLNLTDEGDYVICFNGAIIQEVKSEKIIHDVEMTLDDFDFIYNNVCKKYKTKIHINTMTNLITPNEAPGKYTLHEAKLNNIEVKYIQKDKIDESIKICKIMIVDEPERLEEIIQQLPKNLFNKY---TIVRSAPFYLEFLGKTTNKGTALKTLCTNLNIPIENAIAVGDEENDQHMIKYAGLGVAMGNARNSIKEIADYVTDT-NNENGVAKVINKY 267
>gi|31711539|gb|AAN78112.1| PC8B [Plasmodium chabaudi chabaudi] (390 aa)
Score = 189, Expect = 1.1e-12, Identities = 77/263 (29%), Positives = 131/263 (49%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE-----------------PKSKV---MIVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYN 266
           + IK+V  D+DGTLL+D     + +I ++ K + KG+   + TGR   + AN +I +   K  +  + G        +  N C       G   ++II++Y D  L   I +     F KEN    R+  Y    A  F+++ Y+ E                  K+K+   +I  DKE + +VI   +  F  +  V     T     E  HPN +K  G+K   K F+++L++ LA GD DND +M+   +  +++ N   + K  A+Y+    NN+D +++
  S:   121 NNIKIVFIDLDGTLLNDRHKASKLNIESLAKAQNKGIKIAISTGRPMFS-ANGVIGEDAKKNNLSLMPG--------IYLNGC----VTYGPNGENIIDNYMDEKLVMDIYN-----FSKENNLLRRMIWYSSEKAYAFEINEYIYEYLAVEPIMPDIIDEETLKKTKIYQILIRLDKENLSSVIKMYQDKFSDRISVANSFKT---YMELFHPNTNKFEGVKALCKHFDISLNDALAIGDGDNDIEMLQGVETSISVQNAPSEIKECAKYVAPS-NNDDAVHH 382
>gi|196127607|ref|ZP_03119356.1| putative hydrolase [Clostridium difficile ATCC 43255] (273 aa)
Score = 189, Expect = 1.1e-12, Identities = 69/265 (26%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPK-SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGT+L+  K +      +I++ K  G    + TGR    +   L+++  + +  D++I   GA    +K+ +      ++ D    I N+  +       I     L  P E   ++++  ++ +++  KY   D      K  K+MIV + E +  +I +  K+  +KY   T + + P   E++    +K   LK    + N+ ++N +A GD +ND  MI  + +GVAM N  +  K +A Y+T+  NN +G+   I KY
  S:     3 KLIALDIDGTILNTQKRITPEVFESIQEAKRAGAKVVITTGRPLPGVKE-LLNQLNLTDEGDYVICFNGAIIQEVKSEKIIHDVEMTLDDFDFIYNNVCKKYKTKIHINTMTNLITPNETPGKYTLHEAKLNNIEVKYIQKDKIDESIKICKIMIVDEPERLEEIIQQLPKNLFNKY---TIVRSAPFYLEFLGKTTNKGTALKTLCTNLNIPIENAIAVGDEENDQHMIKYAGLGVAMGNARNSIKEIADYVTDT-NNENGVAKVINKY 267
>gi|123442892|ref|YP_001006867.1| putative haloacid dehalogenase-like hydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122089853|emb|CAL12709.1| putative haloacid dehalogenase-like hydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] (269 aa)
Score = 188, Expect = 1.2e-12, Identities = 67/258 (25%), Positives = 126/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI--RLSEYDHMTAKYFDVDVYLTEPKS--------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTLL+    +   +I A+K++  +     LC+ R    +A V I   +++  + + I   GA  Y+    +  +   L    +K++I    + +         + +F ++N  S    ++++ H  ++ F +++   EPK         KV IV   +++  V N+  + F  +Y +     T    +E M   ++K   L    +  N+   +V++ GD +ND  M   S +GVAM N SD  KS A  ++ QDNN+ G+
  S:     3 KLLALDLDGTLLNQENQISAQNINAVKRVIHQHGTVVLCSARPVRAIAAV-IRNTELEYLIRYFISFNGAWIYDAVEKKDIRFMPLRRLDVKNVITMLAENEFK-------HHFFTRDNMISSLKDINDHTHYESQLFAMELAFVEPKDIIQRDDIVKVSIVGSTDFIDNVANKIDERFHCQYSLSK---TSRHYYEIMRQGITKGEALHYLSRHLNIGSQSVVSMGDQENDISMFQFSAVGVAMGNASDFVKSCADKVS-QDNNHHGV 259
>gi|168185559|ref|ZP_02620194.1| phosphatase YidA [Clostridium botulinum C str. Eklund] >gi|169296377|gb|EDS78510.1| phosphatase YidA [Clostridium botulinum C str. Eklund] (270 aa)
Score = 188, Expect = 1.3e-12, Identities = 72/265 (27%), Positives = 123/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHS-----IRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMD TLLD SK +   +  AI K  +KG+   L TGR  + ++  L  +  +    ++ + C GA   N  T+E    + L  D +  + N  + L +            PK N+ +     +   EY+ M     D  V +     K++ V  KE + +++N     K  YE  T + +     E+++  ++K  G++   +   +  D ++  GDA+ND  MI  + +GVAM N     K  A YIT   N+  G+ + I K+
  S:     3 KLIALDMDNTLLDSSKLITTKNKTAINKASKKGVKVVLATGRFISGISKYL-KELDLDNKDNYCVTCNGAIVVNAGTHEIISKTLLEYDDLCYLYNLSRKLGVYVHALTADKCIVPKYNKFTAIEIGMNQVEYEEMPFSELDQSVEII----KILFVGPKEQIASIMNNLP--KEVYEKYTVMRSHDNFLEFLNKKINKGFGVQCLGEKLGINKDEIICVGDAENDLHMIEYAGLGVAMENAFPDVKKAADYIT-YTNDESGVAHVINKF 264
>gi|184154860|ref|YP_001843200.1| hypothetical protein LAF_0384 [Lactobacillus fermentum IFO 3956] >gi|183226204|dbj|BAG26720.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956] (275 aa)
Score = 188, Expect = 1.3e-12, Identities = 71/266 (26%), Positives = 132/266 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAI-------------KDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSE--YDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  D+D TLL++ K +  ++   ++ + E+G+   LCTGR  N + + LI++  +    DF I   G    N ++ E    + LS + +              D+++  Q  +++   PD+  LY  ++   +IR  +  ++ + A   +  VY     +K ++    E MP V +   +     +    + + P + E++     K  G+K  L  F L   +++AFGDADND  M+  +  GV M NG    K++A + T   N  DG+  ++ K F
  S:     6 KMIALDLDNTLLNNQKEISPANTKILRCLHEQGIKVVLCTGRPINAIWH-LIEQLDLTRPDDFTITFNGGLVINNQSREALYQNGLSKEDLVPVHDFMAARRLPMDVLDFEQIYEID---PDHRSLY--QQTVKNIRFEDTTFEQLAA---EDHVY-----AKNVMAIPAEEMPAVKSEVLATDRITKRVQVVQSQPHILEFLPQGSDKAVGIKHLLNHFGLDFADLMAFGDADNDAGMLKAAGDGVVMANGLPAVKAIADHETAS-NEEDGVARYLTKTF 271
>gi|168179020|ref|ZP_02613684.1| HAD hydrolase, IIB family [Clostridium botulinum NCTC 2916] >gi|182670095|gb|EDT82071.1| HAD hydrolase, IIB family [Clostridium botulinum NCTC 2916] (268 aa)
Score = 188, Expect = 1.4e-12, Identities = 75/265 (28%), Positives = 126/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++ K + + +  AIK    KG    L TGR    +   L  +  +    D+ I   GA     KT +    + ++ + +K +    ++LD++         Y PK N +S   +  +++     D D      K  K+M V  +E +  +I    K F+ KY V   + T  I  E+++ + SK  G++      ++    V+  GDA+ND  MI  + +GVAM N   + K VA YIT ++N + G+   I K+
  S:     3 KLIALDMDGTLLNNKKTISKENKEAIKAAISKGSKVVLATGRPLKGIEKYL-KELDLINNGDYAIAFNGALVQETKTGKVLYENNMTKEDLKILYKLSKELDVDIHFLTIDECYTPKLNVYSQIETTLNNIPLNIIDFDNVPDHLKIIKIMFVGSEEKITEIIKLVPKEFQEKYNV---VRTASIYLEFLNKDTSKGYGVERLCNILSIDKKEVICAGDAENDIHMIEYAGLGVAMENAYPQVKKVANYIT-KNNEDHGVAQVINKF 264
>gi|77977487|ref|ZP_00832934.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia intermedia ATCC 29909] (269 aa)
Score = 188, Expect = 1.5e-12, Identities = 66/258 (25%), Positives = 122/258 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRH--SIRLSEYDHMTAKYFDVDVYLTEPK--------SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTLLD    +   +I AIK+I ++  +  LC+ R    +A V+ +  +++  + + I   GA  Y+       + + LS   ++  I    +           + +F + N    S  +S Y    +  F +++   EP          K+ +V   +++  + N+  + F  +Y +     T    +E M   ++K + L    +  N++   V++ GD +ND  M   S +GVAM N SD  KS A  ++ QDNN  G+
  S:     3 KLLALDLDGTLLDKENQISAQNINAIKRIIQQHCMVVLCSARPVKAIAAVIYNT-ELEHLIRYFISFNGAWIYDAVERADIRFTPLSRKEVQTAIAMLAENQFP-------HHFFTRTNMMICSPNISYYTRYESDIFAMEIVFAEPAYIAQRDDIVKISMVGSTDFIDNIANKIDEQFHLQYSLSK---TSNHYYEIMKHGINKGDALHYLSQHLNISAQAVVSIGDQENDISMFQFSAVGVAMGNASDYVKSCADRVS-QDNNQHGV 259
>gi|148978760|ref|ZP_01815140.1| Predicted hydrolase of the HAD superfamily protein [Vibrionales bacterium SWAT-3] >gi|145962181|gb|EDK27465.1| Predicted hydrolase of the HAD superfamily protein [Vibrionales bacterium SWAT-3] (275 aa)
Score = 188, Expect = 1.5e-12, Identities = 73/267 (27%), Positives = 131/267 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD---------VYLTEPKSKVMIVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQD----NNNDGIYNFIVKYF 272
           +K+V SD+DGTLL  +  + E + L +KK+ E+G  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +  + ++ +I+   QD ++   +  N      +E+    +       + K F+ D         V+ T P+       D EY+ T   + K +F  K  V     + P   E M   VSK + L    K  NLTLDN +AFGD  ND +M+  +  G  +I G+   K V Q + + +    N +D + +++ K+ 
  S:    10 VKIVASDLDGTLLAPNHQLSEFTKLTLKKLHEQGYTFIFATGRHHVDVAGIR----QIAGIPAYMITSNGARVHD-QNDQLMYSQNVPQELVQPVIDIVRQDPNIFIHMYQNEDWLLDREDEMLAKFHSESGFSYKRFEADNAPNDGIAKVFFTHPEQ------DHEYLVTFEQKLKEAFGDKLNVA---FSTPWCLEVMAAEVSKGHALDAVAKSLNLTLDNCVAFGDGMNDAEML--AMAGKGLIMGTSHEK-VMQALPDNEVIGSNADDAVAHYLEKHL 274
>gi|29377552|ref|NP_816706.1| HAD superfamily hydrolase [Enterococcus faecalis V583] >gi|29345019|gb|AAO82776.1| hydrolase, haloacid dehalogenase-like family [Enterococcus faecalis V583] (275 aa)
Score = 187, Expect = 1.6e-12, Identities = 70/266 (26%), Positives = 128/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGI-PDNGYLYFPKE-NRHSIRLSEYDHMTAKYFDVDVYLTEPK--SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL+  K +   +  A+   K+ G+   +CTGR    +   L ++  +++  D+ I   G       T    + + +  +AI ++      L++ F +  D   +  P   N  SI  S    +T + + ++  LT  +  +KV++  D+ Y+   I     SF  ++E+   + T   L E+M   ++K  G+ +  KD  +  + ++  GD +ND  MI  + +GVAM N     K  A  +T+  N+ DG+   + KY
  S:     2 IKLVAIDLDGTLLNSQKEISLRNKQALMAAKQAGVKVVICTGRPLAAIGPYL-EELGLQDEGDYSITFNGGLVQKNDTGAIIEKTLMPLEAIHELYQLATTLNMPFDVLSDEVVMQLPSAPNYPSIYSSLNKLLTFESYKLE-ELTPNRIYNKVVVAIDEAYLNERIKEIPASFYERFEI---IKTRNNLLEFMPKGITKAYGISLLAKDLGIRAEEIMTLGDEENDLPMIEYAGLGVAMANAIPLVKEAADVVTDT-NDQDGVAKAVEKY 266
>gi|170022267|ref|YP_001718772.1| Cof-like hydrolase [Yersinia pseudotuberculosis YPIII] >gi|169748801|gb|ACA66319.1| Cof-like hydrolase [Yersinia pseudotuberculosis YPIII] (269 aa)
Score = 187, Expect = 1.7e-12, Identities = 73/266 (27%), Positives = 117/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     LS +         ++L ++F   D   LY       K   H + L+          ++D  L  PK  VM++ + E +   +    +    +E  T + + P   E +   V K  G+K+  +   +  +NV+A GD  ND  M+  + +GVAM N   + K +AQY+T   N  DG+   I KY
  S:     3 IELIAIDMDGTLLNPQHEITPRVKQAIAAARAKGVCVVLATGRPYIGVQRYL-RELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRELGVSFQAFDFNTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPK--VMMIDEPERLDRALAMMPA--EVFERFTIMKSAPFYLEILSKRVDKGTGVKMLAEHLGIAQENVMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQYVTGT-NCEDGVATAIEKY 267
>gi|196166106|ref|ZP_03126637.1| putative hydrolase [Clostridium difficile QCD-23m63] (273 aa)
Score = 187, Expect = 1.7e-12, Identities = 69/265 (26%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPK-SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGT+L+  K +      +I++ K  G    + TGR    +   L+++  + +  D++I   GA    +K+ +      ++ D    I N+  +       I     L  P E   ++++  ++ + +  KY   D      K  K+MIV + E +  +I +  K+  +KY   T + + P   E++    +K   LK    + N+ ++N +A GD +ND  MI  + +GVAM N  +  K +A Y+T+  NN +G+   I KY
  S:     3 KLIALDIDGTILNTQKRITPEVFESIQEAKRAGAKVVITTGRPLPGVKE-LLNQLNLTDEGDYVICFNGAIIQEVKSEKIIHDVEMTLDDFDFIYNNVCKKYKTKIHINTMTNLITPNETPGKYTLHEAKLNDIEVKYIQKDKIDESIKICKIMIVDEPEKLEEIIQQLPKNLFNKY---TIVRSAPFYLEFLGKTTNKGTALKTLCANLNIPIENAIAVGDEENDQHMIKYAGLGVAMGNARNSIKEIADYVTDT-NNENGVAKVINKY 267
>gi|172058891|ref|YP_001815351.1| Cof-like hydrolase [Exiguobacterium sibiricum 255-15] >gi|171991412|gb|ACB62334.1| Cof-like hydrolase [Exiguobacterium sibiricum 255-15] (268 aa)
Score = 187, Expect = 1.8e-12, Identities = 70/265 (26%), Positives = 121/265 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY----LYFPKENRHSI---RLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG---PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +++V D+D TLL     +   +  ++   + +G    L +GR    M + L  + ++  Y  +I+   GA   + KTNE    S  S   + + ++   DL     I  + Y    ++  + N  S     L+  D +T    D    +TEP  K +++ ++  +  V       K + E+   L      P   E+    V+K   L +  +   +   +V+A GD +ND  MI  + +GVAM N +D  K  AQY+T   N+ DGI   I K+
  S:     4 EMIVLDLDDTLLTSDHTISPKTKQSLLDAQRRGKKVVLASGRPTYAMID-LAKELELARYGSYILSFNGASIIDCKTNE----SLFSSTLLPETVHRLYDLSKRENIDIHTYVGHEIFTERANEFSTIEGELTGMDVITVP--DFKAAITEPVVKCLMLAEENRLAEV-----ELKLQLELAGELAVARSKPFFLEFTEAGVTKGTSLALLAERLGIKQADVIACGDGNNDLSMIEWAGLGVAMANAADTVKEKAQYMTAS-NDEDGIALVIEKF 265
>gi|57899484|dbj|BAD86945.1| haloacid dehalogenase-like hydrolase-like [Oryza sativa Japonica Group] (593 aa)
Score = 187, Expect = 1.8e-12, Identities = 74/267 (27%), Positives = 125/267 (46%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR------DANNMANVLIDKWKIKEYVD-------FIIGCGGAQFY--NLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG--PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           + K +  DMDGTLL+    V   +  A+++ + +G+   + TG+      DA NM ++      + E           + G  G + Y  NL    C++    S +    ++   QD   + +  P    L++      +  +S  D +           T    KV+ +   E + + +   + F  K   G   V    P + E + P  SK NG+KI L    ++ D V+A GD +ND +M+  + +GVA+ NGS+KTK+VA  I    N+ DG+   I  Y
  S:   320 KFKYIFCDMDGTLLNSKSQVTARNAEALREARSRGVNIVIATGKARPAVIDALNMVDLSGRTGIVSESSPGIFLQGLLVYGLQGREIYKRNLDQEVCREALLYSLEQKVPLVAFSQDRCFSMYDDPLVDSLHYVYHEPKAEIVSSIDQLLG---------TAEIQKVLFLETPEGISSAL---RPFWEKAIEGRARVVQAQPDMLELVPPATSKGNGVKILLDHLCISPDEVMAIGDGENDIEMLQLASLGVALANGSEKTKAVANIIGAT-NDEDGVAQAIYDY 591
>gi|188535558|ref|YP_001909355.1| Putative haloacid dehalogenase-like hydrolase [Erwinia tasmaniensis] >gi|188030600|emb|CAO98495.1| Putative haloacid dehalogenase-like hydrolase [Erwinia tasmaniensis] (269 aa)
Score = 186, Expect = 2.1e-12, Identities = 78/266 (29%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENR----HSIRLSEYDHMTAK----------------------YFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL+    +      AI+  ++KG+   L TGR    +   L  +  +++   + I   GA        EC          + ++   ++D           YLYF + +R    H   LS+ +  TA                         ++D  LT PK  VM++   E +   I R       +Y   T + + P   E +   V+K  G+++  +   L+ D V+A GD +ND  M+  +  GVAM NG DK K+VAQ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLNPQHEITPRVRQAIQTARDKGVAVVLATGRPFIGVQRYL-QELGLQQEGQYCITNNGALVQQAADGEC----------VAEVALTFED-----------YLYFEQLSRTLGVHFQALSKTELFTANKDISEYTVHESWMTGIPLRHRSVSEMDRNLTFPK--VMMIDPPELLDAAIARIPHEALQRY---TIMKSSPYYLEILDKRVNKGAGVRLLAERLKLSSDEVMAIGDQENDLAMLEYAGTGVAMGNGIDKVKAVAQFVT-KTNAEDGVAWAIEKF 267
>gi|18309595|ref|NP_561529.1| hypothetical protein CPE0613 [Clostridium perfringens str. 13] >gi|18144272|dbj|BAB80319.1| conserved hypothetical protein [Clostridium perfringens str. 13] (266 aa)
Score = 186, Expect = 2.2e-12, Identities = 70/258 (27%), Positives = 123/258 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI---RLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K+V  DMDGTLL + K V E +  AIK  +EK +   L TGR  + +   L ++  +    ++++   GA    +  +       L G  +K +    +++ +N     N     PK N+++    R++  +   A Y D+     E   K+M++ + E +   I +    +  YE  T + + P   E++    +K  G+K   +   +  + V+A GDA ND  MI  + +GVAM N  ++ K  A +IT + N  DG+
  S:     3 KLVAIDMDGTLLKEDKTVSEKTKEAIKNAREKNVKVVLATGRPVDGVKRYL-EELDLCHDDEYVLTFNGAIVKEVGPDRVICRDTLKGSDLKYLYEISKNVGVNIHAFSNFGCVTPKMNKYTELEGRINGIEVCEADYNDIKE--DEEIIKIMMIDEPEVLEEGIKKLP--EEVYEKYTVVRSAPYFLEFLSKTCNKGEGVKSLAESLGIKREEVIAIGDAGNDLHMIEYAGLGVAMGNAFEEVKEKADFIT-KSNEEDGV 257
>gi|171778107|ref|ZP_02919364.1| hypothetical protein STRINF_00199 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283089|gb|EDT48513.1| hypothetical protein STRINF_00199 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (270 aa)
Score = 186, Expect = 2.3e-12, Identities = 74/265 (27%), Positives = 129/265 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSG---DAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD--VYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVG-----TPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNN---NDGIYNFIVK 270
           IK++  D+DGTLL+  K + E ++ AI+K  + G+   LCTGR  + +     +K  + +  ++II   G   YN K  E    + ++    D + + + +Y D+ L       G  ++         L +YD      FD    V L E K+   I+    YM     +  SF+   E+      + + +   +FE M    +K   LK   +    + + V+A GDA ND +M+  +   VAM N +D+ KS+ +Y T  ++N      IY++++K
  S:     2 IKLIAIDLDGTLLNSDKKIPEENVKAIQKAAQAGVKIVLCTGRPKSGILP-FFEKLGLGDE-EYIIMNNGCTIYNTKNWELVFHAQVTNEELDKLNEAVANYPDVCLTL----TGEKHYYAVGEEVPELVQYD--AGLVFDNAHAVTLDEMKATDEIIFQAMYMAKA-PQLNSFQEAKEIALAKDFSVVRSQEYIFEAMPKGYTKATALKALSEKLGFSPEQVMALGDAANDLEMLEFAYHSVAMGNATDEVKSICRYETTTNDNAGVAQAIYDYVLK 270
>gi|152969413|ref|YP_001334522.1| hypothetical protein KPN_00856 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954262|gb|ABR76292.1| conserved protein, phophatase-like domain [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (271 aa)
Score = 186, Expect = 2.3e-12, Identities = 70/263 (26%), Positives = 128/263 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K       LA   +++++G+ F + +G     + +   +   I+E + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   PD       K      R+S+Y  +    F   + L  P S++  + DK ++           S   +  P+ +G    + + P + K NG+   LK ++L+    +A GD+ ND +M+   K   AM N +D  K++A Y T+ DNN+DG  N I
  S:     3 VKVIVTDMDGTFLNDAKQYDRPRFLAQFAQLRQQGIEFVVASGNQYYQLISFFPE---IREQISFVAENGALVYEHGKQLFHGELTR-HESQVVIGELLKDPQLNFVACGLQSAYVSDKAPDAFVELMSKHYHRLQRVSDYHAIDDTLFKFSLNL--PDSEIPQLIDKLHV-----------SLDGIMKPVTSGFGFVDLIIPGLHKANGISRLLKRWDLSPQQCVAIGDSGNDAEMLKLVKYAFAMGNAADSIKAIAGYATD-DNNHDGALNVI 259
>gi|150005755|ref|YP_001300499.1| haloacid dehalogenase-like hydrolase [Bacteroides vulgatus ATCC 8482] >gi|149934179|gb|ABR40877.1| haloacid dehalogenase-like hydrolase [Bacteroides vulgatus ATCC 8482] (268 aa)
Score = 186, Expect = 2.3e-12, Identities = 72/265 (27%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY--FPKENRHSIRLSEYDHMTAKYFDVDVYLTE---PKSKVMIV--------CDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++V D+DGTL +  K V E +   + + +E+G+   L +GR    +A  L +  ++++Y  +I+   G +  + KT E    + L  D +  +     D        D  Y+   +P E+ + ++ +  + MT K   VD +L     P +K +IV         +KE    + +R   F+S+          P   E +   + K   L + LK+  +T + ++A GD  ND  MI  + +GVAM N  +  +  A YIT   N  DG+   + K+
  S:     4 KLLVLDLDGTLTNQKKEVTEHTRRTLIEAQERGVKIVLASGRPTYGVAP-LAEILELQKYEGYILSYNGGEIIDWKTGEMMYENVLDPDILPYLYKCATDNHFAIVTYDGKYVLTEYP-EDEYVLKEAILNVMTPK--KVDHFLEAIKFPIAKCLIVGEPTRLAVLEKEMYEHLKDRMGVFRSE----------PYFLELVPKGIDKAQSLAVLLKEIGMTKEEMIAVGDGFNDLSMIQYAGLGVAMANAQEIVRQNADYIT-LSNEEDGVAAVVEKF 266
>gi|81097334|ref|ZP_00875627.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Streptococcus suis 89/1591] >gi|80976624|gb|EAP40214.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Streptococcus suis 89/1591] (271 aa)
Score = 186, Expect = 2.4e-12, Identities = 74/266 (27%), Positives = 131/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANV--LIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL++ K +++  I AI +  E G+   LCTGR    +A V   +++       +FII   G   ++ K         LS   I  +    ++ D+   + D    YF    + + R++  D          + L E +S      + M V +KE++    N+     S++   + + +   L E +    SK +GLK       +  + ++A GDA+ND +MI  + +G+AM N +++ K++AQ IT+  N N+G+   I K+
  S:     2 IKLIALDMDGTLLNEKKELMQPQIDAIHQAVEAGVKIVLCTGRP---LAGVKPFVEQLGFDTEEEFIIVNNGCSTHSTKDWSLIDWEELSISDIDYLSTFIENDDVQISLFDEED-YFVLAEKANARVN-LDAGLVGMTPQPIVLKEAQSGQHRFFEAMFVGEKEHIDAFENQHNPVLSQHY--STVRSQDYLLEILPNGASKASGLKKLADRLGILPEEIMAMGDANNDLEMIEFAGLGIAMGNANEQVKAIAQDITDT-NENNGVAKAIEKH 267
>gi|163943078|ref|YP_001647962.1| Cof-like hydrolase [Bacillus weihenstephanensis KBAB4] >gi|163865275|gb|ABY46334.1| Cof-like hydrolase [Bacillus weihenstephanensis KBAB4] (273 aa)
Score = 185, Expect = 2.8e-12, Identities = 66/241 (27%), Positives = 119/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ ++  I D+      +EN    ++ E +       +VD + T  K  V+ V   +    ++   K  + + E    ++ + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEDVWIHTYIGDD---IVTEENNPYTKI-EGEITGMPIIEVDDFKTAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSVMRSKPFFLEFTEHGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|116874065|ref|YP_850846.1| Cof-like hydrolase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742943|emb|CAK22067.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (279 aa)
Score = 185, Expect = 2.8e-12, Identities = 64/267 (23%), Positives = 122/267 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           + ++ D+DGTLL+D K +   +  A+   ++ G+   L +GR    M ++  ++ +++ Y   ++   GA+  + +T E      L+    K ++ H +  ++   I  + Y+Y       +       I + +Y+     +      D+  +L    +K++   D +YM    N              + T    FE+   N+ K   L   L    +  +N++AFGD  ND  M+  +  G+AM N   + K+VA  IT   NN DGI + +  + K
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQQNGVKLILASGRPTTGM-HLYAEQLEMETYHGLLVSYNGAKVVDCQTKEELFNQTLTIAEGKAVLEHMKQFEVKVMIDKDDYMYVNNVYDCYIPYKGEEINIIQYESRGGNFKLCEKEDLAAFLDYRINKILTAGDPDYMQK--NYQAMMAPFKNTLNCVFTADFYFEFTAKNIDKAKALDTVLTPMGIHAENIIAFGDGHNDITMVKYAGTGIAMDNAVPELKAVANSIT-LSNNKDGIAHVLNNFIK 278
>gi|94991092|ref|YP_599192.1| hydrolase [Streptococcus pyogenes MGAS10270] >gi|94544600|gb|ABF34648.1| Hydrolase [Streptococcus pyogenes MGAS10270] (462 aa)
Score = 185, Expect = 3.1e-12, Identities = 75/266 (28%), Positives = 132/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQD--LDLNFG---------IPDNGYLYF--------PKENRHSIRLSEYDHMTAK-----YFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K V  D+DGTLL+D KN+ +++  AI+++K++G++ GL TGR         ++ + +    DF +   G   Y L  ++    + L    I  +I +  +   +++ G         I D G   F        PK    ++  S + H+  +     + ++   + EP  +V++V  +         +K  + K+       + P   + +  + SK  G+K   + F   L  V+AFGD+DND +M+    IGVAM N     K  A + T+  NNNDGI   +  Y
  S:     3 VKAVFFDIDGTLLNDRKNIQKTTQKAIQQLKKQGIMVGLATGR-GPGFVQPFLENFGL----DFAVTYNGQ--YILTRDKVLYQNQLPKSMIYKVIRYANEKKREISLGTASGLAGSRIIDMGTSPFGQVISSFVPKSWARTVEGS-FKHLIRRIKPQSFRNLVTIMREPIYQVVLVASQA-------ETKKIQEKFPHIKITRSSPYSLDLISVDQSKIKGIKRLGEMFGFDLSEVMAFGDSDNDLEMLSGVGIGVAMGNAETVVKDGAHFTTDS-NNNDGISKALAHY 276
>gi|15004774|ref|NP_149234.1| HAD phosphatase superfamily protein [Clostridium acetobutylicum ATCC 824] >gi|14994386|gb|AAK76816.1|AE001438_69 HAD phosphatase superfamily protein [Clostridium acetobutylicum ATCC 824] (283 aa)
Score = 185, Expect = 3.1e-12, Identities = 67/271 (24%), Positives = 127/271 (46%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY----FPKENRHS---IRLSEYDHMTAKY-----FDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +S +KV++ D+DGTL    K + E +  A+KK +E G +  L +GR  + + +    + ++ +    ++   GA+  + +TN+      +S D  + ++ H +  ++   I    Y+Y    F  E ++      + +Y+    K+      D+  +   P +K++   + EY+    +  +  +   E    + T    FE+    + K   L   L       + ++AFGD  ND  M+  + IGVAM N   + K+ A  +T   N  DGI   + KY K
  S:     1 MSDVKVIIMDIDGTLTTSKKIISEKTKKALKKAQELGAVLILASGRPTSGLMD-FAKELEMDKNHGLLVSFNGARVVDCETNKILFNETMSIDQGQAVLEHMKKFEVKPMIDKGDYMYVNDVFDNEIQYKGEPFNIIQYESRNNKFKLCEKHDLAAFADYPLNKILTAGEPEYLKK--HYKEMMEPFKESLNCMFTADFYFEFTAEGIDKAKALDTVLIPMGYKKEEMIAFGDGHNDISMVKYAGIGVAMDNAVQELKNAADEVT-LSNEEDGIAYTLSKYMK 279
>gi|182684933|ref|YP_001836680.1| cof family protein [Streptococcus pneumoniae CGSP14] >gi|182630267|gb|ACB91215.1| cof family protein [Streptococcus pneumoniae CGSP14] (472 aa)
Score = 185, Expect = 3.3e-12, Identities = 76/264 (28%), Positives = 134/264 (50%)
  Q:     2 DISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           D  ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:     9 DRMEVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 280
>gi|51598223|ref|YP_072414.1| sugar phosphatase [Yersinia pseudotuberculosis IP 32953] >gi|153947940|ref|YP_001403091.1| sugar phosphatase [Yersinia pseudotuberculosis IP 31758] >gi|186893349|ref|YP_001870461.1| Cof-like hydrolase [Yersinia pseudotuberculosis PB1/+] >gi|51591505|emb|CAH23177.1| putative haloacid dehalogenase-like hydrolase [Yersinia pseudotuberculosis IP 32953] >gi|152959435|gb|ABS46896.1| Cof-like hydrolase [Yersinia pseudotuberculosis IP 31758] >gi|186696375|gb|ACC87004.1| Cof-like hydrolase [Yersinia pseudotuberculosis PB1/+] (269 aa)
Score = 184, Expect = 3.5e-12, Identities = 73/266 (27%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     LS +         ++L ++F   D   LY       K   H + L+          ++D  L  PK  VM++ + E +   +    +    +E  T + + P   E +   V K  G+K+  +   +   NV+A GD  ND  M+  + +GVAM N   + K +AQY+T   N  DG+   I KY
  S:     3 IELIAIDMDGTLLNPQHEITPRVKQAIAAARAKGVCVVLATGRPYIGVQRYL-RELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRELGVSFQAFDFNTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPK--VMMIDEPERLDRALAMMPA--EVFERFTIMKSAPFYLEILSKRVDKGTGVKMLAEHLGIAQKNVMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQYVTGT-NCEDGVATAIEKY 267
>gi|193216804|ref|YP_002000046.1| COF family HAD hydrolase protein [Mycoplasma arthritidis 158L3-1] >gi|193002127|gb|ACF07342.1| COF family HAD hydrolase protein [Mycoplasma arthritidis 158L3-1] (273 aa)
Score = 184, Expect = 3.6e-12, Identities = 73/268 (27%), Positives = 134/268 (50%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIK---DIINHYQDLDLNFGIPDNGYL---YFPKENRHSIRLSEYDHMTAKY-FDVDVYLTEPKSKVMIVCDKEYMPTVINRS-KSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +K++  DMDGTLL+  + + +  I  +K+I+++G      TGR   N   +    +K     DF +   GA  YNL TNE     FL+ +  K   DI      L L+F   +N Y    Y   EN  +    +Y  ++  Y +   +   +  ++V++     + P VI +  K  ++K+   +  +T  + ++   P+ SK  G++   +  ++  D++++FGD++ND  M+  +K   AM NG+ + K +A  +   D N+D I N + +  K
  S:     1 MKLLTFDMDGTLLNSDQTLNKKKINILKRIQKRGNKIAFVTGRGKKN-TEIYYRDFK----PDFAVLNNGADIYNLATNEVFIPHFLTLEEAKIANDIAEENGTL-LSFSTNENFYAILDYCQNENFLTSEDKKYFSLSKHYSYAEAIESIKANNEVILQIALRHYPEVIEKVLKENQNKFPKLSSRITSRVFWDLNGPSTSKFTGIQKLFEILDIDCDSLISFGDSNNDLPMLEKAKYSFAMGNGTPEVKKIATEVI-GDCNSDAIVNKLEELIK 269
>gi|169335765|ref|ZP_02862958.1| hypothetical protein ANASTE_02190 [Anaerofustis stercorihominis DSM 17244] >gi|169258503|gb|EDS72469.1| hypothetical protein ANASTE_02190 [Anaerofustis stercorihominis DSM 17244] (269 aa)
Score = 184, Expect = 4.1e-12, Identities = 64/256 (25%), Positives = 117/256 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANV-----LIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNND 262
           K++ +D+DGTL  D K + E +  AIKK  + G+   L +GR    +  +     L D + + +         G  ++N +  E +  +    D  K +I H +    +F + +   +++  E+R  +     ++  A Y  +   L  P      +C   Y  T   R      +YE  +  V+  +L ++    + K   L    K  N+  + +LA GD+DND  MI N+++GV++ N S+  K+ +  +  Q NN D
  S:     3 KILATDIDGTLFTDDKKITEKTRNAIKKCADMGVYVVLSSGRYYKGVLPIAESLGLTDSYHVAD--------NGICYFNTE-GEAEFVNVFDKDEYKVLIEHLRKTCKSFVVTNETGMWYETEDRRCVETMLPNNGDAHYIKMKDILDVPNP--FKIC--AYYETDEERDNILSREYEKISGCVSFKVLIDFYPKGIDKYATLLEVAKRLNVKEEEILAVGDSDNDLPMIENARLGVSVKNASENLKNASDIVLTQTNNED 250
>gi|24379186|ref|NP_721141.1| hypothetical protein SMU.718c [Streptococcus mutans UA159] >gi|24377095|gb|AAN58447.1|AE014914_9 conserved hypothetical protein [Streptococcus mutans UA159] (269 aa)
Score = 184, Expect = 4.2e-12, Identities = 73/266 (27%), Positives = 124/266 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL+  + V      AI+  K+ G+   + TGR    + + L++K  +K+  D++I   GA   +  T E      L+ D   DI    + L ++        +Y    +     + +Y    A   ++ VY   P+        K+M++ + E +   I +  +  S YE  T + + P   E M+  VSK   +    +   L+ D  +A GD +ND  M+      V M NG  + K +A+YIT + N+N G+   I K+
  S:     3 IKLVAVDIDGTLLNSKREVTPEVYTAIQDAKKAGVKVVIATGRPIAGVTD-LLEKLNLKDQGDYVITFNGALVQDTATGEDLIKETLTYDDYLDIELLSRKLGVHMHAISKEGIYTANRD-----IGKYTVHEASLVNMPVYYRTPEEMVGKEIVKIMMIDEPEMLDAAIAQLPA--SLYEHYTVVKSRPFYLEIMNKKVSKGTAIVHLAEKLGLSRDETMAIGDEENDRAMLEAVGSPVVMENGIPELKKMAKYIT-KSNDNSGVAYAIKKW 266
>gi|153176007|ref|ZP_01931266.1| Cof-like hydrolase [Listeria monocytogenes FSL N3-165] >gi|133728720|gb|EBA30418.1| Cof-like hydrolase [Listeria monocytogenes FSL N3-165] (279 aa)
Score = 183, Expect = 4.8e-12, Identities = 63/258 (24%), Positives = 116/258 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   ++ G+   L +GR    M +V  ++ +++++   ++   GA+  +  TNE      L+ +  K ++ H +   +   I    Y+Y       +       I + +Y+     +      D+  +L    SK++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQQNGVKLILASGRPTTGM-HVYAEQLEMEKHHGLLVSYNGAKVVDCATNEELFNQALTVEEGKAVLEHMKQFKVKVMIDKEDYMYTNDVYDCYVPYRGEEINIIQYESRGGNFKLCEKDDLAAFLDYRLSKILTAGDPAYMQK--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKVKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|148989999|ref|ZP_01821274.1| Cof family protein [Streptococcus pneumoniae SP6-BS73] >gi|168495062|ref|ZP_02719205.1| Cof family protein [Streptococcus pneumoniae CDC3059-06] >gi|147924659|gb|EDK75745.1| Cof family protein [Streptococcus pneumoniae SP6-BS73] >gi|183575082|gb|EDT95610.1| Cof family protein [Streptococcus pneumoniae CDC3059-06] (462 aa)
Score = 183, Expect = 4.9e-12, Identities = 75/261 (28%), Positives = 133/261 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:     2 EVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 270
>gi|116516548|ref|YP_817216.1| Cof family protein [Streptococcus pneumoniae D39] >gi|148985580|ref|ZP_01818769.1| Cof family protein [Streptococcus pneumoniae SP3-BS71] >gi|116077124|gb|ABJ54844.1| Cof family protein [Streptococcus pneumoniae D39] >gi|147922300|gb|EDK73421.1| Cof family protein [Streptococcus pneumoniae SP3-BS71] (462 aa)
Score = 183, Expect = 4.9e-12, Identities = 75/261 (28%), Positives = 133/261 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:     2 EVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 270
>gi|168265581|ref|ZP_02687546.1| hypothetical protein LmonFSL_05864 [Listeria monocytogenes FSL J2-071] (256 aa)
Score = 183, Expect = 5.0e-12, Identities = 69/260 (26%), Positives = 126/260 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYN 266
           K+V  D+DGTL+ ++K +  S+  AI K+KE G+   + TGR    M + +  +  I  Y+     C   Q+   +  E      L  ++++ +I    + +  + F   D+     P  +R +I ++    EY  + A Y+   D+Y      + ++ CD+ Y          ++ +++    L    +  +    + SK  G+K  +K    ++++  AFGD  ND  M+     GVAM NG D+ K+VA Y+T    ++DG+YN
  S:     3 KIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGR-GPFMLDEIRKELDINSYI-----CYNGQYVIFEGKEIYAKP-LPTESLERLITVASEHEHPIVFSGKDSMRANLPDHDRVTIGMNSIKREYPKVDANYYKGRDIY------QCLLFCDESY-------DAYYREEFKQYGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMEDTYAFGDGLNDIAMLQAVGTGVAMGNGRDEVKAVADYVTSH-VDDDGVYN 248
>gi|15903853|ref|NP_359403.1| Cof family protein [Streptococcus pneumoniae R6] >gi|15459497|gb|AAL00614.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] (472 aa)
Score = 183, Expect = 5.0e-12, Identities = 75/261 (28%), Positives = 133/261 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:    12 EVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 280
>gi|46906394|ref|YP_012783.1| Cof-like hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47092845|ref|ZP_00230628.1| Cof-like hydrolase [Listeria monocytogenes str. 4b H7858] >gi|167013624|ref|ZP_02276157.1| Cof-like hydrolase [Listeria monocytogenes FSL J1-194] >gi|46879658|gb|AAT02960.1| Cof-like hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47018749|gb|EAL09499.1| Cof-like hydrolase [Listeria monocytogenes str. 4b H7858] (270 aa)
Score = 183, Expect = 5.0e-12, Identities = 69/258 (26%), Positives = 119/258 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTLL+D+  +  +   +IK  K KG+   LCTGR    +   LI+   + E  D+ I   GA      + +      L+   +++I       ++N    D   +Y P      I   +   +    + + V         SKVM++   E +  VI +  +S K K+ V   + + P   E++   V+K + L    +   ++   V++ GD +ND  MI  + +GVAM N ++  K +A Y T   NN DG+
  S:     3 KIIAIDIDGTLLNDAHEITLAVRDSIKAAKAKGVKVVLCTGRPLAGIKKSLIELDLLDEG-DYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENVNVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKITDVIKKLPESIKEKFYV---VRSVPYNLEFLQKGVNKGSALASLAEKLGVSQSEVMSIGDQENDITMIEYAGMGVAMGNATEHIKEIANYTTTT-NNEDGV 259
>gi|73662744|ref|YP_301525.1| hypothetical protein SSP1435 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495259|dbj|BAE18580.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (267 aa)
Score = 183, Expect = 5.4e-12, Identities = 64/259 (24%), Positives = 124/259 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYF-DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG-PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           + + K+VV DMD TL+++   +   +   +  I+++G    L +GR    M      K K   Y  ++I   G +  N+ T   +K+  ++ +    I+++ +  +L     ++G++ +  E+ +    SE   +  ++  D+  ++ +   KVM V   +Y+ T+   +      +     + T  P   E+M   VSK N +    K  ++ L  V+AFGD+ ND  M+      VAM N +D+ K+VA  IT  +++N
  S:     1 MGKYKMVVMDMDDTLMNNENQMSPETESYLLDIQKQGYKVVLASGRPTEGMLPT-AKKLKFDTYQSYVISYNGGKTVNVNTESVEKSRTVTKENFDLIVDYCRKNNLFILTYEDGHIVYEGEHEYMNIESELTGLPMEHVNDLKDFIQDDVPKVMGV---DYVSTISKLNTDLAGHFNEDIDVTTSKPYFLEFMAQGVSKGNAVTDLSKKLDIALSEVVAFGDSSNDISMLQVVGHAVAMGNANDQVKAVADEITLSNSDN 257
>gi|110802826|ref|YP_697910.1| HAD family hydrolase [Clostridium perfringens SM101] >gi|110683327|gb|ABG86697.1| HAD hydrolase, IIB family [Clostridium perfringens SM101] (266 aa)
Score = 183, Expect = 5.5e-12, Identities = 72/258 (27%), Positives = 123/258 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVL--IDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI---RLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K+V  DMDGTLL + K + E +  AIKK +EK +   L TGR  + +   L  +D +   EYV   +   GA    +  +       L G  +K +    ++  +N     N     PK N+++    R++  +   A Y ++     E   K+M++ + E +   I +    +  Y+  T + + P   E++    +K  G+K   +   +  + V+A GDA ND  MI  + +GVAM N  ++ K  A +IT + N  DG+
  S:     3 KLVAIDMDGTLLKEDKTISEKTKEAIKKAREKNVKVVLATGRPVDGVKRYLEELDLFHNDEYV---LTFNGAIVKEIGPDRVICRDTLKGSDLKYLYEVSKNAGVNIHAFSNFGCVTPKMNKYTELEGRINGIEVCEADYNEIKE--DEEIIKIMMIDEPEVLEEGIKKLP--EEVYKKYTVVRSAPYFLEFLSKTCNKGEGVKSLAESLGIKREEVIAIGDAGNDLHMIEYAGLGVAMGNAFEEVKEKADFIT-KSNEEDGV 257
>gi|153197609|ref|ZP_01941840.1| Cof-like hydrolase [Listeria monocytogenes 10403S] >gi|127633030|gb|EBA22455.1| Cof-like hydrolase [Listeria monocytogenes 10403S] (256 aa)
Score = 183, Expect = 5.6e-12, Identities = 69/260 (26%), Positives = 125/260 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYN 266
           K+V  D+DGTL+ ++K +  S+  AI K+KE G+   + TGR    M + +  +  I  Y+     C   Q+   +  E      L  ++++ +I    + +  + F   D+     P  +R +I ++    EY  + A Y+   D+Y      + ++ CD+ Y          ++ +++    L    +  +    + SK  G+K  +K    ++ +  AFGD  ND  M+     GVAM NG D+ K+VA Y+T    ++DG+YN
  S:     3 KIVFFDVDGTLVGETKEITASAKQAIAKLKENGVYVAIATGR-GPFMLDEIRKELDINSYI-----CYNGQYVIFEGKEIYAKP-LPTESLERLITVASEHEHPIVFSGKDSMRANLPDHDRVTIGMNSIKREYPKVDANYYKGRDIY------QCLLFCDESY-------DAYYREEFKQYGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMKDTYAFGDGLNDIAMLQTVGTGVAMGNGRDEVKAVADYVTSH-VDDDGVYN 248
>gi|56964913|ref|YP_176644.1| hypothetical protein ABC3149 [Bacillus clausii KSM-K16] >gi|56911156|dbj|BAD65683.1| conserved hypothetical protein [Bacillus clausii KSM-K16] (272 aa)
Score = 183, Expect = 5.6e-12, Identities = 69/266 (25%), Positives = 117/266 (43%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  DMDGTLL+D   V      A+ + ++ G    LCTGR    +   L  + ++ +  D++I   GA   +  TN+   +  L  + + ++    + L+      D+  LY    +  S  + E            V   +P     KVM + + E +   I     + K +Y +   + + P  +E +HP VSK N +K   +      + V+  GD  ND  MI  +  G+AM N   + K+ A  +T   NN DG+ + I   F
  S:     3 KLIAIDMDGTLLNDHHEVTPEVKKALLEARQAGATIVLCTGRPLGGVTRYL-HELELNQKGDYVIAYNGALVQDTHTNQVVVSHTLRYNDLVELDELAKTLNTPMHYFDDKRLYTGDRDISSYTVYESFLTKVPLRYCPVKEADPSILVPKVMYIDEPEKLDQAIAAIPAAVKERYSM---VKSAPFFYEILHPLVSKGNAVKHLAEKLGFEREEVMCIGDNGNDLSMIEYAGCGIAMENSIPELKAAADIVT-TSNNEDGVAHAIRTQF 267
>gi|15901820|ref|NP_346424.1| Cof family protein [Streptococcus pneumoniae TIGR4] >gi|111658881|ref|ZP_01409502.1| hypothetical protein SpneT_02000053 [Streptococcus pneumoniae TIGR4] >gi|148993139|ref|ZP_01822705.1| Cof family protein [Streptococcus pneumoniae SP9-BS68] >gi|148998529|ref|ZP_01825970.1| Cof family protein [Streptococcus pneumoniae SP11-BS70] >gi|149021948|ref|ZP_01835935.1| Cof family protein [Streptococcus pneumoniae SP23-BS72] >gi|168487135|ref|ZP_02711643.1| Cof family protein [Streptococcus pneumoniae CDC1087-00] >gi|168490002|ref|ZP_02714201.1| Cof family protein [Streptococcus pneumoniae SP195] >gi|168576601|ref|ZP_02722467.1| Cof family protein [Streptococcus pneumoniae MLV-016] >gi|194398524|ref|YP_002038580.1| conserved hypothetical protein [Streptococcus pneumoniae G54] >gi|14973505|gb|AAK76064.1| Cof family protein [Streptococcus pneumoniae TIGR4] >gi|147755722|gb|EDK62768.1| Cof family protein [Streptococcus pneumoniae SP11-BS70] >gi|147928113|gb|EDK79131.1| Cof family protein [Streptococcus pneumoniae SP9-BS68] >gi|147929986|gb|EDK80974.1| Cof family protein [Streptococcus pneumoniae SP23-BS72] >gi|183569962|gb|EDT90490.1| Cof family protein [Streptococcus pneumoniae CDC1087-00] >gi|183571628|gb|EDT92156.1| Cof family protein [Streptococcus pneumoniae SP195] >gi|183577660|gb|EDT98188.1| Cof family protein [Streptococcus pneumoniae MLV-016] >gi|194358191|gb|ACF56639.1| conserved hypothetical protein [Streptococcus pneumoniae G54] (462 aa)
Score = 183, Expect = 5.6e-12, Identities = 75/261 (28%), Positives = 133/261 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:     2 EVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 270
>gi|168492026|ref|ZP_02716169.1| Cof family protein [Streptococcus pneumoniae CDC0288-04] >gi|183573734|gb|EDT94262.1| Cof family protein [Streptococcus pneumoniae CDC0288-04] (462 aa)
Score = 182, Expect = 5.9e-12, Identities = 75/261 (28%), Positives = 133/261 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:     2 EVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 270
>gi|47570428|ref|ZP_00241065.1| hydrolase, haloacid dehalogenase-like family, putative [Bacillus cereus G9241] >gi|47552910|gb|EAL11324.1| hydrolase, haloacid dehalogenase-like family, putative [Bacillus cereus G9241] (283 aa)
Score = 182, Expect = 5.9e-12, Identities = 73/266 (27%), Positives = 134/266 (50%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+K +E G +  +CTGR   ++  +L++       V+    II   GA  YN K    K+    +  A+ +I+N+ ++  L + +  N  +Y P+    S+R              L E + + A Y +   +L+    K ++  D    + +P    + + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + + +AM N  ++ K++ QY T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRKCQEAGHVVAICTGRSIVDIERLLLE-------VNLECPIIAENGALIYNDK-KMMKRYPIQNMQAL-EIVNYLEENGLYYQLYTNKGVYVPEYGVESVRNEIDYVKNSNENIDLKELETIAALYLEHTAFLSAESCKPIVETDIHVHKLLPFSYDMEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANLSIAMGNAVEEIKAMCQYET-LTNEEHGVAHALYKY 281
>gi|118443838|ref|YP_877441.1| Cof family protein [Clostridium novyi NT] >gi|118134294|gb|ABK61338.1| Cof family protein [Clostridium novyi NT] (270 aa)
Score = 182, Expect = 6.0e-12, Identities = 71/265 (26%), Positives = 122/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHS-----IRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMD TLLD SK +   +  AI K  EKG+   L TGR    ++  L  +  +    ++ + C GA   N  T+E    + L  D +  + N  + L +            PK N  S     +   E++ M+    +  V +     K++ V  KE + +++N     K  YE  T + +     E+++  ++K  G++   +   +  + ++  GDA+ND  MI  + +GVAM N     K  A YIT   N+  G+ + I K+
  S:     3 KLIALDMDNTLLDSSKMITSDNKTAINKASEKGVKVVLATGRFITGISKYL-KELNLDNKDNYCVTCNGAIVINAGTHEILSKTLLEYDDLCYLYNLSKKLGVYVHALTPEKCIVPKYNEFSAIEIGMNQVEFEEMSFSELEPSVEII----KILFVGPKEKIASIMNTLP--KEVYEKYTVMRSHDNFLEFLNKKINKGFGVECLGEKLGIKKEEIICVGDAENDLHMIEYAGLGVAMGNAFPDVKKAADYIT-YTNDESGVAHVINKF 264
>gi|149012414|ref|ZP_01833445.1| Cof family protein [Streptococcus pneumoniae SP19-BS75] >gi|147763470|gb|EDK70406.1| Cof family protein [Streptococcus pneumoniae SP19-BS75] (462 aa)
Score = 182, Expect = 6.1e-12, Identities = 75/261 (28%), Positives = 133/261 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:     2 EVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKIVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 270
>gi|42781720|ref|NP_978967.1| HAD superfamily hydrolase [Bacillus cereus ATCC 10987] >gi|42737643|gb|AAS41575.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus ATCC 10987] (283 aa)
Score = 182, Expect = 6.1e-12, Identities = 73/266 (27%), Positives = 133/266 (50%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K +   +  AI+K +E G +  +CTGR   ++  +L++       V+    II   GA  YN K    K+    +  A+ +I+N+ ++  L + +  N  +Y P+    S+R              L E + + A Y +   +L+    K ++  D    + +P    + + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + + +AM N  ++ K++ QY T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISNENAEAIRKCQEAGHVVAICTGRSIIDIERLLLE-------VNLECPIIAENGALIYNDK-KMMKRYPIQNMQAL-EIVNYLEENGLYYQLYTNKGVYVPEYGVESVRNEIDYVKHSNENIDLKELETIAALYLEHTAFLSAESCKPIVETDIHVHKLLPFSYDMEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANLSIAMGNAVEEIKAMCQYET-LTNEEHGVAHALYKY 281
>gi|153853963|ref|ZP_01995296.1| hypothetical protein DORLON_01287 [Dorea longicatena DSM 13814] >gi|149753345|gb|EDM63276.1| hypothetical protein DORLON_01287 [Dorea longicatena DSM 13814] (272 aa)
Score = 182, Expect = 6.5e-12, Identities = 69/267 (25%), Positives = 132/267 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI---INHY--QDLDLNFGIPDNGYLYFPKENRHS---IRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-----SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +++V D+DGTL +  K + + ++ A+ +I+E G    L +GR    +   L ++  +++Y  +I+   G +  + +T +      L  D I+ +   +  Y  Q +D+    P++  L   K N+++    R+++   + A    +D    +P +K ++  D    P V+++     SK F S   V     + P   E M   + K + L   L    LT + ++  GD  ND  MI  + +GVAM N     +  A YIT + N+ DG+ + I ++ +
  S:     4 QILVLDLDGTLTNSKKEITQPTLEALIEIQEAGKKVVLASGRPTQGVMP-LAEQLHLEDYGSYILSFNGGRITDCRTKQAIYNKILPADCIQGVYKTVRKYASQGIDVLTYTPEH-ILSGIKSNQYTELESRINQMPVIDASENFLDCVPDDP-NKFLVTGD----PAVLDQIRKELSKQFHSYLSV---YCSDPFFVEVMPAGIDKAHSLLKLLTSIGLTTEQMICCGDGYNDLTMIETAGLGVAMANAQPAVRETADYIT-KSNDEDGVLHVINEFMR 272
>gi|30682927|ref|NP_850072.1| haloacid dehalogenase-like hydrolase family protein [Arabidopsis thaliana] >gi|20466676|gb|AAM20655.1| unknown protein [Arabidopsis thaliana] >gi|26452541|dbj|BAC43355.1| unknown protein [Arabidopsis thaliana] >gi|133778884|gb|ABO38782.1| At2g25870 [Arabidopsis thaliana] (584 aa)
Score = 182, Expect = 6.8e-12, Identities = 70/263 (26%), Positives = 124/263 (47%)
  Q:     9 VVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVL-----------IDKWKIKEYVD--FIIGCGGAQFY--NLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +  DMDGTLL+    + E++  A+K+   +GL   + TG+       +L           I +     +V    + G  G + Y  NL  + C++T   S +    +I   QD  L  F  P    L+       +  +S  D + A+     V   +    V  V    +     +R+   +++ +          + E + P  SK NG+K+ L    ++ D ++A GD +ND +M+  + +GVA+ NG++KTK+VA  I    N+ DG+ + I +Y
  S:   315 IFCDMDGTLLNSKSQISEANAKALKEALLRGLKVVIATGKSRPGAIRILKTADLTGSDGIISESSPGVFVQGLLVYGRQGKEVYRGNLDRDVCRETCLYSLEHRIPLIAFSQDRCLTLFDHPLVDSLHTIYNEPKAEIISSVDQLIAEADIQKVIFMDTTEGVSSVIRPYWSEATGDRANVVQAQSD----------MLEIVPPGTSKGNGVKMLLNHLGVSPDEIMAIGDGENDIEMLQLASLGVALSNGAEKTKAVADVIG-VSNDQDGVADAIYRY 582
>gi|116333143|ref|YP_794670.1| HAD superfamily hydrolase [Lactobacillus brevis ATCC 367] >gi|116098490|gb|ABJ63639.1| Predicted hydrolase of the HAD superfamily [Lactobacillus brevis ATCC 367] (271 aa)
Score = 182, Expect = 7.1e-12, Identities = 76/266 (28%), Positives = 122/266 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYMPTV-INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+DGTLL++   + +++I A++  K +G+   LCTGR    +   L D   I     + I   G+    +        S    D I D+    + +  +F I    Y+Y   ++   ++I  S    M  +Y +V      P+    SK M V   + +  V  N  + FK ++ V   + + P   E M+   SK   L   +    LT D+V+  GD  ND  MI  + +GVAM N  D+ K  AQ +T   N  +G+   I KY
  S:     3 IKLIAIDIDGTLLNEKNELAQATIDAVQAAKAQGIKVVLCTGRPLTGVQPYL-DAMDIDGDDQYAITFNGSVAQTISGKVLTNHSLTYEDYI-DLEAWARKVRAHFQIETPDYIYTANKDISAYTIAESYLVRMLIQYREVS---ETPRDLTISKAMFVDYPQVIEQVKANMPQDFKDRFSV---VQSAPYFIEVMNRRASKGGTLSELVDQLGLTADDVMTLGDQGNDLTMIKYAGLGVAMGNAIDEVKEAAQAVT-LTNAENGVAAAIRKY 266
>gi|168484069|ref|ZP_02709021.1| Cof family protein [Streptococcus pneumoniae CDC1873-00] >gi|172042590|gb|EDT50636.1| Cof family protein [Streptococcus pneumoniae CDC1873-00] (462 aa)
Score = 182, Expect = 7.4e-12, Identities = 75/261 (28%), Positives = 133/261 (50%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           ++K V  D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:     2 EVKAVFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 270
>gi|157150363|ref|YP_001450122.1| Cof family protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157075157|gb|ABV09840.1| Cof family protein [Streptococcus gordonii str. Challis substr. CH1] (270 aa)
Score = 181, Expect = 7.8e-12, Identities = 78/267 (29%), Positives = 130/267 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYM---PTVINRSKSFKSKYEVGTPLV--------------------------TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK++  DMDGTLL+  K + + +I AI K  + G+   LCTGR            + ++ Y + ++G      Y +  N C          I  +    QD+          YLY   +N  SI+L+ +D     YF V     E  S + +V D  Y+   PT I+  ++   KY +   +                           +  +++E M   V+K   L+   +  N+ ++ ++A GDA+ND +M+  + +G+AM N SD  KS+A  +TE  N+ +G+   I KY 
  S:     2 IKLLALDMDGTLLNSQKKISQENISAIHKAIKAGVKLVLCTGRPP----------FGVRPYYE-LLGLAQEDEYVIVDNGCAIHRTSDWKVIDSVALDKQDIH---------YLYSLTQNS-SIQLTLFDE--EHYFVVG----ETPSPI-VVRDTGYVFTSPTEISLEEAVSGKYTMFQAMFLAEKETVDFFEEKYASDICQHFSGVRSQDVIYEVMPAGVTKAFALEKLAQKLNIKVEEIMALGDANNDLEMLKFAGLGIAMGNASDYVKSLADDVTES-NDENGVAKAIEKYL 268
>gi|90961977|ref|YP_535893.1| HAD superfamily hydrolase [Lactobacillus salivarius UCC118] >gi|90821171|gb|ABD99810.1| Hydrolase, HAD superfamily [Lactobacillus salivarius UCC118] (269 aa)
Score = 181, Expect = 7.8e-12, Identities = 72/267 (26%), Positives = 124/267 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDL--------NFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           K++  D+DGT L++   +   +   ++K  + G +  + TGR  N ++    D+  I   +    G  G   +     E  +T   S D   D++   + L +        N+ + D      P     +++ +E  +         + L +  S + ++ D+  +P ++   K+ F  K  VG      PIL E     V+K  G+    K +N+   N++AFGD  ND  MI  +  GV M NG+DK KS+A  ITE DN +DG+  ++  Y K
  S:     4 KLIAIDLDGTTLNNESKISSYTKEVLQKAAQAGHIVSIVTGR-PNRISENFYDELNIPTPMINFNGALGHIPHKNWDKEYIET--FSKDIALDLVAEKEKLGIKIVAAESKNYALADQPNNIIPDFFPATLKANEVLNA--------INLQKDPSAMTMLVDEHKLPNIVETLKANFGDKITVGVWGGKNPIL-ELSPKGVNKAKGVDFLAKTYNIDKKNIIAFGDEHNDASMIDYAGWGVVMQNGTDKLKSLANDITEYDNEHDGLARYLEDYLK 267
>gi|53711489|ref|YP_097481.1| haloacid dehalogenase-like hydrolase [Bacteroides fragilis YCH46] >gi|52214354|dbj|BAD46947.1| haloacid dehalogenase-like hydrolase [Bacteroides fragilis YCH46] (278 aa)
Score = 181, Expect = 7.9e-12, Identities = 70/266 (26%), Positives = 119/266 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY--FPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD-KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++V D+DGTL +  K +   +  A+   +E+G+   L +GR    +A  L D+ ++KE+  FI+   G +  +  T E    + L    I  +        L     D+ Y+   +P ++  R    L++     +  F  D+ L  P  K +IV +    +P     S   + +  V     + P   E +   + K   L + L   N+  + ++A GD  ND  MI  + +GVAM N  +  K  A YIT   N  DG+   + K+F
  S:     4 KLLVLDLDGTLTNAKKEITLRNREALIHAQEQGVKLILASGRPTFGIAP-LADELRMKEFGGFILSYNGGEIIDWSTGEIVYANVLPDKVIPRLYECATRNQLPILTYDHQYIITEYPDDDYVRKEAFLNKMQIYPSTDFLKDIRL--PLPKCLIVGEPHRLIPIEAELSVELQGQLSV---YRSEPFFLELVPQGIDKAQSLSVLLNKLNMNREEIVAVGDGYNDLSMIQFAGLGVAMGNAQEPVKKAADYIT-LSNEEDGVAAVVNKFF 267
>gi|50123346|ref|YP_052513.1| sugar phosphatase [Pectobacterium atrosepticum SCRI1043] >gi|49613872|emb|CAG77324.1| putative haloacid dehalogenase-like hydrolase [Erwinia carotovora subsp. atroseptica SCRI1043] (271 aa)
Score = 181, Expect = 8.1e-12, Identities = 78/266 (29%), Positives = 127/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGD--------AIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYF---DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  DMDGTLL     +  +   AI   +EKG+   L TGR    +   L++   +++   + I   GA        +C   + LS D        A K  + H+  LD NF    N  +     + ++I  S    M  KY    ++D  LT PK  VM++ + E +   I  S+     +E  T + +     E +   V+K  G+K+  +  N+  ++V+  GD  ND  MI  + IGVAM N  D+ K  +Q++T + N  DG+   I K+
  S:     3 VKLIAIDMDGTLLTPQNQISPAVKAAIAAAREKGVQVVLATGRPYIGVERYLME-LDLQQEGCYCITNNGALVQRTVNGDCVAQTALSFDDYLYFEALACKLGV-HFHALDFNFVYTANKDI-----SPYTIHESHLTGMPLKYRAVEEMDRSLTFPK--VMMIDEPEILDRAI--SQLPPEAFERYTIMKSAEYYLEILDKRVNKGEGVKMLAEHLNIPRESVMTLGDQQNDLAMIRYAGIGVAMGNAIDEVKEASQFVT-KTNMEDGVAYAIEKF 267
>gi|83319761|ref|YP_424776.1| HAD superfamily hydrolase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283647|gb|ABC01579.1| hydrolase, haloacid dehalogenase-like family, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (280 aa)
Score = 181, Expect = 8.8e-12, Identities = 81/261 (31%), Positives = 128/261 (49%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVL-IDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQD---LDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDV--YLTEPKSKVMIVCDKEYMPTV-INRSKSFKSKYEVGTPLVT-GPILFEYMHPNVSKTNGLKIALKDFNL--TLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           ++ SD+DGTLL D       +I  ++K+ +KG+     T R   D    AN+L IDK+K       I+   GAQ Y+ KT++      L  + IK+I N Y +     L F  P+  Y++   E R+S +   +  M  KY  VD    + EP +   IV + +  P   +N  K   + Y     + +    +F+     V K  G+   ++  NL  T  +   FGD  ND+ ++     GVAM NG  + K +A  IT+  N+ DG+  +I
  S:     7 IIFSDLDGTLLHDDYIFSPKTIEVVEKLYKKGIYLIPITARTIKDLKQKANLLGIDKFK-----GIIVASNGAQIYDYKTDKLIFDQTLPKEFIKEIFNRYHNKFFAKLIFYSPNCCYVF--AEGRNS-KYWAHQVMGLKYISVDSPDQIDEPITHFYIVTNSKATPEENLNEYKYLMNHYSDDYKVDSYNNRVFDISVKGVDKGCGVNKVMQYLNLDETTTHSYGFGDGPNDFSLLKACTTGVAMKNGIIELKEIADDITDYSNDKDGVARYI 272
>gi|16803069|ref|NP_464554.1| hypothetical protein lmo1029 [Listeria monocytogenes EGD-e] >gi|47096115|ref|ZP_00233715.1| Cof-like hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|153173977|ref|ZP_01929656.1| Cof-like hydrolase [Listeria monocytogenes FSL N3-165] >gi|153179131|ref|ZP_01932372.1| Cof-like hydrolase [Listeria monocytogenes F6900] >gi|153185870|ref|ZP_01936364.1| Cof-like hydrolase [Listeria monocytogenes J0161] >gi|153190430|ref|ZP_01937832.1| Cof-like hydrolase [Listeria monocytogenes J2818] >gi|16410431|emb|CAC99107.1| lmo1029 [Listeria monocytogenes] >gi|47015464|gb|EAL06397.1| Cof-like hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|126941596|gb|EBA19480.1| Cof-like hydrolase [Listeria monocytogenes J0161] >gi|127766116|gb|EBA26459.1| Cof-like hydrolase [Listeria monocytogenes J2818] >gi|133730604|gb|EBA32302.1| Cof-like hydrolase [Listeria monocytogenes FSL N3-165] >gi|133733286|gb|EBA34984.1| Cof-like hydrolase [Listeria monocytogenes F6900] (256 aa)
Score = 181, Expect = 8.9e-12, Identities = 69/260 (26%), Positives = 125/260 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYN 266
           K+V  D+DGTL+ ++K +  S+  AI K+KE G+   + TGR    M + +  +  I  Y+     C   Q+   +  E      L  ++++ +I    + +  + F   D+     P  +R +I ++    EY  + A Y+   D+Y      + ++ CD+ Y          ++ +++    L    +  +    + SK  G+K  +K    ++ +  AFGD  ND  M+     GVAM NG D+ K+VA Y+T    ++DG+YN
  S:     3 KIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGR-GPFMLDEIRKELDINSYI-----CYNGQYVIFEGKEIYAKP-LPTESLERLITVASEHEHPIVFSGKDSMRANLPDHDRVTIGMNSIKREYPKVDANYYKGRDIY------QCLLFCDESY-------DAYYREEFKQYGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMKDTYAFGDGLNDIAMLQTVGTGVAMGNGRDEVKAVADYVTSH-VDDDGVYN 248
>gi|182417442|ref|ZP_02948769.1| HAD phosphatase superfamily protein [Clostridium butyricum 5521] >gi|182378611|gb|EDT76138.1| HAD phosphatase superfamily protein [Clostridium butyricum 5521] (284 aa)
Score = 181, Expect = 9.6e-12, Identities = 67/269 (24%), Positives = 126/269 (46%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK--------ENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +S+IK +V D+DGTL +  K + E +   + K + KG+   L +GR    +      + ++ +    ++   G++  + +  E      +S +  K ++ H +   +   I    ++            +N + I + EY+     Y      D+  Y+  P +K++   D +Y+    N  +  K   +  + + T    FE+    + K   L   LK   ++ +N+++FGD  ND  MI  ++IGVAM N  D+ K  A  IT   N  DGI   ++K+
  S:     1 MSKIKAIVMDVDGTLTNGKKQIPEKTKEVLLKAQSKGIKLILASGRPTTGLME-FARELEMDKNNGLLVSFNGSKVVDCENFEELFNEPMSVEDGKAVLEHMKKFKVKPMIDKGEHMLVNNVFDNIVHMKNGNEINIIEYESRGGNYKLCEIDDLAEYVDYPLNKILTAGDADYLKE--NYKEMMKPFEDKLSCMFTAEFYFEFTAKGIDKAKALDTVLKPMGISEENIISFGDGQNDLSMIKYAEIGVAMENAVDELKEYADEIT-LSNEEDGIAYSLLKH 278
>gi|94993889|ref|YP_601987.1| Hydrolase [Streptococcus pyogenes MGAS10750] >gi|94547397|gb|ABF37443.1| Hydrolase [Streptococcus pyogenes MGAS10750] (274 aa)
Score = 181, Expect = 9.6e-12, Identities = 74/259 (28%), Positives = 122/259 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYF--PKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  D+DGTL +  K V +++  A+  ++EKG+   + TGR    + N+L +   +      I   GG    N  T E    S LS D +  I    + + L   I   G +Y    K+ RHS        +T  + +V      PK    +K++ V D +++   +I  S S    +E      +  I+FE M   + K  GL +  +   L   +V+A GD  ND+ M+  + +GVAM NG    K+VA  +T   N+  G+
  S:     3 IRILALDLDGTLYNTEKIVTDANKKALAAVREKGVKVVITTGRPLKAIGNLLEELDLLDHDDYSITFNGGLVQRN--TGEVLDKSSLSFDQVCQIQQALEAVGLPTDIISGGDVYSIPSKDGRHSQYHLANPLLT--FIEVTSVAELPKDITYNKIVTVTDPDFLDQQIIKLSPSLFEDFEA---FKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEANDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGV 261
>gi|22127977|ref|NP_671400.1| sugar phosphatase [Yersinia pestis KIM] >gi|45443724|ref|NP_995263.1| sugar phosphatase [Yersinia pestis biovar Microtus str. 91001] >gi|21961122|gb|AAM87651.1|AE014012_8 hypothetical protein y4109 [Yersinia pestis KIM] >gi|45438594|gb|AAS64140.1| putative haloacid dehalogenase-like hydrolase [Yersinia pestis biovar Microtus str. 91001] (296 aa)
Score = 180, Expect = 1.0e-11, Identities = 72/266 (27%), Positives = 115/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     LS +         ++L ++F   D   LY       K   H + L+          ++D  L  PK  VM++ + E +   +    +    +E  T + + P   E +     K  G+K+  +   +   NV+A GD  ND  M+  + +GVAM N   + K +AQY+T   N  DG+   I KY
  S:    30 IELIAIDMDGTLLNPQHEITPRVKQAIAAARAKGVCVVLATGRPYIGVQRYL-RELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRELGVSFQAFDFNTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPK--VMMIDEPERLDRALAMMPA--EVFERFTIMKSAPFYLEILSKRADKGTGVKMLAEHLGIAQKNVMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQYVTGT-NCEDGVATAIEKY 294
>gi|42518629|ref|NP_964559.1| hypothetical protein LJ0707 [Lactobacillus johnsonii NCC 533] >gi|41582914|gb|AAS08525.1| hypothetical protein LJ_0707 [Lactobacillus johnsonii NCC 533] (268 aa)
Score = 180, Expect = 1.1e-11, Identities = 81/266 (30%), Positives = 125/266 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH--YQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDH--MTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINRSK---------------SFKSKYEVGTPLVTGPILF-EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D DGTLL     +L S+  AIKK  + G+   LC+GR    +A+ + +           +G  G+  Y +  N     +       +D++N+  Y+ L           + F KE +    + + D   +TA + DVD +        +  M +   + MP     SK               + + K+     +V     F E +HPNV+K NGLK   +   +T D ++AFGD  ND  M       VAM NGS + K  A YIT   N+NDGI   + K+
  S:     2 IKLIALDTDGTLLSSKNKILPSTKRAIKKALDLGIKVVLCSGRPIAGLAHFMKE-----------LGIEGSDQYAVTLNGAITRTADGKIMTQDLVNNALYRAL-----------IKFAKEQKVPFNIVDPDSRIITADH-DVDYFELLQAWENTAPMFIRTPDEMPDNFEISKGCFIGSKEILDQVEPTLREKFSKNLYIVRADDHFLECLHPNVNKGNGLKELGEKIGITPDEMIAFGDEKNDISMFDIVGTAVAMGNGSQEAKDHADYITSS-NDNDGIAKALDKF 266
>gi|16124202|ref|NP_407515.1| sugar phosphatase [Yersinia pestis CO92] >gi|108810129|ref|YP_654045.1| sugar phosphatase [Yersinia pestis Antiqua] >gi|108814111|ref|YP_649878.1| sugar phosphatase [Yersinia pestis Nepal516] >gi|145597329|ref|YP_001161404.1| sugar phosphatase [Yersinia pestis Pestoides F] >gi|150260972|ref|ZP_01917700.1| putative haloacid dehalogenase-like hydrolase [Yersinia pestis CA88-4125] >gi|162418656|ref|YP_001608444.1| sugar phosphatase [Yersinia pestis Angola] >gi|165926207|ref|ZP_02222039.1| Cof-like hydrolase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936975|ref|ZP_02225541.1| Cof-like hydrolase [Yersinia pestis biovar Orientalis str. IP275] >gi|166009455|ref|ZP_02230353.1| Cof-like hydrolase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213191|ref|ZP_02239226.1| Cof-like hydrolase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401593|ref|ZP_02307087.1| Cof-like hydrolase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422866|ref|ZP_02314619.1| Cof-like hydrolase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425500|ref|ZP_02317253.1| Cof-like hydrolase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470733|ref|ZP_02335437.1| predicted hydrolase [Yersinia pestis FV-1] >gi|108777759|gb|ABG20278.1| haloacid dehalogenase-like hydrolase [Yersinia pestis Nepal516] >gi|108782042|gb|ABG16100.1| putative haloacid dehalogenase-like hydrolase [Yersinia pestis Antiqua] >gi|115349681|emb|CAL22662.1| putative haloacid dehalogenase-like hydrolase [Yersinia pestis CO92] >gi|145209025|gb|ABP38432.1| haloacid dehalogenase-like hydrolase [Yersinia pestis Pestoides F] >gi|149290380|gb|EDM40457.1| putative haloacid dehalogenase-like hydrolase [Yersinia pestis CA88-4125] >gi|162351471|gb|ABX85419.1| Cof-like hydrolase [Yersinia pestis Angola] >gi|165915217|gb|EDR33828.1| Cof-like hydrolase [Yersinia pestis biovar Orientalis str. IP275] >gi|165922067|gb|EDR39244.1| Cof-like hydrolase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991377|gb|EDR43678.1| Cof-like hydrolase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205489|gb|EDR49969.1| Cof-like hydrolase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958258|gb|EDR55279.1| Cof-like hydrolase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048975|gb|EDR60383.1| Cof-like hydrolase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055514|gb|EDR65307.1| Cof-like hydrolase [Yersinia pestis biovar Mediaevalis str. K1973002] (269 aa)
Score = 180, Expect = 1.1e-11, Identities = 72/266 (27%), Positives = 115/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     LS +         ++L ++F   D   LY       K   H + L+          ++D  L  PK  VM++ + E +   +    +    +E  T + + P   E +     K  G+K+  +   +   NV+A GD  ND  M+  + +GVAM N   + K +AQY+T   N  DG+   I KY
  S:     3 IELIAIDMDGTLLNPQHEITPRVKQAIAAARAKGVCVVLATGRPYIGVQRYL-RELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRELGVSFQAFDFNTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPK--VMMIDEPERLDRALAMMPA--EVFERFTIMKSAPFYLEILSKRADKGTGVKMLAEHLGIAQKNVMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQYVTGT-NCEDGVATAIEKY 267
>gi|42784570|ref|NP_981817.1| HAD superfamily hydrolase [Bacillus cereus ATCC 10987] >gi|42740502|gb|AAS44425.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus ATCC 10987] (273 aa)
Score = 180, Expect = 1.1e-11, Identities = 69/241 (28%), Positives = 121/241 (50%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ ++  I D+      +EN     + E D        VD +   + EP  KV++  + E +  V ++  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEDVWIHTYIGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVESKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|28378407|ref|NP_785299.1| HAD superfamily hydrolase [Lactobacillus plantarum WCFS1] >gi|28271243|emb|CAD64147.1| hydrolase, HAD superfamily, Cof family [Lactobacillus plantarum WCFS1] (269 aa)
Score = 180, Expect = 1.1e-11, Identities = 63/266 (23%), Positives = 127/266 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYF---------DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGP-ILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  D+DGT L+    +  ++I  +++++  G +  + TGR     +  + D+ ++K  +    G  G   +    +E + T  ++   +  ++ + + L +N  I          EN++S   +  D +  ++F           D     P S V++V        +   ++ F  + +VG  +  GP  + E     V K  G+      F ++  N++AFGD  ND +M+  + +GVAM NG+DK K+ A  +T  +N+ +G+  ++  YF
  S:     4 KLIALDLDGTTLNAESKLNSATIQTMQRLQAAGHIVSIITGRSYQG-SQAIYDQLRLKSPMINFNGSLGHLPHQTWASEYQFT--INKAIVLALVKYREQLGINEII---------AENKNSTMTAGQDLIAGQFFPEIADSPRLTPDTLTRNPNSLVLLVQLDRRAAIIDWITERFGDQVDVG--VWGGPNAILEITSKGVHKAKGVAYLADYFQISRRNIIAFGDEHNDLEMLAYAGLGVAMANGTDKIKATADDVTAYNNDQNGVARYLNDYF 265
>gi|15829020|ref|NP_326380.1| hypothetical protein MYPU_5490 [Mycoplasma pulmonis UAB CTIP] >gi|14089964|emb|CAC13722.1| conserved hypothetical protein [Mycoplasma pulmonis] (275 aa)
Score = 180, Expect = 1.1e-11, Identities = 72/264 (27%), Positives = 135/264 (51%)
  Q:     5 QIKVVVSDMDGTLLDDS-KNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQ---DLDLNFGIPDNGYLYFPKENRHSIRLSEY-DHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSK----YEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +IK+++SD+DGT+L    K V + ++ + +K+KE      L TGR+   + +VL        + DF IG  G+  Y++K  +   +++L+ D +K     ++   + DL F + D+ +++    N   +  S +  +   K+ D+ D  + + K  ++ +  K+    V N  K F  K     E+ T   +G   F       +K +  K      N ++D V+AFGD++ND +MI     G+A+ N  D  K VA+ +     N DG+++++
  S:     7 KIKLIISDIDGTILPYGWKRVSDKTVESFQKLKENNYYTALATGREYVTIGDVLDQV----GHSDFFIGANGSFIYDIKNKKEIYSNYLNFDNVKKFSKFFKANFNNDLMF-VTDDKWIHLSDINHSHLDQSWFLANHKDKFKDIADKSINKEKISILTIVSKD--ENVYNECKGFIEKNCPEIEINTKWSSG---FFVSSKGTNKLSAAKALSTHLNSSIDQVMAFGDSENDIEMIKGVGHGIAVANALDSVKKVAKLVV-GPANKDGVFHYL 269
>gi|90961024|ref|YP_534940.1| HAD superfamily hydrolase [Lactobacillus salivarius UCC118] >gi|90820218|gb|ABD98857.1| Hydrolase, HAD superfamily [Lactobacillus salivarius UCC118] (271 aa)
Score = 180, Expect = 1.1e-11, Identities = 71/266 (26%), Positives = 118/266 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH---YQDLDLNFGI--PDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+DGTL++  K +      AI+K K +G+   +CTGR       +L +     +   +++  GGA    +  +   K  +  G   +D ++     + ++L+F +  PD  Y        +++  +    M   Y   D     P  K M + + E +   I     F    +      T    +E     VSK N +    ++  LT +NV+A GD +ND  MI  + IGVAM N     K  A  IT  DN++DG+   I K+
  S:     3 IKLIAIDIDGTLVNSKKELTAGVKAAIEKAKAQGIKVVICTGRPLPGALKLLAELGLDNDDNQYVVSFGGA----VVQSTSGKVIYHQGLTYEDFVDLEAIARKMNLHFQVISPDRIYTCNKDIGYYTLYEANLVSMGISYRTPDELRDVPLIKGMFIDEPEILDPAIADRTYFGQLEDRLEFTKTAAFYYEAYTKGVSKGNAVAKLCEELGLTAENVMAIGDEENDISMIEFAGIGVAMENAVPAVKEAANEIT-VDNDHDGVAKVIEKF 268
>gi|24378920|ref|NP_720875.1| hypothetical protein SMU.428 [Streptococcus mutans UA159] >gi|24376804|gb|AAN58181.1|AE014889_6 conserved hypothetical protein [Streptococcus mutans UA159] (275 aa)
Score = 180, Expect = 1.1e-11, Identities = 72/266 (27%), Positives = 120/266 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECK--------------KTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVG-----TPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  DMDGTLL+  K + + +I  I++    G    LCTGR              ++ Y +  +G    Q Y +  N C                 +F     + D++  Y ++DL     D  YL    +      L  YD          V L + K     V    Y+    +R  +F+ K+E       T + + P +FE M  +++K  GLK   +   ++  +++A GDA ND +M+  +   VAM N S + K+ A  +T   N++ G+   I KY
  S:     4 VKLIAIDMDGTLLNSQKEIPQENIAVIQEAARSGYKIVLCTGRMQTG----------VEPYFE-QLGLVAEQEYAILNNGCSLHTINRDWQLLTYHDLNFNGVSYLYDLLEGYPEIDLTL-TADRDYLVLADQVSE---LVAYDASLVFTQAQTVGLNDVKHAAKPVFQAMYLGES-DRLDAFQQKFECKLAEKFTTVRSQPYIFEVMPQSITKATGLKELAQKLRISRTDIMAIGDALNDLEMLKAAGFSVAMGNASPEVKAAADLVT-GSNDDAGVAQAIAKY 271
>gi|153204343|ref|ZP_01945140.1| Cof-like hydrolase [Listeria monocytogenes HPB2262] >gi|133734123|gb|EBA35821.1| Cof-like hydrolase [Listeria monocytogenes HPB2262] (279 aa)
Score = 180, Expect = 1.1e-11, Identities = 62/258 (24%), Positives = 117/258 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   +E G+   L +GR    M +V  ++ +++++   ++   GA+  +  T+E      L+ +  K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    +K++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQENGVKLILASGRPTTGM-HVYAEQLEMEKHHGLLVSYNGAKVVDCATSEELFNQALTVEEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEVINIVQYESRGGNFKLCEKDDLAAFLDYRLNKILTAGDPAYMQE--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|152975647|ref|YP_001375164.1| Cof-like hydrolase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024399|gb|ABS22169.1| Cof-like hydrolase [Bacillus cereus subsp. cytotoxis NVH 391-98] (284 aa)
Score = 180, Expect = 1.1e-11, Identities = 70/264 (26%), Positives = 139/264 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLS--------------EYDHMTAKYFDVDVYLTEPKSKVMIVCDKE-----YMPTVINRSK--SFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT---EQDNNNDGIYNFIV 269
           +K++  D+DGTLL  +K + + +  AI+K +E+G +  +CTGR        ++D  ++ + V+    II   GA  Y  KT   K+ +  +  A+ DI+ + ++  + + +  +  +Y PK    +IR                E +++ A Y +   + +    K +I  +KE     ++P   ++ K    K K++  + L+     +   E  H +  K NGL    + FN+  +N +A GD  ND  M+  + + +AM N  ++ K++  Y T   E+      +Y++++
  S:     1 MKLIAIDLDGTLLSKNKMISKENAEAIRKCQEEGHVVAICTGRS-------IVDIERLLQEVNLQCPIIAENGAVIYKDKT-MLKRYAIQNEHAL-DIVEYLEEQGMYYQLYTDKGVYVPKYGEENIRKEMEVIRNLDINISEEEVENIAALYLEHTAFHSIESCKSII--NKELYVHKFLPFSYDQQKLKRLKEKFQHNSELIISASYWHNLEINHCDAQKGNGLYTLAEYFNIPFENTVAIGDGLNDVSMMQKANVSIAMGNAVNELKAMCHYETLTNEEHGVAHALYHYVI 283
>gi|160943709|ref|ZP_02090940.1| hypothetical protein FAEPRAM212_01203 [Faecalibacterium prausnitzii M21/2] >gi|158444883|gb|EDP21886.1| hypothetical protein FAEPRAM212_01203 [Faecalibacterium prausnitzii M21/2] (273 aa)
Score = 180, Expect = 1.2e-11, Identities = 70/269 (26%), Positives = 117/269 (43%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKE----NRHSIRLSEYDHMTAKY-----FDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +S IKV+  D+DGTL +D K V   +  A+    EKG+   L +GR    +   L ++  + +    I+   G +  + +T E      L    + ++       D+         L + +E     R     +  +  T K       D+  Y+  P  K++I  D      V     + F  + ++     + P   E +   V+K   L   L+   LT +N++A GD  ND  MI  + +GVAM N     K  A Y+T  DNN+DG+   + K+
  S:     1 MSDIKVLALDLDGTLTNDQKLVTPRTRAALDAAIEKGVTIVLASGRPTAGI-QPLAEELGLDKKGGCILSYNGGKIVDCRTGETLVEKTLDPALVPELCAFAAAQDI-------AILTYNREGIVCERDKDEWANKECFTTKLPMIHVDDLASYVNYPVCKMLITLDPARRDAVCAAGQQQFAGRADL---YPSSPFFIEAVPLGVAKDGSLAELLRRMGLTRENLMACGDGLNDRSMIAYAGVGVAMQNAEQPVKDCADYVTTADNNHDGVAEAVEKF 268
>gi|150020640|ref|YP_001305994.1| Cof-like hydrolase [Thermosipho melanesiensis BI429] >gi|149793161|gb|ABR30609.1| Cof-like hydrolase [Thermosipho melanesiensis BI429] (273 aa)
Score = 180, Expect = 1.3e-11, Identities = 74/267 (27%), Positives = 134/267 (50%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF------IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----GIPDNGYLYFPKENR--HSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKE--YMPTVINRSKSFKSKYE-VGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK++++D+DGTLL+D K++ E + +A+KK  +KG+   + TGR+           +  K+YV+       ++   GA  Y    N+    + L  D  K +I+  +D  L++       D   +Y  KE++  +   L +      K  DV  Y+ E     +++  KE   +  V    + ++ K+  V   ++ G   FE+     SK + L+  L  F ++ +  +  GD+ ND  ++      VAM N  ++ K VA+++T   +NNDG   F V+ F
  S:     2 IKLILTDLDGTLLNDEKHIPERNKIALKKAMDKGIHVSIATGRNY----------YSAKKYVEELGLDVPVVFQNGAFIYMPFENKILYETPLHSDIAKQLIDFARDEGLDYILFSDFFDEKDMYMDKEHQGGYVKYLQQNSWRINKVDDVKKYILEDTVAEVVLMGKEDKILKVVEILRRKYQGKFSVVKNNVIDGWAFFEFFGKGASKEDALRFLLDYFGVSENETMFLGDSYNDIGIMKLVGFPVAMENAFEEVKKVAKFVTL--SNNDGGVGFAVEKF 271
>gi|28377370|ref|NP_784262.1| HAD superfamily hydrolase [Lactobacillus plantarum WCFS1] >gi|28270202|emb|CAD63101.1| hydrolase, HAD superfamily, Cof family [Lactobacillus plantarum WCFS1] (269 aa)
Score = 180, Expect = 1.3e-11, Identities = 68/263 (25%), Positives = 120/263 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS--------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +K++  DMDGTLL++   +  +++ AI     +G+   +CTGR  + +   L  +  I    +++I   G+    + T +      LS D   DI    + L+++  +    ++Y    N     +S Y    +   ++ +    P+         K M +     +   I +   SF  ++   T + +     E+M+P  SK N L       NLT D V+A GD  ND  M+  +   VAM N  D+ K +A+Y T + N  DG+ + I
  S:     3 VKLIAIDMDGTLLNEHSELNPATVQAINAANAQGIKVVICTGRPLSGVTPFL-KQLGIAGEDNYVITFNGSMVQTI-TGKIITGLTLSHDDYIDIETLSRKLNIHCHVESEDHIYTANRN-----ISPYTVGESALVNMPIRFRTPEEMRPDLPIVKCMFIDHAPLLDAAIKQLPASFSKRF---TIVRSEAYFLEFMNPAASKGNALATLTDHLNLTADEVMAIGDQGNDLSMLRYATNSVAMGNAIDEAKQIARYET-KTNVEDGVAHAI 263
>gi|26246797|ref|NP_752837.1| hypothetical protein c0907 [Escherichia coli CFT073] >gi|26107196|gb|AAN79380.1|AE016757_284 Hypothetical protein ybiV [Escherichia coli CFT073] (271 aa)
Score = 179, Expect = 1.4e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFSFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMSNAAENIKQIARYATD-DNNHEGTLNVI 259
>gi|167455167|ref|ZP_02321390.1| Cof-like hydrolase [Listeria monocytogenes FSL J2-064] (279 aa)
Score = 179, Expect = 1.4e-11, Identities = 62/258 (24%), Positives = 117/258 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   +E G+   L +GR    M +V  ++ +++++   ++   GA+  +  T+E      L+ +  K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    +K++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQENGVKLILASGRPTTGM-HVYAEQLEMEKHHGLLVSYNGAKVVDCATSEELFNQALTVEEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEVINIVQYESRGGNFKLCEKDDLAAFLDYRLNKILTAGDPAYMQE--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|77958157|ref|ZP_00822195.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia bercovieri ATCC 43970] (269 aa)
Score = 179, Expect = 1.4e-11, Identities = 73/266 (27%), Positives = 118/266 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSF--KSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     LS +         + + ++F   D   LY       K   H + L+          ++D  L  PK  VM++ +    P  ++R+ +      +E  T + + P   E +   V K  G+K+      +  +NV+A GD  ND  M+  + +GVAM N   + K +AQ+IT   N+ DG+   I KY
  S:     3 IELIAIDMDGTLLNPQHEITPRVKQAIDAARAKGVCVVLATGRPYIGVQRYL-RELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRKMGVSFQAFDFDTLYTANKDISKYTLHEVLLTGIPLKYRAVEEMDPTLRFPK--VMMIDE----PEALDRALAMMPAEAFERFTIMKSAPFYLEILSKRVDKGTGVKMLADHLGIAQENVMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQFITTT-NSEDGVAVAIEKY 267
>gi|146318781|ref|YP_001198493.1| HAD superfamily hydrolase [Streptococcus suis 05ZYH33] >gi|146320986|ref|YP_001200697.1| HAD superfamily hydrolase [Streptococcus suis 98HAH33] >gi|145689587|gb|ABP90093.1| Predicted hydrolase of the HAD superfamily [Streptococcus suis 05ZYH33] >gi|145691792|gb|ABP92297.1| Predicted hydrolase of the HAD superfamily [Streptococcus suis 98HAH33] (271 aa)
Score = 179, Expect = 1.4e-11, Identities = 75/266 (28%), Positives = 129/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANV--LIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDN-GYLYFPKENRHSIRL-SEYDHMTAKYFDVDVYLTEPKS------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL++ K +++  I AI +  E G    LCTGR    +A V   +++       +FII   G   ++ K         LS   I  +    ++ D+   + D   Y    ++    + L +    MT +  D    L E +S      + M V +K ++    N+     SK    + + +   L E +    SK +GLK       +  + ++A GDA+ND +MI  + +G+AM N +++ K++AQ IT+  N N+G+   I K+
  S:     2 IKLIALDMDGTLLNEKKELMQPQIDAIHQAVEAGFKIVLCTGRP---LAGVKPFVEQLGFDTEEEFIIVNNGCSTHSTKDWSLIDWEELSISDIDYLSTFIENADVQISLFDEEDYFVLAEKANARVNLDAGLVGMTPQPID----LKEAQSGQYRFFEAMFVGEKVHIDAFENQHNPVLSKRY--STVRSQDYLLEILPNGASKASGLKKLADRLGILPEEIMAMGDANNDLEMIEFAGLGIAMGNANEQVKAIAQDITDT-NENNGVAKAIEKH 267
>gi|29377525|ref|NP_816679.1| HAD superfamily hydrolase [Enterococcus faecalis V583] >gi|29344992|gb|AAO82749.1| hydrolase, haloacid dehalogenase-like family [Enterococcus faecalis V583] (258 aa)
Score = 179, Expect = 1.4e-11, Identities = 72/259 (27%), Positives = 123/259 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF---GIPDNGYLYFPKENRHSIRLSEYD----HMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           K+   D+DGTLL+  K  L+S+  A+ K++E+G L  L TGR +  MA  +I  W + ++ ++++  G A F +   +E    + L  +A++ +        L F   G+ D       K N+H     E      H  +  +D   Y      + +   D E   T       F+ +Y     +       + +  + SK+  L    K   +   N++AFGD +ND +M+ ++ IGVAM N S   + VA  +T+  N+NDGI+
  S:     4 KLFAFDIDGTLLNSEKKALDSTREALAKLREQGHLVTLATGR-SRYMAQEVI--WDL-DFTNYVLCNGAAAFVD---HEQYYQNLLHAEALERLAQDSDQRGLGFACVGLDD-----IKKSNQHRAEKMEIAMNSFHFHSPAYDEHFYRQNDIYQALAFYDAEDQCT-------FEEEYPEFRFIRWHQHSVDVVPKDGSKSATLTYLAKRVGIDAKNIIAFGDGENDREMLSHAGIGVAMGNASPSIQKVATMVTDT-NDNDGIW 249
>gi|163815223|ref|ZP_02206600.1| hypothetical protein COPEUT_01383 [Coprococcus eutactus ATCC 27759] >gi|158449418|gb|EDP26413.1| hypothetical protein COPEUT_01383 [Coprococcus eutactus ATCC 27759] (277 aa)
Score = 179, Expect = 1.4e-11, Identities = 67/265 (25%), Positives = 124/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH----------YQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKY-EVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTL +  K++   ++  I +++EKG +  + +GR    +  +  D  ++  +  +++   G +  N KT E    + L  + ++DI ++          Y    +  G   +GY+ F     H + L   D       D   Y+  P +K ++  + +    +    +   S++ +  T   + P   E M  NV K   L+  L   N+ + +++A GD  ND  MI  + +GVAM N  D  K  A YIT   N+ DG+   + K+
  S:     8 KLLALDIDGTLTNTQKDITPETLKKIIEVQEKGHVVAIASGRPLPGIRKI-ADIIQLDRFGGYVLAFNGGRIVNYKTGEVVYQAALDNEIVRDIYDYCLKVGCGMVTYDGDRVITGTDIDGYMTFEASINH-MELMRID-------DFKEYIDFPLNKCLLTAEPDKAEKI---EEELVSRFGDKVTIFRSEPYFVEIMPQNVHKATSLEKLLGVLNMDVRDLIACGDGYNDLTMIEYAGVGVAMANAQDIVKKHADYIT-LSNDEDGLVPVVDKF 270
>gi|118443531|ref|YP_877480.1| Cof-like hydrolase [Clostridium novyi NT] >gi|118133987|gb|ABK61031.1| Cof-like hydrolase [Clostridium novyi NT] (274 aa)
Score = 179, Expect = 1.5e-11, Identities = 78/265 (29%), Positives = 123/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSK-----VMIVCDKEYMPTVINRSKSFK--SKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLLD +K + + +  AIKK  EKG+   + TGR    A   AN+L            II   GA        E    S +     KDIIN  ++ + +F +     +     +PK   +    +E       + +V+  L E  +      V  +C  +    + N  K  +     E+ + L      FE M+ +VSK  G+K+    + ++ D V+  GD +ND  MI  + +GV M N  D  K  A YI +  N+NDG+   I ++
  S:     4 KLICLDMDGTLLDTNKKISDRTKNAIKKAHEKGVKIAISTGRVFISAKYYANML-------GISAPIIASNGAYIREKDKEEIIYKSPIDESLCKDIINIAKNYEFHFYLNTFDTIISAKPYPKGYTYLEMSNELPDNMKVHLEVNTNLEEEATNRNGQIVKAICISDNREILENARKEIERLGNLEIVSSLGDN---FEIMNKDVSKGKGVKVLADFYGISQDEVICMGDGENDLSMIKYAGLGVVMENAPDAIKKYADYIADT-NDNDGVAKVIEEF 271
>gi|77963654|ref|ZP_00827462.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia mollaretii ATCC 43969] (270 aa)
Score = 179, Expect = 1.5e-11, Identities = 72/268 (26%), Positives = 121/268 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNE--CKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVG--TPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           IK++  DMDGT L+D  +       A   ++KE G+ F + +G     + +   D   I   + F+   G   + + K  E  C + +    + +   +     LD+     +  Y+    +      +S+Y H   K  D    +TEP  K  I    E +P  +    +F  +   G  TP+ +G    + + P V K NG+K+  K++ +  + V+ FGD  ND +M+  +  G AM N  D  K +A+Y  E  NN+ G+ N I K  K
  S:     3 IKIIAVDMDGTFLNDQMSFDRQRFSAQYSQLKENGIRFVVASGNQYYQLISFFPD---IAHEIAFVAENGA--YVSDKNTEIFCGEIASQDTNNVLKTLLSIPYLDVIRCSKNGAYMLSSSDEDFYATMSKYYHRL-KIIDNFNQVTEPAFKFAISLPNEKLPGFM----TFIEQKLAGIVTPVSSGHGSVDLIIPGVHKANGIKLLQKNWGVKDEEVVTFGDGGNDVEMLQYAGFGYAMANAPDNIKKIAKYQAES-NNDSGVLNIIDKIIK 264
>gi|19745686|ref|NP_606822.1| hypothetical protein spyM18_0637 [Streptococcus pyogenes MGAS8232] >gi|139474213|ref|YP_001128929.1| haloacid dehalogenase-like hydrolase [Streptococcus pyogenes str. Manfredo] >gi|19747820|gb|AAL97321.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|134272460|emb|CAM30717.1| haloacid dehalogenase-like hydrolase [Streptococcus pyogenes str. Manfredo] (274 aa)
Score = 179, Expect = 1.5e-11, Identities = 74/259 (28%), Positives = 122/259 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYF--PKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  D+DGTL +  K V +++  A+   +EKG+   + TGR    + N+L +   +      I   GG    N  T E    S LS D +  I    + + L   I   G +Y    K+ RHS        +T  + +V   +  PK    +K++ V D +++   +I  S S    +E      +  I+FE M   + K  GL +  +   L   +V+A GD  ND+ M+  + +GVAM NG    K+VA  +T   N+  G+
  S:     3 IRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGRPLKAIGNLLEELDLLDHDDYSITFNGGLVQRN--TGEVLDKSSLSFDQVCQIQQALEAVGLPTDIISGGDVYSIPSKDGRHSQYHLANPLLT--FIEVTSVVELPKDITYNKIVTVTDPDFLDQQIIKLSPSLFEDFEA---FKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEANDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGV 261
>gi|160914464|ref|ZP_02076679.1| hypothetical protein EUBDOL_00468 [Eubacterium dolichum DSM 3991] >gi|158433622|gb|EDP11911.1| hypothetical protein EUBDOL_00468 [Eubacterium dolichum DSM 3991] (276 aa)
Score = 179, Expect = 1.6e-11, Identities = 69/266 (25%), Positives = 129/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEK-GLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAI-----KDIINHYQDLDLNFGIPDNGYLY-FPKENRHSIRLSEYDHMTAK-YFDVDVYLTEPKSKVMIV-CDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+D TLL+D K + E ++ AI+K +E+ G+ F + +GR    +  +L     + +  ++IIG  G         ECK    L+  A+     K+++ + + + +   +    ++Y F   +     L +YD +  +   D+D        KV+ V  D +Y+  V +  K       V     +G  L E+    V+K  GL        + ++  +A GD  ND  M+  +   VAM+N  D  K+V+ Y+T+ ++N+ G+   I ++
  S:     2 IKLIACDLDETLLNDDKKICERNLKAIRKAREEYGVKFVIASGRSCTRIKPILETLGMLHQPNEYIIGFNGGM-----VCECKDYKRLAFHALPFAKAKELVAYGKSIGICVEVFTEHHVYSFNMNDDERENLKKYDFIADECEGDIDFLKDTAIIKVLFVKPDMDYLKQVADGMKELTQGVYVS--FSSGRYL-EFNREGVNKGLGLSDLAGSLGIAMEETMAIGDNYNDVGMLKVAGTSVAMVNAHDDIKAVSSYVTQANHNDGGVAEAIERF 268
>gi|124520865|ref|ZP_01695937.1| Cof-like hydrolase [Bacillus coagulans 36D1] >gi|124497234|gb|EAY44799.1| Cof-like hydrolase [Bacillus coagulans 36D1] (285 aa)
Score = 179, Expect = 1.6e-11, Identities = 64/256 (25%), Positives = 122/256 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF-IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR-----LSEYDHMTA-----------------KYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           +K++  D DGTLL D   + E +  AI++++E+G +   C+GR  ++  ++L      K  +D  +I   GA  Y+  +++C     +    + D++   +     + +  N  +Y  ++ R  +      L E D   +                  YF     L  P  +V  +    + P  + + +S+ S  +  +   +G    E  H  VSK + L+   +  N+ L+N +A GD  ND  M   + I +AM N  ++ K+ + Y+T+  N N
  S:     1 MKLIAIDFDGTLLSDDGTISEENAGAIREVQEQGNIVVACSGRSLHDTRHILK-----KAGLDCPVITGNGAVIYD--SDQCILKLVMPDKVLDDLLPELEAQGYYYELYTNQGVYLLEKGRKRLESEMHSLHEKDETFSLEWAAGQIELQMRQYGIHYFHHYAELDLPHLEVYKIFVLSFHPERLKQLRSWLSGRQDLSMTTSGRTKLEIAHAEVSKGHALQFMARHLNIPLENTVAIGDNFNDLSMFEVAGISIAMGNAEEQVKARSTYVTKTHNKN 272
>gi|169349626|ref|ZP_02866564.1| hypothetical protein CLOSPI_00364 [Clostridium spiroforme DSM 1552] >gi|169293701|gb|EDS75834.1| hypothetical protein CLOSPI_00364 [Clostridium spiroforme DSM 1552] (268 aa)
Score = 179, Expect = 1.7e-11, Identities = 73/259 (28%), Positives = 127/259 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY---FPKENRHSIRLSEYDHMTAKYFD---VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           +VV SD+DGTLL+D   +   ++LAIKKI+++G+ F + + R  + +  +L    K    V  +I  GG    N +     +    +  A+K IIN+ +    NF I    Y +     K+      + E   + AK      +++       K++ +C+ E++  +  + K    + ++   + +  IL E  H N+SK   +K      N+ + N +AFGD  ND +M+     G+AM N     K   + +T +DNN+DGIY
  S:     3 QVVFSDVDGTLLNDQHCITPLTLLAIKKIQQQGIPFVIVSARSPSGIYPIL----KENNLVCPMICYGGGMILNHENEIIYEKGMETSLALK-IINYIEAN--NFDIAWCIYSFDDWLVKDCLDPRIIKEEQIVRAKSRQGNQIEIKKLSKVHKILCICNHEHINDLETKLKIMFKECQI---VKSSNILIEITHQNISKAFAIKKYCDLLNINIKNTIAFGDQYNDLEMLKIVGCGIAMKNAPLGIKKEVKQVT-KDNNHDGIY 256
>gi|88798963|ref|ZP_01114544.1| hydrolase, haloacid dehalogenase-like family protein [Reinekea sp. MED297] >gi|88778190|gb|EAR09384.1| hydrolase, haloacid dehalogenase-like family protein [Reinekea sp. MED297] (314 aa)
Score = 179, Expect = 1.7e-11, Identities = 64/261 (24%), Positives = 124/261 (47%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVD--------FIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIIN--HYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           M+ + I+++V DMD TLL+D   + ES++ AI+++  +G+   L +GR    M          + Y D        ++I   GA   +  T E      L+      +++  H Q+ DL+  +  +G +   + N ++   S    +  +  D +   +     KV++V   E +  +  R    K+  +  T  ++ P   E+ +  V K+  + +      +   +V+A GD+ ND  M+ +  IGVAM N  D  K++A + T  +N++
  S:    40 MNAADIRMIVMDMDDTLLNDQHQISESNLQAIQRVSAQGITIALASGRPTPAM----------ESYADLLGLTQQGYVISYNGAYVTDWSTQEQIYECSLTKAECDLLVDAAHEQNSDLHTYV--DGAIVTTRHNPYTDIESNLTGLPIRLVDSLKAVVQGTVPKVLLVAPPEQVTEM--RQIFAKTLGDHFTISISKPYFLEFTNKQVDKSAAIDVLCARLGIAKSSVMAIGDSYNDLTMLTDCGIGVAMGNAPDDIKAIANWTTASNNDH 297
>gi|86148181|ref|ZP_01066479.1| Predicted hydrolase of the HAD superfamily protein [Vibrio sp. MED222] >gi|85834028|gb|EAQ52188.1| Predicted hydrolase of the HAD superfamily protein [Vibrio sp. MED222] (275 aa)
Score = 179, Expect = 1.7e-11, Identities = 69/267 (25%), Positives = 127/267 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD---------VYLTEPKSKVMIVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKT-KSVAQYITEQDNNNDGIYNFIVKYF 272
           +K+V SD+DGTLL  +  + + + L +KK+ E+G  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +    ++ +I+   QD ++   +  N      +E+    +       + K F+ D         V+ T P+       D EY+ T   + K +F  K  +     + P   E M   VSK + L    K  NLTLDN +AFGD  ND +M+  +  G+ M    +K  K++        N +D + +++ K+ 
  S:    10 VKIVASDLDGTLLAPNHQLSDFTKLTLKKLHEQGYTFIFATGRHHVDVAGIR----QIAGIPAYMITSNGARVHD-QNDQLMYSQDVPQKLVQPVIDIVRQDPNIFIHMYQNEDWLLDREDEMLAKFHSESGFSYKRFEADNAPSDGIAKVFFTHPEQ------DHEYLVTFEQKLKDAFGDKLNIA---FSTPWCLEVMAAEVSKGHALDAVAKSLNLTLDNCVAFGDGMNDAEMLAMAGKGLIMGTSHEKVMKALPDNEVIGSNADDAVAHYLEKHL 274
>gi|56964211|ref|YP_175942.1| HAD superfamily hydrolase [Bacillus clausii KSM-K16] >gi|56910454|dbj|BAD64981.1| HAD superfamily hydrolase [Bacillus clausii KSM-K16] (257 aa)
Score = 179, Expect = 1.7e-11, Identities = 66/250 (26%), Positives = 122/250 (48%)
  Q:    12 DMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH--YQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           D+DGTLLD+ K + +S+  AI  +KEKG    + TGR A      L ++ +I  Y+     C   Q+   K  E    + L  DA  ++  +   Q+  L F +    Y    +++ + I+  +   +    ++ D+Y  +P  + ++ C++          K +++++     +   P+  + +    SK NG+   ++  N+ L NV AFGD  ND +M+   + GVAM N  +K K+ A+Y+T+  + N
  S:     9 DIDGTLLDEEKRLPQSTKQAIAALKEKGHEVAIATGR-APYFFKELREELEIDSYI-----CFNGQYVVFK-GELIYENTLDMDAFTEMERYASSQEHPLVF-MGSKTYTSNREDHPYVIKSIKTLKIDLPQYNPDLYNEQPLHQALLFCEE-------GEEKDYETRFPALRFVRWHPLSVDVLPREGSKANGIAKFIQRANIDLANVYAFGDQLNDLEMLSFVEHGVAMGNAPEKVKAQARYVTKPVHEN 245
>gi|110801694|ref|YP_697906.1| HAD family hydrolase [Clostridium perfringens SM101] >gi|110682195|gb|ABG85565.1| HAD hydrolase, IIB family [Clostridium perfringens SM101] (279 aa)
Score = 178, Expect = 1.8e-11, Identities = 80/265 (30%), Positives = 122/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIP-----------DNGYLYFPK---ENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++   + E +  AIKK  E+G+   + TGR    A   A +L  K  I       I C GA       ++    S L+ D +  I N  +  D+N   F  P           ++GY    K   E++  +  SE       +     Y       + I  D   +  +    +  K KYE    + + P  FE M+   SK   +K+     N+  + V+  GD++ND  MI  + +GVAM N  +  K  A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNNKHEISERNKEAIKKATERGVKVAVTTGRLFTSAKYYAGLLGVKTPI-------ISCNGAFIREKDEDKVIYESVLNEDQLDRIYNVIKKYDINMAYFNTPNTVISEKIVPEEHGYKVMNKMMGESKEKVMFSEGIDFREAF---KTYGKHILKAICIENDSNKLNDLFKAKEELK-KYEDLEVVSSSPSNFEVMNKGTSKGRAVKVLADILNINREEVMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDT-NENDGVAKAIEKF 276
>gi|50913841|ref|YP_059813.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS10394] >gi|50902915|gb|AAT86630.1| Hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS10394] (274 aa)
Score = 178, Expect = 1.8e-11, Identities = 75/259 (28%), Positives = 123/259 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYF--PKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYM--------PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  D+DGTL +  K V +++  A+   +EKG+   + TGR    + N+L +   +      I   GG    N  T E    S LS D I  I    + + L   I   G +Y    K+ RHS        +T  + +V      PK    +K++ V D +++        P++    ++FKS+           I+FE M   + K  GL +  +   L   +V+A GD  ND+ M+  + +GVAM NG    K+VA  +T   N+  G+
  S:     3 IRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGRPLKAIGNLLEELDLLDHDDYSITFNGGLVQRN--TGEVLDKSSLSFDQICQIQQALEAVGLPTDIISGGDVYSIPSKDGRHSQYHLANPLLT--FIEVTSVAELPKDITYNKIVTVTDPDFLDQQIIKLSPSLFEDFEAFKSR----------DIIFEIMPKGIDKAFGLNLLCQHLGLEARHVMAMGDEANDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGV 261
>gi|91209856|ref|YP_539842.1| hypothetical protein UTI89_C0825 [Escherichia coli UTI89] >gi|110641025|ref|YP_668753.1| HAD family hydrolase [Escherichia coli 536] >gi|117623001|ref|YP_851914.1| hypothetical protein APECO1_1271 [Escherichia coli APEC O1] >gi|191173741|ref|ZP_03035264.1| sugar phosphatase SupH [Escherichia coli F11] >gi|91071430|gb|ABE06311.1| hypothetical protein YbiV [Escherichia coli UTI89] >gi|110342617|gb|ABG68854.1| putative hydrolase of the HAD superfamily [Escherichia coli 536] >gi|115512125|gb|ABJ00200.1| conserved hypothetical protein YbiV [Escherichia coli APEC O1] >gi|190905991|gb|EDV65607.1| sugar phosphatase SupH [Escherichia coli F11] (271 aa)
Score = 178, Expect = 1.8e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMSNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|94989974|ref|YP_598074.1| hydrolase [Streptococcus pyogenes MGAS10270] >gi|94543482|gb|ABF33530.1| Hydrolase [Streptococcus pyogenes MGAS10270] (274 aa)
Score = 178, Expect = 1.9e-11, Identities = 75/259 (28%), Positives = 121/259 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYF--PKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  D+DGTL +  K V +++  A+   +EKG+   + TGR    + N+L +   +      I   GG    N  T E    S LS D I  I    + + L   I   G +Y    K+ RHS        +T  + +V      PK    +K++ V D +++   +I  S S    +E      +  I+FE M   + K  GL +  +   L   +V+A GD  ND+ M+  + +GVAM NG    K+VA  +T   N+  G+
  S:     3 IRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGRPLKAIGNLLEELDLLDHDDYSITFNGGLVQRN--TGEVLDKSSLSFDQICQIQQALEAVGLPTDIISGGDVYSIPSKDGRHSQYHLANPLLT--FIEVTSVAELPKDITYNKIVTVTDPDFLDQQIIKLSPSLFEDFEA---FKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEANDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGV 261
>gi|157146531|ref|YP_001453851.1| hypothetical protein CKO_02292 [Citrobacter koseri ATCC BAA-895] >gi|157083736|gb|ABV13414.1| hypothetical protein CKO_02292 [Citrobacter koseri ATCC BAA-895] (282 aa)
Score = 178, Expect = 1.9e-11, Identities = 71/263 (26%), Positives = 133/263 (50%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI--RLSEYDHM---TAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V DMDGT LDD+K    +  +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD         LNF        Y  +    S    +S++ H       Y D+D  L     K  +    + +P V++   +  S   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+DND +M+  ++   AM N +D  K++++Y T+ DNN+ G  N I
  S:    14 VKVIVIDMDGTFLDDAKKYDHARFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKD-------KQLNFVACGLKSAYVSEHAPESFVALMSKHYHRLQPVKDYQDIDDVLF----KFSLNLPDQQIPFVVDALHT--SLDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSDNDAEMLKMARYAFAMANAADNIKALSRYHTD-DNNHQGALNVI 270
>gi|68076179|ref|XP_680009.1| hypothetical protein PB001420.02.0 [Plasmodium berghei strain ANKA] >gi|56500873|emb|CAH98841.1| conserved hypothetical protein [Plasmodium berghei] (288 aa)
Score = 178, Expect = 2.0e-11, Identities = 75/258 (29%), Positives = 133/258 (51%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDL-----NFGIPDN---GYLYFPKENRHSIRLSEY--DHMTAKYFDVDVYLTEPKS-----KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           + IK+V +D+DGTLL+D+    + +I ++ K K KG+     TGR   +  +V+ +  K K  +  + G        +  N C  T   +GD I   I+HY + +L     NF    N     +++  E  H++ ++E+  ++MT +    D+   E        K++I  +K  +P V+   K ++ K+     +  T     E  H N +K  G+K   K FN++L + L  GD +ND +M+   +  +A+ N S K K +A Y+   +N+N
  S:    19 NNIKIVFTDLDGTLLNDNSKASKLNIESLVKAKNKGIKIVFATGRPIFSANDVIGEDAK-KNNLSLMPG--------IYLNGCI-TYGPNGDRI---IDHYINENLIMDIYNFSKEHNLVKHIVWYSLEKTHTLEINEHIKEYMTVECIKPDIIDEETLKNTKIYKILISLNKHNLPNVL---KIYQDKFSDQICVANTFKTYVELFHHNTNKFEGVKALCKYFNISLSDALVIGDGENDIEMLQGIETSIAVHNASSKIKQLANYVGPSNNDN 276
>gi|168143916|ref|ZP_02587145.1| hydrolase (HAD superfamily) protein [Bacillus cereus G9842] (273 aa)
Score = 178, Expect = 2.1e-11, Identities = 69/241 (28%), Positives = 120/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ L+  + D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEDVWLHTYMGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNKLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|187934444|ref|YP_001887393.1| phosphatase YidA [Clostridium botulinum B str. Eklund 17B] >gi|187722597|gb|ACD23818.1| phosphatase YidA [Clostridium botulinum B str. Eklund 17B] (275 aa)
Score = 178, Expect = 2.1e-11, Identities = 82/265 (30%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQ--DLDLNFGIPDNGYLYFPKENRHSIRLSE---YDHMTAKYF---DVDVYLTEPKSKVMIVC------DKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+   ++ E +  A+KK   KG+   + TGR    A+  A ++  K  +       I C GA   N  TNE   ++ L+ + +  I N  +  +  + +   D   +  P    H+  L+     D    K+F   D++  L    +K++ +       DK+ +  V N    F     V +        FE M  +VSK N  KI  +   +  + V+  GD +ND  MI  + +GVAM NGSD  K +A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNGHSSISERNKKALKKAVNKGVQVAISTGRIFASADYFAELIGIKTDL-------ISCNGAYIKNRSTNEIIYSNTLTNEQVLKIHNSIKGHNFRIMYYTHDTAIVDSPFPENHTYNLTNKLVSDEKKVKFFITSDINEILEIYNNKIIKIICIDNGDDKDTLFKVKNNLLKFSDIETVSSEDNN----FEIMQKDVSKGNAAKILSEKLGIKPEEVVCIGDNENDLSMIKFAGLGVAMGNGSDVIKKIANYITDT-NVNDGVAKVIEKF 273
>gi|52142861|ref|YP_083968.1| HAD superfamily hydrolase [Bacillus cereus E33L] >gi|51976330|gb|AAU17880.1| hydrolase (HAD superfamily) [Bacillus cereus E33L] (283 aa)
Score = 178, Expect = 2.1e-11, Identities = 72/266 (27%), Positives = 130/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+K +E G +  +CTGR   ++  +L++       V+    II   GA  Y  K  +  K   +      +I+N+ ++  L + +  +  +Y P     S+R              L E + + A Y +   +L+    K ++  D    + +P    I + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ QY T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRKCQEAGHVVAICTGRSIVDIERLLLE-------VNLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVNYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEYVKNSKENFDLKELETIAALYLEHTAFLSAESCKPIVETDIHVHKLLPFSYDIEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCQYET-LTNEEHGVAHALYKY 281
>gi|82543267|ref|YP_407214.1| hypothetical protein SBO_0712 [Shigella boydii Sb227] >gi|187733293|ref|YP_001880990.1| sugar phosphatase SupH [Shigella boydii CDC 3083-94] >gi|81244678|gb|ABB65386.1| conserved hypothetical protein [Shigella boydii Sb227] >gi|187430285|gb|ACD09559.1| sugar phosphatase SupH [Shigella boydii CDC 3083-94] (271 aa)
Score = 178, Expect = 2.2e-11, Identities = 65/263 (24%), Positives = 138/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++        +F     +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKAVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI--------AFDG---IMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|47095506|ref|ZP_00233115.1| Cof-like hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|153180894|ref|ZP_01933861.1| Cof-like hydrolase [Listeria monocytogenes F6900] >gi|153185949|ref|ZP_01936427.1| Cof-like hydrolase [Listeria monocytogenes J0161] >gi|153192459|ref|ZP_01939451.1| Cof-like hydrolase [Listeria monocytogenes J2818] >gi|47016116|gb|EAL07040.1| Cof-like hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|126941512|gb|EBA19397.1| Cof-like hydrolase [Listeria monocytogenes J0161] >gi|127763963|gb|EBA24781.1| Cof-like hydrolase [Listeria monocytogenes J2818] >gi|133731412|gb|EBA33110.1| Cof-like hydrolase [Listeria monocytogenes F6900] (279 aa)
Score = 178, Expect = 2.2e-11, Identities = 61/258 (23%), Positives = 117/258 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   ++ G+   L +GR    M +V  ++ +++++   ++   GA+  +  T+E      L+ +  K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    +K++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQQNGVKLILASGRPTTGM-HVYAEQLEMEKHHGLLVSYNGAKVVDCATSEELFNQALTVEEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEVINIVQYESRGGNFKLCEKDDLAAFLDYRLNKILTAGDPAYMQE--NYQAMMAPFKDALNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|46908877|ref|YP_015266.1| Cof-like hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47092319|ref|ZP_00230110.1| Cof-like hydrolase [Listeria monocytogenes str. 4b H7858] >gi|46882150|gb|AAT05443.1| Cof-like hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47019298|gb|EAL10040.1| Cof-like hydrolase [Listeria monocytogenes str. 4b H7858] (279 aa)
Score = 178, Expect = 2.2e-11, Identities = 61/258 (23%), Positives = 117/258 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   ++ G+   L +GR    M +V  ++ +++++   ++   GA+  +  T+E      L+ +  K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    +K++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQQNGVKLILASGRPTTGM-HVYAEQLEMEKHHGLLVSYNGAKVVDCATSEELFNQALTVEEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEVINIVQYESRGGNFKLCEKDDLAAFLDYRLNKILTAGDPAYMQE--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|160915728|ref|ZP_02077936.1| hypothetical protein EUBDOL_01737 [Eubacterium dolichum DSM 3991] >gi|158432204|gb|EDP10493.1| hypothetical protein EUBDOL_01737 [Eubacterium dolichum DSM 3991] (296 aa)
Score = 177, Expect = 2.4e-11, Identities = 69/268 (25%), Positives = 127/268 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYL--------YFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR------------------SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           IK +  DMDGTLL+ +  ++  +   +  ++++G+   L +GR    +      + ++  Y  +++   G   Y++K ++ K+ +  S    KD+  ++++  +   G  D+G L         + K  R   ++ +    TA  F V   + E       + D+  +  + N+                     FK  Y +G   +T     E M   V+K +GL    +   +T D +LAFGD +ND  M+      +AM N  D  K  A ++T   NN++GI   I  YF+
  S:     2 IKAIAMDMDGTLLNSNDEIMPQTKQTLIALEKQGVRLVLSSGRSYRRLMK-YAKELEMDRYGGYLVEVNGIALYDVKQDQRKRLASFSLSECKDLFAYFKNKGMEVIGNMDDGLLCYMTEEIYEYKKHYRKEHKIPKDFPWTAGAFSVLSDMREGYPHQRYIQDESEIDVIFNKICVTHFDSQRVAAIMEQAKHDFKDSYWLG---LTTKRWLEVMPKGVTKASGLSAFCEASGITFDEILAFGDGENDIAMLDACGKAIAMENALDSVKKHADFVTAT-NNDEGIAKGIA-YFR 290
>gi|168266909|ref|ZP_02688874.1| Cof-like hydrolase [Listeria monocytogenes FSL J2-071] (279 aa)
Score = 177, Expect = 2.5e-11, Identities = 61/258 (23%), Positives = 116/258 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   +E G+   L +GR    M +   ++ +++++   ++   GA+  +  T+E      L+ +  K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    +K++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKQISPETKKALITAQENGVKLILASGRPTTGM-HAYAEQLEMEKHHGLLVSYNGAKVVDCATSEELFNQALTVEEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEVINIVQYESRGGNFKLCEKDDLAAFLDYRLNKILTAGDPAYMQE--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|153176315|ref|ZP_01931574.1| Cof-like hydrolase [Listeria monocytogenes FSL N3-165] >gi|133729028|gb|EBA30726.1| Cof-like hydrolase [Listeria monocytogenes FSL N3-165] (270 aa)
Score = 177, Expect = 2.5e-11, Identities = 69/262 (26%), Positives = 118/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++  D+DGTLL+D+  +  +   +IK  K KG+   LCTGR    +   LI+   + E  D+ I   GA      + +      L+   +++I       ++N    D   +Y P      I   +   +    + + V         SKVM++   E +  VI +  ++ K K+ V   + + P   E++   V+K + L        +    V++ GD +ND  MI  + +GVAM N ++  K +A Y T   NN DG+   I
  S:     3 KIIAIDIDGTLLNDTHEITSAVRDSIKAAKAKGVKVVLCTGRPLAGIKKSLIELDLLDEG-DYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENVNVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKITDVIKKLPENIKEKFYV---VRSVPYNLEFLQKGVNKGSALASLADKLGVDQSEVMSIGDQENDITMIEYAGMGVAMGNATEHIKEIANYTTTT-NNEDGVAQAI 263
>gi|77976620|ref|ZP_00832099.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia intermedia ATCC 29909] (269 aa)
Score = 177, Expect = 2.5e-11, Identities = 69/266 (25%), Positives = 118/266 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     +S +         + +D++F   D   LY       K   H + L+          ++D  L  PK  VM++ + E + + +    +    +E  T + + P   E +   V K  G+K+      +  +NV+A GD  ND  M+  + +GVAM N   + K +AQ++T   N+ +G+   I K+
  S:     3 IELIAIDMDGTLLNPQHEITPRVKQAIDAARAKGVCVVLATGRPYIGVQRYL-RELNMQNSGDYCISNNGALVQKAATGECILQETISFEDYLYFEALSRKMDVSFQAFDFDTLYTANKDISKYTLHEVLLTGIPLKYRAIEEMDPTLRFPK--VMMIDEPEKLDSALAMMPA--EAFERFTIMKSAPFYLEILSKRVDKGTGVKMLADHLGIAQENVMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQFVT-HTNSEEGVAVAIEKF 267
>gi|15672719|ref|NP_266893.1| hypothetical protein L143879 [Lactococcus lactis subsp. lactis Il1403] >gi|12723652|gb|AAK04835.1|AE006307_5 conserved hypothetical protein [Lactococcus lactis subsp. lactis Il1403] (462 aa)
Score = 177, Expect = 2.6e-11, Identities = 72/266 (27%), Positives = 128/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH----YQDLDLN--FGIPDNGYLYFPKENRHSIRLS-------------EYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK V  D+DGTL   ++ V  S+  AI+++++K +  G+ TGR    +  +L D       +DF +   G   +  K  E    + L   ++K++IN+    + D+ L    G+  +G L F  E R +  LS              + H+  +    +  L + + +V+    +  M    N +   +  +       + P   + +  +  K  G++   + +  TLD V+ FGD++ND  MI     G+AM N   + K++A YIT+  NN DGI   +  Y
  S:     3 IKAVFFDLDGTLFTSTRGVATSTRKAIQELRQKDIFVGIATGRGPAFVMPLLEDL-----DLDFAVSYNGQYIFTPK--EVIFQNPLEQKSLKNLINYATENHSDISLGTAHGVNGSGLLKF-GETRLASFLSGVLPSGTSGVARNSFKHIIRRVLPQNSNLADNEEEVIY---QAMMVATRNETARLQEAFPELLVTRSNPYSVDLISKSGGKLPGIQRLGEHYGFTLDQVMCFGDSENDLTMISGVGYGIAMGNAVPEVKNIATYITDT-NNQDGIAKALAYY 275
>gi|60679758|ref|YP_209902.1| putative haloacid dehalogenase-like hydrolase [Bacteroides fragilis NCTC 9343] >gi|60491192|emb|CAH05940.1| putative haloacid dehalogenase-like hydrolase [Bacteroides fragilis NCTC 9343] (278 aa)
Score = 177, Expect = 2.6e-11, Identities = 65/266 (24%), Positives = 115/266 (43%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY--LTEPKSKVMIVCD-KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++V D+DGTL +  K +   +  A+ +++++G+   L +GR    +   L D+ ++KE+  FI+   G +  +  T E    + L  + I  +        L     D  Y+     +   +R   + +    Y   D    +  P  K +IV +    +P     S   + +  V     + P   E +   + K   L + L   N+  + ++A GD  ND  MI  + +GVAM N  +  K  A YIT   N  DG+   + K+F
  S:     4 KLLVLDLDGTLTNAKKEITLHNREALIRVQQQGVKLILASGRPTFGIVP-LADELRMKEFGGFILSYNGGEIIDWSTGEIVYANVLPDEVIPRLYECATRNQLPILTYDRQYIITEYPDDVYVRKEAFLNKMQIYPSTDFLKDIRLPLPKCLIVGEPHRLIPIEAELSVELQGQLSV---YRSEPFFLELVPQGIDKAQSLSVLLNKLNMNREEMVAVGDGYNDLSMIQFAGLGVAMGNAQEPVKKAADYIT-LSNEEDGVAAVVNKFF 267
>gi|123444338|ref|YP_001008303.1| sugar phosphatase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122091299|emb|CAL14185.1| putative haloacid dehalogenase-like hydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] (269 aa)
Score = 177, Expect = 2.7e-11, Identities = 70/266 (26%), Positives = 118/266 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     LS +         +++ ++F   D   LY       K   H + L+          ++D  L  PK  VM++ + E +   +    +    +E  T + + P   E +   V K  G+K+     ++  +N++A GD  ND  M+  + +GVAM N   + K +AQ++T   N+ DG+   I KY
  S:     3 IELIAIDMDGTLLNTQHEITPRVKQAIDAARAKGVCVVLATGRPYIGVQRYL-RELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSREMGVSFQAFDFDTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPK--VMMIDEPEKLDRALAMIPA--EAFERFTIMKSAPFYLEILSKRVDKGTGVKMLADHLDIPQENIMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQFVTGT-NSEDGVAMAIEKY 267
>gi|21909936|ref|NP_664204.1| hypothetical protein SpyM3_0400 [Streptococcus pyogenes MGAS315] >gi|28896367|ref|NP_802717.1| hypothetical protein SPs1455 [Streptococcus pyogenes SSI-1] >gi|71903118|ref|YP_279921.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS6180] >gi|94988094|ref|YP_596195.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS9429] >gi|94991981|ref|YP_600080.1| hydrolase [Streptococcus pyogenes MGAS2096] >gi|21904124|gb|AAM79007.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811618|dbj|BAC64550.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] >gi|71802213|gb|AAX71566.1| hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS6180] >gi|94541602|gb|ABF31651.1| hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS9429] >gi|94545489|gb|ABF35536.1| Hydrolase [Streptococcus pyogenes MGAS2096] (274 aa)
Score = 177, Expect = 2.7e-11, Identities = 74/259 (28%), Positives = 121/259 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYF--PKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  D+DGTL +  K V +++  A+   +EKG+   + TGR    + N+L +   +      I   GG    N  T E    S LS D +  I    + + L   I   G +Y    K+ RHS        +T  + +V      PK    +K++ V D +++   +I  S S    +E      +  I+FE M   + K  GL +  +   L   +V+A GD  ND+ M+  + +GVAM NG    K+VA  +T   N+  G+
  S:     3 IRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGRPLKAIGNLLEELDLLDHDDYSITFNGGLVQRN--TGEVLDKSSLSFDQVCQIQQALEAVGLPTDIISGGDVYSIPSKDGRHSQYHLANPLLT--FIEVTSVAELPKDITYNKIVTVTDPDFLDQQIIKLSPSLFEDFEA---FKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEANDFAMLEWAGLGVAMANGVSGAKAVADAVTTLTNDESGV 261
>gi|21909972|ref|NP_664240.1| hypothetical protein SpyM3_0436 [Streptococcus pyogenes MGAS315] >gi|28896331|ref|NP_802681.1| hypothetical protein SPs1419 [Streptococcus pyogenes SSI-1] >gi|21904161|gb|AAM79043.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811582|dbj|BAC64514.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] (269 aa)
Score = 177, Expect = 2.8e-11, Identities = 66/266 (24%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + + +    A+++ K +G+   + TGR    + + L+++ ++    + +I   G    + +T E      ++ D   +     + L ++        +Y    N  ++++  S   +M   Y   +    +   K+M++ + + +   I +  + F  KY   T + + P   E+M   VSK N +K   K   L +   +A GDA+ND  M+      V M NG  + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGRPIAGVIS-LLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLGVHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLDAAIKQIPQHFFDKY---TIVKSTPFYLEFMPKTVSKGNAIKYLAKKLGLDMSQTMAIGDAENDRAMLEVVANPVVMENGVPELKKIAKYIT-KSNNDSGVAHAIRKW 266
>gi|154497163|ref|ZP_02035859.1| hypothetical protein BACCAP_01456 [Bacteroides capillosus ATCC 29799] >gi|150273562|gb|EDN00690.1| hypothetical protein BACCAP_01456 [Bacteroides capillosus ATCC 29799] (279 aa)
Score = 177, Expect = 2.9e-11, Identities = 68/267 (25%), Positives = 116/267 (43%)
  Q:     5 QIKVVVSDMDGT-LLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLT----------EPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV---TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +I ++  D+DGT LLDD K        A+    +KG+     TGR    +   +       ++ D  + C G++   L+T E  +  ++  DA   +I     + L+  +   G LY  +E+    R    +H  A YF ++  LT          E  ++  +  DK  +P V    ++   +     P+    + P   E  H   +K NG+  A +   +     +A GD+ ND  M+  + +GVAM     + K  A  +T   N  DG    I +Y
  S:     2 EISLLAMDLDGTALLDDHKTFTPRLYAALSAAAQKGVAIVPTTGRQYAMLPPAVHTG---ADWEDLCVLCNGSEVRRLRTGELLEAHYIEADAAGQMIEIAARMGLSVELSAGGLLYLTRESWDMQR----EHEDALYFHLNNILTTRGRTVSALEEVLNQPELALDKVNLPYVPQELRAEVEELLKAAPVSYAWSSPHSVEVTHSQATKANGMLAACRILGVDPARTMAIGDSGNDIPMLKAAALGVAMGTAPQEVKDAADTVTAS-NLEDGAAMVIERY 274
>gi|166032104|ref|ZP_02234933.1| hypothetical protein DORFOR_01807 [Dorea formicigenerans ATCC 27755] >gi|166027827|gb|EDR46584.1| hypothetical protein DORFOR_01807 [Dorea formicigenerans ATCC 27755] (270 aa)
Score = 176, Expect = 3.0e-11, Identities = 66/267 (24%), Positives = 127/267 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDA---IKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHM-TAKYFDVDVYLTEPKS-KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +++  D+DGTL +  K +  S+  A+  I++ G    L +GR +  +   L ++  + +Y  +I+   G +  + ++ E   + +L  D    + +I+  Y  +D+     D   +     N +S + S  +HM   K  D   Y+T+  + K +I  + E +  V  ++++ K  +   +   + P   E M   + K + L   L    L+ D ++  GD  ND  MI  + +GVAM N     K  A YIT + N+ DG+ + I ++ +
  S:     4 QLLALDLDGTLTNSRKEITPSTRDALIDIQKNGKKVVLASGRPSQGVLP-LAEELHLGDYGSYILSYNGGRITDCRSGEIIYSKYLPNDVAAPLLEIVKKYPGIDI-LAYTDTELISGGDTNEYSEKESFINHMPITKVDDFVSYVTKNNNNKFLITGEPELIQEV--KAEAEKQFHSYLSIYCSDPFFLEIMPQGIDKAHSLTKLLTSIGLSTDAMICCGDGYNDMTMIETAGLGVAMANAQPLVKESADYIT-KSNDEDGVLHVINEFMR 270
>gi|153168860|ref|ZP_01928621.1| Cof-like hydrolase [Listeria monocytogenes FSL N1-017] >gi|167015790|ref|ZP_02278323.1| Cof-like hydrolase [Listeria monocytogenes FSL J1-194] >gi|167218486|ref|ZP_02288122.1| Cof-like hydrolase [Listeria monocytogenes FSL J1-175] >gi|133726094|gb|EBA27792.1| Cof-like hydrolase [Listeria monocytogenes FSL N1-017] (279 aa)
Score = 176, Expect = 3.0e-11, Identities = 61/258 (23%), Positives = 117/258 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   ++ G+   L +GR    M +V  ++ +++++   ++   GA+  +  T+E      L+ +  K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    +K++   D  YM    N         +    + T    FE+    + K   L   L    +  +NV+AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQQNGVKLILASGRPTTGM-HVYAEQLEMEKHHGLLVSYNGAKVVDCATSEELFNQALTVEEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEVINIVQYESRGGNFKLCEKDDLAAFLDYRLNKILTAGDPAYMQE--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENVIAFGDGHNDITMVEYAGTGIAMQNAVPELKAAASSVT-LSNNEDGI 269
>gi|166982654|ref|ZP_02254086.1| hydrolase, haloacid dehalogenase-like family protein [Bacillus cereus AH187] (273 aa)
Score = 176, Expect = 3.1e-11, Identities = 68/241 (28%), Positives = 120/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ ++  + D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEDVWIHTYMGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|182625736|ref|ZP_02953504.1| HAD hydrolase, IIB family [Clostridium perfringens D str. JGS1721] >gi|177908998|gb|EDT71480.1| HAD hydrolase, IIB family [Clostridium perfringens D str. JGS1721] (279 aa)
Score = 176, Expect = 3.2e-11, Identities = 80/265 (30%), Positives = 130/265 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIPDN--GYLYFPKENRHSI--RL---SEYDHMTAKYFDV-DVYLTEPKSKVMIVC---DKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++   + E +  AIKK  E+G+   + TGR    A   A +L  K  I       I C GA       ++    S L+ D +  I +  +  D+N   F  P+        P+E+ + +  R+   S+   M ++  D  + + T  K  +  +C   D   +  +    +  K KYE    + + P  FE M+   SK   +K+     N+T + ++  GD++ND  MI  + +GVAM N  +  K  A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNNKHEISERNKEAIKKATERGVKVAVTTGRLFASAKYYAGLLGVKTPI-------ISCNGAFIREKDKDKVIYESVLNEDQLDRIYDVIKKYDINMAYFNTPNTVISEKIVPEEHGYKVMNRMMGESKEKVMFSEGIDFKEAFKTYGKHILKAICIENDSNKLNDLFKAKEELK-KYEDLEVVSSSPSNFEVMNKGTSKGCAVKVLADILNITREEIMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDT-NENDGVAKAIEKF 276
>gi|192810226|ref|ZP_03038899.1| Cof-like hydrolase [Geobacillus sp. Y412MC10] >gi|192800518|gb|EDV77025.1| Cof-like hydrolase [Geobacillus sp. Y412MC10] (268 aa)
Score = 176, Expect = 3.3e-11, Identities = 70/269 (26%), Positives = 124/269 (46%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD--VYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           ++  K++  D+D TL++D K V      A+++    G++  L TGR A   A  +  +  +      II   GA   NL   +     F+  DA   +  +  + +L+     +  LY  +EN+  I     +  T  Y + D    + +P  K++I+ D +Y+  +I   +         T   + P   E+MH   +K + L      F   L   +A GD+ ND++M+  + +GVAM N  +  K++A Y+T   NN DG+ + I K+
  S:     1 MTTYKLMAIDIDDTLINDDKEVTPGVQQALEQAVAHGVVVTLATGR-AYASAQAIARQTGLNVP---IITYQGALIKNLLDEKVLYERFVPADAAVKLFEYCVEHNLHLQTYIDDKLYAREENQKLIDYCALNR-TPYYIEPDFMTMVQKPTPKMLIIDDPDYLDELIPIFRELLGDEVHITK--SKPHFLEFMHKEGTKGHALTFLADHFGCDLKETIAVGDSWNDHEMLEAAGLGVAMGNSIEPLKAIADYVT-LGNNEDGVKHVIDKF 263
>gi|94993927|ref|YP_602025.1| Hydrolase [Streptococcus pyogenes MGAS10750] >gi|94547435|gb|ABF37481.1| Hydrolase [Streptococcus pyogenes MGAS10750] (269 aa)
Score = 176, Expect = 3.4e-11, Identities = 66/266 (24%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + + +    A+++ K +G+   + TGR    + + L+++ ++    + +I   G    + +T E      ++ D   +     + L ++        +Y    N  ++++  S   +M   Y   +    +   K+M++ + + +   I +  + F  KY   T + + P   E+M   VSK N +K   K   L +   +A GDA+ND  M+      V M NG  + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGRPIAGVIS-LLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFMSRKLGVHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLDAAIKQIPQHFFDKY---TIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAENDRAMLEVVANPVVMENGVPELKKIAKYIT-KSNNDSGVAHAIRKW 266
>gi|170682885|ref|YP_001742927.1| sugar phosphatase SupH [Escherichia coli SMS-3-5] >gi|170520603|gb|ACB18781.1| sugar phosphatase SupH [Escherichia coli SMS-3-5] (271 aa)
Score = 176, Expect = 3.5e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|24112189|ref|NP_706699.1| hypothetical protein SF0772 [Shigella flexneri 2a str. 301] >gi|30062305|ref|NP_836476.1| hypothetical protein S0815 [Shigella flexneri 2a str. 2457T] >gi|110804821|ref|YP_688341.1| hypothetical protein SFV_0805 [Shigella flexneri 5 str. 8401] >gi|24051031|gb|AAN42406.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30040550|gb|AAP16282.1| hypothetical protein S0815 [Shigella flexneri 2a str. 2457T] >gi|110614369|gb|ABF03036.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (271 aa)
Score = 176, Expect = 3.5e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|188495558|ref|ZP_03002828.1| sugar phosphatase SupH [Escherichia coli 53638] >gi|188490757|gb|EDU65860.1| sugar phosphatase SupH [Escherichia coli 53638] (271 aa)
Score = 176, Expect = 3.5e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSKNAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|16802206|ref|NP_463691.1| hypothetical protein lmo0158 [Listeria monocytogenes EGD-e] >gi|47096976|ref|ZP_00234551.1| Cof-like hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|153181178|ref|ZP_01934145.1| Cof-like hydrolase [Listeria monocytogenes F6900] >gi|167211213|ref|ZP_02281520.1| hypothetical protein LmonL_01347 [Listeria monocytogenes LO28] >gi|16409517|emb|CAC98373.1| lmo0158 [Listeria monocytogenes] >gi|47014639|gb|EAL05597.1| Cof-like hydrolase [Listeria monocytogenes str. 1/2a F6854] >gi|133731696|gb|EBA33394.1| Cof-like hydrolase [Listeria monocytogenes F6900] (270 aa)
Score = 176, Expect = 3.5e-11, Identities = 69/262 (26%), Positives = 118/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++  D+DGTLL+D+  +  +   +IK  K KG+   LCTGR    +   LI+   + E  D+ I   GA      + +      L+   +++I       ++N    D   +Y P      I   +   +    + + V         SKVM++   E +  VI +  ++ K K+ V   + + P   E++   V+K + L        +    V++ GD +ND  MI  + +GVAM N ++  K +A Y T   NN DG+   I
  S:     3 KIIAIDIDGTLLNDTHEITPAVRDSIKAAKAKGVKVVLCTGRPLAGIKKSLIELDLLDEG-DYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENVNVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKITDVIKKLPENIKEKFYV---VRSVPYNLEFLQKGVNKGSALASLADKLGVDQSEVMSIGDQENDITMIEYAGMGVAMGNATEHIKEIANYTTTT-NNEDGVAQAI 263
>gi|139474176|ref|YP_001128892.1| haloacid dehalogenase-like hydrolase [Streptococcus pyogenes str. Manfredo] >gi|134272423|emb|CAM30679.1| haloacid dehalogenase-like hydrolase [Streptococcus pyogenes str. Manfredo] (269 aa)
Score = 176, Expect = 3.6e-11, Identities = 66/266 (24%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + + +    A+++ K +G+   + TGR    + + L+++ ++    + +I   G    + +T E      ++ D   +     + L ++        +Y    N  ++++  S   +M   Y   +    +   K+M++ + + +   I +  + F  KY   T + + P   E+M   VSK N +K   K   L +   +A GDA+ND  M+      V M NG  + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGRPIAGVIS-LLEQLELSHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLGVHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLDAAIKQIPQHFFDKY---TIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAENDRAMLEVVANPVVMENGVPELKKIAKYIT-KSNNDSGVAHAIRKW 266
>gi|74311367|ref|YP_309786.1| hypothetical protein SSON_0804 [Shigella sonnei Ss046] >gi|194433146|ref|ZP_03065428.1| sugar phosphatase SupH [Shigella dysenteriae 1012] >gi|73854844|gb|AAZ87551.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|194418643|gb|EDX34730.1| sugar phosphatase SupH [Shigella dysenteriae 1012] (271 aa)
Score = 176, Expect = 3.6e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKAVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|42519210|ref|NP_965140.1| hypothetical protein LJ1285 [Lactobacillus johnsonii NCC 533] >gi|41583498|gb|AAS09106.1| hypothetical protein LJ_1285 [Lactobacillus johnsonii NCC 533] (270 aa)
Score = 176, Expect = 3.7e-11, Identities = 73/268 (27%), Positives = 113/268 (42%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF--GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           +  IK++  D+DGTLL+  K +      AI K K  G+   + TGR  + +  +L +   + +  D  + C G                L+ D   D+      L L+F    PD  Y        +++  +   ++   Y         P  K M V +K+ +   I   K F    +  T   T P  +E     VSK N LK      NL+ +N++A GD +ND  MI  + +GVAM N     K  AQ +T  D ++DG+   I K
  S:     1 MKNIKIIAIDVDGTLLNSKKELTPKVRNAILKAKSAGIKIVIATGRPLSGVEKILTE-LGLNDQEDQYVVCFGGGVVETTAGNVLFEKKLTYDNYLDLETISLKLGLHFHASAPDRIYTADRDIGDYTLYEANLVNLGISYRTPAEMKDIPIIKCMYVDEKDLLDQKIADHKPFAHLDDKITFTKTAPFYYEANPKGVSKGNALKFLCHKLNLSSENLMAIGDEENDLSMIKLAGVGVAMGNAVPAVKEAAQRVT-SDCDHDGVAEAIEK 268
>gi|157158127|ref|YP_001462018.1| sugar phosphatase SupH [Escherichia coli E24377A] >gi|157080157|gb|ABV19865.1| sugar phosphatase SupH [Escherichia coli E24377A] (271 aa)
Score = 176, Expect = 3.7e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKAVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|167756059|ref|ZP_02428186.1| hypothetical protein CLORAM_01579 [Clostridium ramosum DSM 1402] >gi|167704051|gb|EDS18630.1| hypothetical protein CLORAM_01579 [Clostridium ramosum DSM 1402] (272 aa)
Score = 176, Expect = 3.7e-11, Identities = 64/259 (24%), Positives = 118/259 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNM---ANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLS-EYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           K++  D+DGTL    K +L  +   ++++ ++G++  L +GR    +   AN L    ++ +   +++   GA+  + KT E              +    +  +L      +  +    E    + +  + +HM  K+ D     +    +KV++    EY  T+++    FK+ Y     +  + P   E M   + K   L+  ++   +  D V++FGD  ND  MI  +K GVAM N  D+ K  A YIT   N+ +GIY
  S:     4 KLIALDLDGTLKSTDKQILPKTKAILQELAKRGVVIVLASGRPTAGLYAEANEL----ELDKTGGYLLSFNGAKVVDYKTKEIIYQKVYDAKTAHQVYERAKQYNLAVMTYTDELILTEDETDEYVCIEGDINHMPIKHIDNFKDAVNFSVNKVLLTAKPEYAETILDE---FKAPYGDSLSIYRSAPFFIEVMAQGIDKAASLQALIERLGIKRDEVISFGDGYNDLSMIEFAKFGVAMANAVDEVKKRAAYIT-LSNDEEGIY 260
>gi|125527647|gb|EAY75761.1| hypothetical protein OsI_003608 [Oryza sativa (indica cultivar-group)] (565 aa)
Score = 176, Expect = 3.8e-11, Identities = 72/258 (27%), Positives = 121/258 (46%)
  Q:    14 DGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR------DANNMANVLIDKWKIKEYVD-------FIIGCGGAQFY--NLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG--PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           DGTLL+    V   +  A+++ + +G+   + TG+      DA NM ++      + E           + G  G + Y  NL    C++    S +    ++   QD   + +  P    L++      +  +S  D +           T    KV+ +   E + + +   + F  K   G  LV    P + E + P  SK NG+KI L    ++ D V+A GD +ND +M+  + +GVA+ NGS+KTK+VA  I    N+ DG+   I  Y
  S:   301 DGTLLNSKSQVTARNAEALREARSRGVNIVIATGKARPAVIDALNMVDLSGRTGIVSESSPGIFLQGLLVYGLQGREIYKRNLDQEVCREALLYSLEQKVPLVAFSQDRCFSMYDDPLVDSLHYVYHEPKAEIVSSIDQLLG---------TAEIQKVLFLETPEGISSAL---RPFWEKAIEGRALVVQAQPDMLELVPPATSKGNGVKILLDHLCISPDEVMAIGDGENDIEMLQLASLGVALANGSEKTKAVANIIGAT-NDEDGVAQAIYDY 563
>gi|71903157|ref|YP_279960.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS6180] >gi|71802252|gb|AAX71605.1| hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS6180] (269 aa)
Score = 176, Expect = 3.8e-11, Identities = 66/266 (24%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + + +    A+++ K +G+   + TGR    + + L+++ ++    + +I   G    + +T E      ++ D   +     + L ++        +Y    N  ++++  S   +M   Y   +    +   K+M++ + + +   I +  + F  KY   T + + P   E+M   VSK N +K   K   L +   +A GDA+ND  M+      V M NG  + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHMVIATGRPIAGVIS-LLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLGVHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLDAAIKQIPQHFFDKY---TIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAENDRAMLEVVANPVVMENGVPELKKIAKYIT-KSNNDSGVAHAIRKW 266
>gi|193064455|ref|ZP_03045536.1| sugar phosphatase SupH [Escherichia coli E22] >gi|194428199|ref|ZP_03060742.1| sugar phosphatase SupH [Escherichia coli B171] >gi|192928917|gb|EDV82530.1| sugar phosphatase SupH [Escherichia coli E22] >gi|194413759|gb|EDX30038.1| sugar phosphatase SupH [Escherichia coli B171] (271 aa)
Score = 176, Expect = 3.8e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPHFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKAVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|16128790|ref|NP_415343.1| predicted hydrolase [Escherichia coli str. K-12 substr. MG1655] >gi|89107673|ref|AP_001453.1| predicted hydrolase [Escherichia coli W3110] >gi|170080481|ref|YP_001729801.1| hydrolase [Escherichia coli str. K12 substr. DH10B] >gi|194438378|ref|ZP_03070468.1| sugar phosphatase SupH [Escherichia coli 101-1] >gi|7388459|sp|P75792|SUPH_ECOLI Sugar phosphatase supH >gi|1787043|gb|AAC73909.1| predicted hydrolase [Escherichia coli str. K-12 substr. MG1655] >gi|4062389|dbj|BAA35503.1| predicted hydrolase [Escherichia coli W3110] >gi|169888316|gb|ACB02023.1| predicted hydrolase [Escherichia coli str. K12 substr. DH10B] >gi|194422602|gb|EDX38599.1| sugar phosphatase SupH [Escherichia coli 101-1] (271 aa)
Score = 176, Expect = 3.8e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHV-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|49477808|ref|YP_036744.1| HAD superfamily hydrolase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49329364|gb|AAT60010.1| hydrolase (HAD superfamily) [Bacillus thuringiensis serovar konkukian str. 97-27] (283 aa)
Score = 176, Expect = 3.8e-11, Identities = 71/266 (26%), Positives = 130/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+K +E G +  +CTGR   ++  +L++       V+    II   GA  Y  K  +  K   +      +I+N+ ++  L + +  +  +Y P     S+R              L E + + A Y +   +L+    K ++  D    + +P    + + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ QY T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRKCQEAGHVVAICTGRSIVDIERLLLE-------VNLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVNYLEENSLYYQLYTDKGVYVPDYGVESVRNEIEYVKNSKENFDLKELETIAALYLEHTAFLSAESCKPIVETDIHVHKLLPFSYDMEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCQYET-LTNEEHGVAHALYKY 281
>gi|94988133|ref|YP_596234.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS9429] >gi|94992021|ref|YP_600120.1| hydrolase [Streptococcus pyogenes MGAS2096] >gi|94541641|gb|ABF31690.1| hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS9429] >gi|94545529|gb|ABF35576.1| Hydrolase [Streptococcus pyogenes MGAS2096] (269 aa)
Score = 175, Expect = 3.9e-11, Identities = 66/266 (24%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + + +    A+++ K +G+   + TGR    + + L+++ ++    + +I   G    + +T E      ++ D   +     + L ++        +Y    N  ++++  S   +M   Y   +    +   K+M++ + + +   I +  + F  KY   T + + P   E+M   VSK N +K   K   L +   +A GDA+ND  M+      V M NG  + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGRPIAGVIS-LLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLGIHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLDAAIKQIPQHFFDKY---TIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAENDRAMLEVVANPVVMENGVPELKKIAKYIT-KSNNDSGVAHAIRKW 266
>gi|94990015|ref|YP_598115.1| hydrolase [Streptococcus pyogenes MGAS10270] >gi|94543523|gb|ABF33571.1| Hydrolase [Streptococcus pyogenes MGAS10270] (269 aa)
Score = 175, Expect = 3.9e-11, Identities = 66/266 (24%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + + +    A+++ K +G+   + TGR    + + L+++ ++    + +I   G    + +T E      ++ D   +     + L ++        +Y    N  ++++  S   +M   Y   +    +   K+M++ + + +   I +  + F  KY   T + + P   E+M   VSK N +K   K   L +   +A GDA+ND  M+      V M NG  + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAVDIDGTLLTDDRRITDDVFQAVQEAKSQGVHVVIATGRPIAGVIS-LLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLGVHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLDAAIKQIPQHFFDKY---TIVKSTPFYLEFMPKTVSKGNAIKHLAKKLRLDMSQTMAIGDAENDRAMLEVVANPVVMENGVPELKKIAKYIT-KSNNDSGVAHAIRKW 266
>gi|149183774|ref|ZP_01862178.1| YitU [Bacillus sp. SG-1] >gi|148848527|gb|EDL62773.1| YitU [Bacillus sp. SG-1] (278 aa)
Score = 175, Expect = 4.0e-11, Identities = 70/266 (26%), Positives = 122/266 (45%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYV--DFIIGCGGAQFYN-LKTNECKKTSFLSGDAIKDIINHYQDLDLNF-----GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           ++V D+DGTLL D K + E +   + K +E G    + TGR           +   KE V    I+   GA  ++ L  N       +  +  K+I+    D D NF      + D+ Y ++  E    I +  +        D+  YL E  + ++I  D+E++  + +   +  ++            + E +   ++K  G++   +  ++  D ++AFGD DND +M+  + IGVAM N  +  KSVA  IT   N  DGI  F+  + +
  S:    12 LIVLDLDGTLLTDEKKIPEKTKQTLHKAREHGHEIMIATGRPYR------ASEMYYKELVLNTPIVNFNGAFVHHPLDENWGVFHEPMEVEVAKEIVQACHDFDFNFRNIIAEVMDDVYFHYHDERL--IDVFNFGKPNVTTGDIRSYLKESPTSMLIHADEEHVTEIRDHLSNVHAEVIDHRRWAAPWHVIEIVKSGLNKAVGIEKVARHLDIPQDRIIAFGDEDNDLEMLKYAGIGVAMGNAIEPLKSVADDIT-LSNEEDGIAAFLNSHLR 276
>gi|58176602|pdb|1RLM|A Chain A, Crystal Structure Of Ybiv From Escherichia Coli K12 >gi|58176603|pdb|1RLM|B Chain B, Crystal Structure Of Ybiv From Escherichia Coli K12 >gi|58176604|pdb|1RLM|C Chain C, Crystal Structure Of Ybiv From Escherichia Coli K12 >gi|58176605|pdb|1RLM|D Chain D, Crystal Structure Of Ybiv From Escherichia Coli K12 >gi|58176610|pdb|1RLT|A Chain A, Transition State Analogue Of Ybiv From E. Coli K12 >gi|58176611|pdb|1RLT|B Chain B, Transition State Analogue Of Ybiv From E. Coli K12 >gi|58176612|pdb|1RLT|C Chain C, Transition State Analogue Of Ybiv From E. Coli K12 >gi|58176613|pdb|1RLT|D Chain D, Transition State Analogue Of Ybiv From E. Coli K12 (271 aa)
Score = 175, Expect = 4.1e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHV-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|153197907|ref|ZP_01942111.1| Cof-like hydrolase [Listeria monocytogenes 10403S] >gi|127632448|gb|EBA22128.1| Cof-like hydrolase [Listeria monocytogenes 10403S] (270 aa)
Score = 175, Expect = 4.1e-11, Identities = 69/262 (26%), Positives = 118/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK---SKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++  D+DGTLL+D+  +  +   +IK  K KG+   LCTGR    +   LI+   + E  D+ I   GA      + +      L+   +++I       ++N    D   +Y P      I   +   +    + + V         SKVM++   E +  VI +  ++ K K+ V   + + P   E++   V+K + L        +    V++ GD +ND  MI  + +GVAM N ++  K +A Y T   NN DG+   I
  S:     3 KIIAIDIDGTLLNDTHEITPAVRDSIKAAKAKGVKVVLCTGRPLAGIKKSLIELDLLDEG-DYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENVNVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKITDVIKKLPENIKEKFYV---VRSVPYNLEFLQKGVNKGSALASLADKIGVDQSEVMSIGDQENDITMIEYAGMGVAMGNATEHIKEIANYTTTT-NNEDGVAQAI 263
>gi|29348761|ref|NP_812264.1| haloacid dehalogenase-like hydrolase [Bacteroides thetaiotaomicron VPI-5482] >gi|29340667|gb|AAO78458.1| haloacid dehalogenase-like hydrolase [Bacteroides thetaiotaomicron VPI-5482] (270 aa)
Score = 175, Expect = 4.2e-11, Identities = 72/266 (27%), Positives = 126/266 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI-----INHYQDLDLNFG--IPDNGY-LYFPKE---NRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDK-EYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++V D+DGTL +  K +   +   + +I+E+G+   L +GR    +   L ++ ++ E+  FI+   G +  N ++ E    + L  + +  +      NH   L  +    + +N    Y  KE   N+ +IR +  D +T         +T P +K +IV D  + +P         + K  V     + P   E +   + K   L + L++  +T + V+A GD  ND  MI  + +GVAM N  +  K  A YIT   N+ DG+   I + F
  S:     4 KLIVLDLDGTLTNSKKEISSRNRETLIRIQEQGIRLVLASGRPTYGIVP-LANELRMNEFGGFILSYNGGEIINWESKEMMYENVLPNEVVPVLYECARTNHLSILTYDGAEIVTENSLDPYVQKEAFLNKMAIRETN-DFLTD--------ITLPVAKCLIVGDAGKLIPVESELCIRLQGKINV---FRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMIKFAGMGVAMGNAQEPVKKAADYIT-LTNDEDGVAEAIERIF 267
>gi|195978423|ref|YP_002123667.1| hydrolase HAD family [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975128|gb|ACG62654.1| hydrolase HAD family [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (269 aa)
Score = 175, Expect = 4.3e-11, Identities = 67/266 (25%), Positives = 124/266 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + V      AI++ K +G+   + TGR    + + L+++ ++ +  D +I   G    +  T E      ++ D   DI    + L ++        +Y    N     + +Y    A+  D+ V+   P+        K+M++ + + +   I +  ++F   Y +   + + P   E     VSK   +    K   + +   +A GDA+ND  M+      V M NG+ + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAIDIDGTLLTDDRRVTNDVFDAIQEAKAQGVHIVIATGRPIAGVIS-LLEQLQLNQKGDHVITFNGGLIQDTATGEEVVKELMTYDDYLDIEYLSRRLGVHMHAITTEGIYTANRN-----IGKYTVREARLVDMPVFYRTPEEMADKEIIKMMMIDEPDLLDEAIKQIPQAFYDTYNI---VKSTPFYLELTPKTVSKGTAISHLAKKLGIDMSQTMAIGDAENDRAMLEAVANPVVMENGAPELKKLAKYIT-KSNNDSGVAHAIRKW 266
>gi|47570516|ref|ZP_00241144.1| hydrolase [Bacillus cereus G9241] >gi|167937742|ref|ZP_02524817.1| hydrolase (HAD superfamily) protein [Bacillus cereus AH1134] >gi|47552824|gb|EAL11247.1| hydrolase [Bacillus cereus G9241] (273 aa)
Score = 175, Expect = 4.3e-11, Identities = 68/241 (28%), Positives = 120/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ ++  + D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEDVWIHTYMGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNKLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|163940455|ref|YP_001645339.1| Cof-like hydrolase [Bacillus weihenstephanensis KBAB4] >gi|163862652|gb|ABY43711.1| Cof-like hydrolase [Bacillus weihenstephanensis KBAB4] (283 aa)
Score = 175, Expect = 4.4e-11, Identities = 73/266 (27%), Positives = 131/266 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFP--------------KENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+K +E G +  +CTGR   ++  +L++       V+    II   GA  Y  K    K+    +  A+ +II + ++ DL + +  N  +Y P              K ++ +  L E + + A Y +   + +    K ++  D    + +P    I + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K + QY T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRKCQEAGHVVAICTGRSIVDIERLLLE-------VNLECPIIAENGALIYTDK-KMMKRYPIQNTQAL-EIIEYLEENDLYYQLYTNKGVYVPDYGVESVRNEIEYVKNSKENFNLKELETIAALYLEHTAFHSTESCKPIVEMDIHVHKLLPFSYDIEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKVMCQYET-LTNEEHGVAHALYKY 281
>gi|30262619|ref|NP_844996.1| HAD superfamily hydrolase [Bacillus anthracis str. Ames] >gi|47527926|ref|YP_019275.1| HAD superfamily hydrolase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49185462|ref|YP_028714.1| HAD superfamily hydrolase [Bacillus anthracis str. Sterne] >gi|118478019|ref|YP_895170.1| HAD superfamily hydrolase [Bacillus thuringiensis str. Al Hakam] >gi|165868853|ref|ZP_02213513.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0488] >gi|166993256|ref|ZP_02259716.1| hydrolase, haloacid dehalogenase-like family protein [Bacillus cereus AH820] >gi|167631847|ref|ZP_02390174.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0442] >gi|167637921|ref|ZP_02396200.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0193] >gi|170685308|ref|ZP_02876532.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0465] >gi|170704450|ref|ZP_02894916.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0389] >gi|177649177|ref|ZP_02932179.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0174] >gi|190565477|ref|ZP_03018397.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis Tsiankovskii-I] >gi|196032584|ref|ZP_03099998.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus W] >gi|196043441|ref|ZP_03110679.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus 03BB108] >gi|30257251|gb|AAP26482.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. Ames] >gi|47503074|gb|AAT31750.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. 'Ames Ancestor'] >gi|49179389|gb|AAT54765.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. Sterne] >gi|118417244|gb|ABK85663.1| hydrolase, haloacid dehalogenase-like family [Bacillus thuringiensis str. Al Hakam] >gi|164715579|gb|EDR21096.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0488] >gi|167514470|gb|EDR89837.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0193] >gi|167532145|gb|EDR94781.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0442] >gi|170130251|gb|EDS99112.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0389] >gi|170670668|gb|EDT21407.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0465] >gi|172084251|gb|EDT69309.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0174] >gi|190563504|gb|EDV17469.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis Tsiankovskii-I] >gi|195995335|gb|EDX59289.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus W] >gi|196025750|gb|EDX64419.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus 03BB108] (283 aa)
Score = 175, Expect = 4.5e-11, Identities = 71/266 (26%), Positives = 130/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+K +E G +  +CTGR   ++  +L++       V+    II   GA  Y  K  +  K   +      +I+N+ ++  L + +  +  +Y P     S+R              L E + + A Y +   +L+    K ++  D    + +P    + + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ QY T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRKCQEAGHVVAICTGRSIVDIERLLLE-------VNLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVNYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEYVKNSKENFDLKELETIAALYLEHTAFLSAESCKPIVETDIHVHKLLPFSYDMEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCQYET-LTNEEHGVAHALYKY 281
>gi|196040377|ref|ZP_03107678.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus NVH0597-99] >gi|196028862|gb|EDX67468.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus NVH0597-99] (283 aa)
Score = 175, Expect = 4.5e-11, Identities = 71/266 (26%), Positives = 130/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+K +E G +  +CTGR   ++  +L++       V+    II   GA  Y  K  +  K   +      +I+N+ ++  L + +  +  +Y P     S+R              L E + + A Y +   +L+    K ++  D    + +P    + + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ QY T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRKCQEAGHVVAICTGRSIVDIERLLLE-------VNLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVNYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEYVKNSKENFDLKELETIAALYLEHTAFLSAESCKPIVETDIHVHKLLPFSYDMEKLKKLKETFLHNTNLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCQYET-LTNEEHGVAHALYKY 281
>gi|15674695|ref|NP_268869.1| hypothetical protein SPy_0617 [Streptococcus pyogenes M1 GAS] >gi|19745723|ref|NP_606859.1| hypothetical protein spyM18_0684 [Streptococcus pyogenes MGAS8232] >gi|50913879|ref|YP_059851.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS10394] >gi|56808527|ref|ZP_00366263.1| COG0561: Predicted hydrolases of the HAD superfamily [Streptococcus pyogenes M49 591] >gi|71910325|ref|YP_281875.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS5005] >gi|81372246|sp|Q5XD45|Y533_STRP6 Putative hydrolase M6_Spy0533 >gi|13621814|gb|AAK33590.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] >gi|19747860|gb|AAL97358.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|50902953|gb|AAT86668.1| Hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS10394] >gi|71853107|gb|AAZ51130.1| hydrolase, HAD superfamily [Streptococcus pyogenes MGAS5005] (269 aa)
Score = 175, Expect = 4.5e-11, Identities = 66/266 (24%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTLL D + + +    A+++ K +G+   + TGR    + + L+++ ++    + +I   G    + +T E      ++ D   +     + L ++        +Y    N  ++++  S   +M   Y   +    +   K+M++ + + +   I +  + F  KY   T + + P   E+M   VSK N +K   K   L +   +A GDA+ND  M+      V M NG  + K +A+YIT + NN+ G+ + I K+
  S:     3 IKLVAVDIDGTLLTDDRRITDDVFQAVQEAKAQGVHVVIATGRPIAGVIS-LLEQLELNHKGNHVITFNGGLVQDAETGEEIVKELMTYDDYLETEFLSRKLGVHMHAITKEGIYTANRNIGKYTVHESTLVNMPIFYRTPEEMTNKEIIKMMMIDEPDLLDAAIKQIPQHFFDKY---TIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAENDRAMLEVVANPVVMENGVPELKKIAKYIT-KSNNDSGVAHAIRKW 266
>gi|72080547|ref|YP_287605.1| HAD superfamily hydrolase [Mycoplasma hyopneumoniae 7448] >gi|71913671|gb|AAZ53582.1| hydrolase of the HAD family [Mycoplasma hyopneumoniae 7448] (276 aa)
Score = 175, Expect = 4.6e-11, Identities = 69/240 (28%), Positives = 112/240 (46%)
  Q:    12 DMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-------------SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVA 251
           D+DGTLL     +   ++  +KK+ E G    L TGR  +      +D  K   Y  +++   G   ++ KT +      LS + I D+I   +  D    F  P+N + +    N   ++         K  D+  Y    + K+  + +KE +  V  R             SK  K+ Y+V    +T  I  +    NV K NG+K+ L+  NL  D ++AFGD+ NDY M+  ++ G AM + +    SVA
  S:     8 DLDGTLLRYDNTIHPENVEILKKLYELGHFLALATGRGLSG----CLDLAKKYPYFHYLVSNNGTLVHDTKTQKTINNGSLSKEIILDLIKDCKATDSICAFSSPNNLFEFSSTNNHPWLK-------KQKIMDLHFYEKVDQDKLYEIIEKEEITQVAFRNDIPVIAELYKKWSKKLKNIYKV---TITNRIFLDINPLNVDKANGIKMLLEKNNLKPDQLIAFGDSSNDYFMVKLARFGYAMEDSTPDLLSVA 248
>gi|77961785|ref|ZP_00825615.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia mollaretii ATCC 43969] (269 aa)
Score = 175, Expect = 4.6e-11, Identities = 70/259 (27%), Positives = 116/259 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSF--KSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  DMDGTLL+    +      AI   + KG+   L TGR    +   L  +  ++   D+ I   GA      T EC     LS +         + + ++F   D   LY       K   H + L+          ++D  L  PK  VM++ +    P  ++R+ +      +E  T + + P   E +   V K  G+K+      +  +NV+A GD  ND  M+  + +GVAM N   + K +AQ+IT   N++DG+
  S:     3 IELIAIDMDGTLLNPQHEITPRVKQAIDAARAKGVCVVLATGRPYIGVQRYL-RELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRKMGVSFQAFDFDTLYTANKDISKYTLHEVLLTGIPLKYRAVEEMDPTLRFPK--VMMIDE----PEALDRALAMMPAEAFERFTIMKSAPFYLEILSKRVDKGTGVKMLADHLGIAQENVMALGDQGNDIAMVNYAGVGVAMGNAIPELKEIAQFITTT-NSDDGV 260
>gi|15893986|ref|NP_347335.1| HAD superfamily hydrolase [Clostridium acetobutylicum ATCC 824] >gi|15023577|gb|AAK78675.1|AE007585_2 Predicted hydrolase of the HAD superfamily [Clostridium acetobutylicum ATCC 824] (276 aa)
Score = 175, Expect = 4.7e-11, Identities = 79/265 (29%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI------------INHYQDLDLNFGIPDNGYLY------FPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVM--IVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGT+LDD K +   +I A+K+  + G+   +CTGR    A   +++L  K  +       I   G        +     S+L  +  KDI             N Y  +  N    +N Y Y       PKE R  +   +         ++D +L E   +++  I  DK+     + R +    ++++V   + +G   FE M   VSK   +K+    +N+  D V+  GD +ND  MI  + IG+AM N  D  K +A Y+T+  NNN G+   I K+
  S:     4 KLICVDMDGTVLDDEKKISNENIEAMKRAHDAGVKIAICTGRLFASALAYSDILGVKAPL-------IASNGGYIREKDNDNVIYESYLKNEEAKDIYHIIEKYNVSMFFNTYNTVISNKEFEEN-YTYNKFNDNLPKEKRVKLVYPK---------NMDKFLEENVGEILKCICIDKDVEKLKLLRKEIESLNRFDV---VSSGEFNFEIMPKGVSKGKAVKMLAAFYNIKQDEVICIGDNENDLSMIKCAGIGIAMGNAEDSIKQIADYVTDT-NNNSGVAKAIDKF 271
>gi|191166171|ref|ZP_03028005.1| sugar phosphatase SupH [Escherichia coli B7A] >gi|190903780|gb|EDV63495.1| sugar phosphatase SupH [Escherichia coli B7A] (271 aa)
Score = 175, Expect = 4.8e-11, Identities = 64/263 (24%), Positives = 137/263 (52%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKAVKDYQKIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|149003661|ref|ZP_01828526.1| alanine aminotransferase [Streptococcus pneumoniae SP14-BS69] >gi|147758393|gb|EDK65393.1| alanine aminotransferase [Streptococcus pneumoniae SP14-BS69] (477 aa)
Score = 175, Expect = 4.9e-11, Identities = 74/259 (28%), Positives = 131/259 (50%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-----------YQDLDLNFGIPDNGYLYF--------PKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           K+   D+DGTL+++ K+VL+S+  AIK +KE+G+L G+ TGR    +  ++ D       +DF +   G   Y    +    TS +S   ++ +I++            +D  L   I   G   F        P     ++  S ++ M +K       D+   + +P  +V+++   E        S+   + +E      + P   + ++   SK  G++   K++   L+ V+AFGD+DND +M+    + VAM NGS   K  A++IT   N  DGI+
  S:    19 KLFFFDIDGTLVNNRKSVLKSTKDAIKIVKEQGVLVGVATGRGPFFVKELMDDL-----DLDFAVTYNGQ--YIFSKDRVLFTSPISKLHLRHLISYAKKEGTEIALGTKDAMLGSKIMSFGLGSFSQRISRFVPSVLTRTVSQS-FNRMVSKVVPQKEEDLLHLMNQPIYQVLMLMTPE-------ESEKAAADFEDLKLTRSNPFASDVINQGNSKLEGIRRVGKEYGFDLNQVMAFGDSDNDLEMLAGVGMSVAMGNGSSSVKEAAKHIT-TSNQQDGIH 285
>gi|30023426|ref|NP_835057.1| HAD superfamily hydrolase [Bacillus cereus ATCC 14579] >gi|29898987|gb|AAP12258.1| hydrolase (HAD superfamily) [Bacillus cereus ATCC 14579] (273 aa)
Score = 174, Expect = 5.1e-11, Identities = 65/241 (26%), Positives = 116/241 (48%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ ++  + D+      +EN     + E D        VD +    K  V+ V   +    ++   K  + + E    ++ + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEDIFSSTLSPEIVHNLFEISKTEDVWIHTYMGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQQQLEGQLSVMRSKPFFLEFTEAGVTKGTSLNKLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|84393550|ref|ZP_00992304.1| Predicted hydrolase of the HAD superfamily [Vibrio splendidus 12B01] >gi|84375829|gb|EAP92722.1| Predicted hydrolase of the HAD superfamily [Vibrio splendidus 12B01] (275 aa)
Score = 174, Expect = 5.3e-11, Identities = 63/241 (26%), Positives = 116/241 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDK 246
           +K+V SD+DGTLL  +  + + + L +KK+ ++G  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +  + ++ +I+   QD +L   +  N      +E+    +       + K F+ +   +E  +KV       D EY+ T   + + +F  K  +     + P   E M   VSK + L    K  NLTLDN +AFGD  ND +M+  +  G+ M    +K
  S:    10 VKIVASDLDGTLLAPNHQLSDFTKLTLKKLHDQGYTFIFATGRHHVDVAGIR----QIAGIPAYMITSNGARVHD-QNDQLMYSQNVPQELVQPVIDIVRQDPNLFIHMYQNEDWLLDREDEMLAKFHSESGFSYKRFEAENAPSEGIAKVFFTHPEQDHEYLVTFEQKLRDAFGDKLNIA---FSTPWCLEVMAAEVSKGHALDAVAKSLNLTLDNCVAFGDGMNDAEMLAMAGKGLVMGTSHEK 247
>gi|65317377|ref|ZP_00390336.1| COG0561: Predicted hydrolases of the HAD superfamily [Bacillus anthracis str. A2012] >gi|165871300|ref|ZP_02215949.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0488] >gi|164712967|gb|EDR18495.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0488] (269 aa)
Score = 174, Expect = 5.4e-11, Identities = 68/241 (28%), Positives = 119/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  + + ++  I D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    24 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEGVWIHTYIGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 261
>gi|18309591|ref|NP_561525.1| HAD hydrolase, IIB family [Clostridium perfringens str. 13] >gi|110799052|ref|YP_695043.1| HAD family hydrolase [Clostridium perfringens ATCC 13124] >gi|168211687|ref|ZP_02637312.1| HAD hydrolase, IIB family [Clostridium perfringens B str. ATCC 3626] >gi|18144268|dbj|BAB80315.1| conserved hypothetical protein [Clostridium perfringens str. 13] >gi|110673699|gb|ABG82686.1| HAD hydrolase, IIB family [Clostridium perfringens ATCC 13124] >gi|170710334|gb|EDT22516.1| HAD hydrolase, IIB family [Clostridium perfringens B str. ATCC 3626] (279 aa)
Score = 174, Expect = 5.6e-11, Identities = 78/265 (29%), Positives = 122/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIP-----------DNGYLYFPK---ENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++   + E +  AIKK  E+G+   + TGR    A   A +L  K  I       I C GA       ++    S L+ D +  I +  +  D+N   F  P           ++GY    K   E++  +  SE       +     Y       + I  D   +  +    +  K KYE    + + P  FE M+   SK   +K+     N+  + ++  GD++ND  MI  + +GVAM N  +  K  A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNNKHEISERNKEAIKKATERGVKVAVTTGRLFASAKYYAGLLGVKTPI-------ISCNGAFIREKDEDKVIYESVLNEDQLDRIYDVIKKYDINMAYFNTPNTVISEKIVPEEHGYKVMNKMMGESKEKVMFSEGIDFKEAF---KTYGKHILKAICIENDSNKLEDLFKAKEELK-KYEDLEVVSSSPSNFEVMNKGTSKGRAVKVLADILNINREEIMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDT-NENDGVAKAIEKF 276
>gi|16801907|ref|NP_472175.1| hypothetical protein lin2847 [Listeria innocua Clip11262] >gi|16415382|emb|CAC98073.1| lin2847 [Listeria innocua] (279 aa)
Score = 174, Expect = 5.9e-11, Identities = 63/258 (24%), Positives = 116/258 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   ++ G+   L +GR    M +   ++ ++ ++   ++   GA+  +  TNE      L+    K ++ H +  ++   I    Y+Y       +       I + +Y+     +      D+  +L    SK++   D  YM        + FK+       + T    FE+    + K   L   L    +  +N++AFGD  ND  M+  +  G+AM N   + K+ A  IT   NN DGI
  S:     4 QAIILDIDGTLLNDGKKISPETKKALITAQQNGVKLILASGRPTTGM-HAYAEQLEMDKHHGLLVSYNGAKVVDCATNEELFNQALTVAEGKAVLEHMKQFEVKVMIDKEDYMYTNDVYDCYVPYRGEVINIIQYESRGGNFKLCEKDDLAAFLDYRLSKILTAGDPAYMQENYQAMMAPFKNTLNC---VFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENIIAFGDGHNDITMVEYAGTGIAMSNAVPELKAAANSIT-LSNNEDGI 269
>gi|71893560|ref|YP_279006.1| HAD family hydrolase [Mycoplasma hyopneumoniae J] >gi|71851687|gb|AAZ44295.1| putative hydrolase of the HAD family [Mycoplasma hyopneumoniae J] (276 aa)
Score = 174, Expect = 6.1e-11, Identities = 69/240 (28%), Positives = 112/240 (46%)
  Q:    12 DMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-------------SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVA 251
           D+DGTLL     +   ++  +KK+ E G    L TGR  +      +D  K   Y  +++   G   ++ KT +      LS + I D+I   +  D    F  P+N + +    N   ++         K  D+  Y    + K+  + +KE +  V  R             SK  K+ Y+V    +T  I  +    NV K NG+K+ L+  NL  D ++AFGD+ NDY M+  ++ G AM + +    SVA
  S:     8 DLDGTLLRYDNTIHPENVEILKKLYELGHFLALATGRGLSG----CLDLAKKYPYFHYLVSNNGTLVHDTKTQKTINNGSLSKEIIFDLIKDCKATDSICAFSSPNNLFEFSSTNNHPWLK-------KQKIMDLHFYEKVDQDKLYEIIEKEEITQVAFRNDIPVIAELYKKWSKKLKNIYKV---TITNRIFLDINPLNVDKANGIKMLLEKNNLKPDQLIAFGDSSNDYFMVKLARFGYAMEDSTPDLLSVA 248
>gi|193069392|ref|ZP_03050347.1| sugar phosphatase SupH [Escherichia coli E110019] >gi|192957345|gb|EDV87793.1| sugar phosphatase SupH [Escherichia coli E110019] (271 aa)
Score = 174, Expect = 6.1e-11, Identities = 64/263 (24%), Positives = 136/263 (51%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN+ G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNQPHFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKAVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHQGALNVI 259
>gi|30265417|ref|NP_847794.1| HAD superfamily hydrolase [Bacillus anthracis str. Ames] >gi|47778423|ref|YP_022322.2| HAD superfamily hydrolase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188233|ref|YP_031486.1| HAD superfamily hydrolase [Bacillus anthracis str. Sterne] >gi|49480440|ref|YP_039387.1| HAD superfamily hydrolase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140168|ref|YP_086663.1| HAD superfamily hydrolase [Bacillus cereus E33L] >gi|166997174|ref|ZP_02263633.1| hydrolase, haloacid dehalogenase-like family protein [Bacillus cereus AH820] >gi|167635730|ref|ZP_02394040.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0442] >gi|167640448|ref|ZP_02398712.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0193] >gi|170688174|ref|ZP_02879385.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0465] >gi|170708026|ref|ZP_02898474.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0389] >gi|177651847|ref|ZP_02934430.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0174] >gi|190568900|ref|ZP_03021802.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis Tsiankovskii-I] >gi|196036518|ref|ZP_03103913.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus W] >gi|30260095|gb|AAP29280.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. Ames] >gi|47552128|gb|AAT34797.2| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182160|gb|AAT57536.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. Sterne] >gi|49331996|gb|AAT62642.1| hydrolase, haloacid dehalogenase-like family [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973637|gb|AAU15187.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus E33L] >gi|167511668|gb|EDR87050.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0193] >gi|167528839|gb|EDR91596.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0442] >gi|170126999|gb|EDS95878.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0389] >gi|170667867|gb|EDT18619.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0465] >gi|172082551|gb|EDT67615.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0174] >gi|190559967|gb|EDV13950.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis Tsiankovskii-I] >gi|195990851|gb|EDX54824.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus W] (273 aa)
Score = 174, Expect = 6.5e-11, Identities = 68/241 (28%), Positives = 119/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  + + ++  I D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEGVWIHTYIGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|118480428|ref|YP_897579.1| HAD superfamily hydrolase [Bacillus thuringiensis str. Al Hakam] >gi|196045423|ref|ZP_03112654.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus 03BB108] >gi|118419653|gb|ABK88072.1| hydrolase, haloacid dehalogenase-like family [Bacillus thuringiensis str. Al Hakam] >gi|196023630|gb|EDX62306.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus 03BB108] (273 aa)
Score = 174, Expect = 6.5e-11, Identities = 68/241 (28%), Positives = 119/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  + + ++  I D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEGVWIHTYIGDD---IVTEENNPYTEI-EGDITGMPIVIVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|153816392|ref|ZP_01969060.1| hypothetical protein RUMTOR_02644 [Ruminococcus torques ATCC 27756] >gi|145846280|gb|EDK23198.1| hypothetical protein RUMTOR_02644 [Ruminococcus torques ATCC 27756] (269 aa)
Score = 173, Expect = 6.9e-11, Identities = 70/267 (26%), Positives = 125/267 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIK------------DIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +V+V D+DGTL +  K +   +  A+ +I+E G    L +GR  N +A  L  + ++  +  +++   GA+     T E      +  + I+            DII+ Y D  +  GI  N Y+   +   +++ +   D       D    L  P +K++I  D + + T+I   +  K  + +    ++ P   E M  N+ K   L+  L    LT + ++  GD  ND  MI  + +GVAM N     K  A +IT + N+ DG+ + I  + +
  S:     4 QVLVLDLDGTLTNSKKEITAPTKQALLEIQEAGRTVVLASGRPINGVAP-LAKELQMDTFGGYMLSFNGARITKCSTGEIIYNKTIPKEIIRPVWEYVKTFPGLDIIS-YDDTHIFSGICPNKYVEI-ESGINNMEIVPTD-------DFPSALDFPVNKLLICGDPKTLETMIEPLR--KQYHGLLNIYLSEPFFLEIMPKNIDKAQSLQKLLNSIGLTANEMICCGDGFNDLSMIEYAGLGVAMENAQPIIKETADFIT-RSNDEDGVLHVIDTFMR 269
>gi|170768937|ref|ZP_02903390.1| sugar phosphatase SupH [Escherichia albertii TW07627] >gi|170122009|gb|EDS90940.1| sugar phosphatase SupH [Escherichia albertii TW07627] (271 aa)
Score = 173, Expect = 7.0e-11, Identities = 64/263 (24%), Positives = 131/263 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D+K    +  +A  +++K++ + F + +G     + +   +   +K  + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P++      K       + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM NG++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDAKTYNRTRFMAQYQELKKRDIEFVVASGNQYYQLISFFPE---LKNEISFVAENGALVYEHGKQLFHGELTR-HESQIVIGELLKDKQLNFVACGLQSAYVSENAPESFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHV-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMDNGAENIKKIARYATD-DNNHEGALNVI 259
>gi|166982497|ref|ZP_02253931.1| hydrolase, haloacid dehalogenase-like family protein [Bacillus cereus AH187] >gi|168159001|ref|ZP_02594234.1| hydrolase, haloacid dehalogenase-like family protein [Bacillus cereus H3081.97] (257 aa)
Score = 173, Expect = 7.0e-11, Identities = 78/262 (29%), Positives = 119/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDII---NHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K+++SD+DGTLL   K + E SI  +++ K  G      T R    +   + D  K     + II   GA    LK N+      +S + I +II   N Y   ++   I D  Y  F   +        + ++  +  DV     E  SK  I+C K      IN+    +   E    +     L + MH  VSK N ++  L+  N  +  V+AFGD  ND +MI    IGVAM N  ++ K+VA+ I  + N+ DG+  F+
  S:     3 KIIISDLDGTLLRSDKTISEKSINILRECKNNGDELIFATARPPRAIKQYIPDVLK----SEIIICYNGALV--LKGNDILYEMKISKNNILEIIEIANKYNLHEICLEIGDKLYSNFDVTDY-------FGNVPCEIMDVRDLNFEKASKA-IICTK----GSINKEFIKELPDECRGVITDDGTLCQIMHAEVSKWNSIQYVLQHLNRDVSEVIAFGDDYNDMEMIEKCGIGVAMSNAVEELKAVAKVIA-KSNDEDGVATFL 248
>gi|94992915|ref|YP_601014.1| hydrolase [Streptococcus pyogenes MGAS2096] >gi|94546423|gb|ABF36470.1| Hydrolase [Streptococcus pyogenes MGAS2096] (293 aa)
Score = 173, Expect = 7.0e-11, Identities = 71/250 (28%), Positives = 125/250 (50%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS------------KVMIVCDKEYMPTVIN--RSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           I+++  D+DGTLL+  K + + +I AI++  + GL   LCTGR  +       D+  + +  +F+I   G   Y+    + + +  L    + DI    ++L  +F  PD  YL   +EN + +   E   +  +  D+   + +P S            + M + +K  +       R++  +S + VG+       + E +   VSK + LK  ++D  LT D V+A GDA ND +M+  + +GVAM N S   K +A  +T
  S:    21 IQLIAIDLDGTLLNQDKQIPKENITAIQEAAQSGLKIVLCTGRPQSG-TRPYFDQLGLTQE-EFLIINNGCSTYSSPDWQLRHSKMLK---VSDI-ELLEELSQSF--PDI-YLTLTEENDYLVLEEEVPDLVQEDGDLVFTIVKPVSLAELSDTPRLIFQAMYLGEKAALDAFERAVRNQLSQSFHVVGSQ----DNILEILPQGVSKASALKELVEDLGLTADQVMAIGDAPNDIEMLTYAGLGVAMENASAAIKPLADKVT 271
>gi|196041056|ref|ZP_03108353.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus NVH0597-99] >gi|196028224|gb|EDX66834.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus NVH0597-99] (273 aa)
Score = 173, Expect = 7.1e-11, Identities = 68/241 (28%), Positives = 118/241 (48%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYL---YFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS     +I+++  ++    G+  + Y+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLS----PEIVHNLFEISKTEGVWIHTYIGNDIVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|168137474|ref|ZP_02580703.1| hydrolase (HAD superfamily) protein [Bacillus cereus B4264] (273 aa)
Score = 173, Expect = 7.2e-11, Identities = 67/241 (27%), Positives = 120/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ ++  + D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  +  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISQTEDVWIHTYMGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNKLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPEDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|146296328|ref|YP_001180099.1| Cof-like hydrolase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409904|gb|ABP66908.1| Cof-like hydrolase [Caldicellulosiruptor saccharolyticus DSM 8903] (296 aa)
Score = 173, Expect = 7.2e-11, Identities = 69/267 (25%), Positives = 127/267 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTA-KYFDVDVYLT---EPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK+V +D+D +LL     +   ++ AI+ +K+  ++  L +GR   ++  +  D       + +     GA  Y+ K +       +  +  K++I   ++ +++  I  +   Y    N    ++  Y ++T  +   VD +L     P +KV+   + E +  +       F  K+ +   + + P   E+   NVSK N LK   + +NL  D ++A GD DND  MI  + IGVA+ N ++K K VA +IT    +N G  + + K F
  S:    32 IKLVATDLDDSLLSKDLKITPKNLKAIEFLKKNNVILILASGRPYPSVKKIAYDLENFYPMITY----QGALVYDPKDDRKLYGCEIQPNDAKELIRLAKEENIHVHIYIDNVWYVEVFNE---KVEYYKNLTGLEPVKVDNFLEFVDRPVTKVLFFDEHERLRKLKESLPLEFSKKFNI---MFSKPFFLEFTDINVSKGNALKFLAQYYNLKRDEIMAIGDGDNDISMIEYAGIGVAVENATEKLKEVASFIT-LSCDNSGFAHAVEKVF 292
>gi|169349440|ref|ZP_02866378.1| hypothetical protein CLOSPI_00158 [Clostridium spiroforme DSM 1552] >gi|169293515|gb|EDS75648.1| hypothetical protein CLOSPI_00158 [Clostridium spiroforme DSM 1552] (272 aa)
Score = 173, Expect = 7.3e-11, Identities = 62/259 (23%), Positives = 122/259 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           K++  D+DGTL    K +L  +   ++++ +KG++  L +GR    M N   ++ K+ +   +++   GA+  N +  +    +        ++ +  ++ +L      D   L     + + +  S+ +HM  K+ D     +    +KV++    +Y+ ++++    FK  +E    +  + P   E M  N+ K   L+  ++   +  D V+ FGD  ND  MI  + +GVAM N  D  K  A Y+T   N+ +GIY
  S:     4 KLIALDLDGTLKSSKKQILLKTKTILQELAKKGIVIVLASGRPTAGMYNE-ANELKLDKLGGYLLSFNGAKVINYQNKKIIYQNVYDASIAHNVYDRAKEFNLAAMTYTDELILTEDDYDEYVLIESDINHMPIKHIDDFKKTVNFSVNKVLLTGKPDYVESILD---DFKVPFEDTLSIYRSTPFFIEVMGKNIDKAASLQRLIEHLGIKQDEVICFGDGYNDLTMIKFAGLGVAMANSVDDVKKYADYVT-LSNDEEGIY 260
>gi|194682944|emb|CAR43340.1| putative phosphatase [Proteus mirabilis HI4320] (268 aa)
Score = 173, Expect = 7.3e-11, Identities = 70/266 (26%), Positives = 130/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPK-----SKVMIVCDKEYMPTVINRSKSF--KSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++V D+DGTLL++   +      AI+  K  G+   L +GR  N ++  L     +    +F I   G+Q +  +  E      L+ +      +  +++ ++F +  +  +Y    NRH   +S +    A      +Y   L+E +     SK MIV      PTV++ +  +   + Y+  + L + P   E ++ +V+K N ++   +   +T + ++  GD DND  M+  + +GVAM N  ++ K VA++IT   N   G+   I K+
  S:     3 IKLIVIDLDGTLLNEQHEITPEVHQAIQHAKNSGVHIVLASGRSFNGISPYL-KALNLDTSDNFCISNNGSQIHQAENGEIITEDLLNFEDYLYFEDLSREIGVHFHVLSDNKIY--TTNRH---ISHFTCREAFLTWTPLYYRPLSEMQRDMRFSKFMIVG----TPTVLDNAMQYLPANIYQQYSILRSAPYFIEILNTDVNKGNAVQKIAEHLKITPEKIMCIGDQDNDLAMLQYAGLGVAMGNAPEEIKKVAKFIT-LSNKEHGVAVAINKF 267
>gi|168161029|ref|ZP_02596262.1| hydrolase, haloacid dehalogenase-like family protein [Bacillus cereus H3081.97] (273 aa)
Score = 173, Expect = 7.3e-11, Identities = 68/241 (28%), Positives = 119/241 (49%)
  Q:    31 AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           A+   +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  + + ++  I D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:    28 ALMTAQEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEGVWIHTYIGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 265
>gi|89099512|ref|ZP_01172387.1| hypothetical protein B14911_11022 [Bacillus sp. NRRL B-14911] >gi|89085665|gb|EAR64791.1| hypothetical protein B14911_11022 [Bacillus sp. NRRL B-14911] (256 aa)
Score = 173, Expect = 7.4e-11, Identities = 75/264 (28%), Positives = 118/264 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY-LYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNV--------SKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           K+V  D+DGTLLD  KN+   +  AI+ ++EKG+   + TGR A  M   L ++  I  YV F       Q Y +  NE    + L    ++ ++ H +          NG+ L F  E+     +  + H+      +      P+        +E   ++I    S + +Y  G     G   F   HP+         SK  G+K  +      +++V AFGD  ND +M+     GVAM N  ++ K  A +IT  D   DGI+N + K
  S:     3 KIVFFDIDGTLLDHGKNLPVKTKEAIRLLQEKGVFTAIATGR-APFMYESLREELGIDSYVSF-----NGQ-YVVFENEPIYANPLDTKELERLLEHGKR---------NGHPLVFMNESTMKSSVPHHPHIEESLGTLK--FPHPEKDESFYNGREIYQSLIFMDDSLEQEYREGY----GKFHFIRWHPHSVDVLPAGGSKAEGIKKMISRLGFAIEDVYAFGDGLNDIEMLQAVGTGVAMGNAEEEVKRHADHIT-SDVGEDGIWNGLKK 252
>gi|190576204|ref|YP_001974049.1| putative haloacid dehalogenase-like hydrolase [Stenotrophomonas maltophilia K279a] >gi|190014126|emb|CAQ47765.1| putative haloacid dehalogenase-like hydrolase [Stenotrophomonas maltophilia K279a] (275 aa)
Score = 173, Expect = 7.4e-11, Identities = 72/268 (26%), Positives = 118/268 (44%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           S I++V  DMDGTLLD +  +      AI + +  G+   L +GR    +A  L  +  I    D+ I C G     + T E      LS D         +++ ++F   D+  +Y P ++   +++  S    M   Y  V D+  +    K+M++ + E +   I R  S    ++ V   L + P   E       K   L+   +   +   NV+A GD +ND  M+  +   VAM N  D  K+VA++ T   N +DG+   I  Y
  S:     6 STIELVAIDMDGTLLDPAHRLTARVRQAIAQARALGVHIVLTSGRPVPGLAPYL-HELGITGNDDYCIACNGGLVQRVGTRETVVEYPLSFDDFLFCEQVAREVGVHFQALDSQRMYTPNQDISYYTVADSHLSRMPLSYRRVEDMDPSMSFIKLMMIDEPEVLDAAIARLPSELTERFAV---LKSAPYFLEVFDHRAGKGPSLQQLAEHLGIDRANVMAIGDQENDLTMLQYAGTSVAMGNAIDAVKAVARFETSS-NADDGVARAIEAY 272
>gi|46907261|ref|YP_013650.1| Cof-like hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47092922|ref|ZP_00230703.1| Cof-like hydrolase [Listeria monocytogenes str. 4b H7858] >gi|153166335|ref|ZP_01926954.1| Cof-like hydrolase [Listeria monocytogenes FSL N1-017] >gi|153201720|ref|ZP_01943529.1| Cof-like hydrolase [Listeria monocytogenes HPB2262] >gi|167014374|ref|ZP_02276907.1| Cof-like hydrolase [Listeria monocytogenes FSL J1-194] >gi|167453688|ref|ZP_02319911.1| Cof-like hydrolase [Listeria monocytogenes FSL J2-064] >gi|46880528|gb|AAT03827.1| Cof-like hydrolase [Listeria monocytogenes str. 4b F2365] >gi|47018669|gb|EAL09421.1| Cof-like hydrolase [Listeria monocytogenes str. 4b H7858] >gi|133727851|gb|EBA29549.1| Cof-like hydrolase [Listeria monocytogenes FSL N1-017] >gi|133736028|gb|EBA37726.1| Cof-like hydrolase [Listeria monocytogenes HPB2262] (256 aa)
Score = 173, Expect = 7.6e-11, Identities = 67/259 (25%), Positives = 124/259 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           K+V  D+DGTL+ ++K +  S+  AI K+KE G+   + TGR    M + +  +  I  Y+     C   Q+   +  E      L  ++++ +I    + +  + F   D+     P  +R +I +     +Y  + A Y+   D+Y      + ++ CD+ Y          ++ +++    L    +  +    + SK  G+K  +K    ++++  AFGD  ND  M+     GVAM NG D+ K+VA Y+T+   + DG+Y
  S:     3 KIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGR-GPFMLDEIRKELDINSYI-----CYNGQYVIFEGKEIYAKP-LPTESLERLITVASEHEHPIVFSGKDSMRANLPDHDRVTIGMDSIKRDYPKVDANYYKGRDIY------QCLLFCDESY-------DAYYREEFKQYGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMEDTYAFGDGLNDIAMLQAVGTGVAMGNGRDEVKAVADYVTDH-VDEDGVY 247
>gi|156936078|ref|YP_001439994.1| sugar phosphatase [Enterobacter sakazakii ATCC BAA-894] >gi|156534332|gb|ABU79158.1| hypothetical protein ESA_03972 [Enterobacter sakazakii ATCC BAA-894] (270 aa)
Score = 173, Expect = 7.7e-11, Identities = 73/266 (27%), Positives = 120/266 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS--------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +      AI   +E+G+   L TGR    + + L  +  + +  D+ I   GA             + LS D  + +    +++  +F   D   LY    NR   R + ++   A    + +   E +         KVM++ + E +   I R  +  K KY V   L + P   E +   V+K  G+K   +  N+  + V+A GD +ND  M+  + +GVAM N  D  K  A ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHTISPGVKNAIAAAREQGINVVLTTGRPFAGVESYL-RELHMDKPGDYCITYNGALVQKASDGSTVAQTPLSYDDYRYLEQLSREVGSHFHALDRTTLY--TANRDISRYTVHESFVAT---IPLVFCEAEKMDPNMTFLKVMMIDEPEILDKAITRIPQEVKEKYTV---LKSAPYFLEILDKRVTKGTGVKSLAEVLNIQPEEVMAIGDQENDIAMLEYAGVGVAMENAIDAAKEAANFVT-RSNLEDGVAYAIEKF 267
>gi|77959448|ref|ZP_00823468.1| COG0561: Predicted hydrolases of the HAD superfamily [Yersinia bercovieri ATCC 43970] (270 aa)
Score = 173, Expect = 7.7e-11, Identities = 73/268 (27%), Positives = 118/268 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQD-------LDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVG---TPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           IK++  DMDGT L+D  +       A   ++KE G+ F + +G     + +   D   I   + F+   G        +NE   T    G    D  +H          LD+     +  Y+    +      +S+Y H   K  D    +TEP  K  I    E +P  +   +     YE+    TP+ +G    + + P V K NG+K+    + +  + V+ FGD  ND +M+  +  G AM N  D  K +A+Y T+  NN+ G+ N I K  +
  S:     3 IKIIAVDMDGTFLNDQMSFDRQRFSAQYSQLKENGIKFVVASGNQYYQLISFFPD---IVNEIAFVAENGA-----YVSNE--NTEIFCGKIASDDCHHVLKTLLPIPYLDVILCGKNGAYMLSSSDEEFYTTMSKYYHRL-KIIDDFTQVTEPAFKFAISLPNEKLPDFMTFIE-----YELAGIVTPVSSGHGSVDLIIPGVHKANGIKLLQNIWGVKDEEVVTFGDGGNDVEMLQYAGFGYAMANAPDNIKRIAKYQTDS-NNDSGVLNIIDKILR 264
>gi|16800097|ref|NP_470365.1| hypothetical protein lin1028 [Listeria innocua Clip11262] >gi|16413487|emb|CAC96259.1| lin1028 [Listeria innocua] (256 aa)
Score = 173, Expect = 8.2e-11, Identities = 67/259 (25%), Positives = 125/259 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           K+V  D+DGTL+ ++K +  S+  AI K+KE G+   + TGR    M + +  +  I  Y+     C   Q+   +  E      L  ++++ +I    + +  + F   D+     P  +R +I ++    +Y  + A Y+   D+Y      + ++ CD+ Y          ++ +++    L    +  +    + SK  G+K  +K    ++++  AFGD  ND  M+     GVAM NG D+ K+VA Y+T+   + DG+Y
  S:     3 KIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGR-GPFMLDEIRKELDINSYI-----CYNGQYVIFEGKEIYAKP-LPTESLERLITVASEHEHPIVFSGKDSMRANLPDHDRITIGMNSIKRDYPKVDANYYKGRDIY------QCLLFCDESY-------DAYYRKEFKQYGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMEDTYAFGDGLNDIAMLQAVGTGVAMGNGRDEVKAVADYVTDH-VDEDGVY 247
>gi|75760113|ref|ZP_00740174.1| Hydrolase (HAD superfamily) [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492385|gb|EAO55540.1| Hydrolase (HAD superfamily) [Bacillus thuringiensis serovar israelensis ATCC 35646] (244 aa)
Score = 173, Expect = 8.2e-11, Identities = 67/236 (28%), Positives = 118/236 (50%)
  Q:    36 KEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY---LTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +E+G+   L +GR    M NV   + +++EY  FI+   GA+  N KTNE   +S LS + + ++  I+  +D+ ++  + D+      +EN     + E D        VD +   + EP  KV++  + E +  V  +  K  + +  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K +A Y+T+  N NDG+   + K+
  S:     4 QEQGVKVVLASGRPTFGMRNV-AKELRLEEYGSFILSFNGAKIINCKTNEEIFSSTLSPEIVHNLFEISKTEDVWIHTYMGDD---IVTEENNPYTEI-EGDITGMPIVVVDDFKAAVKEPVVKVLMNKEAERLVEVEKKLQKQLEGQLSV---MRSKPFFLEFTEAGVTKGTSLNKLIQKLGIKREEVIAMGDSYNDQAMIEFAGLGVAMGNAPDDIKEIANYVTDT-NMNDGVAKVVEKF 236
>gi|167214176|ref|ZP_02284483.1| Cof-like hydrolase [Listeria monocytogenes FSL R2-503] (267 aa)
Score = 173, Expect = 8.4e-11, Identities = 67/265 (25%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD--LNFGIPDNGYLYFPKENRHSIRLS----EYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  D+DGTL+ ++K +  S+  AI K+KE G+   + TGR    M + +  +  I  Y+     C   Q+   +  E      L  ++++ +I    + +  + F   D+     P  +R +I +     +Y  + A Y+   D+Y      + ++ CD+ Y          ++ +++    L    +  +    + SK  G+K  +K    ++++  AFGD  ND  M+     GVAM NG D+ K+VA Y+T+   + DG+Y  + ++
  S:     3 KIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGR-GPFMLDEIRKELDINSYI-----CYNGQYVIFEGKEIYAKP-LPTESLERLITVASEHEHPIVFSGKDSMRANLPDHDRVTIGMDSIKRDYPKVDANYYKGRDIY------QCLLFCDESY-------DAYYREEFKQYGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMEDTYAFGDGLNDIAMLQAVGTGVAMGNGRDEVKAVADYVTDH-VDEDGVYKALEQF 253
>gi|15800574|ref|NP_286586.1| hypothetical protein Z1044 [Escherichia coli O157:H7 EDL933] >gi|15830153|ref|NP_308926.1| hypothetical protein ECs0899 [Escherichia coli O157:H7 str. Sakai] >gi|168706580|ref|ZP_02738857.1| hypothetical protein EschericoliO157_03605 [Escherichia coli O157:H7 str. EC4045] >gi|168719096|ref|ZP_02751373.1| hypothetical protein EschericcoliO157_15977 [Escherichia coli O157:H7 str. EC4206] >gi|168735880|ref|ZP_02768157.1| hypothetical protein EschecoliO157_12694 [Escherichia coli O157:H7 str. EC4115] >gi|168750004|ref|ZP_02775026.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4113] >gi|168756614|ref|ZP_02781621.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4401] >gi|168763330|ref|ZP_02788337.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4501] >gi|168767330|ref|ZP_02792337.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4486] >gi|168776361|ref|ZP_02801368.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4196] >gi|168779372|ref|ZP_02804379.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4076] >gi|168787041|ref|ZP_02812048.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC869] >gi|168794276|ref|ZP_02819283.1| hypothetical protein EschercoliO157_18496 [Escherichia coli O157:H7 str. EC4042] >gi|168799898|ref|ZP_02824905.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC508] >gi|195936863|ref|ZP_03082245.1| hypothetical protein EscherichcoliO157_10425 [Escherichia coli O157:H7 str. EC4024] >gi|12513824|gb|AAG55194.1|AE005263_3 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|13360358|dbj|BAB34322.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|187768227|gb|EDU32071.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4196] >gi|188015746|gb|EDU53868.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4113] >gi|189002736|gb|EDU71722.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4076] >gi|189356299|gb|EDU74718.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4401] >gi|189363379|gb|EDU81798.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4486] >gi|189366482|gb|EDU84898.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC4501] >gi|189373005|gb|EDU91421.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC869] >gi|189377775|gb|EDU96191.1| sugar phosphatase SupH [Escherichia coli O157:H7 str. EC508] (271 aa)
Score = 172, Expect = 8.6e-11, Identities = 64/263 (24%), Positives = 136/263 (51%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L+D K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNDVKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHI-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|154488720|ref|ZP_02029569.1| hypothetical protein BIFADO_02027 [Bifidobacterium adolescentis L2-32] >gi|154082857|gb|EDN81902.1| hypothetical protein BIFADO_02027 [Bifidobacterium adolescentis L2-32] (273 aa)
Score = 172, Expect = 8.7e-11, Identities = 75/267 (28%), Positives = 126/267 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVL-ESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDA--IKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG----PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK    D+DGTL     +V+ +S++ A+  ++  G+   +C+GR  + M  VL     I    D I+G  G Q+   +     +      D   I D +  + D+  N+   D GY  F + N    R       TA   DV     +P+ ++      +  P V    ++ +++       V G    P   + +  +  K  G+++ L+ F  T DN +AFGD  ND DM+  + IGVAM N +D+ K+ A Y+T+   ++ GI N  +K+F
  S:    12 IKTAFFDIDGTLTSFVTHVVPQSTVDALHALQRNGVKVFICSGRAPSYMGVVLD---TIPVTFDGIVGLNG-QYCTTRDGLDYRHPIDQADVKLITDWLETHADVVANYAESDYGY--FNRTNAALERTWNSLGKTAPKIDVH----DPRERIANHSTFQISPYV---DETMEAEIASMCSNVRGVRWHPAFTDLIPADGGKAVGMQVMLEHFGWTKDNAIAFGDGGNDVDMLRFAGIGVAMGNATDEPKAAADYVTDS-VDDAGIAN-ALKHF 270
>gi|167037145|ref|YP_001664723.1| Cof-like hydrolase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855979|gb|ABY94387.1| Cof-like hydrolase [Thermoanaerobacter pseudethanolicus ATCC 33223] (274 aa)
Score = 172, Expect = 9.2e-11, Identities = 73/267 (27%), Positives = 129/267 (48%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY-LTEPKS----------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           Q K++  DMD TLL   K + + +I A+ K +EKG+   + TGR       V    +   + + F   II   GA   +   N   + S L+ D++++II   Q  +  F +  +  ++ P+      R +E++ +      VDV  + EP            K+++  D   +   I    S  +  ++ +  +      E ++  VSK   LKI      +  + ++A GD++ND +MI  + +GVA+ N  D+ K VA +IT + N  DG+   I K+
  S:     2 QYKLIAIDMDDTLLRHDKTISKENIEALHKAREKGVYVVISTGR-------VFASAYAYADMIGFRTYIIASNGALIRDPDNNTIYE-SLLNYDSMEEIIKVCQKYNTYFQLISDKTVFSPEITNKFQRYAEWNELFKTELKVDVQEVKEPLKELDKLKSSILKIIVFNDDVEVLKSIREELSKNTSIQITSSYMDN---IEIVNKGVSKGRALKILGGYLGIEREEMIAIGDSENDIEMIKFAGLGVAVENAIDEVKKVADFIT-KSNMEDGVKYVIDKF 270
>gi|70943743|ref|XP_741882.1| hypothetical protein PC000057.03.0 [Plasmodium chabaudi chabaudi] >gi|56520540|emb|CAH79045.1| hypothetical protein PC000057.03.0 [Plasmodium chabaudi] (285 aa)
Score = 172, Expect = 9.4e-11, Identities = 78/268 (29%), Positives = 131/268 (48%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDL-----NFGIPDN--GYLYFPK-ENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-------KVMIVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           + IK+V  D+DGTLL+D   + + +I ++ K   KG+     TGR +  +AN +I K   +  +  I G        +  N C       G   + II++Y D  L     NF    N  G +Y+   E R ++  +E       +  +     + +S       KVMI  DK+ + +VI   +  F  +  +G    T     E  H N +K  G+K   K F+++L++ LA GDA ND +M+      +A+ N S K K  A+Y+    NN+D +++ +  +
  S:    16 NNIKIVFIDLDGTLLNDRNKISKLNIESLVKAHNKGIKIVFATGR-SMFLANSIIGKDVKRNNLSLIPG--------IYINGC----IAYGPNGERIIDNYIDEKLLMDIFNFSKEKNLLGCVYWCGLEKRDTLETNECTDENLSFLPIMPNFIDEESLKDTKIYKVMIRLDKKSVSSVIKMYQDKFSDRISIGKKFKT---YVELFHHNANKFEGVKALCKHFDISLNDALAIGDAVNDIEMLQGVGTSIAVQNASSKIKECAKYVGPS-NNDDAVHHILQTF 282
>gi|153809807|ref|ZP_01962475.1| hypothetical protein RUMOBE_00188 [Ruminococcus obeum ATCC 29174] >gi|149833985|gb|EDM89065.1| hypothetical protein RUMOBE_00188 [Ruminococcus obeum ATCC 29174] (295 aa)
Score = 172, Expect = 1.0e-10, Identities = 65/267 (24%), Positives = 118/267 (44%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD--VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKY--EVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           + +++ +D+DGTLL+D K V   + +AI +    G    +CTGR   + A V   K  + +   ++I   G Q Y+    +       S +    II      DL+     + ++   ++     R ++ + +  K  +   DV   +P  K++ +   E     I   K   S+Y  EV +   +     E +   +SK   ++       + ++N +A GDA ND +M+  + +G  M N          Y+TE DNN+DG+   I K+
  S:    23 ETRILFTDLDGTLLNDHKEVTSGNQVAIDEALACGHKIVVCTGRPLAS-ARVCAAKAGLDKEGCYVICFNGGQIYDPYHEKTVYGKTFSKETAAKIIGEAMKRDLHIQSYSDTHILSARDTEELHRYAKINQLPYKVVECAADVVPEDP-YKLIAITPAEQKEKNICFQKEVISQYAGEVHS-FFSNDCYQEIVPEGISKGFAVRWFCDYLGIPIENSVAAGDAQNDVEMLKAAHVGAVMCNAFPGIAEYGNYVTEHDNNHDGVAEIIHKF 290
>gi|167747085|ref|ZP_02419212.1| hypothetical protein ANACAC_01797 [Anaerostipes caccae DSM 14662] >gi|167654045|gb|EDR98174.1| hypothetical protein ANACAC_01797 [Anaerostipes caccae DSM 14662] (267 aa)
Score = 172, Expect = 1.0e-10, Identities = 67/258 (25%), Positives = 119/258 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNEC-KKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMT--------AKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTL  D K +   +  A+ + +++GL+  LC+ R    +   +    +++++   +I   G +    +  E   +  F  G AI +++ H +   +   I D    Y   +N + ++   +++              D D+        +M V  +E    +   SK F+        + T P   E M   ++K  GL+   +  +++ + V+AFGDA+ND +MI  S  GVAM N  D  K  A  IT   NN DGI
  S:     4 KLIALDLDGTLNTDEKTITPKTRDALLRAQQQGLIIALCSARPVPGLYKDM-KTLELEKHHGILIAYNGGKILRAEDKEILHQQIFPRGLAI-EVLKHLKRYPVTPIIDDGERFYVTDKNGYKVQHECWNNQMECMEVPSLTNCLDFDLV-----KILMSVRPEELWDILPEVSKPFEDDLVF---VRTAPFYIEAMPKGLNKAEGLRRTCELLHISSEEVIAFGDAENDLEMIRFSGRGVAMGNACDALKEAADEIT-LTNNEDGI 259
>gi|50365320|ref|YP_053745.1| HAD-superfamily cof-like hydrolase [Mesoplasma florum L1] >gi|50363876|gb|AAT75861.1| cof-like hydrolase, HAD-superfamily [Mesoplasma florum L1] (273 aa)
Score = 172, Expect = 1.0e-10, Identities = 68/269 (25%), Positives = 124/269 (46%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLD-LNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTV-----INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +++IK++V DMDGT      N++ES+I  ++   + G      TGR      N L     + E    +IGC     Y+L T +  K+S +  D  K +    ++ D + +G  D+          + +  +E  H   ++FD +  + E    V    + ++   +      +  + F+ ++ +      G I  E   P ++K   +    + FN+ L+N+ A GD  ND  MI ++ IGVA+ N   + K VAQ   +++N    +  F+ KY
  S:     1 MNEIKLLVLDMDGTSYHKMGNIIESNIKPLQDAIKTGTKVAFVTGRPVLAKPNNL-KAHNLAEENAILIGCNSGCIYDLNTEKVLKSSPIKSDQAKQLFEEVKNTDTILWGYVDDLNTVILSRKVNDV-YNEECHWEGRFFDGEYLIYE---DVKDNFNFDFFKILGFNGNYDLYEKFEKEFNLNIATNDGKIA-EINAPGINKKFAIDWLSEYFNIPLENIAAMGDGMNDLPMIEHAGIGVALKNSEPRIKEVAQVYIDKENTEGAVAEFVNKY 269
>gi|189461321|ref|ZP_03010106.1| hypothetical protein BACCOP_01971 [Bacteroides coprocola DSM 17136] >gi|189431850|gb|EDV00835.1| hypothetical protein BACCOP_01971 [Bacteroides coprocola DSM 17136] (269 aa)
Score = 172, Expect = 1.1e-10, Identities = 68/265 (25%), Positives = 122/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYL---TEPKSKVMIVCD--------KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++V D+DGTL +  K + E +   + + +++GL   L +GR    +   L ++ ++ +Y  +I+   G +  + KT E    + L  + +  +    +D +      +N Y+     +   + L E      K   VD +L     P +K +IV D        KE    + +R   F+S+          P   E +   + K   L + LK+ N+  + ++A GD  ND  MI  + +GVAM N     +  A YIT   N+ DG+   + K+
  S:     4 KLLVLDLDGTLTNSKKVITEHTRTTLIEAQKRGLKIVLASGRPTYGVVP-LANQLELDKYEGYILSYNGGEIIDWKTGEMMYKNLLDPEVLPYLYQCAKDNNFAIVSYENEYVLTEHPDDEYV-LKEALLNVMKIKKVDNFLKAINHPITKCLIVGDPTRLAVLEKEMYDHLKDRMGVFRSE----------PYFLELVPKGIDKARSLSVLLKEINMKKEEMIAVGDGFNDLSMIQYAGLGVAMANAQPVVRENADYIT-LSNDEDGVAAVVEKF 266
>gi|154484220|ref|ZP_02026668.1| hypothetical protein EUBVEN_01931 [Eubacterium ventriosum ATCC 27560] >gi|149734697|gb|EDM50614.1| hypothetical protein EUBVEN_01931 [Eubacterium ventriosum ATCC 27560] (259 aa)
Score = 172, Expect = 1.1e-10, Identities = 72/263 (27%), Positives = 132/263 (50%)
  Q:     6 IKVVVSDMDGTLLD-DSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH--YQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGP-ILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAM--INGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +K V  D+DGTL+D   K +  SSI AI+++++ G    L TGRD N++    I    I  +  +++  G A + N  T  C K      + ++ I+ +    ++ L F   +  YL        +  +++      KY+  ++          IV    + P   + S+  K   ++   +V  P + ++ M   +SK  G++  +K +    D+ +AFGD +ND +M+ N+KIG+A+  I+GS+K + +A Y+ +     DGIY F+
  S:     1 MKAVFFDVDGTLIDCVEKKIPASSIKAIEELRKNGYKVALATGRDINSIRG--IKDLDISVFDAYVLNNGAAIYDN--TLRCIKDFPFLREDVEKILEYCNNNNMSLIFDTVEGPYL--------ATEITDCLVEGKKYYKEEIPPYIEWKGEEIVKINIFAPMGYDFSELEK---DISARIVPCPTVCYDVMAKGISKQTGIRELMKYYGFNEDDYMAFGDQENDLEMLENAKIGIAVKDIDGSEKLQHMADYVCDAP-RKDGIYTFL 253
>gi|119026014|ref|YP_909859.1| HAD-type hydrolase [Bifidobacterium adolescentis ATCC 15703] >gi|118765598|dbj|BAF39777.1| possible Had-type hydrolase [Bifidobacterium adolescentis ATCC 15703] (273 aa)
Score = 171, Expect = 1.1e-10, Identities = 75/267 (28%), Positives = 126/267 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVL-ESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDA--IKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG----PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK    D+DGTL     +V+ +S++ A+  ++  G+   +C+GR  + M  VL     I    D I+G  G Q+   +     +      D   I D +  + D+  N+   D GY  F + N    R       TA   DV     +P+ ++      +  P V    ++ +++       V G    P   + +  +  K  G+++ L+ F  T DN +AFGD  ND DM+  + IGVAM N +D+ K+ A Y+T+   ++ GI N  +K+F
  S:    12 IKTAFFDIDGTLTSFVTHVVPQSTVDALHALQRNGVKVFICSGRAPSYMGVVLD---TIPVTFDGIVGLNG-QYCTTRDGLDYRHPIDQADVKLITDWLETHADVVANYAESDYGY--FNRTNAALERTWNSLGKTAPKIDVH----DPRERIANHSTFQISPYV---DETMEAEIASMCGNVRGVRWHPAFTDLIPADGGKAVGMQVMLEHFGWTKDNAIAFGDGGNDVDMLRFAGIGVAMGNATDEPKAAADYVTDS-VDDAGIAN-ALKHF 270
>gi|153197463|ref|ZP_01941713.1| Cof-like hydrolase [Listeria monocytogenes 10403S] >gi|127633182|gb|EBA22600.1| Cof-like hydrolase [Listeria monocytogenes 10403S] (279 aa)
Score = 171, Expect = 1.2e-10, Identities = 60/258 (23%), Positives = 114/258 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-------FPKENRHSIRLSEYDHMTAKYF-----DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           + ++ D+DGTLL+D K +   +  A+   +E G+   L +GR    M +   ++ +++++   ++   GA+  +   +E      L+ +  K ++ H +   +   I    Y+Y       +       I + +Y+     +      D+  +L    SK++   D  YM    N         +    + T    FE+    + K   L   L    +  +N++AFGD  ND  M+  +  G+AM N   + K+ A  +T   NN DGI
  S:     4 QAIILDIDGTLLNDDKKISPETKKALITAQENGVKLILASGRPTTGM-HAYAEQLEMEKHHGLLVSYNGAKVVDCARSEELFNQALTVEEGKAVLEHMKQFKVKVMIDKEDYMYTNDVYDCYVPYRGEEINIIQYESRGGNFKLCEKDDLAAFLDYRLSKILTAGDPAYMQK--NYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAENIIAFGDGHNDITMVEYAGTGIAMQNAVAELKAAASSVT-LSNNEDGI 269
>gi|194367557|ref|YP_002030167.1| Cof-like hydrolase [Stenotrophomonas maltophilia R551-3] >gi|194350361|gb|ACF53484.1| Cof-like hydrolase [Stenotrophomonas maltophilia R551-3] (277 aa)
Score = 171, Expect = 1.3e-10, Identities = 71/268 (26%), Positives = 119/268 (44%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           S I++V  DMDGTLLD +  +   +  AI + +  G+   L +GR    +A  L  +  I    D+ I C G     + T E      LS D         +DL ++F   D+  +Y P ++   +++  S    M   Y  V D+  +    K+M++   + +   I R  S    ++ V   L + P   E       K   L+   +   +   NV+A GD +ND  M+  +   VAM N  D  K+VA++ T   N ++G+   I ++
  S:     8 STIELVAIDMDGTLLDPTHTLTVRAKQAIAQARALGVHIVLTSGRPVPGLAPFL-HELGITGDDDYCIACNGGLVQRIGTRETVVEYPLSFDNFLFCEQVARDLGVHFQALDSRRMYTPNQDISYYTVADSHLSRMPLSYRRVEDMDPSMSFIKLMMIDAPDVLDAAIARLPSELTERFAV---LKSAPFFLEVFDHRAGKGPSLQKLAEHLGIDRANVMAIGDQENDLTMLQYAGTSVAMGNAIDAVKAVARFET-TSNADEGVARAIERF 274
>gi|194467638|ref|ZP_03073625.1| Cof-like hydrolase [Lactobacillus reuteri 100-23] >gi|194454674|gb|EDX43571.1| Cof-like hydrolase [Lactobacillus reuteri 100-23] (273 aa)
Score = 171, Expect = 1.3e-10, Identities = 74/266 (27%), Positives = 121/266 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQF----------YNLKTNE-------CKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK+V  D+DGTL++D + +   ++ AIKK   +G+   LCTGR    +   L          +F+I   GA            Y +  N+       C K    S    +D I +  + DL+ + + ++  +  P   R      E   M  +Y      + + K ++    DK +          F       + + +     E+M+   SK N L++  K+  +  D V+A G+A ND  MI  + +GVAM N    T  +A  +T  DNN+DG+   I KY
  S:     3 IKLVAIDIDGTLINDQRKITPQTVAAIKKASAQGVKIVLCTGRPMTGVKAYLDQLGLNDSDNEFVISFNGALAQSTSGNVLVNYTMSFNDYADWQTYCIKEGVKSQIETRDYI-YTINRDLSPYTVYESDLVSMPIRYR---TFEELSKMQDQYVIAKAMMVDTKEQI----DKAWTELPAEMRDHF-------SIVRSEDFYLEFMNKQASKGNALQLLSKELGIKKDEVMALGNAQNDDSMIEFAGLGVAMGNSIPGTLKIAD-VTTADNNHDGVGKAIEKY 270
>gi|168217968|ref|ZP_02643593.1| HAD hydrolase, IIB family [Clostridium perfringens NCTC 8239] >gi|182379997|gb|EDT77476.1| HAD hydrolase, IIB family [Clostridium perfringens NCTC 8239] (279 aa)
Score = 171, Expect = 1.3e-10, Identities = 77/265 (29%), Positives = 122/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIP-----------DNGYLYFPK---ENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++   + E +  AI+K  E+G+   + TGR    A   A +L  K  I       I C GA       ++    S L+ D +  I +  +  D+N   F  P           ++GY    K   E++  +  SE       +     Y       + I  D   +  +    +  K KYE    + + P  FE M+   SK   +K+     N+  + ++  GD++ND  MI  + +GVAM N  +  K  A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNNKHEISERNKEAIRKATERGVKVAVTTGRLFASAKYYAGLLGVKTPI-------ISCNGAFIREKDEDKVIYESVLNEDQLDRIYDVIKKYDINMAYFNTPNTVISEKIVPEEHGYKVMNKMMGESKEKVMFSEGIDFKEAF---KTYGKHILKAICIENDSNKLNDLFKAKEELK-KYEDLEVVSSSPSNFEVMNKGTSKGGAVKVLADILNINREEIMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDT-NENDGVAKAIEKF 276
>gi|30262426|ref|NP_844803.1| HAD superfamily hydrolase [Bacillus anthracis str. Ames] >gi|47527720|ref|YP_019069.1| HAD superfamily hydrolase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49185270|ref|YP_028522.1| HAD superfamily hydrolase [Bacillus anthracis str. Sterne] >gi|165868573|ref|ZP_02213233.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0488] >gi|167632586|ref|ZP_02390913.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0442] >gi|167641379|ref|ZP_02399630.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0193] >gi|170686989|ref|ZP_02878208.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0465] >gi|170704606|ref|ZP_02895072.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0389] >gi|177649267|ref|ZP_02932269.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0174] >gi|190565278|ref|ZP_03018198.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis Tsiankovskii-I] >gi|30257057|gb|AAP26289.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. Ames] >gi|47502868|gb|AAT31544.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. 'Ames Ancestor'] >gi|49179197|gb|AAT54573.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. Sterne] >gi|164715299|gb|EDR20816.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0488] >gi|167510656|gb|EDR86051.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0193] >gi|167532884|gb|EDR95520.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0442] >gi|170130407|gb|EDS99268.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0389] >gi|170669040|gb|EDT19784.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0465] >gi|172084341|gb|EDT69399.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis str. A0174] >gi|190563305|gb|EDV17270.1| hydrolase, haloacid dehalogenase-like family [Bacillus anthracis Tsiankovskii-I] (257 aa)
Score = 171, Expect = 1.4e-10, Identities = 76/262 (29%), Positives = 118/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEY---MPTVINRSKSFKSKYEVGTP------LVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K+++SD+DGTLL   K + E SI  +++ K  G      T R              IK+Y+  ++       YN    LK N       +S + I +II                     K N H I L   D + +  FDV  Y      +++ V D ++      +I  +   K K+    P      +     L + MH  VSK N ++  L+  N  +  V+AFGD  ND +MI    IGVAM N  ++ K+VA++I  + N+ DG+  F+
  S:     3 KIIISDLDGTLLRSDKTISEKSINILRECKNNGDELIFATARPPR----------AIKQYIPNVLKSEIIICYNGALVLKGNNILYEMKISKNDILEIIEIAN-----------------KYNLHEICLEIGDKLYSN-FDVTDYFGNIPCEIIDVRDLDFEKASKAIICTNGPIKQKFIKELPDECRGVITDDGTLCQIMHAEVSKWNSIQYVLQHLNRDVSEVIAFGDDYNDMEMIEKCGIGVAMSNAVEELKAVAKFIA-KSNDEDGVATFL 248
>gi|168206727|ref|ZP_02632732.1| HAD hydrolase, IIB family [Clostridium perfringens E str. JGS1987] >gi|170661857|gb|EDT14540.1| HAD hydrolase, IIB family [Clostridium perfringens E str. JGS1987] (279 aa)
Score = 170, Expect = 1.5e-10, Identities = 78/265 (29%), Positives = 122/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIP-----------DNGYLYFPK---ENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++   + E +  AIKK  E+G+   + TGR    A   A +L  K  I       I C GA       ++    S L+ D +  I +  +  D+N   F  P           ++GY    K   E++  +  SE       +     Y       + I  D   +  +    +  K KYE    + + P  FE M+   SK   +K+     N+  + ++  GD++ND  MI  + +GVAM N  +  K  A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNNKHEISERNKEAIKKATERGVKVAVTTGRLFASAKYYAGLLGVKTPI-------ISCNGAFIREKDEDKVIYESVLNEDQLDRIYDVIKKYDINMAYFNTPNTVISEKIVPEEHGYKVMNKMMGESKEKVMFSEGIDFKEAF---KTYGKHILKAICIENDSNKLNDLFKAKEELK-KYEDLEVVSSSPSNFEVMNKGTSKGCAVKVLADILNINREEIMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDT-NENDGVAKAIEKF 276
>gi|19746608|ref|NP_607744.1| hypothetical protein spyM18_1711 [Streptococcus pyogenes MGAS8232] >gi|19748826|gb|AAL98243.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] (274 aa)
Score = 170, Expect = 1.5e-10, Identities = 69/250 (27%), Positives = 124/250 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS------------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           I+++  D+DGTLL+  K + + +I AI++  + GL   LCTGR  +       D+  + +  +F+I   G   Y+    + + +  L    I D I   ++L  +F  PD  YL   +EN + +   E   +  +  D+   + +P S            + M + +K  +       ++ +++      +V +   + E +   VSK + LK  ++D  LT D V+A GDA ND +M+  + +GVAM N S   K +A  +T
  S:     2 IQLIAIDLDGTLLNQDKQIPKENITAIQEAAQSGLKIVLCTGRPQSG-TRPYFDQLGLTQE-EFLIINNGCSTYSSPDWQLRHSKMLK---ISD-IELLEELSQSF--PDI-YLTLTEENDYLVLEEEVPDLVQEDGDLVFTIVKPVSLAELSDTPRLIFQAMYLGEKAALDAF---ERAVRNQLSQSFHVVRSQDNILEILPQGVSKASALKELVEDLGLTADQVMAIGDAPNDIEMLTYAGLGVAMENASAAIKPLADKVT 252
>gi|125624696|ref|YP_001033179.1| hypothetical protein llmg_1914 [Lactococcus lactis subsp. cremoris MG1363] >gi|124493504|emb|CAL98483.1| Hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] (278 aa)
Score = 170, Expect = 1.5e-10, Identities = 70/266 (26%), Positives = 126/266 (47%)
  Q:     7 KVVVSDMDGTLL-DDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGA--QFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY----------LTE-PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPI-LFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  D+DGT L  D +++   +    K+++  G +  + TGR       + +D ++  E    +I   GA     N K  E  K+ ++    I D++ H Q+ +L+F         F  E R    L+ + ++  K F V+ +          +TE P + ++    K+ +       + +  K +VG  +  GP  + E +   +SK +GL   LK  ++ L+N++AFGD  ND +M   +    AM N S +    A  I    N+ DG+   + K F
  S:     8 KLIAIDLDGTTLQSDGRSISRYTKYIFKQVESLGHIICITTGRPFR----MSLDVYRELELTSPVINFNGALISMPNDKNWEHTKSYYIDRSFIFDLLRHQQNFNLHF---------FAVEYRRKFFLNTFRNVEPKLFGVEKFQPYNRLRADRVTENPHAVLLSTRQKDKLALAEEMKRHYNGKIDVG--VWGGPNGILEVVPKGISKASGLNHLLKVLDIPLENLIAFGDEHNDIEMFKLAPQAYAMKNASARLTPYASEILPWTNDEDGVARQLEKLF 273
>gi|160883991|ref|ZP_02064994.1| hypothetical protein BACOVA_01965 [Bacteroides ovatus ATCC 8483] >gi|156110721|gb|EDO12466.1| hypothetical protein BACOVA_01965 [Bacteroides ovatus ATCC 8483] (270 aa)
Score = 170, Expect = 1.6e-10, Identities = 67/265 (25%), Positives = 119/265 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYL--------YFPKE---NRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++V D+DGTL +  K +   +   + +++E+G+   L +GR    +   L ++ ++ E+  FI+   G +  N +T E    + L  + +  +    +   L+    D   +        Y  KE   N+ ++R +  D +T     V   L    S  +I  + E    +  R   F+S+          P   E +   + K   L + LK+  +  + V+A GD  ND  MI  + +G+AM N  +  K  A YIT   N  DG+   I K+
  S:     4 KLIVLDLDGTLTNSKKEITPRNRETLIRMQEQGIRLVLASGRPTYGIVP-LANELRMNEFGGFILSYNGGEIINWETQEMVYENVLPNEVVPVLYECARTHQLSILTYDGAEIITENSQDPYVLKEAFLNKMAVRETN-DFLTDITLPVAKCLIVGDSDKLIPLEAELCLRLQGRINVFRSE----------PYFLELVPQGIDKALSLAVLLKEIGVAREEVIAIGDGYNDLSMIKFAGLGIAMGNAQEPIKKAADYIT-LSNEEDGVAEAINKF 266
>gi|49483132|ref|YP_040356.1| putative haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241261|emb|CAG39940.1| putative haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MRSA252] (274 aa)
Score = 170, Expect = 1.6e-10, Identities = 73/268 (27%), Positives = 132/268 (49%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRD--ANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKT-SFLSGDAIKDIINHYQDLDLNFGIPD-NGYLYFPKENRHSIRLSEYDHM---TAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKY----EVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           Q  ++  D+DGTLL+D+K +   +   + +++++G    + TGR   A+ M       +        I+   GA  ++ K    K     L     ++II   Q   ++  I +   Y++    N H  RL E   M     +  ++ V+L E  + ++I  ++  +P + N    F + +      G P    P++ E +   ++K  G++   +  N+  +N++AFGD DND +MI  ++ GVAM NG  + K VA  IT  +NN DGI  ++  +F
  S:     2 QPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMY------YHELNLTTPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFI---NNHDPRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWGAPF---PVI-EIVKLGINKARGIEQVRQFLNIERNNIIAFGDEDNDIEMIEYARHGVAMENGLQELKDVANNIT-FNNNEDGIGRYLNDFF 266
>gi|13508122|ref|NP_110071.1| HAD family phosphatase/phosphatase [Mycoplasma pneumoniae M129] >gi|2493757|sp|P75399|Y383_MYCPN Uncharacterized protein MG265 homolog >gi|1674142|gb|AAB96102.1| HAD superfamily hydrolase/phosphatase [Mycoplasma pneumoniae M129] (282 aa)
Score = 170, Expect = 1.6e-10, Identities = 69/269 (25%), Positives = 126/269 (46%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF-IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGI-PDNGYLYFPKENRHSIRLSEYDH------MTAKYFDVDV--------YLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +++ ++ D+DGTLL      L  ++  +K+++++G      TGR     +++LI         D  +I   GA  Y+    +    + L+  ++  I+     L+ +F I  D     F K      RL           +T   F ++         + T+  +K++++ +       I++        E  + + +     + MH +V+K  GLK   +   L     + FGD DND ++    K  VAM NGSD  K  A +I+E DN++DGIY+F+  + K
  S:     4 KVQNLIFDLDGTLLSWGHEPLPQTVTFLKELQKQGFKITFATGR-----SHILIRNTTQFIQPDLPVISSNGALIYDFAREKALHMTQLAPQSVVPIMRLLLQLEESFCIYTDKKVFGFEKPGIPCKRLRTTQSKIVEPDITQNNFTINPLTDASKFDFATQNITKILLITEDR---GRISKITKHLDAIENISYVSSMTFALDIMHKDVNKAYGLKALEQQTGLDPQMTMVFGDGDNDVEIFNAVKYSVAMANGSDLAKQNATFISEFDNDHDGIYHFLQCFLK 280
>gi|166993039|ref|ZP_02259499.1| hydrolase, haloacid dehalogenase-like family protein [Bacillus cereus AH820] (257 aa)
Score = 170, Expect = 1.6e-10, Identities = 76/262 (29%), Positives = 118/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEY---MPTVINRSKSFKSKYEVGTP------LVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K+++SD+DGTLL   K + E SI  +++ K  G      T R    +   + +  K     + II   GA    LK N       +S + I +II                     K N H I L   D + +  FDV  Y      +++ V D ++      +I  +   K K+    P      +     L + MH  VSK N ++  L+  N  +  V+AFGD  ND +MI    IGVAM N  ++ K+VA++I  + N+ DG+  F+
  S:     3 KIIISDLDGTLLRSDKTISEKSINILRECKNNGDELIFATARPPRAIEQYIPNVLK----SEIIICYNGALV--LKGNNILYEMKISKNDILEIIEIAN-----------------KYNLHEICLEIGDKLYSN-FDVTDYFGNIPCEIIDVRDLDFEKASKAIICTNGPIKQKFIKELPDECRGVITDDGTLCQIMHAEVSKWNSIQYVLQHLNRDVSEVIAFGDDYNDMEMIEKCGIGVAMSNAVEELKAVAKFIA-KSNDEDGVATFL 248
>gi|70939776|ref|XP_740387.1| hypothetical protein PC000085.05.0 [Plasmodium chabaudi chabaudi] >gi|70948045|ref|XP_743580.1| hypothetical protein PC000194.00.0 [Plasmodium chabaudi chabaudi] >gi|56518068|emb|CAH81934.1| hypothetical protein PC000085.05.0 [Plasmodium chabaudi] >gi|56523144|emb|CAH74563.1| hypothetical protein PC000194.00.0 [Plasmodium chabaudi] (285 aa)
Score = 170, Expect = 1.7e-10, Identities = 71/265 (26%), Positives = 126/265 (47%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS--------------------KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           + IK+V +D+DGTLL+      + +I ++ K K KG+   + +GR   + AN +I +   K  +  + G        +  N C       G  I + IN    +D+           F KEN    R+  YD      F+++ Y+ E K+                    K++I  +++ + +V+      F  +  V  P  T     E  + N++K  G+K   K F ++L++ L  GD DND +M+   K  +A+ N   K K  A+Y+    NN+D +++ +
  S:    16 NNIKIVFTDLDGTLLNSHHKASKLNIESLAKAKNKGIKVVIASGRPILS-ANAVIGEDIKKYNLSLMPG--------IYLNGCITYEPNGGRIIDNYINDKLIMDI---------YNFSKENNFVNRMVWYDFEKTYTFEMNEYIDEYKALECITPDIIDEERLKNTKIYKILICLNEQNLSSVLKMYHDKFSDRASVINPFKT---YIELFNSNINKFEGVKALCKHFGISLNDALVIGDGDNDMEMLQGVKTSIAVQNAGSKIKECAKYVGPS-NNDDAVHHIL 279
>gi|168214798|ref|ZP_02640423.1| HAD hydrolase, IIB family [Clostridium perfringens CPE str. F4969] >gi|170713758|gb|EDT25940.1| HAD hydrolase, IIB family [Clostridium perfringens CPE str. F4969] (279 aa)
Score = 170, Expect = 1.8e-10, Identities = 78/265 (29%), Positives = 129/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIPDN--GYLYFPKENRHSI--RL---SEYDHMTAKYFDV-DVYLTEPKSKVMIVC---DKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++   + E +  AI+K  E+G+   + TGR    A   A +L  K  I       I C GA       ++    S L+ D +  I +  +  D+N   F  P+        P+E+ + +  R+   S+   M ++  D  + + T  K  +  +C   D   +  +    +  K KYE    + + P  FE M+   SK   +K+     N+  + ++  GD++ND  MI  + +GVAM N  +  K  A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNNKHEISERNKEAIRKATERGVKVAVTTGRLFASAKYYAGLLGVKTPI-------ISCNGAFIREKDEDKVIYESVLNEDQLDRIYDVIKKYDINMAYFNTPNTVISEKIVPEEHGYKVMNRMMGESKEKVMFSEGIDFREAFKTYGKHILKAICIENDSNKLNDLFKAKEELK-KYEDLEVVSSSPSNFEVMNKGTSKGCAVKVLADILNINREEIMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDT-NENDGVAKAIEKF 276
>gi|164686327|ref|ZP_02210357.1| hypothetical protein CLOBAR_02765 [Clostridium bartlettii DSM 16795] >gi|164601929|gb|EDQ95394.1| hypothetical protein CLOBAR_02765 [Clostridium bartlettii DSM 16795] (273 aa)
Score = 170, Expect = 1.9e-10, Identities = 74/267 (27%), Positives = 125/267 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFI------IGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEP------KSKVM-IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           K++VSDMDGTLL D+  + E + +A+ K  EKG+     +GR  N+           +E+ DF+      I C GA     KTN+    + +  D    II+ ++  ++ + +     +     ++   R ++         D++V+  +       K K++ I+   +Y    + + K    + E      +     E MH  V+K   LK  +    +  D V+AFGD  ND  M+  + IGV M N +D+ K    YIT + N  DG+   I K+ K
  S:     4 KLIVSDMDGTLLGDNHKITEENKIALSKALEKGVKIVPASGRIYNSA----------REHFDFLDINTPLIACNGAIIKETKTNKLIYKNNIPNDICLKIIDIFEKNEVYYQLYSENTMMCKNLSKEDQRQTKERLKNFFNDDINVHFGDDLKEEVIKHKILKIIAIDDYDMDKLKKVKEDLDQIEDIEITSSWFNNVEIMHKGVNKGEALKALINYLGIDKDEVIAFGDNYNDLPMLELAGIGVVMGNANDEVKEKGDYITAK-NTEDGVAKAIYKFLK 272
>gi|150007775|ref|YP_001302518.1| haloacid dehalogenase-like hydrolase [Parabacteroides distasonis ATCC 8503] >gi|149936199|gb|ABR42896.1| haloacid dehalogenase-like hydrolase [Parabacteroides distasonis ATCC 8503] (268 aa)
Score = 169, Expect = 2.0e-10, Identities = 69/262 (26%), Positives = 119/262 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK-ENRHSIRLSEYDHMTAKYFDVDVY-LTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPL---VTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K++V D+DGTL +  K +   +   + + +EKGL   L +GR    +   L ++  IK+Y  FI+   G +  +L T++      L  D +  + N  ++  L     +  Y+     EN++    S    M  K  D  +  L +P  K ++V + E +  +       K + E+G  +    +     E +   + K   L   L+   +  + V+A GD  ND  MI  + +GVAM N     K+ A  IT+  N+ DG+  FI
  S:     4 KLLVLDLDGTLTNSKKEITPFTRETLLQAQEKGLHLVLASGRPTYGIVP-LAEELNIKQYGGFILSFNGGKVIDLMTDKVLFEQALPPDIVPVLYNRSKEAGLAILSYNGKYILSEHPENKYVQYESFLTKMKIKATDDFLRDLHQPADKCLVVGEPEMLVPL-----EEKLRQELGKRINVYRSEAFYLELVPKGIDKAASLSRLLERTRIKQEEVIAIGDGFNDVSMIHFAGLGVAMANAQPPVKANADRITQYTNDEDGVARFI 264
>gi|169335699|ref|ZP_02862892.1| hypothetical protein ANASTE_02119 [Anaerofustis stercorihominis DSM 17244] >gi|169258437|gb|EDS72403.1| hypothetical protein ANASTE_02119 [Anaerofustis stercorihominis DSM 17244] (265 aa)
Score = 169, Expect = 2.1e-10, Identities = 71/265 (26%), Positives = 128/265 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN-RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKE---YMPTVINRSKSFK-----SKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++V D+D TLL   K+V + ++ AIKK K+KG++  L +GR A    +VL     I    ++ I   GA  +  K N+ K     + D   D+++  +   +  G+  +  L F  EN   SI  S           +++Y    K+K+  + D +    + T     K ++      K    + ++  P  F+ M   ++K  G +   K+  +++D V+  GD +NDY  I  + +G+A+ N +D  K +A  + EQ  + D +   + KY
  S:     4 KLIVMDVDNTLLCTDKSVSKKNLEAIKKCKDKGIMVSLASGRPA---LDVLHYAKMIGIEDNYHISDNGAGIF--KGNDRKIIKTFNHDFYIDLVDKLRAKGIECGVFSSENLDFVYENGSESIGKS-----------IEIYFPVTKTKLGNIKDIKGVYKISTYFKDDKEYEFVKGLEKENEMSGVIPDPNYFDMMPYEITKIKGTEAIAKELGISMDEVIVMGDQENDYTNIKGAGLGIAVANATDDVKEIADVVLEQSCDEDAVAYVVDKY 261
>gi|15673714|ref|NP_267888.1| hypothetical protein L173313 [Lactococcus lactis subsp. lactis Il1403] >gi|12724751|gb|AAK05830.1|AE006403_8 conserved hypothetical protein [Lactococcus lactis subsp. lactis Il1403] (278 aa)
Score = 169, Expect = 2.1e-10, Identities = 70/266 (26%), Positives = 126/266 (47%)
  Q:     7 KVVVSDMDGTLL-DDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGA--QFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY----------LTE-PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPI-LFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  D+DGT L  D +++   +    K+++  G +  + TGR       + +D ++  E    +I   GA     N K  E  K+ ++    I D++ H Q+ +L+F         F  E R    L+ + ++  K F V+ +          +TE P + ++    K+ +       + +  K +VG  +  GP  + E +   +SK +GL   LK  ++ L+N++AFGD  ND +M   +    AM N S +    A  I    N+ DG+   + K F
  S:     8 KLIAIDLDGTTLQSDGRSISRYTKYIFKQVESLGHIICITTGRPFR----MSLDVYRELELTSPVINFNGALISMPNDKNWEHTKSYYIDRSFIFDLLRHQQNFNLHF---------FAVEYRRKFFLNTFRNVEPKLFGVEKFQPYNRLRADRVTENPHAVLLSTRQKDKLALAEEMKRHYNGKIDVG--VWGGPNGILEVVPKGISKASGLNHLLKVLDIPLENLIAFGDEHNDIEMFKLAPNAYAMKNASARLTPYASEILPWTNDEDGVARQLEKLF 273
>gi|116512586|ref|YP_811493.1| HAD superfamily hydrolase [Lactococcus lactis subsp. cremoris SK11] >gi|116108240|gb|ABJ73380.1| Predicted hydrolase of the HAD superfamily [Lactococcus lactis subsp. cremoris SK11] (278 aa)
Score = 169, Expect = 2.1e-10, Identities = 70/266 (26%), Positives = 126/266 (47%)
  Q:     7 KVVVSDMDGTLL-DDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGA--QFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY----------LTE-PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPI-LFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  D+DGT L  D +++   +    K+++  G +  + TGR       + +D ++  E    +I   GA     N K  E  K+ ++    I D++ H Q+ +L+F         F  E R    L+ + ++  K F V+ +          +TE P + ++    K+ +       + +  K +VG  +  GP  + E +   +SK +GL   LK  ++ L+N++AFGD  ND +M   +    AM N S +    A  I    N+ DG+   + K F
  S:     8 KLIAIDLDGTTLQSDGRSISRYTKYIFKQVESLGHIICITTGRPFR----MSLDVYRELELTSPVINFNGALISMPNDKNWEHTKSYYIDRSFIFDLLRHQQNFNLHF---------FAVEYRRKFFLNTFRNVEPKLFGVEKFQPYNRLRADRVTENPHAVLLSTRQKDKLGLAEEMKRHYNGKIDVG--VWGGPNGILEVVPKGISKASGLNHLLKVLDIPLENLIAFGDEHNDIEMFKLAPQAYAMKNASARLTPYASEILPWTNDEDGVARQLEKLF 273
>gi|15675557|ref|NP_269731.1| hypothetical protein SPy_1700 [Streptococcus pyogenes M1 GAS] >gi|71911206|ref|YP_282756.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS5005] >gi|13622760|gb|AAK34452.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] >gi|71853988|gb|AAZ52011.1| hydrolase, HAD superfamily [Streptococcus pyogenes MGAS5005] (274 aa)
Score = 169, Expect = 2.3e-10, Identities = 68/250 (27%), Positives = 124/250 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS------------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           I+++  D+DGTLL+  K + + +I AI++  + GL   LCTGR  +       D+  + +  +F+I   G   Y+    + + +  L    + D I   ++L  +F  PD  YL   +EN + +   E   +  +  D+   + +P S            + M + +K  +       ++ +++      +V +   + E +   VSK + LK  ++D  LT D V+A GDA ND +M+  + +GVAM N S   K +A  +T
  S:     2 IQLIAIDLDGTLLNQDKQIPKENITAIQEAAQSGLKIVLCTGRPQSG-TRPYFDQLGLTQE-EFLIINNGCSTYSSPDWQLRHSKMLK---VSD-IELLEELSQSF--PDI-YLTLTEENDYLVLEEEVPDLVQEDGDLVFTIVKPVSLAELSDTPRLIFQAMYLGEKAALDAF---ERAVRNQLSQSFHVVRSQDNILEILPQGVSKASALKELVEDLGLTADQVMAIGDAPNDIEMLTYAGLGVAMENASAAIKPLADKVT 252
>gi|21911016|ref|NP_665284.1| hypothetical protein SpyM3_1480 [Streptococcus pyogenes MGAS315] >gi|28895299|ref|NP_801649.1| hypothetical protein SPs0387 [Streptococcus pyogenes SSI-1] >gi|139473271|ref|YP_001127986.1| haloacid dehalogenase-like hydrolase [Streptococcus pyogenes str. Manfredo] >gi|21905224|gb|AAM80087.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28810545|dbj|BAC63482.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] >gi|134271517|emb|CAM29740.1| haloacid dehalogenase-like hydrolase [Streptococcus pyogenes str. Manfredo] (274 aa)
Score = 169, Expect = 2.3e-10, Identities = 68/250 (27%), Positives = 124/250 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS------------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           I+++  D+DGTLL+  K + + +I AI++  + GL   LCTGR  +       D+  + +  +F+I   G   Y+    + + +  L    + D I   ++L  +F  PD  YL   +EN + +   E   +  +  D+   + +P S            + M + +K  +       ++ +++      +V +   + E +   VSK + LK  ++D  LT D V+A GDA ND +M+  + +GVAM N S   K +A  +T
  S:     2 IQLIAIDLDGTLLNQDKQIPKENITAIQEAAQSGLKIVLCTGRPQSG-TRPYFDQLGLTQE-EFLIINNGCSTYSSPDWQLRHSKMLK---VSD-IELLEELSQSF--PDI-YLTLTEENDYLVLEEEVPDLVQEDGDLVFTIVKPVSLAELSDTPRLIFQAMYLGEKAALDAF---ERAVRNQLSQSFHVVRSQDNILEILPQGVSKASALKELVEDLGLTADQVMAIGDAPNDIEMLTYAGLGVAMENASAAIKPLADKVT 252
>gi|58176606|pdb|1RLO|A Chain A, Phospho-Aspartyl Intermediate Analogue Of Ybiv From E. Coli K12 >gi|58176607|pdb|1RLO|B Chain B, Phospho-Aspartyl Intermediate Analogue Of Ybiv From E. Coli K12 >gi|58176608|pdb|1RLO|C Chain C, Phospho-Aspartyl Intermediate Analogue Of Ybiv From E. Coli K12 >gi|58176609|pdb|1RLO|D Chain D, Phospho-Aspartyl Intermediate Analogue Of Ybiv From E. Coli K12 (271 aa)
Score = 169, Expect = 2.4e-10, Identities = 63/263 (23%), Positives = 136/263 (51%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+ MDGT L+D+K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTXMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHV-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|15674658|ref|NP_268832.1| hypothetical protein SPy_0568 [Streptococcus pyogenes M1 GAS] >gi|71910284|ref|YP_281834.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS5005] >gi|13621774|gb|AAK33553.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] >gi|71853066|gb|AAZ51089.1| hydrolase, HAD superfamily [Streptococcus pyogenes MGAS5005] (274 aa)
Score = 169, Expect = 2.4e-10, Identities = 73/259 (28%), Positives = 120/259 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYF--PKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           I+++  D+DGTL +  K V +++  A+   +EKG+   + TGR    + N+L +   +      I   GG    N  T E    S LS D +  I    + + L   I   G +Y    K+ RHS        +T  + +V      PK    +K++ V D +++   +I  S S    +E      +  I+FE M   + K  GL +  +   L   +V+A GD  ND+ M+  + +GVAM NG    K+ A  +T   N+  G+
  S:     3 IRILALDLDGTLYNTEKIVTDANKKALAAAREKGVKVVITTGRPLKAIGNLLEELDLLDHDDYSITFNGGLVQRN--TGEVLDKSSLSFDQVCQIQQALEAVGLPTDIISGGDVYSIPSKDGRHSQYHLANPLLT--FIEVTSVAELPKDITYNKIVTVTDPDFLDQQIIKLSPSLFEDFEA---FKSRDIIFEIMPKGIDKAFGLNLLCQHLGLDARHVMAMGDEANDFAMLEWAGLGVAMANGVSGAKADADAVTTLTNDESGV 261
>gi|160892117|ref|ZP_02073120.1| hypothetical protein BACUNI_04580 [Bacteroides uniformis ATCC 8492] >gi|156858595|gb|EDO52026.1| hypothetical protein BACUNI_04580 [Bacteroides uniformis ATCC 8492] (410 aa)
Score = 169, Expect = 2.5e-10, Identities = 67/258 (25%), Positives = 115/258 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNEC--------KKTSFLSGDAIKD--IINHYQDLDLNFGIPDNGYLYFPK--ENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++V D+DGTLL+D + + + ++ A+ K+++ G+   L +GR    +   L    ++  Y  F++   G Q    +  E         +   +L   A K+   I  Y D  L    PDN Y+       N   I+  E+      +      L   K K +I  ++ +   +     +F+S+          P   E +   V+K N L   L+   +T + V+A GD   D  M+  + +GVAM +  D  K  A Y+T   N  DG+
  S:     4 KLLVLDVDGTLLNDEREISKRTLAALLKVQQMGVRIVLASGRPTYGLMP-LAKTLELGNYGGFVLSYNGCQIIKAQNGEILFERRINPEMLPYLEKKARKNGFAIFTYHDDTLITDSPDNEYIKNEALLNNLKIIKEDEFS-TAIDFAPCKCMLVSDKEKALIGLEQHWEKRLAGTLDAFRSE----------PYFLEVVPCGVNKANTLGALLEHLGVTREEVIAVGDGVCDVTMLQLAGMGVAMGHSQDSVKVCADYVTAS-NEEDGV 260
>gi|171779535|ref|ZP_02920499.1| hypothetical protein STRINF_01380 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282152|gb|EDT47583.1| hypothetical protein STRINF_01380 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (307 aa)
Score = 168, Expect = 2.6e-10, Identities = 66/268 (24%), Positives = 123/268 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA--IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQ----DLDLNFGIPDNGYL----YFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           IK++  DMDGT LD+ K   ++      + ++ ++G+LF + TG   + M  V  +   +   + +++G GG      +T   K    L+   ++  + +Y+    D  +    P++ Y+    Y  +      RL  Y+        +D  L  P  K+     +  M    +  + F+ ++    P+ +G    + + P V K  G+K  +    ++ D V+ FGD DND  M+  +K   AM N S   K+VA +I    N   G++  I +Y +
  S:    36 IKLIAVDMDGTFLDE-KGQFDAKRFEQLLDELDKRGILFVVATGNQISRMKIVFGN---LANRLAYVVGNGGHLLVKDQTIYLKN---LNAQQLQHFLQYYEKHFDDYHVVISSPEHSYMTKGAYSCQNLGDPERLKYYNASFPNVILLDNMLELPHEKINKSTTQLPMALFESVIQDFRKEFPDLVPMASGLGAIDVVLPGVDKALGIKELMALKGISADQVMTFGDGDNDISMLRLAKYSYAMENASKTVKAVANFIAPT-NAKSGVFQMIEQYLE 305
>gi|160893341|ref|ZP_02074128.1| hypothetical protein CLOL250_00890 [Clostridium sp. L2-50] >gi|156865033|gb|EDO58464.1| hypothetical protein CLOL250_00890 [Clostridium sp. L2-50] (270 aa)
Score = 168, Expect = 2.6e-10, Identities = 67/265 (25%), Positives = 124/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH----------YQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKY-FDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTL +  K V + ++  I +I+EKG +  + +GR    +  +  D  K+ +Y  +++   G +  + KT E    + +  D  + I ++          Y+   +  G P + Y+   +   + + + + D+      F ++  L   +S V    ++E      ++   F+S+          P   E M  NV K   L+  LK  ++ + +++A GD  ND  MI  + +GVAM N     K  A YIT   N+ DG+   I K+
  S:     4 KIIALDIDGTLTNSKKEVTQPTLDKIIEIQEKGHVVAIASGRPLPGIRKI-ADTLKLDKYEGYVLAFNGGRIVDYKTGEVVYQACVDNDIARRIYDYCVKKKIGMVTYEGDTVITGTPIDEYMSL-EARLNFMEIHQVDNFKEYIDFPLNKCLLTAESTVAEQVEQELNALYGDKVTVFRSE----------PFFVEIMPKNVHKATSLEKLLKYLDMDVKDLIACGDGFNDLTMIDYAGVGVAMGNAQQIVKDHADYIT-LTNDEDGLVPVIEKF 266
>gi|154483130|ref|ZP_02025578.1| hypothetical protein EUBVEN_00831 [Eubacterium ventriosum ATCC 27560] >gi|149735938|gb|EDM51824.1| hypothetical protein EUBVEN_00831 [Eubacterium ventriosum ATCC 27560] (275 aa)
Score = 168, Expect = 2.7e-10, Identities = 70/260 (26%), Positives = 124/260 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQ--DLDLNFGIPDNGYLYFPK---ENRHSIRLSEYDHMTAKYF----DVDVYLT---EPKSKVMIVC-DKEYMPTVINRSK--SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           IK+V  D+DGTLLD +KN+ E +   +K+ +E+G+ F   TGR  N +  V         YV + I C GA   + + N+   +  L    ++ I +  +  D+D+ F +  +G +Y  +   E+     +   D    K      ++  Y+    +P +KV I     E    V+ + K  ++   Y  GT L       E+     +K  GL    +   ++++  +A GD  ND D++  + + V M N  D+ K +  +IT  ++ N   Y
  S:     2 IKLVAMDIDGTLLDSNKNLSEENKTTVKEYEERGIKFTFSTGRIDNELEEVS----SKMPYVKYGIMCNGAYVIDFENNKMLYSDLLDMSDVRYIYDTVKAMDMDMMFELQADGVIYSERRCIEDTKRYNVYHIDEFIKKTRVPVENIGEYIASRDKPVAKVNIFFPTAEIRDEVVEKIKDINYDLSYSEGTNL-------EFNVKGTTKAKGLMALAEYLGISIEETMAIGDNLNDVDILKTAGVSVVMYNARDEIKKLGDFITLSNDENGVAY 265
>gi|15923961|ref|NP_371495.1| alpha/beta hydrolase superfamily protein [Staphylococcus aureus subsp. aureus Mu50] >gi|15926560|ref|NP_374093.1| hypothetical protein SA0832 [Staphylococcus aureus subsp. aureus N315] >gi|21282582|ref|NP_645670.1| hypothetical protein MW0853 [Staphylococcus aureus subsp. aureus MW2] >gi|49485747|ref|YP_042968.1| putative haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651663|ref|YP_185844.1| HAD superfamily hydrolase [Staphylococcus aureus subsp. aureus COL] >gi|82750588|ref|YP_416329.1| hydrolase [Staphylococcus aureus RF122] >gi|87162380|ref|YP_493574.1| hypothetical protein SAUSA300_0874 [Staphylococcus aureus subsp. aureus USA300] >gi|88194666|ref|YP_499462.1| hypothetical protein SAOUHSC_00909 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267405|ref|YP_001246348.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH9] >gi|150393458|ref|YP_001316133.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH1] >gi|151221054|ref|YP_001331876.1| hypothetical protein NWMN_0842 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979297|ref|YP_001441556.1| hypothetical protein SAHV_0966 [Staphylococcus aureus subsp. aureus Mu3] >gi|161509171|ref|YP_001574830.1| HAD family phosphatase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728314|ref|ZP_02760591.1| possible HAD superfamily hydrolase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13700775|dbj|BAB42071.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14246740|dbj|BAB57133.1| similar to hydrolase, haloacid dehalogenase-like family [Staphylococcus aureus subsp. aureus Mu50] >gi|21204020|dbj|BAB94718.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49244190|emb|CAG42616.1| putative haloacid dehalogenase-like hydrolase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285849|gb|AAW37943.1| hydrolase, haloacid dehalogenase-like family [Staphylococcus aureus subsp. aureus COL] >gi|82656119|emb|CAI80528.1| probable hydrolase [Staphylococcus aureus RF122] >gi|87128354|gb|ABD22868.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202224|gb|ABD30034.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740474|gb|ABQ48772.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH9] >gi|149945910|gb|ABR51846.1| Cof-like hydrolase [Staphylococcus aureus subsp. aureus JH1] >gi|150373854|dbj|BAF67114.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721432|dbj|BAF77849.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160367980|gb|ABX28951.1| possible HAD superfamily hydrolase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (274 aa)
Score = 168, Expect = 2.7e-10, Identities = 73/268 (27%), Positives = 132/268 (49%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRD--ANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKT-SFLSGDAIKDIINHYQDLDLNFGIPD-NGYLYFPKENRHSIRLSEYDHM---TAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKY----EVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           Q  ++  D+DGTLL+D+K +   +   + +++++G    + TGR   A+ M       +        I+   GA  ++ K    K     L     ++II   Q   ++  I +   Y++    N H  RL E   M     +  ++ V+L E  + ++I  ++  +P + N    F + +      G P    P++ E +   ++K  G++   +  N+  +N++AFGD DND +MI  ++ GVAM NG  + K VA  IT  +NN DGI  ++  +F
  S:     2 QPHLICLDLDGTLLNDNKEISSYTKQVLNELQQRGHQIMIATGRPYRASQMY------YHELNLTTPIVNFNGAYVHHPKDKNFKTCHEILDLGIAQNIIQGLQQYQVSNIIAEVKDYVFI---NNHDPRLFEGFSMGNPRIQTGNLLVHLKESPTSILIEAEESKIPEIKNMLTHFYADHIEHRRWGAPF---PVI-EIVKLGINKARGIEQVRQFLNIDRNNIIAFGDEDNDIEMIEYARHGVAMENGLQELKDVANNIT-FNNNEDGIGRYLNDFF 266
>gi|167750497|ref|ZP_02422624.1| hypothetical protein EUBSIR_01473 [Eubacterium siraeum DSM 15702] >gi|167656423|gb|EDS00553.1| hypothetical protein EUBSIR_01473 [Eubacterium siraeum DSM 15702] (267 aa)
Score = 168, Expect = 2.8e-10, Identities = 69/261 (26%), Positives = 125/261 (47%)
  Q:     1 MDISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNEC---KKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           MD   + +++SD+DGTLLDD K + +  + +I +  +KG +F + TGR   +MA  +  K K++  +  +I  G A  Y+   +E     + +  +GD IK +++ + D+ +   +     +Y P  N         +++      +D    E   KV+    ++ MP +   ++        GT  V + P  +E +   VSK  G K  L+         +A GD  ND +M+ ++ +GVA+ N  D+ KS A  I   +N +
  S:     1 MDFKNV-IIMSDLDGTLLDDKKEISQRDMESINEFCDKGGMFTIATGR-GYSMARPVAQKLKLR--IPAVIFNGSA-VYDFDKDEFLWQSEVTQKAGDYIKLVMDRFPDVGIE--VLHKHTVYVPALNDVERAHMALENVHGDVCRLDDIPHEGWLKVLFAYPEDKMPEL---ARFIDEHCAEGTNRVLSAPFFYELLPEGVSKAYGYKQLLRVTGSEDRFTVAAGDYPNDAEMVRSADLGVAVSNAHDEVKSSADVIIGSNNED 255
>gi|167766406|ref|ZP_02438459.1| hypothetical protein CLOSS21_00911 [Clostridium sp. SS2/1] >gi|167711815|gb|EDS22394.1| hypothetical protein CLOSS21_00911 [Clostridium sp. SS2/1] (275 aa)
Score = 168, Expect = 2.9e-10, Identities = 69/266 (25%), Positives = 124/266 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGI----------PDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVC--DKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++VV+D+DGTLL++ K V E+++ AI+ +K++ + F + TGR ++ M      + K    VD +IGC GA   N++T E    + L  +         +   L + +          P N      ++   ++   E   M     D++ Y+ +     ++V   D  Y+  V    K    K      + +G  +       VSK   +K   +   + + +++AFGD  ND +M+    +G+AM N  D  K  A  I  + N+ DG+   + K F
  S:     3 RMVVTDLDGTLLNNKKQVSEANVKAIQNLKDQNITFVMATGR-SDVMTRAYTKQLK---NVDIVIGCDGAVIRNIRTGEILCENHLRSETCHTTFEICKKYGLQYYVFAKDELVSDDPQNERFLVHQKFNQTVEEDEEIPMQIAD-DLNEYVNDHIIYKIVVSHNDTSYLDKVAEVIK----KETDADAIRSGKKVLAVKARGVSKAEAIKKLAQKLGILIKDIIAFGDEVNDIEMLTLVGLGIAMENADDVVKEAADQIAGR-NDQDGVGKELEKIF 270
>gi|50914788|ref|YP_060760.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS10394] >gi|71904098|ref|YP_280901.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS6180] >gi|94989024|ref|YP_597125.1| HAD superfamily hydrolase [Streptococcus pyogenes MGAS9429] >gi|94991023|ref|YP_599123.1| hydrolase [Streptococcus pyogenes MGAS10270] >gi|94994902|ref|YP_603000.1| Hydrolase [Streptococcus pyogenes MGAS10750] >gi|50903862|gb|AAT87577.1| Hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS10394] >gi|71803193|gb|AAX72546.1| hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS6180] >gi|94542532|gb|ABF32581.1| hydrolase (HAD superfamily) [Streptococcus pyogenes MGAS9429] >gi|94544531|gb|ABF34579.1| Hydrolase [Streptococcus pyogenes MGAS10270] >gi|94548410|gb|ABF38456.1| Hydrolase [Streptococcus pyogenes MGAS10750] (293 aa)
Score = 168, Expect = 2.9e-10, Identities = 68/250 (27%), Positives = 124/250 (49%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS------------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           I+++  D+DGTLL+  K + + +I AI++  + GL   LCTGR  +       D+  + +  +F+I   G   Y+    + + +  L    + D I   ++L  +F  PD  YL   +EN + +   E   +  +  D+   + +P S            + M + +K  +       ++ +++      +V +   + E +   VSK + LK  ++D  LT D V+A GDA ND +M+  + +GVAM N S   K +A  +T
  S:    21 IQLIAIDLDGTLLNQDKQIPKENITAIQEAAQSGLKIVLCTGRPQSG-TRPYFDQLGLTQE-EFLIINNGCSTYSSPDWQLRHSKMLK---VSD-IELLEELSQSF--PDI-YLTLTEENDYLVLEEEVPDLVQEDGDLVFTIVKPVSLAELSDTPRLIFQAMYLGEKAALDAF---ERAVRNQLSQSFHVVRSQDNILEILPQGVSKASALKELVEDLGLTADQVMAIGDAPNDIEMLTYAGLGVAMENASAAIKPLADKVT 271
>gi|19703733|ref|NP_603295.1| HAD superfamily hydrolase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713863|gb|AAL94594.1| Hydrolase (HAD superfamily) [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (267 aa)
Score = 168, Expect = 3.0e-10, Identities = 75/266 (28%), Positives = 132/266 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDII--NHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD---VYLTEPKSKVMIVCDKEYMPTV-INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQ---DNNNDGIYNFIVKYF 272
           K+VV DMDGTLL  +  + + +   IKKI++ G+ F + TGR   + A    D  K+K    F+I   GA+ ++   N     + +  + +K ++  N  +D+  N  + D+  + +  E      L E+   +   F++D    Y  E  +KV  +   E +  +  N  K F++   +    ++ P   E+M   V+K   LK  LK  N+  + V+AFGD+ NDY+M+  S +G   I G+   + +      +   +NN DGI   +++ F
  S:     4 KLVVCDMDGTLLTSNHKISDHTADVIKKIEDNGVKFMIATGRPYLD-ARYYRDSLKLKS---FLITSNGARAHDEDNNPIVIEN-IPKEFVKRLLAYNVGKDIHRNIYLNDDWIIEYEIEG-----LVEFHKESGYRFNIDNLNKYENEEAAKVFFLGKDEDIENLEKNMEKEFQNDLSI---TISSPFCLEFMKKGVNKAETLKKVLKLLNIEPEEVIAFGDSMNDYEML--SLVGKPFIMGNANQRLIDALPNVEVVGNNNEDGIGKKLIEIF 263
>gi|152977579|ref|YP_001377096.1| Cof-like hydrolase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026331|gb|ABS24101.1| Cof-like hydrolase [Bacillus cereus subsp. cytotoxis NVH 391-98] (273 aa)
Score = 168, Expect = 3.0e-10, Identities = 74/265 (27%), Positives = 132/265 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYL---YFPKENRHSIRLSEYDHMTAKYFDVDVYLT---EPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++V D+D TLL D   + E +  A+   +E+G+   L +GR    M ++   + +++EY  FI+   GA+  N KT+E   +S LS     +I+++  ++    G+  + Y+      +EN     + E          VD ++    EP  KV++  + E +  V  +  K  + K  V   + + P   E+    V+K   L   ++   +  + V+A GD+ ND  MI  + +GVAM N  D  K++A Y+T+  N NDG+   + K+
  S:     4 KMIVLDLDDTLLRDDHTISERTKRALMTAQEQGVKVVLASGRPTFGMRHI-AKELRLEEYGSFILSFNGAKIINCKTDEKIFSSTLS----PEIVHNLYEISKEEGVWIHTYIGDDIITEENNPYTEI-EGQLTGMPIIQVDNFVAAVQEPVVKVLMNKEAERLIEVEKKLQKQLEGKLSV---MRSKPYFLEFTEAGVTKGTSLNQLIQKLGIKREEVIAIGDSYNDQTMIEFAGLGVAMGNAPDDIKAIANYVTDT-NMNDGVAKVVEKF 265
>gi|51971427|dbj|BAD44378.1| unnamed protein product [Arabidopsis thaliana] (266 aa)
Score = 168, Expect = 3.1e-10, Identities = 68/259 (26%), Positives = 122/259 (47%)
  Q:    13 MDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVL-----------IDKWKIKEYVD--FIIGCGGAQFY--NLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           MDGTLL+    + E++  A+K+   +GL   + TG+       +L           I +     +V    + G  G + Y  NL  + C++T   S +    +I   QD  L  F  P    L+       +  +S  D + A+     V   +    V  V    +     +R+   +++ +          + E + P  SK +G+K+ L    ++ D ++A GD +ND +M+  + +GVA+ NG++KTK+VA  I    N+ DG+ + I +Y
  S:     1 MDGTLLNSKSQISEANAKALKEALLRGLKVVIATGKSRPGAIRILKTADLTGSDGVISESSPGVFVQGLLVYGRQGKEVYRGNLDRDVCRETCLYSLEHRIPLIAFSQDRCLTLFDHPLVDSLHTIYNEPKAEIISSVDQLIAEADIQKVIFMDTTEGVSSVIRPYWSEATGDRANVVQAQSD----------MLEIVPPGTSKGDGVKMLLNHLGVSPDEIMAIGDGENDIEMLQLASLGVALSNGAEKTKAVADVIG-VSNDQDGVADAIYRY 264
>gi|157160301|ref|YP_001457619.1| sugar phosphatase SupH [Escherichia coli HS] >gi|157065981|gb|ABV05236.1| sugar phosphatase SupH [Escherichia coli HS] (271 aa)
Score = 167, Expect = 3.3e-10, Identities = 63/263 (23%), Positives = 136/263 (51%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L++ K   +   +A  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T+ DNN++G  N I
  S:     3 VKVIVTDMDGTFLNNVKTYNQPRFMAQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHV-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATD-DNNHEGALNVI 259
>gi|86609548|ref|YP_478310.1| HAD family hydrolase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558090|gb|ABD03047.1| HAD hydrolase, IIB family [Synechococcus sp. JA-2-3B'a(2-13)] (286 aa)
Score = 167, Expect = 3.4e-10, Identities = 71/266 (26%), Positives = 118/266 (44%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG-------GAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVT--GPILFEYMHPNVSKTNGLK-IALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYI---TEQDNNNDGIYNFIV 269
           +QI+++V D+DGT+   S  V E    AI+K K  G+   + TGR             +  E   + IG         GA   +  + +  K   L     ++++   QD  +   +  +  LY  + +  S   +E   +  + F    Y   P   + +  D E++  +     S + +Y      +T   PI  E  HP V+K N ++ +A +   L+ + V+A GD DND +MI  + IGVAM N S      A +I     +D     I  FI+
  S:    21 AQIRLLVVDIDGTIAGPSNQVSEPVREAIQKAKAAGVRVAIATGR-----------MHRSAERFHYAIGADMPLCSYQGALIRDPDSQKTLKHWSLDWPLAEELLQALQDQPVGVHLYIDDQLYLRELSPLSQAYAERSQVPFQMFSSAQYGRSPTKILAVSEDTEFLQEL---QGSLRRRYSPEQLYLTRSEPIFLEATHPAVNKGNAVRFLAEEMLGLSAEQVMAIGDGDNDIEMIQYAGIGVAMGNASPALLPHADWIAPPVAEDGVAAAIETFIL 285
>gi|47570126|ref|ZP_00240783.1| hydrolase, haloacid dehalogenase-like family, putative [Bacillus cereus G9241] >gi|47553190|gb|EAL11584.1| hydrolase, haloacid dehalogenase-like family, putative [Bacillus cereus G9241] (257 aa)
Score = 167, Expect = 3.4e-10, Identities = 76/262 (29%), Positives = 116/262 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEY---MPTVINRSKSFKSKYEVGTP------LVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K+++SD+DGTLL   K + E SI  +++ K  G      T R              IK+Y+  ++       YN    LK N+      +S + I +II                     K N H I L   D + +  FDV  Y      ++M V D  +      +I    S   ++    P      +     L + MH  VSK N ++  L+  N  +  V+AFGD  ND +MI    IGVAM N  ++ K+VA+ I  + N+ DG+  F+
  S:     3 KIIISDLDGTLLRSDKTISEKSINILRECKNNGDELIFATARPPR----------AIKQYIPNVLKSEIIICYNGALVLKGNDILYEMKISKNDILEIIE-----------------IATKYNLHQICLEIGDKLYSN-FDVTDYFGNVPCEIMDVRDLNFEKASKAIICTKGSINKEFIKELPDECRGVITDDGTLCQIMHAEVSKWNSIQYVLQHLNRDVSEVIAFGDDYNDMEMIEKCGIGVAMSNAVEELKAVAKVIA-KSNDEDGVATFL 248
>gi|28379848|ref|NP_786740.1| HAD superfamily hydrolase [Lactobacillus plantarum WCFS1] >gi|28272689|emb|CAD65618.1| hydrolase, HAD superfamily, Cof family [Lactobacillus plantarum WCFS1] (271 aa)
Score = 167, Expect = 3.5e-10, Identities = 75/262 (28%), Positives = 118/262 (45%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS-------KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           +  IK++  D+DGTL++  K V      AIK  K+K +   +CTGR    +  +L +     +   +++  GGA  Y   + E      +S +   D+    + L L+F       LY    N     + +Y    A    + +    P+        K M V + E +   I + K F+   +  T   + P  +E     VSK N L++  +  +LT  NV+A GD  ND  MI  +  GVAM N   + K VA  IT  DN +DG+
  S:     1 MENIKMIAIDIDGTLVNSKKQVTLRVKQAIKMAKKKKIKVVICTGRPLTGVKALLQELELDAQDDQYVVCFGGAATYT-TSGELIDERPISYEDYIDLEALARKLRLHFHTVSEDRLYTADRN-----IGDYTLYEANLVSMGISYRTPEEMRNIKLIKSMYVDEPEVLDAAIKQQKLFEPLKKQVTFTKSAPFYYEANANGVSKGNALQVLCEKLSLTAANVMAIGDEANDLSMIKFAGHGVAMGNAIPEVKQVADEIT-VDNEHDGV 262
>gi|28210544|ref|NP_781488.1| putative haloacid dehalogenase-like hydrolase [Clostridium tetani E88] >gi|28202981|gb|AAO35425.1| putative haloacid dehalogenase-like hydrolase [Clostridium tetani E88] (263 aa)
Score = 167, Expect = 3.6e-10, Identities = 69/259 (26%), Positives = 121/259 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECK--KTSFLSGDAIKDIIN--HYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIY 265
           K++  D+DGTLL+    + + +I  IK+  +KG+   L +GRD +  A   I K + K   D  +G  GA  Y+   NE K   + +L  + ++ II     +D+ +   I +N Y+    E    + +  Y   + +   +  +  E     +++  KE     I      K   ++ +   + P   E  +  ++K   LK   + + +  +NV+A GD DND  MI  + +G+AM NGS+  K  A +IT  +  N   Y
  S:     3 KLIALDIDGTLLNREHEISDETIDTIKESMDKGIKIILVSGRDYS-AAEPYIKKLETK---DLFLGLNGANIYD---NEGKIIHSEYLDKEIVEYIIELCEKEDIYIVLFIENNTYV---NEISDFMGIDNYVFNSIEVGQISKFYKEQNVTKILLTHKEEKLIPIKEKLDSKYGSKINSQF-SLPQFLEIFNGKINKGVALKRICEKYKIPKENVMAIGDWDNDITMIKYAGLGIAMGNGSENIKEAADFITNSNEENGAAY 254
>gi|54020380|ref|YP_115686.1| hypothetical protein mhp173 [Mycoplasma hyopneumoniae 232] >gi|53987553|gb|AAV27754.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (276 aa)
Score = 167, Expect = 3.7e-10, Identities = 71/240 (29%), Positives = 109/240 (45%)
  Q:    12 DMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPD-NGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-------------SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVA 251
           D+DGTLL     +   ++  +KK+ E G    L TGR    +A  L D  K   Y  +++   G   ++ KT +      LS + I D+I   +  D        N    F   N H     +      K  D+  Y    + K+  + +KE +  V  R             SK  K+ Y+V    +T  I  +    NV K NG+K+ L+  NL  D ++AFGD+ NDY M+  ++ G AM + +    SVA
  S:     8 DLDGTLLRYDNTIHPENVEILKKLYELGHFLALATGR---GLAGCL-DLAKKYPYFHYLVSNNGTLVHDTKTQKTINNGSLSKEIILDLIKDCKATDSICAFSSLNNLFEFSSTNNHPWLKKQ------KIMDLHFYEKVDQDKLYEIIEKEEITQVAFRNDIPVIAELYKKWSKKLKNIYKV---TITNRIFLDINPLNVDKANGIKMLLEKNNLKPDQLIAFGDSSNDYFMVKLARFGYAMEDSTPDLLSVA 248
>gi|153807845|ref|ZP_01960513.1| hypothetical protein BACCAC_02129 [Bacteroides caccae ATCC 43185] >gi|149129454|gb|EDM20668.1| hypothetical protein BACCAC_02129 [Bacteroides caccae ATCC 43185] (410 aa)
Score = 167, Expect = 3.7e-10, Identities = 70/258 (27%), Positives = 122/258 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNEC--------KKTSFLSGDAIKD--IINHYQDLDLNFGIPDNGYLYFPKENR-HSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++V D+DGTLL+D+K + + ++ A+ K+++ G+   L +GR    +   L    ++  Y  FI+   G Q  N +  E         +   +L   A K+   +  Y D  +    P+N ++    E R +++R+ E    +A    VD        K M+V D E    +I     +K +      +  + P   E +   + K N L   L++ ++  + V+A GD   D  MI  + +GVAM +  D  K  A Y+T   N  DG+
  S:     4 KLLVLDVDGTLLNDAKEISKRTLAALLKVQQMGVRIVLASGRPTYGLMP-LAKSLELGNYGGFILSYNGCQIINAQNGEILFERRINPEMLPYLEKKARKNGFALFTYHDDTIITDSPENEHI--QNEARLNNLRIIEETEFSAA---VDF----APCKCMLVSDNE--EALIGLEDHWKRRLNGALDVFRSEPYFLEVVPCAIDKANSLGALLEELDVKREEVIAIGDGVCDVTMIQLAGLGVAMGHSQDSVKICADYVTAS-NEEDGV 260
>gi|52079612|ref|YP_078403.1| putative hydrolase YitU [Bacillus licheniformis ATCC 14580] >gi|52784975|ref|YP_090804.1| YitU [Bacillus licheniformis ATCC 14580] >gi|52002823|gb|AAU22765.1| putative hydrolase YitU [Bacillus licheniformis ATCC 14580] >gi|52347477|gb|AAU40111.1| YitU [Bacillus licheniformis DSM 13] (270 aa)
Score = 167, Expect = 3.8e-10, Identities = 70/265 (26%), Positives = 125/265 (47%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKK-TSFLSGDAIKDIIN---HYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++  D+DGTLL D K + ESS   I+K++E G    + TGR     +++  D+ ++      I+   GA  ++ K     +  + L  + +K II     Y   ++   I D+ Y ++  E    +      ++T    D+   L +  + V+I   +E +P + +      ++            + E +   ++K  GL+     + +  + V+AFGD DND +M+  +  GVAM NG +  KSVA  +T + N  DGI  F+  YF
  S:     7 LIALDLDGTLLKDDKTISESSSEVIRKLREDGHYVCISTGRPFR-ASSMYYDQLQLDTP---IVNFNGAFVHHPKDESWGRFHTSLDLEVVKQIIEVSETYNVHNILAEIVDDVYFHYHDEKLIDVFTMGSPNITVG--DLRTNLGQDVTSVLIHAKEEDVPAIRSYLSDVHAEMVDHRRWAAPWHVIELIKSGINKAVGLEKITDYYGIPPERVIAFGDEDNDLEMLEFAGCGVAMGNGIEGVKSVANKVT-KSNEEDGIAVFLKDYF 268
>gi|20808185|ref|NP_623356.1| HAD superfamily hydrolase [Thermoanaerobacter tengcongensis MB4] >gi|20516778|gb|AAM24960.1| predicted hydrolases of the HAD superfamily [Thermoanaerobacter tengcongensis MB4] (273 aa)
Score = 167, Expect = 3.8e-10, Identities = 74/267 (27%), Positives = 130/267 (48%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLT--------EPKSKVMIVCDKEYMPTVINRSKSFKSK---YEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           Q K++  DMD TLL   K + E +I A+ + +EKG+   + TGR       V    +   + + F   II   GA   +   N   + S L  + + ++I   Q     F +  +  +Y P+      R +E++ +      V+V           + K +V+ V      P ++ R +S  S+    ++ +  V      E M+  VSK   L+I  +   ++ + ++A GD++ND +MI  + +GVAM N  D+ K VA +IT + N  DG+ + I K+
  S:     2 QYKLIAIDMDDTLLRHDKTISEENIKALHRAREKGVYVVIATGR-------VFASAYAYADMIGFRTYIIASNGALIRDPDNNTIYE-SILDYNNMIEVIRTCQKYGTYFQLISDTTVYTPEITNKFQRYAEWNALLKTEIKVEVEEIENPLEEAEKLKDRVLKVIVFNEDPDLLKRIRSELSERLDVQITSSYVDN---IEIMNKGVSKGRALEILGRYLGVSREEMIAIGDSENDIEMIKFAGLGVAMENAIDEVKKVADFIT-KSNMEDGVKHVIEKF 270
>gi|125718365|ref|YP_001035498.1| HAD superfamily hydrolase [Streptococcus sanguinis SK36] >gi|125498282|gb|ABN44948.1| Hydrolase, HAD superfamily [Streptococcus sanguinis SK36] (272 aa)
Score = 166, Expect = 4.4e-10, Identities = 67/269 (24%), Positives = 115/269 (42%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV-DVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           ++ IK++  D+DGTLL   K + + ++ A+K  ++KG+   L TGR    M   L +        ++ I   G       T E    +  S D +  I      L +       G +Y  + ++ S+       +T +  D  D+   +  +K +    +E +   I + S     +YE+     +  +L E+   NV K NGL+  +    +    V+A GD  ND  MI  + +GVAM N     K  A  +T   N+ D +   I +Y
  S:     1 MADIKLIALDLDGTLLTSDKKISDRNLAALKAAQDKGVKVVLTTGRPLKAMDFFLHELGTDGREDEYTITFNGG-LVQRNTGEILDKTVFSYDDVARIYEETDKLHIPLDAICEGLVYQIQSDQDSLYAQFNPALTFEPVDFSDLSSQQTYNKCVTAYAQEPLDAAIEQISPELFERYEI---FKSREMLLEWSPKNVHKANGLEKLIAHLGIERSQVMACGDEANDLSMIEWAGLGVAMQNAVTIVKEAANVVTPMTNDEDAVAWAIEEY 267
>gi|187917947|ref|YP_001883510.1| hydrolase (HAD superfamily) [Borrelia hermsii DAH] >gi|119860795|gb|AAX16590.1| hydrolase (HAD superfamily) [Borrelia hermsii DAH] (296 aa)
Score = 166, Expect = 4.4e-10, Identities = 75/266 (28%), Positives = 134/266 (50%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIIN----HYQDL-----------------DLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQD-NNNDGIYNFI 268
           +  IK VVSD+DGTLL  +  +   S L I K+ ++   F + TGR  N +  ++ +   +  +V F I   GA+ YN +     +   LS + + +I+N     Y+D+                 ++     +N +       +H     E   ++ KY +++ +         +K++++  +E            K + E+   L T P   E ++  VSK N LK  L+  N+ L+ V+AFGD  ND DM+ N K G+ M N + + K +  Y+   D N+N+ + ++I
  S:     1 MKNIKAVVSDLDGTLLLSNIQIGAFSELVITKLIKENKKFIIATGRSKNEIIPLIEN---LSSHVSFFITLNGARVYNNQWQLISRYD-LSSEIVNEILNLRESKYKDIPHFLQKSEDIDEKLYADNITKNAINNMFEKHELLRKHKYIEHELKDISIKYHEINNFREFKNFNNIAKILLLHHEEAQLIKYEAIILEKYRKEINAYLST-PHSLEIVNSRVSKGNALKDVLQSININLNEVIAFGDGFNDVDMLENVKKGLLMGNANYRLKKMLSYLEIIDTNDNEAVAHYI 287
>gi|170020823|ref|YP_001725777.1| Cof-like hydrolase [Escherichia coli ATCC 8739] >gi|169755751|gb|ACA78450.1| Cof-like hydrolase [Escherichia coli ATCC 8739] (271 aa)
Score = 166, Expect = 4.5e-10, Identities = 64/263 (24%), Positives = 135/263 (51%)
  Q:     6 IKVVVSDMDGTLLDDSKNVL-ESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+DMDGT L D+K    E  ++  +++K++G+ F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND +M+  ++   AM N ++  K +A+Y T  DNN++G  N I
  S:     3 VKVIVTDMDGTFLSDAKTYNNERFMVQYQELKKRGIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHV-----------ALDGIMKPVTSGFGFIDLIIPGLHKANGITRLLKRWDLSPQNVVAIGDSGNDAEMLKIARYSFAMGNAAENIKQIARYAT-GDNNHEGALNVI 259
>gi|194397310|ref|YP_002037894.1| Cof family protein [Streptococcus pneumoniae G54] >gi|194356977|gb|ACF55425.1| Cof family protein [Streptococcus pneumoniae G54] (268 aa)
Score = 166, Expect = 4.5e-10, Identities = 66/263 (25%), Positives = 119/263 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N  ++++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDEGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGKYTVHESTLVSMPIXYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYERYSINK---SAPFYLELLKKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|58336930|ref|YP_193515.1| putative hydrolase [Lactobacillus acidophilus NCFM] >gi|58254247|gb|AAV42484.1| putative hydrolase [Lactobacillus acidophilus NCFM] (269 aa)
Score = 166, Expect = 4.8e-10, Identities = 73/261 (27%), Positives = 117/261 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDII-NHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYD-----HMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILF---------EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYN 266
           IK +  D DGTLL+ +  +L S+ +AIK   +KG+   LC+GR    + + + +           +G  G + Y +  N     +       +D++ N +     +FG  ++        N   I  S++D     ++ A      +Y+ EP        D E              ++E       G  L+         E ++P V+K NGLK   +   +  D V+A GDA ND  M   + I V M NGS++ K  A Y+T   N+NDGI N
  S:     3 IKFIAIDTDGTLLNSNGEILPSTRIAIKHALDKGIKVALCSGRPIAGLQHFMKE-----------LGIEGPEQYAITLNGAITRTADGKIMTEDLVSNEFYRKMTDFGKQNHIPFNVVSPNSEIIT-SDHDVDFMVYLQAYENTATLYIREPDD---FASDFEVAKGCFVGKSELLDQWEEKIHQEFGNDLYIVRADDHFLELLNPKVNKGNGLKELTEKLGINRDEVMAIGDAGNDISMFDFAGIAVCMGNGSEEAKKHADYVT-TSNDNDGINN 262
>gi|196033818|ref|ZP_03101229.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus W] >gi|195993498|gb|EDX57455.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus W] (257 aa)
Score = 166, Expect = 4.8e-10, Identities = 75/262 (28%), Positives = 117/262 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEY---MPTVINRSKSFKSKYEVGTP------LVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K+++SD+DG LL   K + E SI  +++ K  G      T R              IK+Y+  ++       YN    LK N       +S + I +II                     K N H I L   D + +  FDV  Y      +++ V D ++      +I  +   K K+    P      +     L + MH  VSK N ++  L+  N  +  V+AFGD  ND +MI    IGVAM N  ++ K+VA++I  + N+ DG+  F+
  S:     3 KIIISDLDGNLLRSDKTISEKSINILRECKNNGDELIFATARPPR----------AIKQYIPNVLKSEIIICYNGALVLKGNNILYEMKISKNDILEIIEIAN-----------------KYNLHEICLEIGDKLYSN-FDVTDYFGNIPCEIIDVRDLDFEKASKAIICTNGPIKQKFIKELPDECRGVITDDGTLCQIMHAEVSKWNSIQYVLQHLNRDVSEVIAFGDDYNDMEMIEKCGIGVAMSNAVEELKAVAKFIA-KSNDEDGVATFL 248
>gi|125571963|gb|EAZ13478.1| hypothetical protein OsJ_003303 [Oryza sativa (japonica cultivar-group)] (425 aa)
Score = 166, Expect = 4.9e-10, Identities = 66/258 (25%), Positives = 117/258 (45%)
  Q:    14 DGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR------DANNMANVLIDKWKIKEYVD-------FIIGCGGAQFY--NLKTNECKKTSFLSGDAIKDIINHYQDLDLN-FGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           DGTLL+    V   +  A+++ + +G+   + TG+      DA NM ++      + E           + G  G + Y  NL    C++    S +    ++   QD   + +  P    L++      +  +S  D +        V   E    +       +   +  R++  +++          P + E + P  SK NG+KI L    ++ D V+A GD +ND +M+  + +GVA+ NGS+KTK+VA  I    N+ DG+   I  Y
  S:   161 DGTLLNSKSQVTARNAEALREARSRGVNIVIATGKARPAVIDALNMVDLSGRTGIVSESSPGIFLQGLLVYGLQGREIYKRNLDQEVCREALLYSLEQKVPLVAFSQDRCFSMYDDPLVDSLHYVYHEPKAEIVSSIDQLLGTAEIQKVLFLETPEGISSALRPFWEKAIEGRARVVQAQ----------PDMLELVPPATSKGNGVKILLDHLCISPDEVMAIGDGENDIEMLQLASLGVALANGSEKTKAVANIIGAT-NDEDGVAQAIYDY 423
>gi|42781522|ref|NP_978769.1| HAD superfamily hydrolase [Bacillus cereus ATCC 10987] >gi|42737445|gb|AAS41377.1| hydrolase, haloacid dehalogenase-like family [Bacillus cereus ATCC 10987] (257 aa)
Score = 166, Expect = 4.9e-10, Identities = 76/262 (29%), Positives = 116/262 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEY---MPTVINRSKSFKSKYEVGTP------LVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           K+++SD+DGTLL   K + E SI  +++ K  G      T R              IK+Y+  ++       YN    LK N+      +S + I +II                     K N H I L E D      FDV  Y      +++ V D  +      +I    S   ++    P      +     L + MH  VSK N ++  L+  N  +  V+AFGD  ND +MI    IGVAM N  ++ ++VA+YI  + N+ DG+  F+
  S:     3 KIIISDLDGTLLRSDKTISEKSINILRECKNNGDELIFATARPPR----------AIKQYIPNVLKSEIIICYNGALVLKGNDILYEMKISKNDILEIIE-----------------IAIKYNLHQICL-EIDDKLYSNFDVTDYFGNVPFEIIDVRDLNFEKASKAIICTKGSINKEFIKELPDECRGVITDDGTLCQIMHAEVSKWNSIQYVLQHLNRDVSEVIAFGDDYNDMEMIEKCGIGVAMSNAVEELRAVAKYIA-KSNDEDGVATFL 248
>gi|123442743|ref|YP_001006720.1| putative hydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122089704|emb|CAL12556.1| putative hydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] (270 aa)
Score = 166, Expect = 4.9e-10, Identities = 73/268 (27%), Positives = 119/268 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNE-CKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVG---TPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           IK+V  DMDGT L+D  N       A   ++K+ G+ F + +G     + +   D   I + + F+    GA   N  T   C   S  + D +   I     LD+     +   +    +N     +S+Y H   K  D    + EP  K  I    E +   +   ++     E+G   TP+ +G    + + P V K NG+K+    + +  + V+ FGD  ND +M+  +  G AM N  D+ K +A+Y T   NN+ G+ N I K  +
  S:     3 IKIVAVDMDGTFLNDQMNFDRKRFSAQYAQLKDNGIKFVVASGNQYYQLISFFPD---IADEIAFVAE-NGAYVSNENTEIFCGVLSDENCDKVLKTILPLPHLDIIVCGKNGACMLSSSDNTFYTTMSKYYHRL-KIIDNFSQIEEPAFKFAISLPDEKLADFMTFIEA-----ELGGIVTPVSSGHGSVDLIIPGVHKANGIKLLQNIWGVKDEEVVTFGDGGNDVEMLQYAGFGFAMANAPDRIKKIAKYQT-NSNNDSGVLNVIDKILR 264
>gi|42560632|ref|NP_975083.1| HAD family hydrolase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492128|emb|CAE76725.1| Putative hydrolase of the HAD family [Mycoplasma mycoides subsp. mycoides SC str. PG1] (280 aa)
Score = 166, Expect = 4.9e-10, Identities = 75/261 (28%), Positives = 126/261 (48%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVL-IDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQD---LDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDV--YLTEPKSKVMIVCDKEYMPTV-INRSKSFKSKYEVGTPLVT-GPILFEYMHPNVSKTNGLKIALKDFNL--TLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           ++ SD+DGTLL D       +I  ++K+ +KG+     T R   D    A++L IDK+K     + I+   GAQ Y+ KT++      L  + IK++ N Y +     + F  P+  Y++   +N    +   +  M  KY  VD    + EP +   IV + +  P   +N  K   + Y     + +    +F+     V K  G+   +K  NL     +   FGD  ND+ ++     G+AM NG  + K +A  IT+  N+ DG+  +I
  S:     7 IIFSDLDGTLLYDDYIFSPKTIEVVEKLYKKGIYLVPITARTIKDLKQKASLLQIDKFK-----EIIVASNGAQIYDYKTDKIIFDKTLPKEFIKEMFNRYHNKFFAKMIFYSPNCCYVFAEGKNS---KYWAHQVMGLKYISVDSPDQIDEPITHFYIVTNSKATPEENLNEYKYLMNNYADSYKVDSYNNRVFDISVKGVDKGCGVAEVMKYLNLDEKTTHSYGFGDGPNDFSLLKACTTGIAMKNGIIELKEIADDITDYSNDKDGVARYI 272
>gi|119952871|ref|YP_945080.1| hydrolase (HAD superfamily) [Borrelia turicatae 91E135] >gi|119861642|gb|AAX17410.1| hydrolase (HAD superfamily) [Borrelia turicatae 91E135] (296 aa)
Score = 166, Expect = 5.2e-10, Identities = 79/266 (29%), Positives = 140/266 (52%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSF--LSGDAIKDIIN----HYQDLD--LNFGIPDNGYLYFPKENRHSIR--------LSEYDHMTAKYFDVDVYLTEPKS-----------KVMIVCDKEYMPTVINRSKSFKSKY--EVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYI-TEQDNNNDGIYNFI 268
           +  IK V+SD+DGTLL  +  +   S + IKK+ ++   F + TGR  N + ++      +  +V F I   GA+ YN   N+ +  S   LS + + +I+N     Y+D+   L      +  LY     +++I         L ++ ++  +  D+ +   E  S           K++++ D+E  P +I    +   KY  E+   L T P   E ++  VSK + LK  LK  ++ L+  +AFGD  ND DM+ N   G+ M N + + K +  Y+     N+N+ + ++I
  S:     1 MKDIKAVISDLDGTLLLSNSQIGAFSEIVIKKLTKENKKFIIATGRSKNEIISL---TEHLNSHVSFFITLNGARVYN---NQWQLISSYDLSSEIVNEILNLRENKYKDIPHFLQKSEDIDEKLYADNTTKNAINNIFEKHELLRKHKYIEHELKDISIKYHEVNSFREIKNFNNIAKILLLHDEE--PQLIKYEATILEKYRKEINAYLST-PHSLEIVNNRVSKGSALKDVLKSIHINLNEAIAFGDGFNDVDMLENVNKGLLMGNANYRLKKMLSYLEIIGTNDNEAVAHYI 287
>gi|47458882|ref|YP_015744.1| COF family HAD hydrolase protein [Mycoplasma mobile 163K] >gi|47458210|gb|AAT27533.1| COF family HAD hydrolase protein [Mycoplasma mobile 163K] (281 aa)
Score = 166, Expect = 5.3e-10, Identities = 77/270 (28%), Positives = 126/270 (46%)
  Q:     3 ISQIKVVVSDMDGTLLDDSK--NVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFI---IGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAK-----------YFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTG-PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +  IK    D+DGTL  DSK   +  SSI AI  +K+KG   G+ TGR         I+  K+ E ++     I   G    +   NE +  S+ S      II+     +LNF +    ++Y+   +  + ++  Y  M  K           +FD ++  T   +K +I   KE   + +     +  K EV   ++ G   + E      SK   LK  ++D NL  +N++ FGD  ND ++   + + V M N  +  K  A +IT + N  +G+ +FI   F
  S:     4 LKNIKAFYFDLDGTLFIDSKLKKIDISSIEAINYLKQKGFKVGIATGRHH-------IEITKVIEQINPTLPTISVNGTIINDSLRNESENISYFSKSETIKIISFLNSQNLNFVLYGFDFMYYKVADISNDKIKSYYEMKQKNAFDEKVKAYFFFDENIEKTSRANKFLIF-SKEVSKSKMQELHKYLIKSEVSASVLQGFSSVIEIFPKQTSKGFTLKKIMQDKNLKKENIIFFGDGLNDIEICKEAGVCVVMNNAENDLKEHATFIT-KSNLENGVSSFIKDNF 281
>gi|19553818|ref|NP_601820.1| HAD superfamily hydrolase [Corynebacterium glutamicum ATCC 13032] >gi|62391458|ref|YP_226860.1| HAD superfamily hydrolase [Corynebacterium glutamicum ATCC 13032] >gi|145296619|ref|YP_001139440.1| hypothetical protein cgR_2527 [Corynebacterium glutamicum R] >gi|21325391|dbj|BAC00013.1| Predicted hydrolases of the HAD superfamily [Corynebacterium glutamicum ATCC 13032] >gi|41326799|emb|CAF21281.1| Predicted hydrolases of the HAD superfamily [Corynebacterium glutamicum ATCC 13032] >gi|140846539|dbj|BAF55538.1| hypothetical protein [Corynebacterium glutamicum R] (271 aa)
Score = 166, Expect = 5.3e-10, Identities = 77/264 (29%), Positives = 118/264 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI-----RLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPL-------VTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           K++  D+ GTLLD S  V  S++ AI+K + KG    L +GR +  + + L   W I   VD +IG  G   Y     E      LSG+  + I+    +  L F +  N  LY  +  R +      RLSE   +T      D++      +     D   +  + N  +   +  E    L        TG  LF  +  +V+K  G+   LK  N    N +AFGD+D D  +   S  GVAM   ++  K+ A  +T+     DG+ N  +K
  S:     3 KLLFVDIGGTLLDYSNEVPRSAVDAIRKARAKGHRVYLSSGRSSAEVTSQL---WDIG--VDGLIGANGG--YVESAQESVFHRRLSGEETRHIVEWLYNRGLEFYLESNNGLYASRGFREASKPVLSRLSEKTDVTVDSMYPDMFWGASLDRD----DVNKISYIFNSQEDLDAAREAFPNLEHTTWGGQTGA-LFGTIGVSVNKKIGVDRLLKYLNADRANTIAFGDSDEDLSLFEASAYGVAMGEATESLKAAADLVTDA-VGQDGLRNAFLK 265
>gi|29350107|ref|NP_813610.1| putative hydrolase, haloacid dehalogenase-like hydrolase [Bacteroides thetaiotaomicron VPI-5482] >gi|29342019|gb|AAO79804.1| putative hydrolase, haloacid dehalogenase-like hydrolase [Bacteroides thetaiotaomicron VPI-5482] (410 aa)
Score = 166, Expect = 5.4e-10, Identities = 65/258 (25%), Positives = 121/258 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNEC--------KKTSFLSGDAIKD--IINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++V D+DGTLL+D+K + + ++ A+ K+++ G+   L +GR    +   L    ++  Y  +I+   G Q  N +  E         +   +L   A K+   +  Y D  +    P+N ++      ++  RL+    +  + F V +       K M+V D E    +++    +K +      +  + P   E +   + K N L   L++ ++  + V+A GD   D  MI  + +GVAM +  D  K  A Y+T   N  DG+
  S:     4 KLLVLDVDGTLLNDAKEISKRTLAALLKVQQMGVRIVLASGRPTYGLMP-LAKSLELGNYGGYILSYNGCQIINAQNGEILFERRINPEMLPYLEKKARKNNFALFTYHDDTIITDTPENEHI------QNEARLNNLKVIKEEEFSVAIDFA--PCKCMLVSDDE--EALVSLEGHWKRRLNGALDVFRSEPYFLEVVPCAIDKANTLGALLEELDVKREEVIAIGDGVCDVTMIQLAGLGVAMGHSQDSVKVCADYVTAS-NEEDGV 260
>gi|116629152|ref|YP_814324.1| HAD superfamily hydrolase [Lactobacillus gasseri ATCC 33323] >gi|116094734|gb|ABJ59886.1| Predicted hydrolase of the HAD superfamily [Lactobacillus gasseri ATCC 33323] (268 aa)
Score = 166, Expect = 5.4e-10, Identities = 74/256 (28%), Positives = 120/256 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSK-------SFKSKYEVGTPLVTGPILF---------EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           IK++  D DGTLL+    +L S+  AIKK  ++G+   LC+GR    +A+  + +  IK    + +   GA   N    +      +S    +++    ++  + F I D      P       R+   DH    YF++ +   E  + + I    E MP     SK       +   ++E    +  G  L+         E +HPNV+K +GLK   K   ++ D ++AFGD  ND  M       VAM NGS + K  A ++T  +N+N
  S:     2 IKLIALDTDGTLLNSENKILPSTKTAIKKALDQGIKVVLCSGRPIAGLAH-FMKELGIKGSNQYAVTLNGAITRN-ADGKIMTQDLVSNKLYRELTKFAKEQKVPFNIVD------PDS-----RIITADH-DVDYFEL-LQAWENTAPLFIRTPDE-MPNDFQISKGCFVGDKALLDQFEPILRVKFGQDLYIVRADDHFLECLHPNVNKGSGLKELGKKIGISTDEMMAFGDERNDISMFDIVGTAVAMGNGSQEAKDHADFVTASNNDN 257
>gi|187603696|ref|ZP_02989908.1| Cof-like hydrolase [Exiguobacterium sp. AT1b] >gi|187484471|gb|EDU22463.1| Cof-like hydrolase [Exiguobacterium sp. AT1b] (286 aa)
Score = 166, Expect = 5.5e-10, Identities = 68/265 (25%), Positives = 111/265 (41%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY----LYFPKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++V DMD TLL     +   +  A+   + +G    L +GR    M +    + ++ +Y  +I+   GA   N  TNE       S     D + H  ++    GI  + Y    +   + N ++    E   M   + D     +T P  K +++ D + + P      +    K  V     + P   E+    V+K   L        +    V+A GD +ND  MI  + +GVAM N +   K  A +IT + NN DGI + I  Y
  S:    17 KMIVLDMDDTLLTSDHTISPKTKEALLDAQARGYKVVLASGRPTFAMWDA-ARELELAKYGSYILSFNGASVINCATNE----EIFSSTLQPDTVAHLHNISEREGIAIHTYVGNEIVTDRPNPYTDIEGELTGMPVIHVDNFKDAVTAPVVKCLMLADGDTLAPIETKLQEELAGKLAVAR---SKPFFLEFTEAGVTKGTSLAFLADQLGIAQKEVIACGDGNNDLTMIEWAGLGVAMGNANTTVKGKADFIT-KSNNEDGIAHVIETY 278
>gi|16767116|ref|NP_462731.1| sugar phosphatase [Salmonella typhimurium LT2] >gi|167992424|ref|ZP_02573522.1| predicted hydrolase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|16422404|gb|AAL22690.1| putative hydrolase of the HAD superfamily [Salmonella typhimurium LT2] (281 aa)
Score = 165, Expect = 6.1e-10, Identities = 71/266 (26%), Positives = 117/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K  ++   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLVEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGVAWAIEKF 267
>gi|154492783|ref|ZP_02032409.1| hypothetical protein PARMER_02422 [Parabacteroides merdae ATCC 43184] >gi|154087088|gb|EDN86133.1| hypothetical protein PARMER_02422 [Parabacteroides merdae ATCC 43184] (410 aa)
Score = 165, Expect = 6.6e-10, Identities = 65/258 (25%), Positives = 124/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNEC--------KKTSFLSGDAIKD---IINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYE-VGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++V D+DGTLL++ K +   ++ A+ K+++ G+   L +GR  N +  +  +K ++  Y  +I+   G Q  N++T E         +   +    A K+   I  +++D  L    PDN Y+   + N + +++   D+  A+  D       P  K M+  D E    +I     +K + + V     + P   E +   + K N L + +   +++ + V+A GD   D  M+  + +G+AM N  D  K+     T   N  +G+
  S:     4 KLLVLDVDGTLLNNQKEISPRTLAALLKVQQMGVHIVLASGRPTNGVMPI-AEKLELNHYGGYILSYNGGQIINVQTGELLFEKRIDPEWIPYFEKKAKKNDFAIFTYHKDFILT-DKPDNKYV-IQEANLNKMQIVGVDNF-AEAVDF------PPCKCMLASDDE--EALIGLENHWKKRLDGVLDAFRSEPYFLEVVPQFIDKGNTLGVLMTKLSVSPEEVIAIGDGVCDVTMLQLAGVGIAMGNAEDSVKACVDKTT-LTNEEEGV 260
>gi|182420182|ref|ZP_02951413.1| putative conserved hypothetical protein [Clostridium butyricum 5521] >gi|182375984|gb|EDT73574.1| putative conserved hypothetical protein [Clostridium butyricum 5521] (280 aa)
Score = 165, Expect = 6.7e-10, Identities = 72/265 (27%), Positives = 125/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLY-----FPKENR-------HSIRLSEYDHMTAKYF------DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVT--GPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           KV+  D+DGTL +D   V ES+  A++  ++ G    LCTGR    + + +++        D +IG GG  +  ++ N       +S   ++ +++ +   ++NF I  NG LY      P+  R       + I   E       +F        D+Y  +      +  D      +    K F++++EV    V   G    E   P V K   + I LK  N  +++ +A GD  ND +M+    +G+AM N  +  K +A  IT+  ++  GIY   +K+
  S:     4 KVIFLDVDGTLCNDEGFVPESAKEAVRSARKNGHKVYLCTGRSKAEIYDFIMEIG-----FDGVIGAGGG-YLQIEDNMVYHKR-VSHSNVRHLVDFFNKHNVNFYIESNGGLYASENLIPQLERCIYGDIDNDIEARERKEKNPHHFIEGLITGEDLYRDDVNKACFLEPDGITFEEI---KKEFENEFEVYRCTVEAFGENSGELGVPGVHKATAIDILLKCINARIEDTIALGDGMNDAEMLKFCNVGIAMGNAKEGLKKIADEITDT-HDEGGIYRSFIKH 277
>gi|110807613|ref|YP_691133.1| sugar phosphatase [Shigella flexneri 5 str. 8401] >gi|110617161|gb|ABF05828.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (270 aa)
Score = 165, Expect = 6.7e-10, Identities = 71/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   + +G+   L TGR    + N L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +V   +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYL-KELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEVEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|193069151|ref|ZP_03050108.1| phosphatase yidA [Escherichia coli E110019] >gi|192957475|gb|EDV87921.1| phosphatase yidA [Escherichia coli E110019] (270 aa)
Score = 165, Expect = 6.8e-10, Identities = 70/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI  ++ +G+   L TGR    + N L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAVRARGVNVVLTTGRPYAGVHNYL-KELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|169342328|ref|ZP_02863398.1| HAD hydrolase, IIB family [Clostridium perfringens C str. JGS1495] >gi|169299553|gb|EDS81616.1| HAD hydrolase, IIB family [Clostridium perfringens C str. JGS1495] (279 aa)
Score = 164, Expect = 7.3e-10, Identities = 76/265 (28%), Positives = 127/265 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN---FGIPDN--GYLYFPKENRHSIR-----LSEYDHMTAKYFDV-DVYLTEPKSKVMIVC---DKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL++   + E +  AI+K  E+G+   + TGR    A   A +L  K  I       I C GA       ++    S L+ D +  I +  +  D+N   F  P+        P+E+ + +       S+   M ++  D  + + T  K  +  +C   D   +  +    +  K KY+    + + P  FE M+   SK   +K+     N+  + ++  GD++ND  MI  + +GVAM N  +  K  A YIT+  N NDG+   I K+
  S:     4 KLICIDMDGTLLNNKHEISERNKEAIRKATERGVKVAVTTGRLFASAKYYAGLLGVKTPI-------ISCNGAFIREKDEDKVIYESVLNEDQLDRIYDVIKKYDINMAYFNTPNTVISEKIVPEEHGYKVMNKMMGKSKEKVMFSEGIDFKEAFKTYGKHILKAICIENDSNKLEDLFKAKEELK-KYDDLEVVSSSPSNFEVMNKGTSKGCAVKVLADILNINKEEIMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDT-NENDGVAKAIEKF 276
>gi|167756037|ref|ZP_02428164.1| hypothetical protein CLORAM_01557 [Clostridium ramosum DSM 1402] >gi|167704029|gb|EDS18608.1| hypothetical protein CLORAM_01557 [Clostridium ramosum DSM 1402] (273 aa)
Score = 164, Expect = 7.3e-10, Identities = 73/258 (28%), Positives = 120/258 (46%)
  Q:     7 KVVVSDMDGTLLD---DSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++  D+DGTL++   D  ++ E++  A+ ++KE G    L TGR         I +  +       + C GA  Y     E    + +  +AIK  +   +  D N+    + Y+Y   +N  RH      +        D  D    E    +++V DK+ +  ++N  SK F  +             F+     VSK  G++  ++  N  +D+ +AFGD  ND +M+   KIGVAM N  D+ K+VA Y T++   NDGI
  S:    13 KLLFFDIDGTLIECNLDIYSITENTRNALDRLKENGHDVFLATGR-----CKCFITEGVMNYPFSGYVTCNGA--YVEYHGEPVYKAIIPSEAIKATMALSEQYDFNYYFESSDYIYVRDQNDERHQWFAKNWGMKPETVIDDFDPETIETYIGMIVVNDKKDISPMVNALSKYFDVQRH------QSDYSFDLTLKGVSKAVGIEKLVERINRNIDDTIAFGDGRNDIEMLETVKIGVAMGNAVDEAKAVANYETDRI-ENDGI 263
>gi|115439833|ref|NP_001044196.1| Os01g0739400 [Oryza sativa (japonica cultivar-group)] >gi|113533727|dbj|BAF06110.1| Os01g0739400 [Oryza sativa (japonica cultivar-group)] (581 aa)
Score = 164, Expect = 7.3e-10, Identities = 35/84 (41%), Positives = 51/84 (60%)
  Q:   188 PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           P + E + P  SK NG+KI L    ++ D V+A GD +ND +M+  + +GVA+ NGS+KTK+VA  I    N+ DG+   I  Y
  S:   497 PDMLELVPPATSKGNGVKILLDHLCISPDEVMAIGDGENDIEMLQLASLGVALANGSEKTKAVANIIGAT-NDEDGVAQAIYDY 579
>gi|116492148|ref|YP_803883.1| HAD superfamily hydrolase [Pediococcus pentosaceus ATCC 25745] >gi|116102298|gb|ABJ67441.1| Predicted hydrolase of the HAD superfamily [Pediococcus pentosaceus ATCC 25745] (266 aa)
Score = 164, Expect = 7.5e-10, Identities = 76/262 (29%), Positives = 130/262 (49%)
  Q:    12 DMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG-----GAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI-RLSEYDHMT--------AKYFDVDVYLTEPKSKVM--IVCDKEYMPTVINRSKSFKSKYEVGTPL---VTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           D+DGTL+D+ +NVL  +   I+K++++G++F + TGR   ++A ++  + KI + V+ I   G     G  F+            L  +A+K+I N   +L L+         Y+ +E    + RL+    M          K  D++ +L +  S+++  I  DK    T   R    + K E    L    + P   E +   +SK   ++  +  + + L+  +AFG+  ND +MI     GVAM N     K  A  +T+  N  +GI NF+  YFK
  S:     4 DIDGTLIDNHQNVLPETKRTIEKLQQRGVIFYIATGR-MLSLAELI--RNKINDQVEIIASNGSVYQKGHHFHK---------EHLGWNALKEIYNITSELGLSTNFFTTDMTYYTREKPWMLSRLARVRVMADKTGNRRFEKVRDLE-HLHQLSSQIINGITIDK----TKSERLDEAREKMEATGLLKVSSSSPNNLELIPRRISKATAVRAIMDKYGIPLERTIAFGNDMNDLEMIKAVGTGVAMGNSPQILKDEADAVTDS-NVENGIGNFLESYFK 266
>gi|53712606|ref|YP_098598.1| haloacid dehalogenase-like hydrolase [Bacteroides fragilis YCH46] >gi|60680817|ref|YP_210961.1| putative haloacid dehalogenase-like hydrolase [Bacteroides fragilis NCTC 9343] >gi|52215471|dbj|BAD48064.1| haloacid dehalogenase-like hydrolase [Bacteroides fragilis YCH46] >gi|60492251|emb|CAH07016.1| putative haloacid dehalogenase-like hydrolase [Bacteroides fragilis NCTC 9343] (410 aa)
Score = 164, Expect = 7.7e-10, Identities = 66/258 (25%), Positives = 115/258 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFP-KENRHSIRLSEYDHMTAKYF----------DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++V D+DGTLL+D K +   ++  + K+++ G+   L +GR    +   L  K ++  Y  +I+   GAQ  N K  E           ++  IN      L      NG+  F   E+R     ++ +H+  + F          +  V +    SK M+V D E    +I   + +K +      +  + P   E +   + K+  L   L   ++T + ++  GD   D  MI  + +G+AM N  D  K  A  +T   N  DG+
  S:     4 KLLVLDVDGTLLNDEKEITPRTLATLLKVQQMGVHIVLASGRPTYGILP-LAKKLELGNYGGYILSYNGAQVINAKNGEV---------LLERRINPEMLPYLEKKARKNGFAIFTYTEDRMIADQADNEHILQEAFLNRMELIEEPEFSVAVDFAPSKCMLVSDDE--EALIGLEEHWKKRLNGALDVFRSEPYFLEVLPCGIDKSTSLGALLSHLDITPEEIIVIGDGVCDVSMIQFAGLGIAMGNAQDSVKVCADVVTAS-NEEDGV 260
>gi|193808313|emb|CAQ39016.1| haloacid dehalogenase-like hydrolase, putative [Plasmodium knowlesi strain H] (290 aa)
Score = 164, Expect = 7.9e-10, Identities = 67/268 (25%), Positives = 127/268 (47%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDL-NFGIP---DNGYLYFPKENRHSIRLSE-------YDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +IK++ +D+DGTLL+    +   ++  + K KEKG+     TGR   ++  V+ ++ K  +            F  +  N C   +      I  IIN    +D+ NF      D   +++ ++      ++E        + ++ +  + + + T    KV++  +++ + +++   K  F  K  V    +      E  H   +K  G+K   + +N+ L+N LA GD +ND +M+      VA  N SDK K  A+YI    +NNDG+ +  ++ F
  S:    20 EIKILFTDIDGTLLNSDNKLSPLNMQTLIKAKEKGIKIVFATGRPIFSVQGVIGEELKKNDL---------KLFPGIYLNGCITYAENGEKIIDHIINDELKMDIHNFTKKKKFDQYCIWYTEDKTFCFSINEEIRNYMNVESVSPEIINEETFKTLKVYKVLMCLNEQNISSILQSCKDLFGHKINVANTFM---YYIELFHQKTNKFEGVKKICESYNINLNNALAIGDGENDMEMLEGVPTSVAPSNASDKVKRCAKYIGP--SNNDGVVSHSLQTF 285
>gi|168473092|ref|ZP_02702115.1| hypothetical protein Salmoentericaenterica_00435 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (281 aa)
Score = 164, Expect = 8.0e-10, Identities = 71/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPATQFLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKAEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGVAWAIEKF 267
>gi|70726979|ref|YP_253893.1| hypothetical protein SH1978 [Staphylococcus haemolyticus JCSC1435] >gi|68447703|dbj|BAE05287.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (274 aa)
Score = 164, Expect = 8.0e-10, Identities = 70/266 (26%), Positives = 128/266 (48%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKT-SFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE---PKSKVMIVCDKEYMPTVINRSKSFKSK----YEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           ++  D+DGTLL+D+K + + +   +  +K++G    + TGR     + +   +  +      I+   GA  ++ K+++ K T   L  D  +++I   Q   +   I +     F   N H  RL E   M     +    L E     + +++  ++ Y+P +      F ++       G P    P++ E +   +SK  G+        +   +++AFGD DND +MI  +K G+AM NG D+ K +A +IT   NN+DGI  ++  +FK
  S:     5 LICLDLDGTLLNDNKEISDYTKQVLTTLKKQGHRIMIATGR-PYRASQIYYHELNMDTP---IVNFNGAYVHHPKSDDFKTTHEVLDVDLARNMIETLQKAKVTNIIAEVRDHVFI--NNHDPRLFEGFSMGNPKIETGNLLEELDEAPTSLLVEAEEIYIPRIKQMLTRFYAENIEHRRWGAPF---PVI-EIVKRGISKARGIDQVKDYLGIEPSHIIAFGDEDNDIEMIKYAKYGIAMDNGLDELKHIANHIT-YSNNDDGIGRYLNNFFK 267
>gi|83317352|ref|XP_731125.1| Cof-like hydrolase [Plasmodium yoelii yoelii str. 17XNL] >gi|23491059|gb|EAA22690.1| Cof-like hydrolase, HAD-superfamily, subfamily IIB [Plasmodium yoelii yoelii] (296 aa)
Score = 164, Expect = 8.2e-10, Identities = 67/258 (25%), Positives = 130/258 (50%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGC--GGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEY--DHMTAKYFDVDVYLTEPKS-----KVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           + IK++ +D+DGTLL+D+    E +I ++ K K KG+     TGR   +  +V+ +  K K  +  + G    G   Y    +      +++ + I DI N  ++ +L   I     +++  E  H+  ++E+  ++MT +    D+   E        K++I  +++ +  ++   K ++ K+     +  T     E  H N +K  G+K   K FN++L + L  GD +ND +M+   +  +A+ N S K K +A Y+   +N+N
  S:    27 NNIKIIFTDLDGTLLNDNSKASELNIESLVKAKNKGIKIVFATGRPIFSANDVIGEDVK-KNNLSLMPGIYLNGCITYGPNGDRIID-HYINENLIMDIYNFSKEHNLVKHI-----VWYSLEKTHTFEINEHIEEYMTVECIKPDIIDEEKLKNTKIYKILISLNEQNLSNIL---KIYQDKFSDQICVANTFKTYVELFHHNTNKFEGVKALCKYFNISLSDALVIGDGENDVEMLQGVENSIAVHNASSKIKQLANYVGPSNNDN 284
>gi|153807262|ref|ZP_01959930.1| hypothetical protein BACCAC_01540 [Bacteroides caccae ATCC 43185] >gi|149130382|gb|EDM21592.1| hypothetical protein BACCAC_01540 [Bacteroides caccae ATCC 43185] (271 aa)
Score = 164, Expect = 8.5e-10, Identities = 66/265 (24%), Positives = 123/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYL--------YFPKE---NRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYM-PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT---EQDNNNDGIYNFIVKY 271
           K++V D+DGTL +  K +   +   + +++E+G+   L +GR    +   L ++ ++ E+  FI+   G +  N +T E    + L  D +  +    +   L+    D   +        Y  KE   N+ ++R +  D +T         +T P +K +IV D + + P         + +  V     + P   E +   + K   L + LK+  +    ++A GD  ND  MI  + +G+AM N  +  K  A YIT   E+D   + + +F  K+
  S:     4 KLIVLDLDGTLTNSKKVITPRNREILIRVQEQGVRLVLASGRPTYGIVP-LANELRMNEFGGFILSYNGGEIINWETQEMLYENVLPNDVVPVLYECARSHQLSILTYDGAEIVTENSQDPYVQKEAFLNKMAVRETN-DFLTD--------ITLPVAKCLIVGDADKLIPLEAELCLRLQGRINV---FRSEPYFLELVPQGIDKALSLAVLLKEIGVERKEMIAIGDGYNDLSMIKFAGLGIAMGNAQEPVKKAADYITLSNEEDGVAEALEHFYYKF 270
>gi|70726577|ref|YP_253491.1| hypothetical protein SH1576 [Staphylococcus haemolyticus JCSC1435] >gi|68447301|dbj|BAE04885.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (267 aa)
Score = 164, Expect = 8.5e-10, Identities = 65/262 (24%), Positives = 124/262 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYF-DVDVYLTEPKSKVMIVCDKEYMPTVINRSK-SFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           +S  K++V DMD TL++    V + +   +  I+ +G    L +GR    M  +   + ++  +  +II   G +   + T E + +  +S      I++  ++ +       +G++    ++ +    SE   +  K   D+  Y+ +   K M V     +  V +    SF S+ +V T   + P   E+M  +VSK N +K   +  N++L  V+ FGD+ ND  M       +AM N +++ K++A  IT  DN+++GI
  S:     1 MSNYKMIVMDMDDTLINSENKVSKETKNYLIDIQNQGYKVVLASGRPTEGMLPI-AKELQLDVHDSYIISYNGGKTIKVATEEVEVSQSVSKKNFDLIVDFCREHNFLILTYQDGHIIHDGDHEYRDIESELTGLPMKRVNDIKAYINDSVPKAMGVDYATNIAKVRDDMHGSFNSEIDVTT---SKPFFLEFMAKDVSKGNAIKALCEKLNVSLSEVICFGDSLNDQSMFEVVGCAIAMGNANEELKAIADKIT-LDNDSNGI 259
>gi|81096643|ref|ZP_00874980.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Streptococcus suis 89/1591] >gi|146318842|ref|YP_001198554.1| HAD superfamily hydrolase [Streptococcus suis 05ZYH33] >gi|146321052|ref|YP_001200763.1| HAD superfamily hydrolase [Streptococcus suis 98HAH33] >gi|80977322|gb|EAP40868.1| Cof protein:HAD-superfamily hydrolase, subfamily IIB [Streptococcus suis 89/1591] >gi|145689648|gb|ABP90154.1| Predicted hydrolase of the HAD superfamily [Streptococcus suis 05ZYH33] >gi|145691858|gb|ABP92363.1| Predicted hydrolase of the HAD superfamily [Streptococcus suis 98HAH33] (270 aa)
Score = 164, Expect = 8.6e-10, Identities = 72/266 (27%), Positives = 117/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEP--KSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  D+DGTLL   K + E++  A++  +E+G+   L TGR    +   L +   + E    I   GG    N       K  F   D ++ I     DLDL   +   G +Y       S+ L+  + +  K    D  + E    +K +     +++   I +       ++E+     +  IL E+    V K NGL   +    +    V+A GD  ND  MI  + +GVAM N +D+ KS A  +  ++N+ DGI   I  Y
  S:     3 IKLIALDLDGTLLTSDKRISEANKKALQAARERGVYVVLTTGRPLQAIGTFLEELDLLGENQYSITFNGGLVQEN-TGRVLDKVGFTIED-VRTIRRVTNDLDLPLDVLYGGDVYSLPSAHESLYLT-CNPLLNKIVASDEEMPEDFVYNKAVSAVAADFLDGQIPKIPAELHERFEI---FKSRDILLEWSPKGVHKANGLAKLIGHLGIDQSEVMACGDEGNDLSMIEWAGLGVAMANATDEIKSAANLVLPKNNDEDGIAWVIEHY 265
>gi|148994102|ref|ZP_01823442.1| Cof family protein [Streptococcus pneumoniae SP9-BS68] >gi|168489118|ref|ZP_02713317.1| phosphatase YidA [Streptococcus pneumoniae SP195] >gi|147927455|gb|EDK78484.1| Cof family protein [Streptococcus pneumoniae SP9-BS68] >gi|183572440|gb|EDT92968.1| phosphatase YidA [Streptococcus pneumoniae SP195] (268 aa)
Score = 164, Expect = 8.7e-10, Identities = 66/263 (25%), Positives = 119/263 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N  ++++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDQGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGKYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYERYSINK---SAPFYLELLTKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|19704204|ref|NP_603766.1| HAD superfamily hydrolase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714426|gb|AAL95065.1| Hydrolase (HAD superfamily) [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (270 aa)
Score = 164, Expect = 8.7e-10, Identities = 73/268 (27%), Positives = 130/268 (48%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD--VDVYLTEPKSKVMIV-CDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++K+VVSD+DGTLL+D   V   +I  IKK+KE G+ F + TGR  N+ AN +  +  ++ Y   +I   GA  YN K  +  K + +  D I+ +IN   +  + +   D   + F   N   I     +     Y     D+       K++I+  D E +  + +   K+F ++ E+   +++     +      SK  G++   ++  +    ++AFGD+ NDY M+      VAM + S  +K   +  T+  N+  G+  ++ KYF
  S:     6 KMKLVVSDLDGTLLNDDSEVSNETIEMIKKLKENGIEFAIATGRSFNS-ANKIRKEIGLEIY---LICNNGANIYN-KNGKMIKNNIMPADLIRKVINFLTENSIGYFAFDGSGINFYVPNDIEIDAELLNEHIPHYIKNLEDINNLPALEKILIIEEDTERIYEIKDLVHKNFDNELEI---VISADDCLDLNIKGCSKRGGVEYISQELKINPKEIMAFGDSGNDYKMLKFVGHPVAMKD-SFMSKRDFENKTDFTNDESGVAKYLQKYF 268
>gi|15901151|ref|NP_345755.1| Cof family protein [Streptococcus pneumoniae TIGR4] >gi|111658518|ref|ZP_01409184.1| hypothetical protein SpneT_02000345 [Streptococcus pneumoniae TIGR4] >gi|148998931|ref|ZP_01826366.1| Cof family protein [Streptococcus pneumoniae SP11-BS70] >gi|168575746|ref|ZP_02721661.1| phosphatase YidA [Streptococcus pneumoniae MLV-016] >gi|14972776|gb|AAK75395.1| Cof family protein [Streptococcus pneumoniae TIGR4] >gi|147755241|gb|EDK62293.1| Cof family protein [Streptococcus pneumoniae SP11-BS70] >gi|183578163|gb|EDT98691.1| phosphatase YidA [Streptococcus pneumoniae MLV-016] (268 aa)
Score = 164, Expect = 9.0e-10, Identities = 66/263 (25%), Positives = 119/263 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N  ++++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDEGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGKYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYERYSINK---SAPFYLELLKKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|86134461|ref|ZP_01053043.1| hydrolase (HAD superfamily protein) [Tenacibaculum sp. MED152] >gi|85821324|gb|EAQ42471.1| hydrolase (HAD superfamily protein) [Polaribacter dokdonensis MED152] (269 aa)
Score = 163, Expect = 9.8e-10, Identities = 71/260 (27%), Positives = 121/260 (46%)
  Q:     2 DISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDL-DLNFGIPDNGYLYF-PKENRHSIRLSEYDHMTAKYFD-VDVYLTEPKSKVMIV---CDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           D +Q+K+VVSDMDGTLL+    V +      +++K+K + F   +GR  N++ + L     IK+ +  I   GG      K  E   ++FL+ D I  +I   + +   N  +  +G  +   K+ R      EY H   +  D + +   +P  K+ +      +E++  VI   K      E     V+G    +      +K   LK   K  +++ +  L FGD  ND +M+  +K   AM N  +  K +A+Y T  ++NN
  S:     3 DFAQVKLVVSDMDGTLLNSKGAVSDEFFTLFEQLKKKNITFCAASGRQHNSIVSKLD---AIKDEIYVIAENGGVA---KKGTEVLLSNFLATDKILQLIPILRTIAGANMVLCCDGEAFIESKDPRFIKHFQEYYHSFQQVEDLIAIAKNKPAYKIAVYHFDSSEEFIYPVIEHLK------EEVLLKVSGKNWLDISDEKANKGRALKHLQKVLDVSKEETLVFGDYHNDIEMMQEAKYSFAMANAHEDIKELAKYGTASNDNN 256
>gi|188159720|ref|ZP_02998837.1| Putative hydrolase of the HAD family protein [Mycoplasma mycoides subsp. mycoides LC str. GM12] (280 aa)
Score = 163, Expect = 1.0e-09, Identities = 75/261 (28%), Positives = 125/261 (47%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVL-IDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQD---LDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDV--YLTEPKSKVMIVCDKEYMPTV-INRSKSFKSKYEVGTPLVT-GPILFEYMHPNVSKTNGLKIALKDFNL--TLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           ++ SD+DGTLL D       +I  ++K+ +KG+     T R   D    A++L IDK+K       I+   GAQ Y+ KT++      L  + IK++ N Y +     + F  P+  Y++   +N    +   +  M  KY  VD    + EP +   IV + +  P   +N  K   + Y     + +    +F+     V K  G+   +K  NL     +   FGD  ND+ ++     G+AM NG  + K +A  IT+  N+ DG+  +I
  S:     7 IIFSDLDGTLLYDDYIFSPKTIEVVEKLYKKGIYLVPITARTIKDLKQKASLLQIDKFK-----GIIVASNGAQIYDYKTDKIIFDKTLPKEFIKEMFNRYHNKFFAKMIFYSPNCCYVFAEGKNS---KYWAHQVMGLKYISVDSPDQIDEPITHFYIVTNSKATPEENLNEYKYLMNNYADSYKVDSYNNRVFDISVKGVDKGCGVAEVMKYLNLDEKTTHSYGFGDGPNDFSLLKACTTGIAMKNGIIELKEIADDITDYSNDKDGVARYI 272
>gi|167555690|ref|ZP_02348708.1| hypothetical protein Sententeri_02310 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (281 aa)
Score = 163, Expect = 1.0e-09, Identities = 71/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQLLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGVAWAIEKF 267
>gi|27364555|ref|NP_760083.1| HAD superfamily hydrolase [Vibrio vulnificus CMCP6] >gi|27360674|gb|AAO09610.1|AE016800_215 Predicted hydrolase of the HAD superfamily [Vibrio vulnificus CMCP6] (276 aa)
Score = 163, Expect = 1.0e-09, Identities = 65/242 (26%), Positives = 115/242 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVD---FIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTK 248
           K+V SD+DGTLL  +  + E S   +K + E+G  F   TGR         ID   I+  V    ++I   GA+ ++ + ++   +  +  + ++ +I+   QD ++   +  N      +E+    +  E    T K +D+D   T+  +K+       D E++    N+  ++F  K  +     + P   E M   VSK + LK   +   LTL+N +AFGD  ND +M+  +  G+ M    +K K
  S:    12 KIVASDLDGTLLAPNHQLSEFSKQTLKALHEQGYTFIFATGRHH-------IDVAGIRAQVGIPAYMITSNGARVHD-QHDQLMYSKNVPAELVQPVIDIVKQDPEIFVHLYQNEDWRLNREDEVMRKFHEETGFTYKVYDIDNAPTDGIAKIFFTHPEQDHEHLVGFENQLREAFGDKLNIA---FSTPWCLEVMAAEVSKGDALKAVAESLGLTLENCVAFGDGMNDVEMLSMAGKGLVMETSHEKVK 250
>gi|168713335|ref|ZP_02745612.1| putative hydrolase [Clostridium difficile QCD-63q42] (270 aa)
Score = 163, Expect = 1.0e-09, Identities = 76/258 (29%), Positives = 126/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNM---ANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-------FGIPDNG------YLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD--KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++ +DMDGTL+     V E +I A+K++ EKG+   L TGR  N M    +VL D        D  I      ++ L   E KK   LS +A+K I    +  +LN         I +N       Y     +N+   R+   ++ + +       L E     ++ C    E + ++    + FK + ++   + +G I FE M    SK   +K       +  + V+  GD +ND  MI  + +G+AM N +D+ KS+A ++T+  N NDG+
  S:     4 KLICTDMDGTLMGKGFEVSEENIKALKEVMEKGIKVALVTGRPYNAMKYFTSVLGD--------DIYIISTNGTYFKLLGYEYKKV--LSKEALKKIYTIGEKYNLNKHFKGCKIVISNNEIGEEHPYRLINSKNKEEDRIEIIENASCET------LLEKADNEILKCILFSENVDSLREAKEEFKKQEDLEV-VSSGKINFEVMSKGTSKGIAVKKFCDILGIDSEEVICIGDNENDISMIKFAGLGIAMGNATDEVKSMADFVTDT-NVNDGV 261
>gi|57234007|ref|YP_181931.1| HAD family hydrolase [Dehalococcoides ethenogenes 195] >gi|57224455|gb|AAW39512.1| HAD-superfamily hydrolase, subfamily IIB [Dehalococcoides ethenogenes 195] (271 aa)
Score = 163, Expect = 1.1e-09, Identities = 66/249 (26%), Positives = 109/249 (43%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD-VYLTEPKSKVMIVCDKEYMPTVINRSKS--FKSKYE-------VGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           ++ V D+DGTL++    + E+   AI + +EKG+   L TGR       +L    K      F I C GA  YN  T +   +  LS + +   I+  ++  +   +      Y   EN  +    E+ H++    D   + L +   K+ ++     +     RS +  F S++E          P          + P VSK   L+       ++L NV+AFGD  ND  +   +  GVAM N   + K +A Y+T
  S:     5 QLAVIDVDGTLINKQGRISEADKKAISQAREKGITVALSTGRVVPACTYLL----KELGLDGFHIFCDGALVYNPDTAQTCYSQPLSREPLLSAIDFVREQSIYLELYTILEYYVEYENWSAKMHREFFHISPTVTDFKKIALRQDVQKIELM-----VHNTAERSGAELFMSRFEDDFHFSIARAPAYPEVEFVNVLSPGVSKGQALEKMAAQMGISLRNVIAFGDGSNDLPLFRAAGFGVAMGNARAELKEIADYVT 254
>gi|15893917|ref|NP_347266.1| HAD superfamily hydrolase [Clostridium acetobutylicum ATCC 824] >gi|15023501|gb|AAK78606.1|AE007578_4 Predicted hydrolase of the HAD family [Clostridium acetobutylicum ATCC 824] (268 aa)
Score = 163, Expect = 1.1e-09, Identities = 73/265 (27%), Positives = 119/265 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHS---IRLSEYDHMTAKYFDV--DVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLL+D K + + +  AIKK K  G    L TGR    +   L  +  +    D+ I   G    N KT E      +  + +  +    Q  ++N  +        PK+N ++   + +++   +   + ++  D  +     K+M++  KE +  V     K     Y V     +  I  E+    V K  GLKI  +  NL  + ++A GDA ND  MI  + +GVAM N     K  A Y+T+ +N   G+   I K+
  S:     3 KLIALDMDGTLLNDDKIISKRNKEAIKKAKNLGYKVVLSTGRPLKGVERYL-KELDLVNDDDYAIAFNGGLVQNTKTGEVLGKELMKFEDLDRLYKLSQKFNVNIHMLSINECITPKKNPYTEVEVNINQIPLIEKNFNELPHDTVIV----KIMMIDSKEKLDKVEKLLPKEIYDDYSVAR---SSDIFLEFSPKGVHKGVGLKILSEHLNLKKEELIAVGDAGNDIAMIEYAGLGVAMGNAFPYVKESADYVTD-NNETHGVAKVIEKF 264
>gi|167938447|ref|ZP_02525522.1| hydrolase (HAD superfamily) protein [Bacillus cereus AH1134] (283 aa)
Score = 163, Expect = 1.1e-09, Identities = 69/266 (25%), Positives = 127/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+  +E G +  +CTGR   ++  +L++       VD    II   GA  Y  K  +  K   +      +I+ + ++  L + +  +  +Y P     S+R              L E + + A Y +   + +    K ++  D    + +P    I + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ +Y T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRTCQEAGHVVAICTGRSIVDIERLLLE-------VDLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVEYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEHVKNSKENFDLKELETIAALYLEHTAFHSAESCKPIVETDIHVHKLLPFSYEIEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCKYET-LSNEEHGVAHALYKY 281
>gi|62182319|ref|YP_218736.1| sugar phosphatase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616948|ref|YP_001590913.1| sugar phosphatase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167545652|ref|ZP_02341221.1| hypothetical protein Sentent_20373 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167548880|ref|ZP_02342639.1| hypothetical protein Sentente_00125 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168260385|ref|ZP_02682358.1| hypothetical protein Salmentericaenterica_04825 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|194445079|ref|YP_002043081.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|62129952|gb|AAX67655.1| putative hydrolase of the HAD superfamily [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161366312|gb|ABX70080.1| hypothetical protein SPAB_04769 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194403742|gb|ACF63964.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Newport str. SL254] (281 aa)
Score = 163, Expect = 1.1e-09, Identities = 71/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGVAWAIEKF 267
>gi|290545|gb|AAA62048.1| f270 (270 aa)
Score = 163, Expect = 1.1e-09, Identities = 70/266 (26%), Positives = 115/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   + +G+   L TGR    + N L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYL-KELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRXLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQXVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|148989316|ref|ZP_01820696.1| hypothetical protein CGSSp6BS73_03357 [Streptococcus pneumoniae SP6-BS73] >gi|147925294|gb|EDK76373.1| hypothetical protein CGSSp6BS73_03357 [Streptococcus pneumoniae SP6-BS73] (268 aa)
Score = 163, Expect = 1.1e-09, Identities = 66/263 (25%), Positives = 119/263 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N  ++++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDEGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGKYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYERYSINK---SAPFYLELLTKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|168134107|ref|ZP_02577336.1| hydrolase (HAD superfamily) protein [Bacillus cereus B4264] (283 aa)
Score = 163, Expect = 1.2e-09, Identities = 69/266 (25%), Positives = 127/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+  +E G +  +CTGR   ++  +L++       VD    II   GA  Y  K  +  K   +      +I+ + ++  L + +  +  +Y P     S+R              L E + + A Y +   + +    K ++  D    + +P    I + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ +Y T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRTCQEAGHVVAICTGRSIVDIERLLLE-------VDLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVEYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEHVKNSKENFDLKELETVAALYLEHTAFHSAESCKPIVETDIHVHKLLPFSYEIEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCKYET-LSNEEHGVAHALYKY 281
>gi|149012348|ref|ZP_01833417.1| Cof family protein [Streptococcus pneumoniae SP19-BS75] >gi|182684224|ref|YP_001835971.1| Cof family protein [Streptococcus pneumoniae CGSP14] >gi|147763674|gb|EDK70609.1| Cof family protein [Streptococcus pneumoniae SP19-BS75] >gi|182629558|gb|ACB90506.1| Cof family protein [Streptococcus pneumoniae CGSP14] (268 aa)
Score = 163, Expect = 1.2e-09, Identities = 63/263 (23%), Positives = 117/263 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T     +  L+ +   D+    + L ++        +Y    N  ++++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDEGDYVVTFNGALVQETATGHEIISESLTYEDYLDMEFLSRKLGVHMHAITKDGIYTANRNIGKYTVHESTLVSMPIFYRTPEEMADKEIVKCMFIDEPEILDATIEKIPAEFYERYSINK---SAPFYLELLTKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|115478973|ref|NP_001063080.1| Os09g0388400 [Oryza sativa (japonica cultivar-group)] >gi|49388855|dbj|BAD26068.1| haloacid dehalogenase-like hydrolase-like protein [Oryza sativa Japonica Group] >gi|113631313|dbj|BAF24994.1| Os09g0388400 [Oryza sativa (japonica cultivar-group)] (373 aa)
Score = 162, Expect = 1.3e-09, Identities = 74/266 (27%), Positives = 126/266 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVL-----------IDKWKIKEYVD--FIIGCGGAQFY--NLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR---LSEYDHMTAKYFDVD--VYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K +  DMDGTLLD S  V E++  AI+  + +G+   + TG+    +  VL           + +     ++    + G GG + Y  NL    C++    S      ++   QD D    + D+  + F     H  +   +S+ DH  +   D+   V+L  P+  +  V    +   V  +++  +++ +V           E +    SK NG+KI L+    + D V+A GD  ND +M+  + +GVA+ NG + TK VA  I    N+  G+   I KY 
  S:   102 KYIFCDMDGTLLDSSGLVPETNAEAIRVARSRGVQTIIATGKSRPAVIEVLGKVNLAGTGGIVSESSPGVFLQGLLVYGEGGQKLYQQNLDIEVCREALLYSLKHRVALVAFSQD-DCYTTLDDHPLVDFFHVMYHEPKAKIISDVDHFLST-IDIQKFVFLETPEV-ISSVLRPHWARRVDGKAQVVQAQGDV----------LEVVPLGTSKGNGVKILLESLCASPDEVMALGDGKNDKEMLQLAGLGVALCNGCEVTKVVADVIGAS-NDESGVAQAIYKYL 373
>gi|62179407|ref|YP_215824.1| HAD family hydrolase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62127040|gb|AAX64743.1| putative hydrolase of the HAD superfamily [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (269 aa)
Score = 162, Expect = 1.3e-09, Identities = 72/263 (27%), Positives = 128/263 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK---ENRHSIRLSEYDHMTA--KYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           + VVV+DMDGT LDD+K       +A  +++K++ + F + +G     + +   +   +K+ + F+   G      G Q ++ +  +  ++  + G+ +KD         LNF        Y  K   E   ++    Y  +     Y D+D  L     K  +    E +P VI+  K   S   +  P+ +G    + + P + K NG+   LK +N +  NV+A GD+ ND +M+  +    AM N +D  K++++Y T+ DNN+ G  N I
  S:     3 VNVVVTDMDGTFLDDAKQYDRVRFMAQYQELKKRNIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTQ-HESRIVIGELLKD-------KQLNFVACGLKSAYVSKNAPETFVALMAKHYHRLQPVNDYHDIDDILF----KFSLNLPDEQIPLVID--KLHVSLDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWNRSPQNVVAIGDSGNDAEMLKMAHYSFAMGNAADNIKALSRYHTD-DNNHQGALNVI 259
>gi|169833492|ref|YP_001694740.1| phosphatase YidA [Streptococcus pneumoniae Hungary19A-6] >gi|168995994|gb|ACA36606.1| phosphatase YidA [Streptococcus pneumoniae Hungary19A-6] (268 aa)
Score = 162, Expect = 1.5e-09, Identities = 66/263 (25%), Positives = 118/263 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N   +++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGIKVVIATGRPIAGVAK-LLDDLQLRDQGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGTYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYERYSINK---SAPFYLELLKKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|160887529|ref|ZP_02068532.1| hypothetical protein BACOVA_05549 [Bacteroides ovatus ATCC 8483] >gi|156107940|gb|EDO09685.1| hypothetical protein BACOVA_05549 [Bacteroides ovatus ATCC 8483] (410 aa)
Score = 162, Expect = 1.5e-09, Identities = 65/258 (25%), Positives = 119/258 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNEC--------KKTSFLSGDAIKD--IINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++V D+DGTLL+D+K + + ++ A+ K+++ G+   L +GR    +   L    ++  Y  FI+   G Q  N +  E         +   +L   A K+   +  Y D  +    P+N ++      ++  RL++   +  + F   V       K M+V D E    ++     +K +      +  + P   E +   + K N L   L+   +  + V+A GD   D  MI  + +G+AM +  D  K+ A Y+T   N  DG+
  S:     4 KLLVLDVDGTLLNDAKEISKRTLAALLKVQQMGVRIVLASGRPTYGLMP-LAKMLELGNYGGFILSYNGCQIINAQNGEILFERRINPEMLPYLEKKARKNGFALFTYHDDTIITDSPENEHI------QNEARLNDLQIIKEEEFSAAVDFA--PCKCMLVSDDE--EALLGLEDHWKRRLNGALDVFRSEPYFLEVVPCAIDKANSLGALLEVLGMKREEVIAVGDGVCDVTMIQLAGLGIAMGHSQDSVKACADYVTAS-NEEDGV 260
>gi|168818309|ref|ZP_02830309.1| hypothetical protein Salentericaenterica_02901 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (281 aa)
Score = 162, Expect = 1.5e-09, Identities = 70/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ +   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCVTYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGVAWAIEKF 267
>gi|134300887|ref|YP_001114383.1| Cof-like hydrolase [Desulfotomaculum reducens MI-1] >gi|134053587|gb|ABO51558.1| Cof-like hydrolase [Desulfotomaculum reducens MI-1] (268 aa)
Score = 162, Expect = 1.5e-09, Identities = 74/265 (27%), Positives = 117/265 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK---ENRHSIRLSEYD-HMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPL---VTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+D TLL+    +   +   IK+ +E G+   L TGR    M    +   K  E    +I   GA     +T E      +     +++I     L  +  +  +  LY  K   E     R+S    H      D   +L E  +KV++V   E +  +    +  + +Y  GT L    + P   E+ HP  +K   L    K + LT + V+A GDA ND +MI  + +GV M NG  + K+ A Y+T   N  DG+   I K+
  S:     6 KLLAIDLDDTLLNGQLKISSRNKEYIKRAQEAGIHVTLATGR----MYCSALRYAKELELNLPLITYQGALVKEAQTGEVLLHRPVPLVLAREVIQRGSQLGYHINVYVDDTLYVEKITPEAEVYQRISGITAHPVGNLLD---FLQEDPTKVLMVGGIEELDRL---GEEMRCQY--GTSLHICKSKPHFLEFSHPQATKGLALDTLAKGWGLTAEQVIAIGDAPNDLEMIDYAGLGVVMGNGEPEVKAKADYVT-HSNEEDGVAEVIAKF 264
>gi|167039946|ref|YP_001662931.1| Cof-like hydrolase [Thermoanaerobacter sp. X514] >gi|166854186|gb|ABY92595.1| Cof-like hydrolase [Thermoanaerobacter sp. X514] (274 aa)
Score = 162, Expect = 1.6e-09, Identities = 73/267 (27%), Positives = 129/267 (48%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY-LTEPKSKVMIVCDKEYMPTVINRS----KSFKSKYEVGTPL-VTGPIL--FEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           Q K++  DMD TLL   K + + +I A+ K +EKG+   + TGR       V    +   + + F   II   GA   +   N   + S L+ D++ +II   Q  +  F +     ++ P+      R +E++ +      V+V  + EP   +  + D      V N      KS + +      + +T   +   E ++  VSK   L+I  +  ++  + ++A GD++ND +MI  + +GVAM N  ++ K VA +IT + N  DG+   I K+
  S:     2 QYKLIAVDMDDTLLRHDKTISKENIEALHKAREKGVYVVISTGR-------VFASAYAYADMIGFRTYIIASNGALIRDPNNNTIYE-SILNYDSMVEIIKVCQKYNTYFQLISETTVFSPEITNKFQRYAEWNELFKTELKVNVKEIKEPLKDIDKLKDNVLKIIVFNDDIEVLKSIREELSKNDSIQITSSYMDNIEIVNKGVSKGRALEILGEYLSIKKEEMIAIGDSENDIEMIKFAGLGVAMENAIEEVKKVADFIT-KSNMEDGVKYVIDKF 270
>gi|154686847|ref|YP_001422008.1| hypothetical protein RBAM_024170 [Bacillus amyloliquefaciens FZB42] >gi|154352698|gb|ABS74777.1| conserved hypothetical protein [Bacillus amyloliquefaciens FZB42] (270 aa)
Score = 162, Expect = 1.6e-09, Identities = 67/268 (25%), Positives = 121/268 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSIL-AIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY-----LTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           IK++  DMDGT L+D     +   +   +++K +G+ F + +G     + +   +   IK  + FI   G    + +   E      +S D IK +I   +  ++   I       +  EN   +   EY H +  Y+ +        + +   K  I    E+   +++  K+    +   TP+ +G    + + P + K +G+K+  K + +  +   AFGD+ ND +M+   K GVAM N  +  K  A +IT Q NN +G+ N I    K
  S:     3 IKLIAVDMDGTFLNDEMAYNKERFMNQYRELKARGIKFAVASGNQYAQLTSFFPE---IKSEIAFISENGA---FVVNAGEELFAGNMSEDTIKAVIRALEQYEVKNVIVCGKKSAYIHEN---VGEDEYLHASKYYYVLKRVPHFENIDDDILKFSISFPAEHCSALLSHLKNAIGSFV--TPVSSGHGDIDLIIPGLHKASGIKLLQKQWGINAEECAAFGDSGNDLEMVSAVKYGVAMDNAQESIKQAAAHIT-QSNNEEGVLNAIDSILK 264
>gi|16078178|ref|NP_388995.1| hypothetical protein BSU11140 [Bacillus subtilis subsp. subtilis str. 168] >gi|1620926|emb|CAB01836.1| putative orf [Bacillus subtilis] >gi|2145415|emb|CAA70632.1| YitU [Bacillus subtilis] >gi|2633450|emb|CAB12954.1| yitU [Bacillus subtilis subsp. subtilis str. 168] (270 aa)
Score = 162, Expect = 1.6e-09, Identities = 65/265 (24%), Positives = 122/265 (46%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKT-SFLSGDAIK---DIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++  D+DGTLL D K + E+++  I+++K+ G    + TGR   + +      ++  E    I+   GA  ++ + +   +  + L  D +K   DI   Y   ++   + D+ Y ++  E  H I     +       D+   L E  + V+I   +E +P + +      ++            + E +   ++K  GL+     + +  + ++AFGD DND +M+  +  GVAM NG D  K +A   T   N  DG+  F+ +YF
  S:     7 LIALDLDGTLLKDDKTISENTLHTIQRLKDDGHYVCISTGRPYRSSSMY----YQQMELTTPIVNFNGAFVHHPQDDSWGRYHTSLPLDVVKQLVDISESYNVHNVLAEVIDDVYFHYHDE--HLIDAFNMNTTNVTVGDLRENLGEDVTSVLIHAKEEDVPAIRSYLSDVHAEVIDHRRWAAPWHVIEIIKSGMNKAVGLQKISDYYGVPRERIIAFGDEDNDLEMLEFAGCGVAMGNGIDAVKQIANRTTAT-NEEDGVARFLKEYF 268
>gi|160931261|ref|ZP_02078662.1| hypothetical protein CLOLEP_00098 [Clostridium leptum DSM 753] >gi|156869739|gb|EDO63111.1| hypothetical protein CLOLEP_00098 [Clostridium leptum DSM 753] (272 aa)
Score = 161, Expect = 1.6e-09, Identities = 65/268 (24%), Positives = 120/268 (44%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGY--------LYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVM--------IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           Q +++  D+DGTL+     + E++  A+    + G +  L +GR    +        ++ +   +++   G +  N KT        +  D +  II   +D  +      + Y        L+F +E   S+   EY  +     D+  Y+T P  K+M        +  +K+    + +R   F+S+              E++   + K   L++ LK   LT D++ AFGD+ ND  MI  +  GVAM N   +    A  +T + N+ DG+ + I +Y 
  S:     2 QYRLLALDLDGTLVTSHGGITEAAKQAVWSYIDAGGVVALASGRPTRGLWPA--QDLRLAQKGGYLLSYNGGKIVNCKTGAAIYEKDIPQDLVPVIIRMIRDAGMEAISYQDQYVLLEHVDRLWFDREA--SVCRMEYKEVP----DLAAYVTFPVVKLMACGAPEQILALEKQAQEAIGSRVDVFRSE----------DFYLEFVAKGIDKAATLEVLLKHLGLTRDSLAAFGDSYNDIPMIKYAGFGVAMANSIPEVLQAADAVT-KSNDEDGVAHAIYRYL 266
>gi|156081887|ref|XP_001608436.1| haloacid dehalogenase, putative [Plasmodium vivax SaI-1] >gi|148801007|gb|EDL42412.1| haloacid dehalogenase, putative [Plasmodium vivax] (292 aa)
Score = 161, Expect = 1.6e-09, Identities = 64/268 (23%), Positives = 126/268 (47%)
  Q:     5 QIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDL-NFGIP---DNGYLYFPKENRHSIRLSE-------YDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +IK++ +D+DGTLL+    +   ++  I K KEKG+   L TGR   ++  V+ ++ K  +            F  +  N C          I  ++N    +D+ NF      D   +++  E      +++        + +T +  + + + T    KV++  +++ + +V    K  F  K  V    +      E  H   +K  G+K   + +N++L+N L  GD +ND +M+      V+  N S+K K  A+Y+    +NND + +++++ F
  S:    24 EIKILFTDIDGTLLNSDHKLSPQNMQTIIKAKEKGIKIVLATGRPTFSVQGVIGEELKKNDL---------KLFPGIYLNGCITYDEKGERIIDHVLNDELKMDIYNFSKKEKFDQYCIWYTLEKTFCFTINDEIRSYMNVESVTPEIINEETFKTLRVYKVLMCLNEQNVCSVFQSCKDLFAHKINVANTFMN---YIELFHQKTNKFEGVKKICESYNISLNNALVIGDGENDMEMLEGVPTSVSPSNASEKVKRCAKYVGP--SNNDSVVSYVLQRF 289
>gi|168233385|ref|ZP_02658443.1| predicted hydrolase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194472010|ref|ZP_03077994.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194458374|gb|EDX47213.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (270 aa)
Score = 161, Expect = 1.6e-09, Identities = 69/259 (26%), Positives = 113/259 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIATAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQLLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGV 260
>gi|154685547|ref|YP_001420708.1| YitU [Bacillus amyloliquefaciens FZB42] >gi|154351398|gb|ABS73477.1| YitU [Bacillus amyloliquefaciens FZB42] (270 aa)
Score = 161, Expect = 1.7e-09, Identities = 66/265 (24%), Positives = 122/265 (46%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKT-SFLSGDAIK---DIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++  D+DGTLL D K +   +   I+K+KE G    + TGR   + +++  D+  +      I+   GA  ++ K     +  + LS D ++   ++   YQ  ++   + D+ Y ++  E  H I     +     + D+   + E  + V+I   +E +  +        ++            + E +   ++K  GLK     + +  + ++AFGD DND +M+  +  GVAM NG+D+ K  A  +T   N  DGI  F+  YF
  S:     7 LIALDLDGTLLKDDKTISPETARTIQKLKEAGHHVCISTGRPFRS-SSMYYDELGLTTP---IVNFNGAFVHHPKDESWGRYHTSLSVDVVRQLAELTETYQIHNVLAEVIDDVYFHYHDE--HLIEAFHMNTANVTFGDLRETVKEDVTSVLIHAKEEDVADIRAHLSDVHAEVIDHRRWAAPWHVIEIIKHGMNKAVGLKKISDYYQVPRERIIAFGDEDNDLEMLRFAGCGVAMGNGTDEVKQAADRVT-GSNEADGIAEFLKSYF 268
>gi|149019290|ref|ZP_01834652.1| hypothetical protein CGSSp23BS72_05035 [Streptococcus pneumoniae SP23-BS72] >gi|147931160|gb|EDK82139.1| hypothetical protein CGSSp23BS72_05035 [Streptococcus pneumoniae SP23-BS72] (268 aa)
Score = 161, Expect = 1.7e-09, Identities = 66/263 (25%), Positives = 118/263 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N  ++++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E    NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDQGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGKYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYERYSINK---SAPFYLELFTKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|82779226|ref|YP_405575.1| sugar phosphatase [Shigella dysenteriae Sd197] >gi|81243374|gb|ABB64084.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (270 aa)
Score = 161, Expect = 1.7e-09, Identities = 70/266 (26%), Positives = 115/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   + +G+   L TGR    + N L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYL-KELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHTLDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|15903213|ref|NP_358763.1| Cof family protein [Streptococcus pneumoniae R6] >gi|116516922|ref|YP_816615.1| Cof family protein [Streptococcus pneumoniae D39] >gi|168491210|ref|ZP_02715353.1| phosphatase YidA [Streptococcus pneumoniae CDC0288-04] >gi|15458801|gb|AAK99973.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116077498|gb|ABJ55218.1| Cof family protein [Streptococcus pneumoniae D39] >gi|183574436|gb|EDT94964.1| phosphatase YidA [Streptococcus pneumoniae CDC0288-04] (268 aa)
Score = 161, Expect = 1.7e-09, Identities = 66/263 (25%), Positives = 118/263 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N  ++++  S    M   Y   +    +   K M + + E +   I +    F   Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDQGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGKYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYEHYSINK---SAPFYLELLKKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|16762494|ref|NP_458111.1| sugar phosphatase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143982|ref|NP_807324.1| sugar phosphatase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|168224996|ref|ZP_02650227.1| predicted hydrolase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168235470|ref|ZP_02660528.1| predicted hydrolase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194737423|ref|YP_002116775.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|25303684|pir||AH0958 conserved hypothetical protein STY3947 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504799|emb|CAD03164.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139618|gb|AAO71184.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|194712925|gb|ACF92146.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (270 aa)
Score = 161, Expect = 1.7e-09, Identities = 69/259 (26%), Positives = 113/259 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGV 260
>gi|110005317|emb|CAK99641.1| hypothetical haloacid dehalogenase-like hydrolase protein [Spiroplasma citri] (269 aa)
Score = 161, Expect = 1.8e-09, Identities = 62/255 (24%), Positives = 120/255 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH-YQDLDLNFGIPDNGYLYFPKENRH---SIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           K V SD+DGTLL+D+      +   +  I++KG+ F + TGR AN+ A     K K+ +Y  +++   GA  Y+ KTN        +   IK I    Y+   ++F   ++ Y+Y   +N +    I  ++Y  +T K  D+   +T          D +    ++ + +    + ++         +FE     +SK + L+       + +    +FGD+ ND ++I  + +G+A+ N  ++ K++A  +T  +  N
  S:     3 KAVFSDLDGTLLNDNHRFSRLTKKTVNSIQKKGIPFVVTTGRLAND-AIRQARKLKVHKYDGYVLANNGASAYSFKTNSFLWMMIFTTAEIKTIFEFTYRKYKVHFFSNNSTYVYEYGDNSYYWSKIMRTKYKIIT-KVTDITEDITHASVIAHHSLDDKAANELMTKLRQLLPQLDITQ---YNNRVFEIACKGISKGSALQFLSHHIGIDISQTYSFGDSYNDLELIRQAGVGIAVGNAINELKTMANEVTLSNREN 256
>gi|168242050|ref|ZP_02666982.1| hypothetical protein Senterienterica_10472 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194448271|ref|YP_002047864.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194406575|gb|ACF66794.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (281 aa)
Score = 161, Expect = 1.9e-09, Identities = 71/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHIISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKAEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGVAWAIEKF 267
>gi|118727768|ref|ZP_01576357.1| Cof-like hydrolase [Clostridium cellulolyticum H10] >gi|118662833|gb|EAV69505.1| Cof-like hydrolase [Clostridium cellulolyticum H10] (273 aa)
Score = 161, Expect = 2.0e-09, Identities = 71/265 (26%), Positives = 124/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDH-MTAK-------YFDVDVYLTEPKSKVM---IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           ++V  D+DGTLLD +K + E + +AI   KEKG+   +C+GR   + A +   +  I   +D II C GA        +   ++++  D    I++ + +  + F +     +   + + +S++  E +  + AK         D++  L E   KV+    V D   +   + +  S     +V +        FE ++  V+K   L+       +    ++A GD +ND  M   + +GVAM NG D  K  A YIT   N  DG+   I K+
  S:     3 RLVAIDLDGTLLDKNKEISERNKIAIHMAKEKGVKIVICSGR-VYSGARIYAKQLGI---MDPIIACNGAIIRENADGKVIYSNYMHTDDCLKILDIFHENSIYFHVYAGETMLTERLDYNSLKYYERNKALHAKDRVEIDIVTDMEKRLKELDGKVLKLVAVSDDSELLATVRKKLSIVETVDVTSSNYNN---FEVVNKGVNKGKALERLSNMLKIPYREIIAIGDNENDIPMFDFAGLGVAMGNGEDCAKEAADYITAT-NTEDGVAKAIEKF 270
>gi|16131565|ref|NP_418152.1| predicted hydrolase [Escherichia coli str. K-12 substr. MG1655] >gi|24114993|ref|NP_709503.1| sugar phosphatase [Shigella flexneri 2a str. 301] >gi|26250438|ref|NP_756478.1| sugar phosphatase [Escherichia coli CFT073] >gi|30065005|ref|NP_839176.1| sugar phosphatase [Shigella flexneri 2a str. 2457T] >gi|74314011|ref|YP_312430.1| sugar phosphatase [Shigella sonnei Ss046] >gi|89110316|ref|AP_004096.1| predicted hydrolase [Escherichia coli W3110] >gi|91213219|ref|YP_543205.1| sugar phosphatase [Escherichia coli UTI89] >gi|110644040|ref|YP_671770.1| sugar phosphatase [Escherichia coli 536] >gi|117625973|ref|YP_859296.1| sugar phosphatase [Escherichia coli APEC O1] >gi|157157907|ref|YP_001465181.1| sugar phosphatase [Escherichia coli E24377A] >gi|170083200|ref|YP_001732520.1| hydrolase [Escherichia coli str. K12 substr. DH10B] >gi|170683176|ref|YP_001746025.1| phosphatase yidA [Escherichia coli SMS-3-5] >gi|191165851|ref|ZP_03027689.1| phosphatase yidA [Escherichia coli B7A] >gi|191170410|ref|ZP_03031963.1| phosphatase yidA [Escherichia coli F11] >gi|193063772|ref|ZP_03044859.1| phosphatase yidA [Escherichia coli E22] >gi|194428060|ref|ZP_03060604.1| phosphatase yidA [Escherichia coli B171] >gi|194431269|ref|ZP_03063562.1| phosphatase yidA [Shigella dysenteriae 1012] >gi|194435879|ref|ZP_03067982.1| phosphatase yidA [Escherichia coli 101-1] >gi|68066493|sp|P0A8Y5|YIDA_ECOLI Phosphatase yidA >gi|68066498|sp|P0A8Y6|YIDA_ECOL6 Phosphatase yidA >gi|68066501|sp|P0A8Y7|YIDA_SHIFL Phosphatase yidA >gi|26110868|gb|AAN83052.1|AE016769_167 Hypothetical protein yidA [Escherichia coli CFT073] >gi|2367265|gb|AAC76720.1| predicted hydrolase [Escherichia coli str. K-12 substr. MG1655] >gi|24054246|gb|AAN45210.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30043266|gb|AAP18987.1| hypothetical protein S4004 [Shigella flexneri 2a str. 2457T] >gi|73857488|gb|AAZ90195.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|85676347|dbj|BAE77597.1| predicted hydrolase [Escherichia coli W3110] >gi|91074793|gb|ABE09674.1| hypothetical protein UTI89_C4247 [Escherichia coli UTI89] >gi|110345632|gb|ABG71869.1| hypothetical protein ECP_3898 [Escherichia coli 536] >gi|115515097|gb|ABJ03172.1| predicted hydrolase [Escherichia coli APEC O1] >gi|157079937|gb|ABV19645.1| phosphatase yidA [Escherichia coli E24377A] >gi|169891035|gb|ACB04742.1| predicted hydrolase [Escherichia coli str. K12 substr. DH10B] >gi|170520894|gb|ACB19072.1| phosphatase yidA [Escherichia coli SMS-3-5] >gi|190904175|gb|EDV63886.1| phosphatase yidA [Escherichia coli B7A] >gi|190909218|gb|EDV68804.1| phosphatase yidA [Escherichia coli F11] >gi|192930487|gb|EDV83094.1| phosphatase yidA [Escherichia coli E22] >gi|194413818|gb|EDX30096.1| phosphatase yidA [Escherichia coli B171] >gi|194420724|gb|EDX36800.1| phosphatase yidA [Shigella dysenteriae 1012] >gi|194425422|gb|EDX41406.1| phosphatase yidA [Escherichia coli 101-1] (270 aa)
Score = 161, Expect = 2.0e-09, Identities = 70/266 (26%), Positives = 115/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   + +G+   L TGR    + N L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYL-KELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|196127411|ref|ZP_03119160.1| putative hydrolase [Clostridium difficile ATCC 43255] (270 aa)
Score = 161, Expect = 2.0e-09, Identities = 76/258 (29%), Positives = 125/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNM---ANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-------FGIPDNG------YLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD--KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++ +DMDGTL+     V E +I A+K++ EKG+   L TGR  N M    +VL D        D  I      ++ L   E KK   LS +A+K I    +  +LN         I +N       Y     +N+   R+   ++ + +       L E     ++ C    E + ++    + FK + ++   + +G I FE M    SK   +K       +    V+  GD +ND  MI  + +G+AM N +D+ KS+A ++T+  N NDG+
  S:     4 KLICTDMDGTLMGKGFEVSEENIKALKEVMEKGIKVALVTGRPYNAMKYFTSVLGD--------DIYIISTNGTYFKLLGYEYKKV--LSKEALKKIYTIGEKYNLNKHFKGCKIVISNNEIGEEHPYRLINSKNKEEDRIEIIENASCET------LLEKADNEILKCILFSENVDSLREAKEEFKKQEDLEV-VSSGKINFEVMSKGTSKGIAVKKFCDILGIDSKEVICIGDNENDISMIKFAGLGIAMGNATDEVKSMADFVTDT-NVNDGV 261
>gi|149007041|ref|ZP_01830710.1| Cof family protein [Streptococcus pneumoniae SP18-BS74] >gi|168484493|ref|ZP_02709445.1| phosphatase YidA [Streptococcus pneumoniae CDC1873-00] >gi|168493211|ref|ZP_02717354.1| phosphatase YidA [Streptococcus pneumoniae CDC3059-06] >gi|147761345|gb|EDK68311.1| Cof family protein [Streptococcus pneumoniae SP18-BS74] >gi|172042284|gb|EDT50330.1| phosphatase YidA [Streptococcus pneumoniae CDC1873-00] >gi|183576537|gb|EDT97065.1| phosphatase YidA [Streptococcus pneumoniae CDC3059-06] (268 aa)
Score = 161, Expect = 2.1e-09, Identities = 66/263 (25%), Positives = 118/263 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N   +++  S    M   Y   +    +   K M + + E +   I +    F  +Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDQGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGTYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYERYSINK---SAPFYLELLTKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KTNDESGVAHAI 263
>gi|37678279|ref|NP_932888.1| hydrolase [Vibrio vulnificus YJ016] >gi|37197018|dbj|BAC92859.1| predicted hydrolase [Vibrio vulnificus YJ016] (276 aa)
Score = 160, Expect = 2.1e-09, Identities = 63/242 (26%), Positives = 116/242 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY-QDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTK 248
           K+V SD+DGTLL  +  + E S   +K + E+G  F   TGR   ++A +   +  I  Y   +I   GA+ ++ + ++   +  +  + ++ +I+   QD ++   +  N      +E+    +  E    T K +D+D   T+  +K+       D E++    N+  ++F  +  +     + P   E M   VSK + LK   +   LTL+N +AFGD  ND +M+  +  G+ M    +K K
  S:    12 KIVASDLDGTLLAPNHQLSEFSKQTLKALHEQGYTFIFATGRHHVDVAGIRA-QVGIPAY---MITSNGARVHD-QHDQLMYSKNVPAELVQPVIDIVKQDPEIFVHLYQNEDWRLNREDEVMRKFHEETGFTYKVYDIDNAPTDGIAKIFFTHPEQDHEHLVGFENQLREAFGDQLNIA---FSTPWCLEVMAAEVSKGDALKAVAESLGLTLENCVAFGDGMNDVEMLSMAGKGLVMETSHEKVK 250
>gi|168225628|ref|ZP_02650859.1| hypothetical protein Sententeric_07631 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168236779|ref|ZP_02661837.1| hypothetical protein Senteenterica_11362 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194734482|ref|YP_002113934.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194709984|gb|ACF89205.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (269 aa)
Score = 160, Expect = 2.1e-09, Identities = 73/263 (27%), Positives = 127/263 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKEN---------RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           + VVV+DMDGT LDD+K       +A  +++K++ + F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD         LNF        Y  K           +H  RL   +     Y D+D  L     K  +    E +P VI+  K   S   +  P+ +G    + + P + K NG+   LK +N +  NV+A GD+ ND +M+  +    AM N +D  K++++Y T+ DNN+ G  N I
  S:     3 VNVVVTDMDGTFLDDAKQYDRVRFMAQYQELKKRNIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKD-------KQLNFVACGLKSAYVSKNAPEAFVALMAKHYHRLQPVN----DYHDIDDILF----KFSLNLPDEQIPLVID--KLHVSLDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWNRSPQNVVAIGDSGNDAEMLKMAHYSFAMGNAADNIKALSRYHTD-DNNHQGALNVI 259
>gi|167464455|ref|ZP_02329544.1| Cof-like hydrolase [Paenibacillus larvae subsp. larvae BRL-230010] (267 aa)
Score = 160, Expect = 2.1e-09, Identities = 64/264 (24%), Positives = 126/264 (47%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNE----CKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           ++  D+DGTL++D   + E +  A++K  + G    LCTGR   +   +L    K  E   + I   GA   + + +E      + +F S + I+ ++ + ++  ++F +    ++Y  K       + E   +T + ++  + L  P  K  +  +   +   I +  +    Y   T + +G    + MH + SK N LK   + +++  + ++A G+  ND +M+  + +GVAM N  D  K  A+ +T   NN DG+   ++KY
  S:     5 IIALDVDGTLINDQFELTEGNKEAVRKAHKLGAKIVLCTGRGPASTLPLL----KELELEGYSINHNGAATIHSRGSEEPVLVHEFAF-SVNQIELLVRYCREHGVHFDVSTAFHMYVEKLTEEEKTVYEKFFLTPELYEDVLKLEIPLVKFTLAGEVAQVDR-IEKEWTESRIYGDLTMMRSGEFFIDVMHTDASKGNALKALAERWDVPPERIMAIGNYFNDLEMLAYAGLGVAMDNSPDAVKKAARVVT-GSNNEDGVREALMKY 265
>gi|168697623|ref|ZP_02729900.1| putative hydrolase [Clostridium difficile QCD-37x79] >gi|168725112|ref|ZP_02757389.1| putative hydrolase [Clostridium difficile QCD-76w55] >gi|168732970|ref|ZP_02765247.1| putative hydrolase [Clostridium difficile QCD-97b34] >gi|196160910|ref|ZP_03121471.1| putative hydrolase [Clostridium difficile CIP 107932] (270 aa)
Score = 160, Expect = 2.2e-09, Identities = 77/258 (29%), Positives = 124/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNM---ANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-------FGIPDNG------YLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD--KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++ +DMDGTL+     V E +I A+K+  EKG+   L TGR  N M    +VL D        D  I      ++ L   E KK   LS +AIK I    +  +LN         I +N       Y     +N+   R+   ++ + +       L E     ++ C    E + ++    + FK + ++   + +G I FE M    SK   +K       +    V+  GD +ND  MI  + +G+AM N +D+ KS+A ++T+  N NDG+
  S:     4 KLICTDMDGTLMGKGFEVSEENIKALKEAMEKGIKVALVTGRPYNAMKYFTSVLGD--------DIYIISTNGTYFKLMGYEYKKV--LSKEAIKKIYTIGEKYNLNKHFKGCKIVISNNEIGEEHPYRLINSKNKEEDRIEIIENASCET------LLEKADNEILKCILFSENVDSLREAKEEFKKQEDLEV-VSSGKINFEVMSKGTSKGIAVKKFCDILGIDSKEVICIGDNENDISMIKFAGLGIAMGNATDEVKSMADFVTDT-NVNDGV 261
>gi|163812345|ref|ZP_02204019.1| Cof-like hydrolase [Dehalococcoides sp. VS] >gi|157403999|gb|EDO70045.1| Cof-like hydrolase [Dehalococcoides sp. VS] (271 aa)
Score = 160, Expect = 2.2e-09, Identities = 66/249 (26%), Positives = 109/249 (43%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD-VYLTEPKSKVMIVCDKEYMPTVINRSKS--FKSKYE-------VGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           ++ V D+DGTL++    + E+   AI + +EKG+   L TGR       +L    K      F I C GA  YN  T +   +  LS + +   I+  ++  +   +      Y   EN  +    E+ H++    D   + L +   K+ ++     +     RS +  F S++E          P          + P VSK   L+       ++L NV+AFGD  ND  +   +  GVAM N   + K +A Y+T
  S:     5 QLAVIDVDGTLINKQGKISEADKKAISQAREKGITVALSTGRVVPACTYLL----KELSLDGFHIFCDGALVYNPDTAQTCYSQPLSREPLLSAIDFVREQSIYLELYTILDYYVEYENWSAKMHREFFHISPTVTDFKKIALRQDVQKIELM-----VHNTAERSGAELFMSRFEDDFHFSIARAPAYPEVEFVNVLSPGVSKGCALEKMAAQMGISLRNVIAFGDGSNDLPLFRAAGFGVAMGNARAELKEIADYVT 254
>gi|16759759|ref|NP_455376.1| hypothetical protein STY0881 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16764204|ref|NP_459819.1| putative hydrolase [Salmonella typhimurium LT2] >gi|29142468|ref|NP_805810.1| hypothetical protein t2047 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56414061|ref|YP_151136.1| HAD family hydrolase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161614902|ref|YP_001588867.1| hypothetical protein SPAB_02656 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167543013|ref|ZP_02338588.1| hypothetical protein Sentent_07044 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167556016|ref|ZP_02349032.1| hypothetical protein Sententeri_03974 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167992086|ref|ZP_02573184.1| hypothetical protein Sententer_01000011_0100011610 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168222172|ref|ZP_02647404.1| hypothetical protein Senterenterica_17377 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168230752|ref|ZP_02655810.1| hypothetical protein Sententerica_07236 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168263646|ref|ZP_02685619.1| hypothetical protein Salmentericaenterica_21427 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168466452|ref|ZP_02700314.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168476525|ref|ZP_02705548.1| hypothetical protein Salmoentericaenterica_17864 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168820003|ref|ZP_02832003.1| hypothetical protein Salentericaenterica_11511 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442260|ref|YP_002040081.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194469620|ref|ZP_03075604.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|25302461|pir||AF0602 conserved hypothetical protein STY0881 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16419349|gb|AAL19778.1| putative hydrolase of the HAD superfamily [Salmonella typhimurium LT2] >gi|16502052|emb|CAD05288.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138099|gb|AAO69670.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56128318|gb|AAV77824.1| putative hydrolase of the HAD superfamily [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161364266|gb|ABX68034.1| hypothetical protein SPAB_02656 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194400923|gb|ACF61145.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194455984|gb|EDX44823.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|195631058|gb|EDX49644.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Newport str. SL317] (269 aa)
Score = 160, Expect = 2.2e-09, Identities = 72/263 (27%), Positives = 127/263 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK---ENRHSIRLSEYDHMTA--KYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           + VVV+DMDGT LDD+K       +A  +++K++ + F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD         LNF        Y  K   E   ++    Y  +     Y D+D  L     K  +    E +P VI+  K   S   +  P+ +G    + + P + K NG+   LK +N +  NV+A GD+ ND +M+  +    AM N +D  K++++Y T+ DNN+ G  N I
  S:     3 VNVVVTDMDGTFLDDAKQYDRVRFMAQYQELKKRNIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKD-------KQLNFVACGLKSAYVSKNAPETFVALMAKHYHRLQPVNDYHDIDDILF----KFSLNLPDEQIPLVID--KLHVSLDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWNRSPQNVVAIGDSGNDAEMLKMAHYSFAMGNAADNIKALSRYHTD-DNNHQGALNVI 259
>gi|168219984|ref|ZP_02645216.1| predicted hydrolase [Salmonella enterica subsp. enterica serovar Agona str. SL483] (270 aa)
Score = 160, Expect = 2.2e-09, Identities = 70/259 (27%), Positives = 116/259 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINRS-----KSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           IK++  DMDGTLL     +  +   AI   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +    P V++R+        K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDE----PVVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGV 260
>gi|126700721|ref|YP_001089618.1| putative hydrolase [Clostridium difficile 630] >gi|115252158|emb|CAJ69996.1| putative hydrolase [Clostridium difficile 630] (273 aa)
Score = 160, Expect = 2.2e-09, Identities = 74/258 (28%), Positives = 124/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNM---ANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIP-------------DNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD--KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++ +DMDGTL+     V E +I A+K+  EKG+   L TGR  N M    +VL D        D  I      ++ L   E KK   LS +A+K I    +  +LN                 ++ Y     +N+   R+   ++ + +       L E     ++ C    E + ++    + FK + ++   + +G I FE M    SK   +K       +  + V+  GD +ND  MI  + +G+AM N +D+ KS+A ++T+  N NDG+
  S:     7 KLICTDMDGTLMGKGFEVSEENIKALKEAMEKGIKIALVTGRPYNAMKYFTSVLGD--------DIYIISTNGTYFKLLGYEYKKV--LSKEALKKIYTIGEKYNLNKHFKGCKIVISNNEIGEEHPYRLINSKNKEEDRIEIIENASCET------LLEKADNEILKCILFSENVDSLREAKEEFKKQEDLEV-VSSGKINFEVMSKGTSKGIAVKKFCDILGIDSEEVICIGDNENDISMIKFAGLGIAMGNATDEVKSMADFVTDT-NVNDGV 264
>gi|15804291|ref|NP_290330.1| sugar phosphatase [Escherichia coli O157:H7 EDL933] >gi|15833886|ref|NP_312659.1| sugar phosphatase [Escherichia coli O157:H7 str. Sakai] >gi|168709438|ref|ZP_02741715.1| predicted hydrolase [Escherichia coli O157:H7 str. EC4045] >gi|168716639|ref|ZP_02748916.1| predicted hydrolase [Escherichia coli O157:H7 str. EC4206] >gi|168735270|ref|ZP_02767547.1| predicted hydrolase [Escherichia coli O157:H7 str. EC4115] >gi|168748587|ref|ZP_02773609.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4113] >gi|168753586|ref|ZP_02778593.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4401] >gi|168759883|ref|ZP_02784890.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4501] >gi|168766184|ref|ZP_02791191.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4486] >gi|168772268|ref|ZP_02797275.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4196] >gi|168779919|ref|ZP_02804926.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4076] >gi|168785652|ref|ZP_02810659.1| phosphatase yidA [Escherichia coli O157:H7 str. EC869] >gi|168791015|ref|ZP_02816022.1| predicted hydrolase [Escherichia coli O157:H7 str. EC4042] >gi|168798732|ref|ZP_02823739.1| phosphatase yidA [Escherichia coli O157:H7 str. EC508] >gi|195936318|ref|ZP_03081700.1| sugar phosphatase [Escherichia coli O157:H7 str. EC4024] >gi|12518533|gb|AAG58894.1|AE005600_12 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|13364107|dbj|BAB38055.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|187771453|gb|EDU35297.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4196] >gi|188016918|gb|EDU55040.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4113] >gi|189002305|gb|EDU71291.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4076] >gi|189359121|gb|EDU77540.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4401] >gi|189364368|gb|EDU82787.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4486] >gi|189369906|gb|EDU88322.1| phosphatase yidA [Escherichia coli O157:H7 str. EC4501] >gi|189374434|gb|EDU92850.1| phosphatase yidA [Escherichia coli O157:H7 str. EC869] >gi|189378788|gb|EDU97204.1| phosphatase yidA [Escherichia coli O157:H7 str. EC508] (270 aa)
Score = 160, Expect = 2.3e-09, Identities = 70/266 (26%), Positives = 115/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   + +G+   L TGR    + N L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYL-KELHMEQPGDYCITYNGALVQKAADGNTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|168240715|ref|ZP_02665647.1| hypothetical protein Senterienterica_03725 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194451418|ref|YP_002044872.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194409722|gb|ACF69941.1| sugar phosphatase SupH [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (269 aa)
Score = 160, Expect = 2.3e-09, Identities = 72/263 (27%), Positives = 127/263 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK---ENRHSIRLSEYDHMTA--KYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           + VVV+DMDGT LDD+K       +A  +++K++ + F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD         LNF        Y  K   E   ++    Y  +     Y D+D  L     K  +    E +P VI+  K   S   +  P+ +G    + + P + K NG+   LK +N +  NV+A GD+ ND +M+  +    AM N +D  K++++Y T+ DNN+ G  N I
  S:     3 VNVVVTDMDGTFLDDAKQYDRVRFMAQYQELKKRNIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKD-------KQLNFVACGLKSAYVSKNAPETFVALMAKHYHRLQPVNDYHDIDDILF----KFSLNLPDEQIPLVID--KLHVSLDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWNRSPQNVVAIGDSGNDAEMLKMAHYSFAMGNAADNIKALSRYHTD-DNNHQGALNVI 259
>gi|34762234|ref|ZP_00143240.1| Hydrolase (HAD superfamily) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27888092|gb|EAA25152.1| Hydrolase (HAD superfamily) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (267 aa)
Score = 160, Expect = 2.3e-09, Identities = 75/266 (28%), Positives = 130/266 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHY--QDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD---VYLTEPKSKVMIVC-DKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQ---DNNNDGIYNFIVKYF 272
           K+VV DMDGTLL  S  + E +   IK+I++K + F + TGR   + A    D   +K Y   +I   GA+ ++   N     + +  + +K ++ +   +D+  N  + D+  + +  E      L E+   +   F++D    Y  E  +KV  +  DKE      N  K F++   +    V+     E+M   V+K   LK  LK  N+  + V+AFGD+ NDY+M+  S +G   + G+   + +      +   +NN DGI   +++ F
  S:     4 KLVVCDMDGTLLTSSHKISEYTANIIKQIEDKNVKFIIATGRPYLD-ARYYRDSLNLKSY---LITSNGARAHDEDNNPIVVEN-IPKELVKRLLTYNVGKDIHRNIYLNDDWIIEYEIEG-----LIEFHKESGYRFNIDDLNKYENEEAAKVFFLGKDKEIENLEKNMEKEFQNDLSI---TVSSSFCLEFMKKGVNKAETLKKVLKILNIEPEEVIAFGDSMNDYEML--SLVGKPFVMGNANQRLIDALPNVEVVGNNNEDGIGKKLIEIF 263
>gi|154684896|ref|YP_001420057.1| YcsE [Bacillus amyloliquefaciens FZB42] >gi|154350747|gb|ABS72826.1| YcsE [Bacillus amyloliquefaciens FZB42] (249 aa)
Score = 160, Expect = 2.4e-09, Identities = 67/258 (25%), Positives = 114/258 (44%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRD---ANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKY-FDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNN 261
           + IK++  DMDGTLL+D + + E +  AIK+ + KG+   + TGR       +A  L       E   F+I   G++ ++    E  +   L  D I+ + +     + NF       ++     R     +  DH   K+ F+++              D E    V+   K +K + E+     + PI  E     ++K   L    +    T++NV+A GD+ ND  MI  + +GVAM N  D  K  A ++T+ +  N
  S:     8 ADIKLIAIDMDGTLLNDEQLIPEENRRAIKEAEAKGIHVVISTGRTLMTCRELAESL-------ELSSFLITANGSEIWD-SDFELVERKLLHTDHIQKLWDLRNKHNTNFWASTVDRVW-----RGEFPETITDHQWLKFGFEIE--------------DDEVRNEVLKELKEYK-ELEITN---SSPINIEVNALGINKAAALAKVSEKLGFTMENVMAMGDSLNDIAMIEKAGVGVAMGNAQDIVKETADWVTDVNTEN 238
>gi|41393670|gb|AAS02075.1| hydrolase [Borrelia miyamotoi] (278 aa)
Score = 160, Expect = 2.4e-09, Identities = 75/271 (27%), Positives = 141/271 (52%)
  Q:     2 DISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIIN-HYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVIN--RSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKS--VAQYITEQDNNNDGIYNFIVKYF 272
           +  + KV+V D+DGTLL+++  +   ++  + K+K+   +  + TGR    +++VL+   ++K    +II   GA+ + LK N   +   ++ D +K+I+N +   +D+N    ++   Y  +E R  I     +++  K   VD+ L E  S   +VC   + P+ +   R+K     ++      +   L E    + SK N +K       +++D +LAFGD  NDY+M+ N   G+ M N ++  KS      IT+ DN+ DG+  F++++F
  S:     4 NFKKYKVLVFDLDGTLLNNNHEITPLTLKVLLKLKDDFHII-IATGRKLYEVSDVLVQLKEVKIDEGYIITANGAEVF-LKNNLILRHK-MNYDVVKEILNINRAGIDINLYTLND--WYSDREIRSPIMNYFIENLGVKPIIVDLSLLEVDSFSKVVC-YSHDPSKLEEFRNKIQDKNFKDINLFYSSQDLLEITSIDASKYNAVKNVALFECISMDAILAFGDNGNDYEMLKNVGKGIIMKNANEFVKSNLPNNEITKFDNDEDGVAKFLIEFF 273
>gi|154483387|ref|ZP_02025835.1| hypothetical protein EUBVEN_01090 [Eubacterium ventriosum ATCC 27560] >gi|149735897|gb|EDM51783.1| hypothetical protein EUBVEN_01090 [Eubacterium ventriosum ATCC 27560] (273 aa)
Score = 160, Expect = 2.4e-09, Identities = 71/270 (26%), Positives = 113/270 (41%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIG------CGGAQFYNLKTNECKKTSFLSGDAIKDI--INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHM----TAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +S+ K++  DMDGTLL+  K +   ++ AI+K   +G    L TGR             +++EY D I G        GA  Y+L+  E    + +  + I  +  I    D+ +     +        +N     L+ Y  +      K  +V  Y  +       +      P     +K   SKY++         L E    NV+K  GL          ++  +  GDA+ND D I  + +GVAM N  DK K +A  + E D ++ G    I KY 
  S:     1 MSEYKLIGLDMDGTLLNSKKKITPENMAAIEKAFSQGKEVVLSTGRSVA----------ELREYTDIIKGLKYLVCTSGAMVYDLEKEETIYCAPIPNEVIDKVSEIAETSDVMVILQTTEAIAKKTDLDNLEHFHLNVYKELLNSVATKVDNVFEYCKQKGQSASKINIYHSTPEAREVTKKILSKYDLVFNYAEENSL-EVSPANVTKGTGLTWLCNHLGFGINKAIDVGDAENDIDAIATAGLGVAMANAIDKVKEIADVVLENDCDHSGCAEAIEKYL 271
>gi|195978484|ref|YP_002123728.1| hydrolase HAD superfamily [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975189|gb|ACG62715.1| hydrolase HAD superfamily [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (275 aa)
Score = 160, Expect = 2.5e-09, Identities = 77/269 (28%), Positives = 129/269 (47%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTA---KYFDVDVYLTEPK----SKVMIVCDKEYMPTVINR--SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           ++++K++  D+DGTL +  K V + +  A+   KEKG+   + TGR    + N+L +   + E    I   GG    N  T      S LS   + DI      + L   +  +G +Y    N    R S+Y H+ +    +  +  +   PK    +K++ V D    P V++R  ++  K+ +E      +  I+FE M   + K  GL +  +   L   +V+A GD  ND+ M+  + +GVAM N  D+ K VA  +T   N+  G+   I KY
  S:     1 MTRVKLLALDLDGTLYNTEKIVSDENKKALAAAKEKGVKVVITTGRPLKAIGNLLEELDLLGEENYSITFNGGLVQRN--TGHILDKSALSLAEVYDIHQQLAAVGLPTDVISDGTVYSLSGNDG--RRSQY-HLASPLLNFVSLKSFAELPKDITYNKIVTVTD----PKVLDRQLARLPKAIFEDFEAFKSRDIIFEIMPKGIHKAFGLDLLCQHLGLEAKHVMAMGDEANDFSMLQWAGLGVAMANAVDQAKEVADAVTTLTNDQSGVAEAIWKY 269
>gi|168464839|ref|ZP_02698731.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195632390|gb|EDX50874.1| phosphatase YidA [Salmonella enterica subsp. enterica serovar Newport str. SL317] (281 aa)
Score = 160, Expect = 2.5e-09, Identities = 70/266 (26%), Positives = 116/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   +I   +EKG+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R     K KY V   L + P   E +   V+K  G+K   +   +  + V+A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I K+
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNSIAAAREKGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRYLEKLSREVGSHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEPAVLDRAIARIPAEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLAEALGIKPEEVMAIGDQENDIAMIEYAGMGVAMDNAIPSVKEVANFVT-KSNLEDGVAWAIEKF 267
>gi|144575440|gb|AAZ53803.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (298 aa)
Score = 159, Expect = 2.8e-09, Identities = 78/270 (28%), Positives = 126/270 (46%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIK--EKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF-IIGCGGAQFYNLKTNECK-KTSFLSGDA--IKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI----------RLSEYDHMTAKYFDVDVYLTEPKSKVMIV----CDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++QI  +V D+DGTLL     +   +   I  ++  EK   F  CTGR         I K+  +   D+ +I C G+  Y+ K NE   K +FL      I +I+  YQ + L +       L F K+N+ S             S+ + +   ++D      +   K+ +V       +  P +  ++ S   K E    + +   + + M    +K  GLK   +++ L LD  + FGDA ND  M   +K  VAM       K VA +IT + N+ DGI  F+ K +
  S:    16 LAQIDNIVFDLDGTLLTSDHEISLRTKAFIDWLQGLEKPKKFIFCTGRPW-----YFIKKYYYQVKPDYPVISCNGSLIYDFKKNEVVFKKTFLPEKVGKIFEILLKYQVVFLVY--TTTKMLAFSKKNQKSSWFTYLRSQNKNFSKAEKLPLTFYDYQELTKKELEKLDVVKFLLIKIDSDPKLFQKASSELEKIEDIYLVQSQEKVIDIMSQGSNKGEGLKFLAQNYQLNLDRSIVFGDAKNDLPMFAIAKYSVAMGQADQSLKEVATFIT-KSNDQDGIPEFLAKCY 297
>gi|161503988|ref|YP_001571100.1| hypothetical protein SARI_02081 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160865335|gb|ABX21958.1| hypothetical protein SARI_02081 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (281 aa)
Score = 159, Expect = 2.9e-09, Identities = 70/263 (26%), Positives = 128/263 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           + VVV+DMDGT LDD+K       +A  +++K++ + F + +G     + +   +   +K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    +   ++   PD    +     +H  RL         Y D+D  L     K  +    E +P VI+  K   S   +  P+ +G    + + P + K NG+   LK +N +  NV+A GD+ ND +M+  +    AM N +D  K++++Y T+ DNN+ G  N I
  S:    15 VNVVVTDMDGTFLDDAKQYDRVRFMAQYQEMKKRNIEFVVASGNQYYQLISFFPE---LKDEISFVAENGALVYEHGNQLFHGELTR-HESRIVIGELLKDKQLNFVACGLKSAYVSENAPDT---FVALMAKHYHRLQP----VKDYHDIDDILF----KFSLNLPDEQIPLVID--KLHISLDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWNRSPQNVVAIGDSGNDAEMLKMAHYSFAMGNAADNIKALSRYHTD-DNNHQGALNVI 271
>gi|1418999|emb|CAA66889.1| unnamed protein product [Lactobacillus sakei] (280 aa)
Score = 159, Expect = 2.9e-09, Identities = 69/266 (25%), Positives = 121/266 (45%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKE-----NRHSIRLSE------YDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +V SD+DGTL+ D + V   +   I++++++ ++F + TGR   N+  V+  +         II   GA F N + +        +  A  +I      L  +F   D  Y  + +E      R +  L+       YD +     D+D  L      +  V   +  P ++   K + ++ +V     +GP   E +   + K   ++       +  D+   FGD  ND  M+  +K  VAM N   + K+VA Y+TE  N NDG+  F+ K+F+
  S:     5 LVFSDIDGTLVIDHQIVTPFTKRVIRELQQRDVIFYIATGR-MYNLGKVIARQINDDAR---IIASNGAVFENEQGSVQHHLGHPALKAAYEITQSDPRLSAHFFTTDAAY--YTREIPRFVARDAGNLTSMGAEIAYDSVN----DLDTLLAMSNQIINGVIVAKGEPALLASVKQYLAEQDVMNLSSSGPDNIELIPKGIDKATAIRQIQTLHGIDADHTFVFGDGQNDLGMLQAAKYSVAMGNALPEVKAVANYVTES-NVNDGVAKFLQKHFE 270
>gi|148322993|gb|EDK88243.1| possible HAD superfamily hydrolase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (266 aa)
Score = 159, Expect = 3.0e-09, Identities = 77/266 (28%), Positives = 129/266 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTS--------FLSGDAIKDI-INHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTV-INRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTK---SVAQYITEQDNNNDGIYNFIVKYF 272
           K+VV DMDGTLL  +  + + +   IKKI++ G+ F + TGR   DA +  + L       E   ++I   GA+ ++   N     +         L+ +  KDI  N Y + D       +G + F KE+ +   +           D++ Y  E  +KV  +   E +  +  N  K F++   +    V+ P   E+M   V+K   LK  LK  N+  + V+AFGD+ NDY+M+  S +G   I G+   +   ++       +NN DGI   +++ F
  S:     4 KLVVCDMDGTLLTSNHRISDYTADIIKKIEDNGIKFMIATGRPYLDARHYRDSL-------ELKSYLITSNGARAHDEDNNPIVVENIPKEYVKRLLAYNVGKDIHRNIYLNDDWIIEYEIDGLVEFHKESGYGFNID----------DLNKYENEEVAKVFFLGKNEDIENLEKNMEKEFQNDLSI---TVSSPFCLEFMKKGVNKAETLKKVLKLLNIKSEEVIAFGDSMNDYEML--SLVGKPFIMGNGNKRLMEALPNVEVVGNNNEDGIGKKLIEIF 263
>gi|91227521|ref|ZP_01261858.1| hypothetical protein V12G01_09737 [Vibrio alginolyticus 12G01] >gi|91188545|gb|EAS74837.1| hypothetical protein V12G01_09737 [Vibrio alginolyticus 12G01] (274 aa)
Score = 159, Expect = 3.0e-09, Identities = 73/251 (29%), Positives = 122/251 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN----LKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVC---DKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAM---------------INGSDKTKSVAQYITEQ 257
           K+V SD+DGTLL  +  +   S   +K + EKG  F   TGR   ++A++   +  I  Y   +I   GA+ ++    L  +E      + G  + D I H Q++ ++    D+   +   ++  ++R   +D  T   FD D   T+  +KV       D E +    N+  + F  K  +     + P   E M   VSK + L+   K  +LTL+N +AFGD  ND +M+  +  G+ M               + GS+   +VA Y+ E 
  S:    12 KIVASDLDGTLLAPNHQLSAYSKETLKALHEKGYTFVFATGRHHVDVASIR-RQVGIPAY---MITSNGARVHDQEDQLMYSENVPAELVQG--VIDTIKHDQEILIHMYQNDS---WLMNKDDETLR-DFHDEFTYVLFDEDQAPTDGIAKVFFTHPGEDHERLVVFENKLREQFGDKLNIA---FSTPWCLEVMSAGVSKGHALEAVAKKLDLTLENCVAFGDGMNDVEMLSMAGKGLVMGTSHEKVMKALPNNEVIGSNAEDAVAHYLQEH 272
>gi|125624611|ref|YP_001033094.1| hypothetical protein llmg_1822 [Lactococcus lactis subsp. cremoris MG1363] >gi|124493419|emb|CAL98393.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] (462 aa)
Score = 159, Expect = 3.4e-09, Identities = 69/259 (26%), Positives = 125/259 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINH----YQDLDLN--FGIPDNGYLYFPKENRHS----IRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYM---PTVINRSKSFKSKYEVGTPLVT--GPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           IK V  D+DGTL   ++ V  S+  AI+++++K +  G+ TGR    +  +L D       +DF +   G   +  K  E    + L    +K ++N+    + D+ L    G+  +G L F +    S    +  S    +    F   +    P++  +   ++E++     V  R+++ + +      LVT   P   + +  +  K  G++   + F   L+ V+ FGD++ND  M+     G+AM N   + K VA Y+T+  NN DGI
  S:     3 IKAVFFDLDGTLFTSTRGVATSTRKAIQELRQKDIFVGIATGRGPAFVMPLLEDL-----DLDFAVTYNGQYIFTPK--EVIFQNPLEQKTLKKLMNYATENHSDISLGTAHGVNGSGLLKFGETRLASFLSGVLPSGTSGVARNSFKHVIRRVLPQNSKLADNEEEFIYQAMMVATRNETARLQEAFPELLVTRSNPYSVDLISESGGKLPGIQRLGERFGFNLEQVMCFGDSENDLTMVSGVGCGIAMGNAVAEVKKVATYVTDT-NNQDGI 268
>gi|153830017|ref|ZP_01982684.1| conserved hypothetical protein [Vibrio cholerae 623-39] >gi|148874502|gb|EDL72637.1| conserved hypothetical protein [Vibrio cholerae 623-39] (275 aa)
Score = 159, Expect = 3.5e-09, Identities = 67/240 (27%), Positives = 118/240 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGD---AIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYM---PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDK 246
           K+V SD+DGTLL  +  + E S   +K++ +KG  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +  D   AI D++ H + L ++    D   L   KE+       E    T + FDV+   T+  +K+       D E++    T++N  + F  K  V     + P   E M   VSK + L+   +  +L+L+N +AFGD  ND +M+  +  G+ M    +K
  S:    11 KIVASDLDGTLLAPNHQLSEFSKQTLKQLHDKGFTFIFATGRHHIDVAGIR----EIAGIPAYMITSNGARVHD-QNDQLMYSKNVPQDLVQAIIDVVKHDEQLFVHLYRNDEWML--NKEDEILRDFHEDSGFTYRVFDVNNAPTDGIAKIFFTQEDQDHEHLVQYETLLN--QRFGDKLNVA---FSTPWCLEVMCAGVSKGDALQAVAESLHLSLENCIAFGDGMNDVEMLSMAGKGLVMGTAHEK 247
>gi|149002666|ref|ZP_01827598.1| hypothetical protein CGSSp14BS69_04578 [Streptococcus pneumoniae SP14-BS69] >gi|147759277|gb|EDK66270.1| hypothetical protein CGSSp14BS69_04578 [Streptococcus pneumoniae SP14-BS69] (268 aa)
Score = 159, Expect = 3.5e-09, Identities = 66/263 (25%), Positives = 117/263 (44%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----------GIPDNGYLYFPKEN--RHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           IK++  D+DGTL++  K +      AI+  KE G+   + TGR    +A  L+D  ++++  D+++   GA      T           + I + + +   LD+ F           I  +G +Y    N   +++  S    M   Y   +    +   K M + + E +   I +    F   Y +     + P   E +  NV K + +    +   LT D  +A GD +ND  M+      V M NG+ + K +A+YIT + N+  G+ + I
  S:     3 IKLIAVDIDGTLVNSQKEITPEVFSAIQDAKEAGVKVVIATGRPIAGVAK-LLDDLQLRDQGDYVVTFNGALVQETATGH---------EIISESLTYEDYLDMEFLSRKLGVHMHAITKDG-IYTANRNIGTYTVHESTLVSMPIFYRTPEEMAGKEIVKCMFIDEPEILDAAIEKIPAEFYEHYSINK---SAPFYLELLKKNVDKGSAITHLAEKLGLTKDETMAIGDEENDRAMLEVVGNPVVMENGNPEIKKIAKYIT-KSNDESGVAHAI 263
>gi|152969432|ref|YP_001334541.1| hypothetical protein KPN_00875 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954281|gb|ABR76311.1| conserved protein, phophatase-like domain [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (270 aa)
Score = 158, Expect = 3.9e-09, Identities = 70/265 (26%), Positives = 122/265 (46%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYF------DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           IK++  DMDGT L D+K       LA  ++++E+ + F + +G     + +   +   I   + F+   GG   + +  NE      L       +++H Q L  N  I   G       NR++  L     + AKY+      D   +L +   K  +      +P +  + K   +  ++ T + TG    + + P V K NGL+I  + + +    V+AFGD+ ND +M+ ++  G AM N  +  K+VA+Y     NN +G+   I K
  S:     3 IKLIAVDMDGTFLSDAKTYNRPRFLAQYQRMREQNIRFVVASGNQYYQLISFFPE---IAHQIAFVAENGG---WVVSGNEDVFNCQLPVHHFNAVVDHLQTLP-NIEIIACGKRSAYTLNRYNDALKT---VAAKYYHRLELVDDFNHLDDTILKFGLNVPDSLIPEI--QPKLHATLGDMVTAVATGYGSIDLIIPGVHKANGLRILQQRWGIEDHEVVAFGDSGNDIEMLQHAGFGFAMANAREDVKAVARYQAPH-NNEEGVLQIIDK 261
>gi|50235450|gb|AAT70834.1| conserved hypothetical protein [Borrelia hermsii] (296 aa)
Score = 158, Expect = 3.9e-09, Identities = 73/266 (27%), Positives = 136/266 (51%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIIN----HYQDL-----------------DLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPK----SKVMIVCDKE-----YMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQD-NNNDGIYNFI 268
           +  IK VVSD+DGTLL  +  +   S L I K+ ++     + TGR  N +  ++ +   +  +V F I   GA+ YN +     +   LS + + +I+N     Y+D+                 ++     +N +       +H     E   ++ KY +++ +         +K++++  +E     Y   ++ + +   + Y      V+ P   E ++  VSK N LK  L+  N+ L+ V+AFGD  ND DM+ N K G+ M N + + K +  Y+   D N+N+ + ++I
  S:     1 MKNIKAVVSDLDGTLLLSNIQIGAFSELVITKLIKENKKCIIATGRSKNEIIPLIEN---LSSHVSFFITLNGARVYNNQWQLISRYD-LSSEIVNEILNLRESKYKDIPHFLQKSEDIDEKLYADNITKNAINNMFEKHELLRKHKYIEHELKDISIKYHEINNFREFKNFNNIAKILLLHHEEAQLIKYEAIILEKYRKEINAY------VSTPHSLEIVNSRVSKGNALKDVLQSININLNEVIAFGDGFNDVDMLENVKKGLLMGNANYRLKKMLSYLEIIDTNDNEAVAHYI 287
>gi|147669668|ref|YP_001214486.1| Cof-like hydrolase [Dehalococcoides sp. BAV1] >gi|146270616|gb|ABQ17608.1| Cof-like hydrolase [Dehalococcoides sp. BAV1] (271 aa)
Score = 158, Expect = 4.2e-09, Identities = 70/249 (28%), Positives = 113/249 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNE-CKKTSFLSG---DAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVD-VYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYE-------VGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT 255
           ++ V D+DGTL++    +  +   AI K ++KG+L  L TGR        L+++  +     F I C GA  YN  T + C       G    AI+ +  H   L+L + I D    Y   EN  +    E+  ++    D   V LT+   K+ ++   +   T    ++ F S++E          P          + P +SK   L+       ++L NV+AFGD  ND  +   +  GVAM N   + K +A Y+T
  S:     5 QLAVIDVDGTLINKQGKISAADKEAIGKARDKGILVALSTGR-VVPACTYLLEELGLD---GFHIFCDGALVYNPATAQTCYSQPLCQGPLLSAIEFVREHNIYLEL-YTILD---YYVEYENWSAKMHREFFRISPTVTDFKKVALTQDVQKIELMVHDQ---TERRGAELFMSRFEDDFHFSIARAPAYPEVEFVNIVSPGISKGRALEKMAAQMGISLRNVIAFGDGSNDLPLFRAAGFGVAMGNARAELKEIADYVT 254
>gi|160942241|ref|ZP_02089550.1| hypothetical protein CLOBOL_07127 [Clostridium bolteae ATCC BAA-613] >gi|158434798|gb|EDP12565.1| hypothetical protein CLOBOL_07127 [Clostridium bolteae ATCC BAA-613] (269 aa)
Score = 158, Expect = 4.4e-09, Identities = 66/265 (24%), Positives = 122/265 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK-ENRHSIRLSEYDHMTAKYF-DVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSK-YEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++V D+DGTL +  K +   +  A+   +E G +  L +GR    +   L  + ++  +  +I+   G    N KT E   +S L  ++ + II   ++  ++    +   +     E  ++I  S  +H+  +   D+  Y+     K +++ D +Y+ TV  + K+   + + V     + P   E M   + K   L   L+   L  + ++A GD  ND  MI  + +GVAM N     +  A YIT   NN+DG+   + K+
  S:     4 KIIVLDLDGTLTNRDKIITPRTKEALMNAQEAGNVVVLASGRPTAGV-EPLARELELSRFGSYILSYNGGMITNCKTGETVFSSLLPRESNQKIIGLAEEHRVDILTYEGEEIITNNVECPYAIAESNINHLPLRQVEDMKSYVDFKVPKFLMLDDGDYLVTVEPKVKAAMGRDFSV---YRSEPYFLEIMPKGIDKARSLARLLEVLGLDREQMIACGDGYNDLTMIKYAGLGVAMENAVLPVRQAADYITAS-NNHDGVGLVVEKF 266
>gi|168139436|ref|ZP_02582665.1| hydrolase (HAD superfamily) protein [Bacillus cereus G9842] (283 aa)
Score = 157, Expect = 4.7e-09, Identities = 69/266 (25%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+  +E G +  +CTGR   ++  +L++       VD    II   GA  Y  K  +  K   +      +I+ + ++  L + +  +  +Y P     S+R              L E   + A Y +   + +    K ++  D    + +P    I + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ +Y T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRTCQEAGHVVAICTGRSIVDIERLLLE-------VDLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVEYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEYVKNSKENFDLKELKTIAALYLEHTAFHSAESCKPIVETDIHVHKLLPFSYDIEKLKKLKETFIHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEYLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKTICKYET-LSNEEHGVAHALYKY 281
>gi|167764090|ref|ZP_02436217.1| hypothetical protein BACSTE_02473 [Bacteroides stercoris ATCC 43183] >gi|167698206|gb|EDS14785.1| hypothetical protein BACSTE_02473 [Bacteroides stercoris ATCC 43183] (273 aa)
Score = 157, Expect = 4.7e-09, Identities = 62/266 (23%), Positives = 118/266 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEY-DHMTAKYFDVDVYLTE---PKSKVMIVCDKE-YMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +++V D+DGTL +  K +   ++  + ++++ G+   L +GR    +   L ++ ++KE   +I+   G +  +  T E    + L  D +  +     D        DN  +     N   ++   + + M  +   V+ +L E   P  K +IV + E  M T    S   + +  V     + P   E +   + K   + +  +   +T + V A GD  ND  MI  + +G+AM N  +  K+ A YI    N+ DG+   + +YF
  S:     6 RLLVLDLDGTLTNSKKEISPRNLRTLLRLQQSGVRLVLASGRPTYGIVP-LAEQLQMKENNGYILSYNGGEIIDWSTGELLYKNLLPDDVLPILYQTATDNRQTILTYDNECILTENPNDPYVQKEAFLNKMQVR--RVENFLQEIPLPLPKCLIVGEPEQLMKTEAELSLRLQRQISV---YRSEPYFLELVPLGIDKARSIAVLSEKLGITREEVAAMGDGYNDLSMIKYAGLGIAMDNAQEPVKAAADYIAPS-NDEDGVAIAVERYF 269
>gi|154503004|ref|ZP_02040064.1| hypothetical protein RUMGNA_00826 [Ruminococcus gnavus ATCC 29149] >gi|153796358|gb|EDN78778.1| hypothetical protein RUMGNA_00826 [Ruminococcus gnavus ATCC 29149] (257 aa)
Score = 157, Expect = 4.9e-09, Identities = 69/268 (25%), Positives = 122/268 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGI-PDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD----------KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           I+++ SD+DGTLL    ++ E +I  IK+ +  G+ +   TGR ++  A  +++ + +    D+I+   GA+F +   N  K  + +  D  + +       +L F I  D G      +   ++ L+EY       ++          K+++ CD          + Y  + ++   SF++  EV +      I+             LK A+K F    + V+ FGD +ND  M        AMING D  K +A  +TE  N+ DG+   + K  K
  S:     2 IRMIASDLDGTLLRKDWSISEYTIKIIKEAQASGIRWVTVTGR-SDRGARPIMENYGLS--CDYIL-MNGAEFRDTNGNLIKSEN-IDTDLARFVCEKLHRENLGFEINTDRG------DYTTTMELAEYSDYLEDGYEKLFEEKHNIRKILVFCDDIPKIRRIKQQIYDASGLSVLSSFENNMEVTSQKAKKGIM-------------LKQAMKHFGFLPEEVVVFGDGENDISMFQEFPCSYAMINGVDALKELAYRVTEYSNDEDGVAKTLEKILK 256
>gi|116629736|ref|YP_814908.1| HAD superfamily hydrolase [Lactobacillus gasseri ATCC 33323] >gi|116095318|gb|ABJ60470.1| Predicted hydrolase of the HAD superfamily [Lactobacillus gasseri ATCC 33323] (273 aa)
Score = 157, Expect = 5.0e-09, Identities = 74/271 (27%), Positives = 120/271 (44%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYD--HMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +++IKV+  D+DGTLL+  K +      AI   ++ G+   + TGR  + +  +L +     +  ++++  GG        N   +   L+ D   D+      L L+F       +Y    +     L E +  ++   Y         P  K M V +++Y+   I     F    +  T   T P  +E     VSK N LK   +  NLT +N++A GD +ND  MI  + IGVAM N     K  AQ IT +D ++DG+   I K  +
  S:     1 MNEIKVIAIDVDGTLLNSKKQLTRGVKNAILMARKAGIKIVIATGRPLSGVKQILHELDLANQNDEYVVCFGGGVVVTTSGNVLFEKQ-LTYDNYLDLETIALKLGLHFHASAPDRIYTADRDIGDFTLYEANLVNLGISYRTPAEMKNIPIIKCMYVDEQKYLDKKIADHMPFAHLDDKITFTKTAPFYYEANPKGVSKGNALKFLCQKLNLTSENIMAIGDEENDLSMIKYAGIGVAMGNAVTLVKDNAQMIT-KDCDHDGVAAAIEKVLQ 271
>gi|196164581|ref|ZP_03125112.1| putative hydrolase [Clostridium difficile QCD-23m63] (273 aa)
Score = 157, Expect = 5.5e-09, Identities = 74/267 (27%), Positives = 131/267 (49%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYN-----LKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTE--PKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           K++V+DMDGTLL ++  V + +  A++K+ + G+   L TGR A + A   +D   +KE +  II C G+         + +N+   T+ L+   I D+++ Y   D+ +       +   K      RLS +     +    D    E   K  +  V  +E  P++++  +    K +      + P   E M+  V K N +KI  +  N+  ++++AFGD  ND +MI  + +GVAM N  +  K  A Y+T+  N + G+   I K+ +
  S:     4 KLIVTDMDGTLLGNNHKVTDENKTALQKVIKNGINVTLATGR-AFDSAKCNVDF--LKEDMP-IIACNGSLIREQNGNIIYSNKIDTTTCLN---ILDVLDKY---DIYYQCNSIDSMLSKKIEGREDRLSVFLGSETEVIIRDDLREEIFKKDILKFVIIEEKNPSILDEIRKELRKVQGIKITSSWPNNIEVMNEGVDKGNAVKILAEKMNIDREDIIAFGDNYNDIEMIKFAGLGVAMGNAEELIKQEADYVTDT-NQDSGVAKAIYKFLE 266
>gi|194531345|ref|YP_002066806.1| conserved hypothetical protein, putative [Vibrio cholerae MO10] >gi|125617273|gb|EAZ45848.1| conserved hypothetical protein, putative [Vibrio cholerae MO10] (312 aa)
Score = 157, Expect = 5.6e-09, Identities = 67/240 (27%), Positives = 115/240 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGD---AIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYM---PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDK 246
           K+V SD+DGTLL  +  + E S   +K++ +KG  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +  D   AI D++ H  D  L   +  N      KE+       E    T + FDV+   T+  +K+       D E++    T++N  + F  K  V     + P   E M   VSK + L+   +  +L L+N +AFGD  ND +M+  +  G+ M    +K
  S:    48 KIVASDLDGTLLAPNHQLSEFSKQTLKQLHDKGFTFIFATGRHHIDVAGIR----EIAGIPAYMITSNGARVHD-QNDQLMYSKNVPQDLVQAIIDVVKH--DKQLFVHLYRNDEWMLNKEDEILRDFHEDSGFTYRVFDVNNAPTDGIAKIFFTQEDQDHEHLVQYETLLN--QRFGDKLNVA---FSTPWCLEVMCAGVSKGDALQAVAESLHLGLENCIAFGDGMNDVEMLSMAGKGLVMGTAHEK 284
>gi|139438888|ref|ZP_01772348.1| Hypothetical protein COLAER_01352 [Collinsella aerofaciens ATCC 25986] >gi|133775599|gb|EBA39419.1| Hypothetical protein COLAER_01352 [Collinsella aerofaciens ATCC 25986] (264 aa)
Score = 157, Expect = 5.8e-09, Identities = 60/248 (24%), Positives = 110/248 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVM---IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGP---ILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYI 254
           K++ SDMDGTLLD++  V   +   I  + E G+ F   +GR  + +         +++ +DF+   G   + + K  + +  S L+   +   +  + +L L   + D    +   +    +R  + D   A+       L +P   ++   I CD   +        ++  + E+G      P      + M P VSK +G+    + + +  D V+AFGD+ NDY++I     G AM N     K+VA  +
  S:     3 KLIASDMDGTLLDENGQVPPETYELILALHEHGVHFAASSGRRYDRLCEFFA---PVRDKMDFVAANGAQVYADGKMVDREVYSHLAIRRLAQAVRTFPNLHL--ALFDRTKSFLLDDECKFVREVDKDLPNAERI---WELPDPSVNIIKASIFCDDSAV-----MDSAYVLQRELGQLFTFAPSGNAWIDAMQPGVSKASGIAQLAEHYGIGRDEVMAFGDSMNDYEIIRFVGTGCAMENARPALKAVADRV 243
>gi|118444958|ref|YP_878920.1| Cof-like hydrolase [Clostridium novyi NT] >gi|118135414|gb|ABK62458.1| Cof-like hydrolase [Clostridium novyi NT] (269 aa)
Score = 157, Expect = 5.9e-09, Identities = 70/266 (26%), Positives = 126/266 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFG-IPDNGYLYFPKE-NRHSIRLSEYDHMTAKYFDV--DVYLTEPKSKVMIVCDKEYMPTVI-NRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K++  DMDGTLL+  K V + +I  I +  ++G+   +CTGR  + +     +    K+  ++II   G+   N    +     +L+ +    I+++ +D ++    + D  YL +  E N    R ++    T K FD   D        K+MI+ +   +  +I N  K+  +   V   + + P L E M  NV K  GL    +  N+   +++  GD  ND  M   + +GVAM N + + K +A +IT  ++ N    ++ + YF
  S:     3 KLIAIDMDGTLLNSDKKVSKENIATINEAMKRGIRVAICTGRPYSGIEPYAKEIGLCKDD-EYIISQNGSYVSNGNDTKTISAKYLNVEETNKILSYLEDKEIGVVLVTDKDYLAYNCEINEEMKRDADLVFKTIKMFDKSKDSIENLKLVKIMIMDNSHKIDNIIENMDKNIINSCYV---VRSMPYLIEIMAKNVDKGYGLSKLAEHLNIDHKDIMVIGDELNDIGMFKVAGLGVAMANANIEIKRLADFITLSNDENG--VSYAIDYF 267
>gi|167854890|ref|ZP_02477666.1| hypothetical protein HPS_05458 [Haemophilus parasuis 29755] >gi|167853957|gb|EDS25195.1| hypothetical protein HPS_05458 [Haemophilus parasuis 29755] (269 aa)
Score = 157, Expect = 6.0e-09, Identities = 70/253 (27%), Positives = 117/253 (46%)
  Q:     6 IKVVVSDMDGTLL--DDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPK---ENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKS--------KYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYIT---EQD 258
           IK+V  D+D TL    +++  L  S   + +++ KG++  + TGR        +      K +  F+   G    YNL  ++      L+ + I+ I+   Q L + +       +   K   E   S+R  + D++     D + YL     ++++   +E    VI RS   +         KY V           + ++ N SK  G++  L  F   ++N +AFGD  ND +MI     GVAM N  D+ K+VA Y+T   EQD
  S:     8 IKIVFFDIDETLYYKKETRIPLSISEQVLPRLRAKGIIPAIATGRTYGAFPKAIKPLMNEKGFDLFVTTNGQ---YNLYRDQVISEYPLTTERIERILAKLQALQIEYAFVTAEQIAVSKNTAEVEESLRPIKEDYIV----DPNFYLDHSVIQLLVFFPQERTEEVI-RSGILEDDLKEVRWHKYSV-----------DLLNKNNSKARGIQDVLNHFGFGIENAMAFGDGLNDLEMIATVGFGVAMGNAEDELKAVADYVTLPIEQD 257
>gi|144227627|gb|AAZ44519.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (298 aa)
Score = 157, Expect = 6.0e-09, Identities = 77/270 (28%), Positives = 126/270 (46%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIK--EKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF-IIGCGGAQFYNLKTNECK-KTSFLSGDA--IKDIINHYQDLDLNFGIPDNGYLYFPKENRHSI----------RLSEYDHMTAKYFDVDVYLTEPKSKVMIV----CDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           ++QI  +V D+DGTLL     +   +   I  ++  EK   F  C+GR         I K+  +   D+ +I C G+  Y+ K NE   K +FL      I +I+  YQ + L +       L F K+N+ S             S+ + +   ++D      +   K+ +V       +  P +  ++ S   K E    + +   + + M    +K  GLK   +++ L LD  + FGDA ND  M   +K  VAM       K VA +IT + N+ DGI  F+ K +
  S:    16 LAQIDNIVFDLDGTLLTSDHEISLRTKAFIDWLQGLEKPKKFIFCSGRPW-----YFIKKYYYQVKPDYPVISCNGSLIYDFKKNEVVFKKTFLPEKVGKIFEILLKYQVVFLVY--TTTKMLAFSKKNQKSSWFTYLRSQNKNFSKAEKLPLTFYDYQELTKKELEKLDVVKFLLIKIDSDPKLFQKASSELEKIEDIYLVQSQEKVIDIMSQGSNKGEGLKFLAQNYQLNLDRSIVFGDAKNDLPMFAIAKYSVAMGQADQSLKEVATFIT-KSNDQDGIPEFLAKCY 297
>gi|153225578|ref|ZP_01954785.1| hydrolase [Vibrio cholerae MAK 757] >gi|124117282|gb|EAY36025.1| hydrolase [Vibrio cholerae MAK 757] (288 aa)
Score = 156, Expect = 6.5e-09, Identities = 67/240 (27%), Positives = 115/240 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGD---AIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYM---PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDK 246
           K+V SD+DGTLL  +  + E S   +K++ +KG  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +  D   AI D++ H  D  L   +  N      KE+       E    T + FDV+   T+  +K+       D E++    T++N  + F  K  V     + P   E M   VSK + L+   +  +L L+N +AFGD  ND +M+  +  G+ M    +K
  S:    24 KIVASDLDGTLLAPNHQLSEFSKQTLKQLHDKGFTFIFATGRHHIDVAGIR----EIAGIPAYMITSNGARVHD-QNDQLMYSKNVPQDLVQAIIDVVKH--DKQLFVHLYRNDEWMLNKEDEILRDFHEDSGFTYRVFDVNNAPTDGIAKIFFTQEDQDHEHLVQYETLLN--QRFGDKLNVA---FSTPWCLEVMCAGVSKGDALQAVAESLHLGLENCIAFGDGMNDVEMLSMAGKGLVMGTAHEK 260
>gi|166985063|ref|ZP_02256369.1| hydrolase (HAD superfamily) protein [Bacillus cereus AH187] (283 aa)
Score = 156, Expect = 6.5e-09, Identities = 67/266 (25%), Positives = 129/266 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K +   +  AI+  +E G +  +CTGR   ++  +L++     +    II   GA  Y  K    K+    +  A+K I+ + ++  L + +  +  +Y P+    S+R              + E + + A Y D   + +    K ++  +    + +P    I + K  K  +   + L      +   E  H +  K NGL    +  N++++N +A GD  ND  M+  + I +AM N  ++ K++ +Y T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISTENAKAIRACQEAGHVVAICTGRSIVDIERLLLEA----DLECPIIAENGALIYKDK-KMMKRYPIQNMQALK-IVEYLEENGLYYQLYTDKGVYVPEYGVESVRREIEDLKNSKTNVDIQELETIAALYLDHTAFHSTESCKSIVETEIHVHKLLPFSYDIEKLKKLKETFLHNSDLAITSSYWHNLEINHRDAQKGNGLYTLAEYLNISVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCKYET-LSNEEHGVAHALYKY 281
>gi|28210122|ref|NP_781066.1| hydrolase [Clostridium tetani E88] >gi|28202558|gb|AAO35003.1| predicted hydrolase [Clostridium tetani E88] (273 aa)
Score = 156, Expect = 6.5e-09, Identities = 73/265 (27%), Positives = 120/265 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVI-----NRSKSFKS--KYEVGTPLVTG-PILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  D+DGTLL D K + + +I AIK   +KG+   + TGR    AN  A ++  K  +       I   GA   N   ++      +  +    IIN  ++  L      +  +            S+ + + +K   VD+ L +     +   + E +  +I     N+ K  K     E G  +V+     FE M   +SK N + I      +  + V+  GD++ND  MI  + +GVAM N ++  K  A YIT+  NN DG+   I K+
  S:     4 KLICIDIDGTLLRDDKKLSQRNINAIKAATKKGVHVAISTGRIFPSANYYAELIGVKSPV-------IASNGAYIKNSSEDKIIYEKTMEYEKTIKIINILKEYKLRPHFNTHNKILTESLEFSKKVYSKMNEVLSKNNKVDIELVDTWENALKTYEHEILKAIIVDEDINKIKEVKEIVAREEGIEVVSSHNNNFEVMSKGISKGNAVNILADMLGIKKEKVMCIGDSENDLSMIKFAGLGVAMGNAAECIKEYADYITDT-NNEDGVAKAIEKF 271
>gi|184155676|ref|YP_001844016.1| hydrolase [Lactobacillus fermentum IFO 3956] >gi|183227020|dbj|BAG27536.1| hydrolase [Lactobacillus fermentum IFO 3956] (268 aa)
Score = 156, Expect = 7.0e-09, Identities = 65/266 (24%), Positives = 122/266 (45%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKE-YVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVY----LTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           ++  DMDGT L++   + + ++  ++++   G L  + TGR     A+ L D+  +K   ++F        + N K     K   ++ +   D++   ++L +   I ++ +  +   N  S  L E+  + A+  D  +     LT+    + I  D      +INR       +        G  + E +H    K   L      F +   +++AFGD  ND +MI  +  GVAM N   + K+VA+ +T  DN +DG+ +++ KYF+
  S:     5 LIALDMDGTTLNNQSKLTDHTVSTLRRLANDGHLVVIVTGRPWLISAH-LYDQIGLKSPIINFNGALAHLPYQNWKHEYAIK---VTRELTLDMLESRRELGVQTLIAEDKHHVWA--NHPSNELPEF--LPAQLSDDQILNERNLTDDPIALTIQFDPAKKDAIINRVNERYGDFVEPRVWGGGYSIMELIHRGTHKETALSYLAHHFQIDRQHIVAFGDEQNDLEMIDFAGHGVAMKNAIPELKAVAKDVTTLDNEHDGVADYLEKYFQ 267
>gi|45181528|gb|AAS55429.1| hydrolase-like protein [Lactobacillus fermentum] (127 aa)
Score = 156, Expect = 7.0e-09, Identities = 39/120 (32%), Positives = 65/120 (54%)
  Q:   153 SKVMIVCDKEYMPTVI-NRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           SK ++  + E +  +I N     K+ Y     + + P++ E++   ++K  GLK  L  F     N+++FGDADND +MI  +  G+ M NG    K+ A  IT+  N+NDG+  +  +YF
  S:     7 SKAVMAIEPEKLTKIISNLPADLKAHYHA---VQSQPMIMEFLPKKLNKAVGLKALLDHFGDDFSNLMSFGDADNDLEMIKAAAQGIVMENGLPNVKAAATAITDT-NDNDGVAKYCERYF 123
>gi|167746205|ref|ZP_02418332.1| hypothetical protein ANACAC_00910 [Anaerostipes caccae DSM 14662] >gi|167654198|gb|EDR98327.1| hypothetical protein ANACAC_00910 [Anaerostipes caccae DSM 14662] (275 aa)
Score = 156, Expect = 7.2e-09, Identities = 63/269 (23%), Positives = 121/269 (44%)
  Q:     3 ISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYD----------HMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPIL--FEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +SQIK+V  D+DGTLL+D K + E +   +++   +G+     TGR    +   + D  +  E V + + C GA  Y+   ++    + +  +    ++    + +    I  NG  Y   E +    L ++D              +  D++ Y+ E    +  +    +   +  R +  K   ++    V+  +    E       K +G+    K  ++ ++  +A GDA ND  MI  +  GV M NG D+ K +A ++T + N  DG+   I ++
  S:     1 MSQIKLVTMDLDGTLLNDQKQISEHTREVLEEAARRGVHIVPATGR----IYKAIPDFIRNLEGVRYAVCCNGATIYDALEDKIIYKNHIPKETALSLLRKLTEYNCTRDIYRNGQGYM--EGKFYNHLEDFDIKGQQKDLILRTRQEVGDLEAYVEENSDGIEKI--SAFFGDLEERKRVMKELSDLEIASVSTALFNNVEITQLGCDKGDGITQLAKHLSIPIEETMACGDAANDTFMIRAAGFGVVMENGMDELKDIADFVT-KSNEEDGVAYAIERF 272
>gi|168185520|ref|ZP_02620155.1| HAD hydrolase, IIB family [Clostridium botulinum C str. Eklund] >gi|169296282|gb|EDS78415.1| HAD hydrolase, IIB family [Clostridium botulinum C str. Eklund] (274 aa)
Score = 156, Expect = 7.3e-09, Identities = 71/265 (26%), Positives = 114/265 (43%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPD-----------NGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K++  DMDGTLLD +K +   +  AIK+  EKG+   + TGR    A   A++L            II   GA       +E    S +  +   DIIN  +  D  F +              GY Y    N     +     +     +  +       K + + +   +     +  +     E+ + L      FE M+ +VSK  G+K+    + ++ D V+  GD +ND  MI  + +GV M N  D  K  A YI +  N+NDG+   I ++
  S:     4 KLICLDMDGTLLDTNKKISNRTKNAIKRAHEKGVKIAISTGRVFVSAKYYASML-------GISAPIIASNGAYIREKDKDEIIYKSPIDKNLCNDIINIAKKYDFAFYLNTFDTIISLKPYPKGYTYLEMSNELPDDMKVNLEVCTNLENEAIKRNGQVIKAICISNNREILEKARKEIAGLGNLEIVSSLGDN---FEIMNKDVSKGKGVKVLADFYGISQDEVICMGDGENDLSMIRYAGLGVVMGNAPDAIKKYADYIADT-NDNDGVAKVIEEF 271
>gi|34762506|ref|ZP_00143504.1| Hydrolase (HAD superfamily) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887839|gb|EAA24909.1| Hydrolase (HAD superfamily) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (264 aa)
Score = 156, Expect = 7.3e-09, Identities = 72/267 (26%), Positives = 129/267 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNF----GIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           +K+VVSD+DGTLL+D   V   +I AIK++KE G+ F + TGR  N+ AN +  K  ++ Y   +I   GA  YN K  +  K + +  + I+ +I    + ++ +    G   N Y+    E    +      H      D++  L   +  ++I  D E +  + +   K+F  + E+   +++     +      SK  G++   ++  +    ++AFGD+ NDY M+      VAM + S   K   +  T+  N+  G+  ++ KYF
  S:     1 MKLVVSDLDGTLLNDDSEVSNETIQAIKRLKENGIEFAIATGRSFNS-ANKIRKKIGLEIY---LICNNGANIYN-KDGQLIKNNVMPAELIRKVIKFLTENNIGYFAFDGSGINFYVPADMEIDGELLKEHIPHYIKNLEDIE-NLPALEKILIIEEDNEKIYEIKDLIHKNFNDELEI---VISADDCLDLNIKGCSKKGGVEYISQELEINPKEIMAFGDSGNDYKMLKFVGHPVAMKD-SFMAKRDFENKTDFTNDESGVAKYLQKYF 262
>gi|153214836|ref|ZP_01949644.1| conserved hypothetical protein [Vibrio cholerae 1587] >gi|153803062|ref|ZP_01957648.1| conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|153826284|ref|ZP_01978951.1| conserved hypothetical protein [Vibrio cholerae MZO-2] >gi|194534832|ref|YP_002070030.1| conserved hypothetical protein [Vibrio cholerae RC385] >gi|124115079|gb|EAY33899.1| conserved hypothetical protein [Vibrio cholerae 1587] >gi|124121381|gb|EAY40124.1| conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|149739952|gb|EDM54131.1| conserved hypothetical protein [Vibrio cholerae MZO-2] >gi|150419626|gb|EDN11948.1| conserved hypothetical protein [Vibrio cholerae RC385] >gi|150422152|gb|EDN14118.1| conserved hypothetical protein [Vibrio cholerae AM-19226] (275 aa)
Score = 156, Expect = 7.4e-09, Identities = 67/240 (27%), Positives = 117/240 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGD---AIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYM---PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDK 246
           K+V SD+DGTLL  +  + E S   +K++ +KG  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +  D   AI D++ H + L ++    D   L   KE+       E    T + FDV+   T+  +K+       D E++    T++N  + F  K  V     + P   E M   VSK + L+   +  +L L+N +AFGD  ND +M+  +  G+ M    +K
  S:    11 KIVASDLDGTLLAPNHQLSEFSKQTLKQLHDKGFTFIFATGRHHIDVAGIR----EIAGIPAYMITSNGARVHD-QNDQLMYSKNVPQDLVQAIIDVVKHDEQLFVHLYRNDEWML--NKEDEILRDFHEDSGFTYRVFDVNNAPTDGIAKIFFTQEDQDHEHLVQYETLLN--QRFGDKLNVA---FSTPWCLEVMCAGVSKGDALQAVAESLHLGLENCIAFGDGMNDVEMLSMAGKGLVMGTAHEK 247
>gi|157163176|ref|YP_001460494.1| sugar phosphatase [Escherichia coli HS] >gi|170018067|ref|YP_001723021.1| Cof-like hydrolase [Escherichia coli ATCC 8739] >gi|188495201|ref|ZP_03002471.1| phosphatase yidA [Escherichia coli 53638] >gi|157068856|gb|ABV08111.1| phosphatase yidA [Escherichia coli HS] >gi|169752995|gb|ACA75694.1| Cof-like hydrolase [Escherichia coli ATCC 8739] >gi|188490400|gb|EDU65503.1| phosphatase yidA [Escherichia coli 53638] (270 aa)
Score = 156, Expect = 7.6e-09, Identities = 70/266 (26%), Positives = 114/266 (42%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   + +G+   L TGR    + N L  +  ++   D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYL-KELHMELPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|47168796|pdb|1RKQ|A Chain A, Crystal Structure Of Had-Like Phosphatase Yida From E. Coli >gi|47168797|pdb|1RKQ|B Chain B, Crystal Structure Of Had-Like Phosphatase Yida From E. Coli (282 aa)
Score = 156, Expect = 7.6e-09, Identities = 69/266 (25%), Positives = 115/266 (43%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +  +   AI   + +G+   L TGR    + N L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVA+ N     K VA ++T + N  DG+   I KY
  S:     5 IKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYL-KELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAVDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 269
>gi|196164384|ref|ZP_03124915.1| putative hydrolase [Clostridium difficile QCD-23m63] (270 aa)
Score = 155, Expect = 8.3e-09, Identities = 75/258 (29%), Positives = 124/258 (48%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNM---ANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLN-------FGIPDNG------YLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCD--KEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGI 264
           K++ +DMDGTL+     V E +I A+K+  EKG+   L TGR  N +    +VL D        D  I      ++ L   E KK   LS +A+K I    +  +LN         I +N       Y     +N+   R+   ++ + +       L E     ++ C    E + ++    + FK + ++   + +G I FE M    SK   +K       +    V+  GD +ND  MI  + +G+AM N +D+ KS+A ++T+  N NDG+
  S:     4 KLICTDMDGTLMGKGFEVSEENIKALKEAMEKGIKVALVTGRPYNAIKYFTSVLGD--------DIYIISTNGTYFKLLGYEYKKV--LSKEALKKIYTIGEKYNLNKHFKGCKIVISNNEIGQEHPYRLINSKNKEEDRIEIIENASCET------LLEKADNEILKCILFSENVESLREAKEEFKKQEDLEV-VSSGKINFEVMSKGTSKGIAVKKFCDILGIDSKEVICIGDNENDISMIEFAGLGIAMGNATDEVKSIADFVTDT-NVNDGV 261
>gi|15640165|ref|NP_229792.1| hypothetical protein VC0134 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587734|ref|ZP_01677495.1| conserved hypothetical protein [Vibrio cholerae 2740-80] >gi|121728297|ref|ZP_01681328.1| conserved hypothetical protein [Vibrio cholerae V52] >gi|147675232|ref|YP_001218286.1| hypothetical protein VC0395_A2386 [Vibrio cholerae O395] >gi|153818960|ref|ZP_01971627.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|153822330|ref|ZP_01974997.1| conserved hypothetical protein [Vibrio cholerae B33] >gi|194531488|ref|YP_002066940.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|9654535|gb|AAF93311.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548033|gb|EAX58111.1| conserved hypothetical protein [Vibrio cholerae 2740-80] >gi|121629427|gb|EAX61856.1| conserved hypothetical protein [Vibrio cholerae V52] >gi|125617416|gb|EAZ45982.1| conserved hypothetical protein [Vibrio cholerae MO10] >gi|126510522|gb|EAZ73116.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] >gi|126520156|gb|EAZ77379.1| conserved hypothetical protein [Vibrio cholerae B33] >gi|146317115|gb|ABQ21654.1| conserved hypothetical protein [Vibrio cholerae O395] (275 aa)
Score = 155, Expect = 8.8e-09, Identities = 67/240 (27%), Positives = 115/240 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGD---AIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIV---CDKEYM---PTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDK 246
           K+V SD+DGTLL  +  + E S   +K++ +KG  F   TGR   ++A +     +I     ++I   GA+ ++ + ++   +  +  D   AI D++ H  D  L   +  N      KE+       E    T + FDV+   T+  +K+       D E++    T++N  + F  K  V     + P   E M   VSK + L+   +  +L L+N +AFGD  ND +M+  +  G+ M    +K
  S:    11 KIVASDLDGTLLAPNHQLSEFSKQTLKQLHDKGFTFIFATGRHHIDVAGIR----EIAGIPAYMITSNGARVHD-QNDQLMYSKNVPQDLVQAIIDVVKH--DKQLFVHLYRNDEWMLNKEDEILRDFHEDSGFTYRVFDVNNAPTDGIAKIFFTQEDQDHEHLVQYETLLN--QRFGDKLNVA---FSTPWCLEVMCAGVSKGDALQAVAESLHLGLENCIAFGDGMNDVEMLSMAGKGLVMGTAHEK 247
>gi|30020745|ref|NP_832376.1| HAD superfamily hydrolase [Bacillus cereus ATCC 14579] >gi|29896297|gb|AAP09577.1| hydrolase (HAD superfamily) [Bacillus cereus ATCC 14579] (283 aa)
Score = 155, Expect = 8.9e-09, Identities = 68/266 (25%), Positives = 126/266 (47%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           +K++  D+DGTLL  +K + + +  AI+  +E G +  +CTGR   ++  +L++       V+    II   GA  Y  K  +  K   +      +I+ + ++  L + +  +  +Y P     S+R              L E   + A Y +   + +    K ++  D    + +P    I + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ +Y T   N   G+ + + KY
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRTCQEAGHVVAICTGRSIVDIERLLLE-------VNLECPIIAENGALIY--KDKKMMKRYPIQNMQALEIVEYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEYVKNSKENFDLKELKTIAALYLEHTAFHSAESCKPIVETDIHVHKLLPFSYDIEKLKKLKETFLHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEHLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKAMCKYET-LSNEEHGVAHALYKY 281
>gi|90578584|ref|ZP_01234394.1| hypothetical protein VAS14_02743 [Vibrio angustum S14] >gi|90439417|gb|EAS64598.1| hypothetical protein VAS14_02743 [Vibrio angustum S14] (264 aa)
Score = 155, Expect = 9.1e-09, Identities = 67/267 (25%), Positives = 119/267 (44%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMP-TVINRSKSFKSKYEVGTPL--------VTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           + IK + +DMDGTLL D+K +        +++++K +LF   +GR   ++ N       +KE + FI   G    Y  K      +S +  D I  I+   +       +PD   +   K + ++   SE      + +  ++ L +     +   D E++   V+N + +    Y V  P+        V+  I  + MH   SK   +K   K+F  T +  ++FGD  ND +M+  +    AM N   + K +A++     NN  G+   I K
  S:     3 TSIKFIATDMDGTLLCDNKQLPSDFYEVFQQLQQKNILFSAASGRQYQSLVNTF---EPVKEEMVFIAENGTLVMYKGKE---IYSSTIPTDEIHTILKSVKQ------VPDCDIVLCGKNSAYTEATSERALNEIRKYYHNLKLVDD----LFSVDDEFIKIAVLNFNGTEDHIYPVLAPVFGETHQVVVSAKIWLDLMHKTASKGAAIKHLQKEFGFTFEESMSFGDFFNDVEMLKETYHSYAMENAHPEIKKLARF-EAPSNNEQGVMTVIKK 261
>gi|25029278|ref|NP_739332.1| hypothetical protein CE2722 [Corynebacterium efficiens YS-314] >gi|23494566|dbj|BAC19532.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] (279 aa)
Score = 155, Expect = 9.2e-09, Identities = 64/266 (24%), Positives = 126/266 (47%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDL-----DLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFD-----VDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSK--YEVGTPLVTGPI----------LFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K+V SD+DGTL+D ++ V       I ++  +G    L TGR A  +  VL ++  ++      +   GA  Y+  T+   K   L+ + + +++   +        ++F +   G   F   +   +   EY H      D     +D  ++ P +K+++            RS   +SK  +++  P++   +          L E   P V+K  G+    +   +  ++V+ FGD  ND +M+  +  GVAM N   + K+V+ ++T   N+  G+ + +  +F
  S:     9 KLVASDVDGTLIDSAERVPARLREVITRMTAQGTAMALSTGRPARWIYTVL-EQLPVRPVC---VCANGAVIYDSATDRILKAHTLAPETMVEVVALARAAMADHGGVSFAVERAGRSAFDNADELFLVTPEYSHAWPTLDDHGVVPLDTLISAPATKLLL------------RSDFLESKEMFDIIRPVIPEEVGHVTFSMSGGLLEIAAPGVTKALGVSYLAELLGVAQEDVITFGDMPNDIEMLQWAGRGVAMGNARPEVKAVSDFVTAT-NDEAGVADVLEWWF 279
>gi|26554467|ref|NP_758401.1| haloacid dehalogenase-like hydrolase [Mycoplasma penetrans HF-2] >gi|26454477|dbj|BAC44805.1| haloacid dehalogenase-like hydrolase [Mycoplasma penetrans HF-2] (276 aa)
Score = 155, Expect = 9.6e-09, Identities = 76/266 (28%), Positives = 123/266 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRD---ANNMANVLIDKWKIKEYVDFIIGC-GGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPN--------------------VSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           K +  D+DGTL+ D   +   +I+AI+ +K+K +  GL TGR+   A   A VL         VD  + C  GA     K      T ++      D     Q LD+ +      +L +  +  +S   SE      +   V   L E K K  +V + +  P ++  SK    K  +    V+  I +E +  N                    V K NG++ A+ +F +    V+ FGD DND +M+   K+ VA+ N   + +  A Y T+     +G+ +FI K+F
  S:     4 KCIYFDIDGTLVPDGVTLTNKTIMAIRYLKDKNIKIGLATGRNIFFAEYFAKVL--------DVDMPLVCVNGAWIVTPKDYLNISTKYI------DFKPQLQLLDVLYK-EKKDFLVYTIDGVYST--SENQPFYKRLLSVQEKLKEKKIKSRLVYEMKVNPNLVFYSKQKLLKVLICYDNVSEKIKYENILSNIPNLAFSVSQNGIIDIYNGEVDKANGIEYAINNFRINKREVMVFGDNDNDLNMMKTFKMSVALKNADYQIRKAATYTTDFTCEEEGVADFIFKHF 276
>gi|169825224|ref|YP_001692835.1| putative hydrolase [Finegoldia magna ATCC 29328] >gi|167832029|dbj|BAG08945.1| putative hydrolase [Finegoldia magna ATCC 29328] (278 aa)
Score = 155, Expect = 9.8e-09, Identities = 69/270 (25%), Positives = 125/270 (46%)
  Q:     4 SQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYD---HMTAKYFDVDVYLTEPKSKV--------MIVCDKEYMPTVINRSKS-FKSKYEVGTPLVTGPI-LFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYFK 273
           +  K V+ D+DGTLL D K + + S   ++K+ + G+   + TGR  +          ++ E +DF   I+   GA  ++       +   L       +++    L   +GI      YF  EN+ ++ + + +          D+   +T  +  +        +++  K ++  ++ R K+     Y + T      I + E  + N  K       L+ F +  D V+A GDA ND +M++NS +GVAM N  D  K  A  IT+  N  DG+  F+ + F+
  S:     3 NNFKAVMIDLDGTLLTDDKKITDFSNQILQKLYDNGIKIIIATGRGLSRAK-------QLTEKLDFDKIILANNGAIIHSSSNIATDEDLMLE----SSVVDELSTLSKEYGIRP----YFFVENKCALLIQDEEDKNRFVDSVGDIGEIMTVSERNLPIDDCVSMIMIAGKNHIYDIVERIKTNLNVTYHIHTKYFPQNIRMLEVQNVNTDKYKRAIHVLEHFGIKSDEVVAIGDAHNDLEMVVNSGLGVAMKNSDDILKQNADIITQYTNEQDGLAKFLEELFE 273
>gi|168206796|ref|ZP_02632801.1| HAD hydrolase, IIB family [Clostridium perfringens E str. JGS1987] >gi|170661775|gb|EDT14458.1| HAD hydrolase, IIB family [Clostridium perfringens E str. JGS1987] (276 aa)
Score = 155, Expect = 1.0e-08, Identities = 79/265 (29%), Positives = 119/265 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDA---IKDIINHYQDL---DLNFGIPDNGYLYFPKENRHSIRLSEYDHMTA----KYFDVDVYLTEPKSKVM--IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLLD    V E +  A+KK  EKG+   + TGR    A    N++     +       I   G+   +  T+E    S L  +    I DIIN Y+ L   D   G+  +  +  P+++ H I  S  D        KY D+     E    ++  I+  +E  P +      F++   V     +     E M    SK + +K       ++L+ V+  GD+ ND  MI  + + V M N  D  K    YIT+  N NDG+   I K+
  S:     4 KLVCIDMDGTLLDSHHKVSERNKEALKKAIEKGVHIAISTGRVFPSARIYGNIIGVNAPL-------ICSNGSYIKDKNTDEVIFKSTLDRETYFKICDIINKYKFLAYVDSTDGLIADTDI--PEDDSHRIMNSWVDEEEKIKFYKYDDLRDAYDEHGEDILKFIIIKQEGGPNIEEAKDEFEALEGVDLVYASWGGCIEIMKKGTSKGSAVKALADKLGISLEEVICIGDSGNDVSMIEEAGLSVVMGNAPDFIKEYGDYITDT-NENDGVAKAIEKF 273
>gi|187604788|ref|ZP_02990994.1| Cof-like hydrolase [Exiguobacterium sp. AT1b] >gi|187483184|gb|EDU21182.1| Cof-like hydrolase [Exiguobacterium sp. AT1b] (270 aa)
Score = 155, Expect = 1.0e-08, Identities = 64/261 (24%), Positives = 115/261 (44%)
  Q:     8 VVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSF-LSGDAIKDIINHYQDLDL-NFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           ++  D+DGTLL D K + E ++ A++  +E G    + TGR   +              V+F     GA  ++ K      T   +      DII    D    N  +    ++YF K+ +          ++    ++  +L +  + ++I   K+++  V ++     ++  +         + E M  N SK  GL+   K  N+   +++AFGD +ND +M+     GVAM N  D+ K+VA  +T   N +DGI  F+
  S:     5 LIAVDLDGTLLRDDKTISERNLRALQAAREAGHEVMIATGRPKRHSIMYYEQMGLTTPLVNF----NGALVHHPKDASYAVTHRPIPLKTAHDIIEEVADTKAHNIVVEVTDHVYFQKDPQEFYSPYAERALSVTSGNLLKHLQDEPTSLLIHATKDHVAHVRSQLDDIHAEAVLNRQWRMPEHMIEVMSKNTSKALGLQEVSKHLNIDRKHIIAFGDEENDLEMLDYVGTGVAMGNAIDQLKNVANEVTAS-NMDDGIALFL 262
>gi|89073814|ref|ZP_01160321.1| hypothetical protein SKA34_16815 [Photobacterium sp. SKA34] >gi|89050349|gb|EAR55850.1| hypothetical protein SKA34_16815 [Photobacterium sp. SKA34] (268 aa)
Score = 155, Expect = 1.0e-08, Identities = 67/242 (27%), Positives = 111/242 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVD---FIIGCGGAQFYNLKTNECKKTSFLSGDAIKDII---NHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEY-DHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLV-TGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTK 248
           K+V SD+DGTLL     +   +   ++++ +    F   TGR         ID   ++E +D   ++I   GA  ++   N   + S LS + I+ +I    H  DL ++    D+  L     N  +  L E+ D    + FDV+   T+   KV    D      ++   ++F  +++    +  + P   E M   VSK + L    K   LTLD+ +AFGD  ND +M+  +  G+ M    DK K
  S:     3 KIVASDLDGTLLTPEHKIAPYTQDVLQRLYQHDKHFVFATGRHH-------IDVAGMREELDIPAYMITSNGASVHDADGNLVFQQS-LSPEVIRGVIALAKHDPDLHIHLYQGDHWLL-----NHENEALREFHDSFHYQLFDVENPPTDNVLKVFFTRDDLDHEKMVKWEQAFNQEFKDKANIAFSTPWCLEVMDAGVSKGDALAAVAKALELTLDDCIAFGDGMNDIEMLSMAGKGLIMGTSHDKVK 239
>gi|167766765|ref|ZP_02438818.1| hypothetical protein CLOSS21_01273 [Clostridium sp. SS2/1] >gi|167711519|gb|EDS22098.1| hypothetical protein CLOSS21_01273 [Clostridium sp. SS2/1] (298 aa)
Score = 154, Expect = 1.1e-08, Identities = 74/269 (27%), Positives = 118/269 (43%)
  Q:     2 DISQIKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEY---DHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYE----VGTPLVTGPIL---------FEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVK 270
           ++S+IK+V  D+D TLLD  K + + +   +K+   +G+     TGR    +   L D   ++    + + C GA  Y+ K N+   T+ L  + +  + +  +       I  NG  Y   E  +   L+EY   DH+     D  + L + +  +      E  P  I +   F    E        L+   I           E       K +GL    +   L++D V+A GDA ND  MI     GV M NG    K +A ++T + NN DG+   I K
  S:    22 NMSKIKLVAMDLDNTLLDSEKQISKHTEEVLKEAIRRGVYIVPATGRIFKAIPEFLRDIPGVR----YAVCCNGATVYDQKENKIIYTNHLPKETVFSLFDILEKYHCTRDIYQNGQGYM--ERCYFDHLAEYGVSDHVLKLVRDTRLPLDDLRKYI------EERPLGIEKINVFFDDMEERETARQELIEKNIASVSSSLGNNIEINQIGCDKGDGLLHLAEQIGLSMDEVMACGDAGNDTMMIKAVGTGVVMENGQPDLKEIADFVT-KTNNEDGVAYAIEK 293
>gi|118587566|ref|ZP_01544990.1| hydrolase, HAD superfamily [Oenococcus oeni ATCC BAA-1163] >gi|118432017|gb|EAV38759.1| hydrolase, HAD superfamily [Oenococcus oeni ATCC BAA-1163] (271 aa)
Score = 154, Expect = 1.1e-08, Identities = 70/267 (26%), Positives = 121/267 (45%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNM----ANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDV---DVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSK--YEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKYF 272
           IK+V  D+D TLL+    + + +I  +K+    G    + +GR         A + ID+ K  +Y    I   GA           +T+    D  KDI +    + +         +Y P  +       E     AK   V   D+  ++  +K+M + +    P +I+R K       Y+    + + P+  E++   VSK N ++   +   + +  V+A GD  ND  MI  + +GVAM NG D  KS+AQ++T + N+ DG+   + K+ 
  S:     3 IKLVAIDVDATLLNSRNELTKHTIDTLKEASAMGTKIVITSGRPLPGTEPYYAKLGIDR-KDDQYA---INYNGATIRTTSGRMISETTLTIKD-YKDIYSLANKIGIKIQAETADCIYTPYLSAPKYTKYEQKLTNAKIRHVRMQDLKKSDVIAKIMFIDE----PEIISRVKKELPAWVYDRFNVVPSSPVYIEFIDKKVSKGNAVRTLAEKLGIDISQVMAIGDQGNDLSMIEAAGVGVAMGNGIDDLKSIAQFVT-KSNDEDGVAYAVEKFL 268
>gi|194099076|ref|YP_002002158.1| hypothetical protein NGK_1533 [Neisseria gonorrhoeae NCCP11945] >gi|193934366|gb|ACF30190.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945] (263 aa)
Score = 154, Expect = 1.1e-08, Identities = 64/248 (25%), Positives = 115/248 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSI-LAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSE-----YDHMTAKYF-DVDVYLTEPKSKVMIVCDKEYMP---TVINRS--KSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYI 254
           K+V  D+D TL     + L  S+  A+  ++ KG+L  L TGR    +   + D    +  +D ++   G QF  L     ++    +G  +  +  H   L ++       Y +   E      LSE       H+ + +F D D + ++P  ++++  ++  MP    ++ R   K+ +   E    L  G          +SKT+G++  ++   L + +V+AFGD  ND +M+     GVAM NG    K  A+Y+
  S:     5 KIVFFDIDDTLYRKYTDTLRPSVKTAVAALRGKGILTALATGRSLATIPEKVRDMMA-ETGMDAVVTING-QFALLHGKTVREVPMDTG-LMGRVCAHLDGLGMD-------YAFVGGEGIAVSALSECVCRALQHIASDFFADKDYFSSKPVYQMLVFAEENEMPLWSDIVEREGLKTVRWHEEAVDLLPAG----------MSKTDGIRSVVEALGLEMADVMAFGDGLNDVEMLSEVGFGVAMGNGEQAAKEAAKYV 244
>gi|59801664|ref|YP_208376.1| hypothetical protein NGO1312 [Neisseria gonorrhoeae FA 1090] >gi|59718559|gb|AAW89964.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] (269 aa)
Score = 154, Expect = 1.1e-08, Identities = 64/248 (25%), Positives = 115/248 (46%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSI-LAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSE-----YDHMTAKYF-DVDVYLTEPKSKVMIVCDKEYMP---TVINRS--KSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYI 254
           K+V  D+D TL     + L  S+  A+  ++ KG+L  L TGR    +   + D    +  +D ++   G QF  L     ++    +G  +  +  H   L ++       Y +   E      LSE       H+ + +F D D + ++P  ++++  ++  MP    ++ R   K+ +   E    L  G          +SKT+G++  ++   L + +V+AFGD  ND +M+     GVAM NG    K  A+Y+
  S:    11 KIVFFDIDDTLYRKYTDTLRPSVKTAVAALRGKGILTALATGRSLATIPEKVRDMMA-ETGMDAVVTING-QFALLHGKTVREVPMDTG-LMGRVCAHLDGLGMD-------YAFVGGEGIAVSALSECVCRALQHIASDFFADKDYFSSKPVYQMLVFAEENEMPLWSDIVEREGLKTVRWHEEAVDLLPAG----------MSKTDGIRSVVEALGLEMADVMAFGDGLNDVEMLSEVGFGVAMGNGEQAAKEAAKYV 250
>gi|112491316|pdb|2HF2|A Chain A, Domain Shifting Confirms Monomeric Structure Of Escherichia Sugar Phosphatase Suph >gi|112491317|pdb|2HF2|B Chain B, Domain Shifting Confirms Monomeric Structure Of Escherichia Sugar Phosphatase Suph (283 aa)
Score = 154, Expect = 1.1e-08, Identities = 64/263 (24%), Positives = 135/263 (51%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILA-IKKIKEKGLLFGLCTGRDANNMANVLIDKW-KIKEYVDFIIGCG------GAQFYNLKTNECKKTSFLSGDAIKD-----IINHYQDLDLNFGIPDNGYLYFPKENRHSIR-LSEYDHMTAKYFDVDVYLTEPKSKVMIVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +KV+V+D DGT L+D+K   +    A  +++K++G+ F + +    NN    LI  + ++K+ + F+   G      G Q ++ +     ++  + G+ +KD     +    Q   ++   P+  ++    ++ H ++ + +Y  +    F   + L  P  ++ +V DK ++           +   +  P+ +G    + + P + K NG+   LK ++L+  NV+A GD+ ND + +  ++   A  N ++  K +A+Y T+ DNN++G  N I
  S:     5 VKVIVTDXDGTFLNDAKTYNQPRFXAQYQELKKRGIKFVVAS----NNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTR-HESRIVIGELLKDKQLNFVACGLQSAYVSENAPE-AFVALXAKHYHRLKPVKDYQEIDDVLFKFSLNL--PDEQIPLVIDKLHV-----------ALDGIXKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEXLKXARYSFAXGNAAENIKQIARYATD-DNNHEGALNVI 261
>gi|75764848|ref|ZP_00744218.1| Hydrolase (HAD superfamily) [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487663|gb|EAO51509.1| Hydrolase (HAD superfamily) [Bacillus thuringiensis serovar israelensis ATCC 35646] (281 aa)
Score = 154, Expect = 1.2e-08, Identities = 67/263 (25%), Positives = 127/263 (48%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDF---IIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIR--------------LSEYDHMTAKYFDVDVYLTEPKSKVMIVCD---KEYMPTV--INRSKSFKSKYEVGTPLVTGPILF---EYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFI 268
           +K++  D+DGTLL  +K + + +  AI+  +E G +  +CTGR   ++  +L++       VD    II   GA  Y  K  +  K   +      +I+ + ++  L + +  +  +Y P     S+R              L E+  + A Y +   + +    K ++  D    + +P    I + K  K  +   T L      +   E  H +  K NGL    +  N+ ++N +A GD  ND  M+  + I +AM N  ++ K++ +Y  E  +N D +++ +
  S:     1 MKLIAIDLDGTLLSGNKMISKENAEAIRTCQEAGHVVAICTGRSIVDIERLLLE-------VDLECPIIAENGAIIY--KDKKMMKRYPIQNMQALEIVEYLEENGLYYQLYTDKGVYVPDYGVESVRNEIEYVKNSKENFDLKEFITIAALYLEHTAFHSAESCKPIVETDIHVHKLLPFSYDIEKLKKLKETFIHNTDLAITSSYWHNLEINHRDAQKGNGLYTLAEYLNIPVENTVAIGDGLNDVSMMEKANISIAMGNAVEEIKTICKY--ETLSNEDMVWHML 277
>gi|110803089|ref|YP_698858.1| HAD family hydrolase [Clostridium perfringens SM101] >gi|110683590|gb|ABG86960.1| HAD hydrolase, IIB family [Clostridium perfringens SM101] (276 aa)
Score = 154, Expect = 1.2e-08, Identities = 78/265 (29%), Positives = 119/265 (44%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDA---IKDIINHYQDL---DLNFGIPDNGYLYFPKENRHSIRLSEYDHMTA----KYFDVDVYLTEPKSKVM--IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLLD    V E +  A+KK  EKG+   + TGR    A    N++     +       I   G+   +  T E    S L  +    I DIIN Y+ L   D   G+  +  +  P+++ H +  S  D        KY D+     E    ++  I+  KE  P +    + F++   V     +     E M    SK + +K       ++L+ V+  GD+ ND  M+  + + V M N  D  K    YIT+  N NDG+   I K+
  S:     4 KLVCIDMDGTLLDSHHRVSERNKEALKKAIEKGVHIAISTGRVFPSARIYGNIIGVNAPL-------ICSNGSYIKDKNTGELIFKSTLDRETYFKICDIINKYKFLAYVDSTDGLIADTDI--PEDDSHRLMNSWVDEEEKIKFYKYDDLRDAYDEHGEDILKFIIIKKEGGPNIEEAKEEFEALEGVDLVYASWGGCIEIMKKGTSKGSAVKALADKLGISLEEVICIGDSGNDISMLEEAGLSVVMGNAPDFIKEYGDYITDT-NENDGVAKAIEKF 273
>gi|170767036|ref|ZP_02901489.1| phosphatase yidA [Escherichia albertii TW07627] >gi|170124474|gb|EDS93405.1| phosphatase yidA [Escherichia albertii TW07627] (270 aa)
Score = 154, Expect = 1.2e-08, Identities = 69/266 (25%), Positives = 114/266 (42%)
  Q:     6 IKVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGRDANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDAIKDIINHYQDLDLNFGIPDNGYLYFPKENRHSIRLSEYDHMTAKYFDVDVYLTEPKS---KVMIVCDKEYMPTVINR-SKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           IK++  DMDGTLL     +      AI   + +G+   L TGR    + + L  +  +++  D+ I   GA             + LS D  + +    +++  +F   D   LY    +     + E    T      +    +P +   KVM++ +   +   I R  +  K KY V   L + P   E +   V+K  G+K       +  + ++A GD +ND  MI  + +GVAM N     K VA ++T + N  DG+   I KY
  S:     3 IKLIAIDMDGTLLLPDHTISPGVKNAIAAARARGVNVVLTTGRPYAGVHSYL-KELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAVLDQAIARIPQEVKEKYTV---LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNAIPSVKEVANFVT-KSNLEDGVAFAIEKY 267
>gi|182626046|ref|ZP_02953808.1| HAD hydrolase, IIB family [Clostridium perfringens D str. JGS1721] >gi|177908658|gb|EDT71174.1| HAD hydrolase, IIB family [Clostridium perfringens D str. JGS1721] (276 aa)
Score = 154, Expect = 1.2e-08, Identities = 77/265 (29%), Positives = 121/265 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDA---IKDIINHYQDL---DLNFGIPDNGYLYFPKENRHSIRLSEYDHMTA----KYFDVDVYLTEPKSKVM--IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLLD    V E +  A+KK  EKG+   + TGR    A    N++     +       I   G+   +  T+E    S L  +    I DIIN Y+ L   D   G+  +  +  P+++ H +  S  D        KY D+     E    ++  I+  +E  P +    + F++   V     +     E M    SK + +K       ++L+ V+  GD+ ND  M+  + + V M N +D  K    YIT+  N NDG+   I K+
  S:     4 KLVCIDMDGTLLDSHHKVSERNKEALKKAIEKGVHIAISTGRVFPSARIYGNIIGVNAPL-------ICSNGSYIKDKNTDEVIFKSTLDRETYFKICDIINKYKFLAYVDSTDGLIADTDI--PEDDSHRLMNSWVDEEEKIKFYKYDDLRDAYDEHGEDILKFIIIKQEGGPNIEEAKEEFEALEGVDLVYASWGGCIEIMKKGTSKGSAVKALADKLGISLEEVICIGDSGNDVSMLEEAGLSVVMGNATDFIKEYGDYITDT-NENDGVAKAIEKF 273
>gi|169342792|ref|ZP_02863827.1| HAD hydrolase, IIB family [Clostridium perfringens C str. JGS1495] >gi|169299049|gb|EDS81121.1| HAD hydrolase, IIB family [Clostridium perfringens C str. JGS1495] (276 aa)
Score = 154, Expect = 1.2e-08, Identities = 77/265 (29%), Positives = 121/265 (45%)
  Q:     7 KVVVSDMDGTLLDDSKNVLESSILAIKKIKEKGLLFGLCTGR---DANNMANVLIDKWKIKEYVDFIIGCGGAQFYNLKTNECKKTSFLSGDA---IKDIINHYQDL---DLNFGIPDNGYLYFPKENRHSIRLSEYDHMTA----KYFDVDVYLTEPKSKVM--IVCDKEYMPTVINRSKSFKSKYEVGTPLVTGPILFEYMHPNVSKTNGLKIALKDFNLTLDNVLAFGDADNDYDMILNSKIGVAMINGSDKTKSVAQYITEQDNNNDGIYNFIVKY 271
           K+V  DMDGTLLD    V E +  A+KK  EKG+   + TGR    A    N++     +       I   G+   +  T+E    S L  +    I DIIN Y+ L   D   G+  +  +  P+++ H +  S  D        KY D+     E    ++  I+  +E  P++    + F++   V     +     E M    SK + +K       ++L+ V+  GD+ ND  M+  + + V M N  D  K    YIT+  N NDG+   I K+
  S:     4 KLVCIDMDGTLLDSHHKVSERNKEALKKAIEKGVHIAISTGRVFPSARIYGNIIGVNAPL-------ICSNGSYIKDKNTDEVIFKSTLDRETYFKICDIINKYKFLAYVDSTDGLIADTDI--PEDDSHRLMNSWVDEEEKIKFYKYDDLRDAYDEHGEDILKFIIIKQEGGPSIEEAKEEFEALEGVDLVYASWGGCIEIMKKGTSKGSAVKALADKLGISLEEVICIGDSGNDVSMLEEAGLSVVMGNAPDFIKEYGDYITDT-NENDGVAKAIEKF 273