>gi|26554296|ref|NP_758230.1| lysyl-tRNA synthetase [Mycoplasma penetrans HF-2] >gi|39932207|sp|Q8EUS8|SYK_MYCPE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|26454305|dbj|BAC44634.1| lysyl-tRNA synthetase [Mycoplasma penetrans HF-2] (489 aa)
Score = 2446, Expect = 0.0e+00, Identities = 489/489 (100%), Positives = 489/489 (100%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK
  S:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
>gi|188524159|ref|ZP_02557488.2| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530719|ref|ZP_03005049.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195659755|gb|EDX53135.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (493 aa)
Score = 1439, Expect = 3.2e-157, Identities = 284/488 (58%), Positives = 373/488 (76%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSK---FAKLKTHNTN-NNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           MERKF+DQELIRR  L+ L++ N++P+   KV R+M++ DF  +   F+K + HN +   + LAGR++ +RQTFG+I+DF    Q Y+NKK V   +   F K LD+GDIVE+ G   +T   E+TL+V  IK+V+K+LK LPEK+HGL DEE++AR RY+DLIVN +S   F+ R  I++ +R ++DSQ + EVETPVL  IL GA ARPFIT HNTL++ +YLRIATE+ LKK IVGGF+KVYEIGRIFRNEGMDSTHNPEFTS+E+Y AY ++ Y+M+LTE+L +++A  LK          + L + F++ HMVD I +  GV+F+EVKS+++A ELAKKH+VK   HQ   GHI+N FFE F E K I+PTFVYGHP+ VSPL+KK+ ++P F  RFELFI  KE+ANA++E+NDPIDQYERF AQ++E  LGNDEA E+DM+FIEALEYG+PPT GLG+G+DR++ML T   SIR+VLLFPHMKDK
  S:     1 MERKFSDQELIRRNHLQELKDQNKNPFLATKVERSMSLKDFAEEYKNFSKEELHNMDLKKVTLAGRLIGVRQTFGIIQDFSTKLQIYINKKNVDPEVFSTF-KSLDIGDIVELQGVAMKTNSDEITLNVTNIKLVAKSLKVLPEKYHGLVDEEIKARQRYLDLIVNDESKNTFIKRSLIIREMRNWLDSQGFFEVETPVLQDILSGAAARPFITHHNTLDKQYYLRIATEIALKKCIVGGFEKVYEIGRIFRNEGMDSTHNPEFTSVELYVAYVDLWYIMQLTEDLIRHIATKLKLLNPTFRGFSVDLNKPFKKAHMVDLINEHVGVNFFEVKSDEQALELAKKHHVKLLDHQKNFGHIVNAFFETFVEEKLIEPTFVYGHPVQVSPLTKKNQEDPRFVDRFELFICQKEFANAYSEINDPIDQYERFVAQLEEAKLGNDEANELDMEFIEALEYGMPPTGGLGIGVDRLVMLLTSNDSIRNVLLFPHMKDK 491
>gi|171920720|ref|ZP_02695465.2| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178848|ref|ZP_02554646.2| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024429|ref|ZP_02570729.2| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039320|ref|ZP_02998103.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 8] >gi|188518484|ref|ZP_03003968.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188568771|ref|ZP_02828891.2| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 2] >gi|188592585|ref|ZP_02694226.2| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 10] >gi|195867438|ref|ZP_03079442.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903464|gb|EDT49753.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209484|gb|EDU06527.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018717|gb|EDU56757.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998068|gb|EDU67165.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660914|gb|EDX54167.1| lysyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (493 aa)
Score = 1435, Expect = 8.5e-157, Identities = 283/488 (57%), Positives = 373/488 (76%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSK---FAKLKTHNTN-NNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           MERKF+DQELIRR  L+ L++ N++P+   KV R+M++ DF  +   F+K + HN +   + LAGR++ +RQTFG+I+DF    Q Y++KK V   +   F K LD+GDIVE+ G   +T   E+TL+V  IK+V+K+LK LPEK+HGL DEE++AR RY+DLIVN +S   F+ R  I++ +R ++DSQ + EVETPVL  IL GA ARPFIT HNTL++ +YLRIATE+ LKK IVGGF+KVYEIGRIFRNEGMDSTHNPEFTS+E+Y AY ++ Y+M+LTE+L +++A  LK          + L + F++ HMVD I +  GV+F+EVKS+++A ELAKKH+VK   HQ   GHI+N FFE F E K I+PTFVYGHP+ VSPL+KK+ ++P F  RFELFI  KE+ANA++E+NDPIDQYERF AQ++E  LGNDEA E+DM+FIEALEYG+PPT GLG+G+DR++ML T   SIR+VLLFPHMKDK
  S:     1 MERKFSDQELIRRNHLQELKDQNKNPFLATKVERSMSLKDFAEEYKNFSKEELHNMDLKKVTLAGRLIGVRQTFGIIQDFSTKLQIYIDKKNVDPEVFSTF-KSLDIGDIVELQGVAMKTNSDEITLNVTNIKLVAKSLKVLPEKYHGLVDEEIKARQRYLDLIVNDESKNTFIKRSLIIREMRNWLDSQGFFEVETPVLQDILSGAAARPFITHHNTLDKQYYLRIATEIALKKCIVGGFEKVYEIGRIFRNEGMDSTHNPEFTSVELYVAYVDLWYIMQLTEDLIRHIATKLKLLNPTFRGFSVDLNKPFKKAHMVDLINEHVGVNFFEVKSDEQALELAKKHHVKLLDHQKNFGHIVNAFFETFVEEKLIEPTFVYGHPVQVSPLTKKNQEDPRFVDRFELFICQKEFANAYSEINDPIDQYERFVAQLEEAKLGNDEANELDMEFIEALEYGMPPTGGLGIGVDRLVMLLTSNDSIRNVLLFPHMKDK 491
>gi|171920411|ref|ZP_02931731.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902853|gb|EDT49142.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] (493 aa)
Score = 1419, Expect = 5.8e-155, Identities = 279/488 (57%), Positives = 370/488 (75%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSK---FAKLKTHNTN-NNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           MERKF+DQELIRR  L+ L+  N++P+ I KV R+M + DF  K   F+K + HN +   + LAGR++ +RQTFG+I+DF    Q Y+NKK V+  +   F K LD+GDI+E+ G   +T   E+TL+V  I++V+K+LK LPEK+HGL DEE++AR RY+DLIVN ++   F+ R  I++ +R ++D++ + EVETPVL  IL GA ARPFIT HNTL + +YLRIATE+ LKK I+GGF+KVYEIGRIFRNEGMDSTHNPEFTS+E+Y AY ++ Y+M+LTE+L +++A  L           I L + F++ HMVD I +  GV+F+EVKS+++A ELAKKH+VK   HQ   GHI+N FFE F E K ++PTFVYGHP+ VSPL+KK+  +P F  RFELFI  KE+ANA++E+NDPIDQYERF AQ++E  LGNDEA E+DM+FIEALEYG+PPT GLG+G+DR++ML T   SIR+VLLFPHMKDK
  S:     1 MERKFSDQELIRRTHLQELKNQNKNPFLITKVDRSMFLKDFAEKYKNFSKEELHNMDLEKLTLAGRLIGIRQTFGIIQDFSAKLQIYINKKNVAPEVFSTF-KSLDIGDIIELEGVAMKTNSDEITLNVTNIRLVAKSLKVLPEKYHGLVDEEIKARQRYLDLIVNDEAKNTFIKRSLIIREMRNWLDNKGFFEVETPVLQDILSGAAARPFITHHNTLNKEYYLRIATEIALKKCIIGGFEKVYEIGRIFRNEGMDSTHNPEFTSVELYIAYVDLWYIMQLTEDLIRHIATKLNLLNPTFRGFSIDLNKPFKKAHMVDLINEYVGVNFFEVKSDEQAIELAKKHHVKLLDHQKNFGHIVNAFFETFVEEKLVEPTFVYGHPLQVSPLTKKNQSDPRFVDRFELFICQKEFANAYSEINDPIDQYERFIAQLEEAKLGNDEASELDMEFIEALEYGMPPTGGLGIGVDRLVMLLTSNDSIRNVLLFPHMKDK 491
>gi|13357618|ref|NP_077892.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762376|ref|YP_001752141.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508493|ref|ZP_02958023.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701849|ref|ZP_02971511.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189082973|sp|B1AI47|SYK_UREP2 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|11387151|sp|Q9PR83|SYK_UREPA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|11271293|pir||G82937 lysyl-tRNA synthetase UU062 [imported] - Ureaplasma urealyticum >gi|6899012|gb|AAF30467.1|AE002106_1 lysyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827953|gb|ACA33215.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675921|gb|EDT87826.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701144|gb|EDU19426.1| lysyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] (493 aa)
Score = 1419, Expect = 5.8e-155, Identities = 279/488 (57%), Positives = 370/488 (75%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSK---FAKLKTHNTN-NNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           MERKF+DQELIRR  L+ L+  N++P+ I KV R+M + DF  K   F+K + HN +   + LAGR++ +RQTFG+I+DF    Q Y+NKK V+  +   F K LD+GDI+E+ G   +T   E+TL+V  I++V+K+LK LPEK+HGL DEE++AR RY+DLIVN ++   F+ R  I++ +R ++D++ + EVETPVL  IL GA ARPFIT HNTL + +YLRIATE+ LKK I+GGF+KVYEIGRIFRNEGMDSTHNPEFTS+E+Y AY ++ Y+M+LTE+L +++A  L           I L + F++ HMVD I +  GV+F+EVKS+++A ELAKKH+VK   HQ   GHI+N FFE F E K ++PTFVYGHP+ VSPL+KK+  +P F  RFELFI  KE+ANA++E+NDPIDQYERF AQ++E  LGNDEA E+DM+FIEALEYG+PPT GLG+G+DR++ML T   SIR+VLLFPHMKDK
  S:     1 MERKFSDQELIRRTHLQELKNQNKNPFLITKVDRSMFLKDFAEKYKNFSKEELHNMDLEKLTLAGRLIGIRQTFGIIQDFSAKLQIYINKKNVAPEVFSTF-KSLDIGDIIELEGVAMKTNSDEITLNVTNIRLVAKSLKVLPEKYHGLVDEEIKARQRYLDLIVNDETKNTFIKRSLIIREMRNWLDNKGFFEVETPVLQDILSGAAARPFITHHNTLNKEYYLRIATEIALKKCIIGGFEKVYEIGRIFRNEGMDSTHNPEFTSVELYIAYVDLWYIMQLTEDLIRHIATKLNLLNPTFRGFSIDLNKPFKKAHMVDLINEYVGVNFFEVKSDEQAIELAKKHHVKLLDHQKNFGHIVNAFFETFVEEKLVEPTFVYGHPLQVSPLTKKNQSDPRFVDRFELFICQKEFANAYSEINDPIDQYERFIAQLEEAKLGNDEASELDMEFIEALEYGMPPTGGLGIGVDRLVMLLTSNDSIRNVLLFPHMKDK 491
>gi|31544279|ref|NP_852857.1| hypothetical protein MGA_0753 [Mycoplasma gallisepticum R] >gi|39932044|sp|Q7NC34|SYK_MYCGA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|31541123|gb|AAP56425.1| LysU [Mycoplasma gallisepticum R] (496 aa)
Score = 1338, Expect = 1.5e-145, Identities = 260/488 (53%), Positives = 358/488 (73%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF-----AKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M +K NDQEL+R +KL  L E+ Q+PYE+ KV+ T        K+      +L     +  I ++GRV+ +R+TF +I+DF+ + Q Y+NK K    + +YFN  LDLGD+V   G P +T   EL+LD++ +KI+SK+L+  PEK+HG+ DEE+R+R RY+DL+ NK+S + FV R +I+  +RQ+ +   +LEVETP LH  +GGA A+PF+T +N L+R++YLRIA ELPLKKLIVG F+K+YEIG+ FRNEGMDSTHNPEFTS+E Y AY +  YMM LTE + KY+AK++      +    I   + F+RI M + +KQETG+DF +VK   +A +LAKKH V  ++H+ T+GHIINLFFEEFCE K ++PTFV  HP+++SPLSK DY +P +T+RFELF   KE AN F+ELNDPIDQ +RFE Q++EK  GNDEA EMD DF+EALE GLPPT GLG+G+DR++M+ T  +SIRD+L FPH++++
  S:     5 MSKKLNDQELVRLDKLNRLIESKQNPYEVTKVANTHNTKSLKEKYDQFSKEQLAEMQLDKPITVSGRVILIRRTFILIQDFHSELQLYINKNK-QPDLFKYFNDYLDLGDVVCATGKPMKTNTNELSLDLESLKIISKSLRVPPEKFHGIADEEIRSRKRYLDLVYNKESKERFVYRSKIIAAMRQYFNENGFLEVETPFLHAQIGGAAAKPFVTRYNALDRDYYLRIAPELPLKKLIVGSFEKIYEIGKCFRNEGMDSTHNPEFTSVETYVAYVDYIYMMELTEAIIKYIAKAIGISHTNIKNETIDWNKPFKRIKMTELVKQETGIDFTQVKKIDQALDLAKKHKVHVKEHEKTIGHIINLFFEEFCEKKLVEPTFVTHHPVEISPLSKLDYSDPRYTERFELFAFGKELANGFSELNDPIDQRQRFEKQLEEKQKGNDEASEMDEDFLEALENGLPPTGGLGIGVDRLVMMLTGTTSIRDILFFPHVREE 496
>gi|13508016|ref|NP_109965.1| lysyl-tRNA synthetase [Mycoplasma pneumoniae M129] >gi|2501019|sp|P75500|SYK_MYCPN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|1674257|gb|AAB96206.1| lysyl-tRNA synthetase [Mycoplasma pneumoniae M129] (489 aa)
Score = 1302, Expect = 2.1e-141, Identities = 254/489 (51%), Positives = 341/489 (69%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN-NIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  + NDQ   R +KL NL++   DPY I K+  T +   F   FA           + L GR++ALRQTF +I+DF G  Q Y+NKK  +  + EYFN  +DLGD +   G P  T+ G LTL+V++++IV+K L+  PEKWHGL D E RAR RY+DL  N+  ++VF+ R +I+  IR F++   +LEVETP+L  +LGGANA+PF T +N L+ +FYLRIA E+ LKKLIVGG  KVYE+GR+FRNEG+D+THNPEFTS+E+Y A  +   MM LTENL K+V K+L +         + L + F+++ MVD I Q TGV+F +VK +Q A  LAK+H V+ +KH+    HIIN FFE+FCE   IQPTFV  +P  VSPL+K+D  NP FT+RFELFINTKE ANA++ELNDP++Q  RFE Q++EK +GNDEA E+D  F++AL +GLPPT GLG+G+DR++ML  E SSIRDV+ FP +++ K
  S:     1 MSDRLNDQAQNRLQKLLNLKQTGNDPYLITKIENTHSAASFQKAFANQSDAELKQYQVILTGRIIALRQTFIIIQDFSGKMQLYINKK-TAPELFEYFNNYIDLGDQIVATGHPMMTKTGVLTLNVERLQIVAKCLQTPPEKWHGLTDPEARARKRYLDLTYNRAQVEVFLKRTQIITAIRTFLNEAGFLEVETPILQAVLGGANAKPFKTHYNALKGDFYLRIANEIALKKLIVGGLPKVYEMGRMFRNEGVDTTHNPEFTSIEMYQANADYAVMMDLTENLIKFVCKTLNQWSFNWNGQTLDLAKPFKKVKMVDLICQVTGVNFDDVKDDQTAIALAKQHKVELKKHEQNKQHIINRFFEQFCEHTLIQPTFVTHYPKAVSPLAKQDPHNPEFTERFELFINTKELANAYSELNDPLEQRARFEQQLQEKRMGNDEASELDESFLDALSFGLPPTGGLGIGVDRLVMLLCECSSIRDVVFFPQLRELK 489
>gi|160916179|ref|ZP_02078386.1| hypothetical protein EUBDOL_02206 [Eubacterium dolichum DSM 3991] >gi|158431903|gb|EDP10192.1| hypothetical protein EUBDOL_02206 [Eubacterium dolichum DSM 3991] (495 aa)
Score = 1295, Expect = 1.4e-140, Identities = 258/485 (53%), Positives = 353/485 (72%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           K  +QE IRR+K+++L+    DP+  +   RT   G   +++   +K +  +   N+K+AGR++  R+     F  I+D  G  Q Y+ K ++ +   E F K  D+GDIV I G   +T  GEL++  K    +SK+L+PLPEK+HGL+D E R R RYVDLI+N ++ ++ + R RI++ I++++D +  +EVETPVL PILGGANARPF+T HNTL+ +FY+RIATELPLK+LIVGG + VYEIGR+FRNEGMD  HNPEFT++E Y AY +ME MM LTE L + VA   L    V   E EI L   F+R+HMVD IK+  GVDFW+  S ++A  LAK+H+++ EKH +++GHIINLFFE++ E   +QPTFVYGHP+++SPLSK+   +P FT+RFEL I+  E+ NAF+ELNDPIDQ +RFEAQ+ EK  GN+EA EMD DF+EALEYGLPPT G+G+GIDR +ML T + +IR+VLLFPHMK++
  S:     3 KLTEQEKIRRQKMEDLRAMGVDPFG-QAYKRTHKSGQIRAEYENCSKEELADKAVNVKIAGRIMTKRRQGKAGFMHIQDLDGKIQIYVRKDEIGEEQYEIFKKS-DIGDIVGIEGQVMKTDHGELSVRAKVYTHLSKSLRPLPEKFHGLQDVEERYRRRYVDLIMNPEAKRIALMRPRIIRAIQRYLDGKGLVEVETPVLQPILGGANARPFVTHHNTLDMDFYMRIATELPLKRLIVGGLEGVYEIGRLFRNEGMDKNHNPEFTTVEAYVAYSDMEGMMELTEGLMENVAFDVLGTTDVTWREKEISLKAPFKRLHMVDGIKEACGVDFWQEMSYEDALALAKEHDIEVEKHHTSVGHIINLFFEKYVEDTIVQPTFVYGHPVEISPLSKRCPDDPRFTERFELLIDGAEFCNAFSELNDPIDQKQRFEAQLAEKENGNEEACEMDTDFVEALEYGLPPTGGVGIGIDRFVMLLTGQDTIREVLLFPHMKNR 493
>gi|83319783|ref|YP_424778.1| lysyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123767562|sp|Q2SR35|SYK_MYCCT Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|83283669|gb|ABC01601.1| lysyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (500 aa)
Score = 1288, Expect = 9.2e-140, Identities = 258/488 (52%), Positives = 358/488 (73%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHN----TNNNIKLAGRVVALRQT-----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +RKF++QEL+RR K KNL + N+DPY+I    R  T+   N K+           T   + +AGR+   R+      F  I D     Q Y+   ++ +   E F + LDLGDI+ + G+  RT  GEL++  K++ ++SKAL+PLP+K  G++D E + R RYVDLI+N D  K F  R +I++ ++ F+D++ Y+EVETP+LH + GGA+A+PF+T +N L  + YLRIATEL LK+LIVGGF+ VYEIGRIFRNEGM + HNPEFTS+E+Y AYE+M ++M LTE +F+    ++    V++    +I L++ F+R+HMVD IKQ TGVDFW+  + ++A ELAKKHNV  EKHQ ++GHIINLF+EEF E+  ++PTFVYGHP ++SPL+K +  +P FT RFELFI  +EYANAF+ELNDPIDQYERF+AQ++E+S GNDEA +MD+DF+EALE+ +PPTAG+G+GIDR++ML T   SI+DVLLFP MK K+
  S:     4 DRKFSEQELVRRNKYKNLVDQNKDPYKITNWKRNTTLLKLNEKYKDYSKEELLNLTQELVIVAGRIKLYREAGKKAAFVNIDDQDSSIQLYVRLDEIGQEAFEDF-RDLDLGDIIGVKGNMMRTDHGELSIRCKEVVLLSKALRPLPDKHAGIQDIEEKYRRRYVDLIMNHDVRKTFQARTKIIRTMQNFLDNRGYMEVETPILHSLKGGASAKPFVTHYNVLNTDVYLRIATELHLKRLIVGGFEGVYEIGRIFRNEGMSTRHNPEFTSIELYVAYEDMFFLMDLTEEIFRVCNSAVNSSSVIEYNNVKIDLSKPFKRLHMVDGIKQVTGVDFWQEMTVEQALELAKKHNVYVEKHQESVGHIINLFYEEFVESTIVEPTFVYGHPKEISPLAKSNPNDPRFTDRFELFIIGREYANAFSELNDPIDQYERFKAQLEEESKGNDEANDMDIDFVEALEHAMPPTAGIGIGIDRLVMLLTNCDSIKDVLLFPQMKPKE 500
>gi|22536914|ref|NP_687765.1| lysyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|25010826|ref|NP_735221.1| lysyl-tRNA synthetase [Streptococcus agalactiae NEM316] >gi|76798749|ref|ZP_00780967.1| lysyl-tRNA synthetase [Streptococcus agalactiae 18RS21] >gi|77405989|ref|ZP_00783067.1| lysyl-tRNA synthetase [Streptococcus agalactiae H36B] >gi|77410771|ref|ZP_00787129.1| lysyl-tRNA synthetase [Streptococcus agalactiae CJB111] >gi|77413074|ref|ZP_00789275.1| lysyl-tRNA synthetase [Streptococcus agalactiae 515] >gi|39932195|sp|Q8E0I1|SYK_STRA5 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|39932198|sp|Q8E656|SYK_STRA3 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|22533765|gb|AAM99637.1|AE014225_20 lysyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|23095205|emb|CAD46415.1| lysyl-tRNA synthetase [Streptococcus agalactiae NEM316] >gi|76585904|gb|EAO62444.1| lysyl-tRNA synthetase [Streptococcus agalactiae 18RS21] >gi|77160867|gb|EAO71977.1| lysyl-tRNA synthetase [Streptococcus agalactiae 515] >gi|77163150|gb|EAO74103.1| lysyl-tRNA synthetase [Streptococcus agalactiae CJB111] >gi|77175384|gb|EAO78175.1| lysyl-tRNA synthetase [Streptococcus agalactiae H36B] (496 aa)
Score = 1285, Expect = 2.1e-139, Identities = 265/483 (54%), Positives = 342/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT T G  N K+A   K   H+      +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R R++DLI N+DS   FV R +I+  IR+FMDS  +LEVETPVLH   GGA+ARPFIT HN  + +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+E Y AY + + +M LTE + ++V K++K   P+   G  EI + + F+R+HMVD +K+ TG+DFW+  + +EAQ LA++ NV  EKH +T+GHIIN FFEEF E   IQPTFV+GHP++VSPL+KK+  +P FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ   K LG+DEA  +D D++EALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALTEQGIDPFG-KRFERTATSGQLNEKYADKSKEDLHDIEETATIAGRLMTKRGKGKVGFAHIQDREGQIQIYVRKDSVGEENYEIFKKA-DLGDFLGVEGQVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDIETIYRKRHLDLISNRDSFDRFVTRSKIISEIRRFMDSNGFLEVETPVLHNEAGGASARPFITHHNAQDIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEAYQAYADYQDIMDLTEGIIQHVTKTVKGDGPINYQG-TEIKINEPFKRVHMVDAVKEITGIDFWKEMTLEEAQALAQEKNVPLEKHFTTVGHIINAFFEEFVEDTLIQPTFVFGHPVEVSPLAKKNDTDPRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQASAKELGDDEATGVDYDYVEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|50364845|ref|YP_053270.1| lysyl tRNA synthetase [Mesoplasma florum L1] >gi|50363401|gb|AAT75386.1| lysyl tRNA synthetase [Mesoplasma florum L1] (499 aa)
Score = 1284, Expect = 2.8e-139, Identities = 260/487 (53%), Positives = 351/487 (72%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHN----TNNNIKLAGRVVALRQT-----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ERKF +QEL+RR KL+ L E   +PYE+ K  RT ++ +    F   +           I +AGR+   R+      F  I D   D Q Y+ + ++  +    F + LDLGDIV   G   +T  GEL+L  K+  ++SKAL+PLP+K  G++D E + R RYVDLI N +S +VF  R +I++ ++Q +D + Y+EVETP+LH + GGA A+PFIT +N L+ + YLRIATEL LK+LIVGGFD VYEIGRIFRNEGM + HNPEFTS+E+Y AYE+M ++M LTE +F+    ++ +  V++ G +++ L++ F+R+HMVD IKQ TGVDFW+  + +EA ELAKKHNV  EKH  T+GHIINLF+EEF E+  I+PTFVYGHP ++SPLSK + ++  FT RFELFI  +EYANAF+ELNDPIDQY+RF  Q+KE + GNDEA EMD+DFIEALE+ +PPTAG+G GIDR++ML T   SI+DVLLFP +K +
  S:     3 ERKFTEQELVRRAKLEKLIENKSNPYEVSKYVRTHSLKELIELFGGYEKDELATLQQTEISIAGRIKLYREAGNKAAFLNIEDQDSDIQVYVRQDEIGDAAFANFRE-LDLGDIVGFKGIMMKTNHGELSLRAKEYTLLSKALRPLPDKHAGIQDIEEKYRRRYVDLITNPESKRVFQARTKIIRTMQQILDERGYMEVETPILHSVKGGAAAKPFITHYNALDVDVYLRIATELHLKRLIVGGFDGVYEIGRIFRNEGMSTRHNPEFTSLELYVAYEDMFFLMDLTEEIFRKCNAAVNESSVIEYGGHKLDLSKPFKRLHMVDGIKQVTGVDFWKEMTVEEALELAKKHNVHVEKHNYTVGHIINLFYEEFVESTIIEPTFVYGHPKEISPLSKSNAEDSRFTDRFELFIVGREYANAFSELNDPIDQYDRFNEQIKEAAAGNDEATEMDIDFIEALEHAMPPTAGIGFGIDRLVMLLTNSESIKDVLLFPQLKPR 498
>gi|76787024|ref|YP_329498.1| lysyl-tRNA synthetase [Streptococcus agalactiae A909] >gi|123602016|sp|Q3K1V5|SYK_STRA1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|76562081|gb|ABA44665.1| lysyl-tRNA synthetase [Streptococcus agalactiae A909] (496 aa)
Score = 1283, Expect = 3.2e-139, Identities = 264/483 (54%), Positives = 342/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT T G  N K+A   K   H+      +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R R++DLI N+DS   FV R +I+  IR+FMDS  +LEVETPVLH   GGA+ARPFIT HN  + +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+E Y AY + + +M LTE + ++V K++K   P+   G  EI + + F+R+HMVD +K+ TG+DFW+  + +EAQ LA++ NV  EKH +T+GHIIN FFEEF E   IQPTFV+GHP++VSPL+KK+  +P FT RFELF+ TKEYANAF ELNDPIDQ  RFEAQ   K LG+DEA  +D D++EALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALTEQGIDPFG-KRFERTATSGQLNEKYADKSKEDLHDIEETATIAGRLMTKRGKGKVGFAHIQDREGQIQIYVRKDSVGEENYEIFKKA-DLGDFLGVEGQVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDIETIYRKRHLDLISNRDSFDRFVTRSKIISEIRRFMDSNGFLEVETPVLHNEAGGASARPFITHHNAQDIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEAYQAYADYQDIMDLTEGIIQHVTKTVKGDGPINYQG-TEIKINEPFKRVHMVDAVKEITGIDFWKEMTLEEAQALAQEKNVPLEKHFTTVGHIINAFFEEFVEDTLIQPTFVFGHPVEVSPLAKKNDTDPRFTDRFELFVMTKEYANAFTELNDPIDQLSRFEAQASAKELGDDEATGVDYDYVEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|171326426|ref|ZP_02914902.1| lysyl-tRNA synthetase [Geobacillus sp. WCH70] >gi|171087604|gb|EDT33979.1| lysyl-tRNA synthetase [Geobacillus sp. WCH70] (494 aa)
Score = 1283, Expect = 3.8e-139, Identities = 255/485 (52%), Positives = 348/485 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ L+RREKL  L+E   DP+    E+  +   + D     +K +       + +AGR++  R      F  I+D  G  Q Y+ +  V +   E F K  DLGDI+ ++G+ F+T+ GEL++ V   + ++KAL+PLPEK+HGL+D E R R RY+DLI+N +S   F+ R RI++ +R+++DS  YLEVETP++H I GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M+LTENL  ++A+  L    ++ GE+ + LT +++R+HMVD IK+  GVDFW+  S++EA+ELAK+H V+   H  T GHI+N FFE+  E K IQPTF+YGHP+++SPL+KK+  +P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA EMD DFIEALEYG+PPT GLG+G+DR++ML T   SIRDVLLFP M++K
  S:     5 ELNDQLLVRREKLNKLREMGIDPFGKRFERTHKAKELFDLYGDLSKEELEEKQIKVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVREDTVGEEQYELF-KTSDLGDIIGVYGTVFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKNTFITRSRIIQAMRRYLDSHGYLEVETPMMHSIAGGAAARPFITHHNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIAQEVLGTTKIQYGEHTVDLTPEWKRLHMVDAIKEYVGVDFWKQMSDEEARELAKEHGVEIAPHM-TFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREQGNDEAHEMDEDFIEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRNK 494
>gi|188159718|ref|ZP_02998835.1| Lysine-tRNA ligase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (500 aa)
Score = 1278, Expect = 1.2e-138, Identities = 259/488 (53%), Positives = 355/488 (72%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNN-IKLAGRVVALRQT-----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +RKF++QEL+RR K K L E N+DPY+I    R  T+   N K+   +K    N N   + +AGR+   R+      F  I D     Q Y+   ++     E F    DLGDI+ + G   RT  GEL++  K++ ++SKAL+PLP+K  G++D E + R RYVDLI+N D  K F  R +I++ ++ F+D++ Y+EVETP+LH + GGA+A+PFIT +N L  + YLRIATEL LK+LIVGGF+ VYEIGRIFRNEGM + HNPEFTS+E+Y AYE+M ++M LTE +F+    ++    +++    +I L++ F+R+HMVD IKQ TGVDFW+  + Q+A ELAKKH V  EKHQ ++GHIINLF+EEF E+  ++PTFVYGHP ++SPL+K +  +P FT RFELFI  +EYANAF+ELNDPIDQYERF+AQ++E+S GNDEA +MD+DFIEALE+ +PPTAG+G+GIDR++ML T   SI+DVLLFP MK ++
  S:     4 DRKFSEQELVRRNKYKTLVEQNKDPYKITNWKRNTTLLKLNEKYKDYSKEDLLNLNQELVVVAGRIKLYREAGKKAAFVNIDDQDSSIQLYVRLDEIGDQSFEDFRN-FDLGDIIGVKGIMMRTDHGELSIRCKEVVLLSKALRPLPDKHAGIQDIEEKYRRRYVDLIMNHDVRKTFQARTKIIRTLQNFLDNKGYMEVETPILHSLKGGASAKPFITHYNVLNTDVYLRIATELHLKRLIVGGFEGVYEIGRIFRNEGMSTRHNPEFTSIELYVAYEDMFFLMDLTEEIFRVCNAAVNSSSIIEYNNVKIDLSKPFKRLHMVDGIKQVTGVDFWQEMTVQQALELAKKHKVHVEKHQESVGHIINLFYEEFVESTIVEPTFVYGHPKEISPLAKSNPSDPRFTDRFELFILGREYANAFSELNDPIDQYERFKAQIEEESKGNDEANDMDIDFIEALEHAMPPTAGIGIGIDRLVMLLTNSESIKDVLLFPQMKPRE 500
>gi|42560629|ref|NP_975080.1| lysine-tRNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81400864|sp|Q6MUG2|SYK_MYCMS Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|42492125|emb|CAE76722.1| Lysine-tRNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (500 aa)
Score = 1278, Expect = 1.3e-138, Identities = 259/487 (53%), Positives = 354/487 (72%)
  Q:     3 RKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNN-IKLAGRVVALRQT-----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           RKF++QEL+RR K K L E N+DPY++    R  T+   N K+   +K    N N   + +AGR+   R+      F  I D     Q Y+   ++     E F    DLGDI+ + G   RT  GEL++  K++ ++SKAL+PLP+K  G++D E + R RYVDLIVN D  K F  R +I++ ++ F+D++ Y+EVETP+LH + GGA+A+PFIT +N L  + YLRIATEL LK+LIVGGF+ VYEIGRIFRNEGM + HNPEFTS+E+Y AYE+M ++M LTE +F+    ++    +++    +I L++ F+R+HMVD IKQ TGVDFW+  + Q+A ELAKKH V  EKHQ ++GHIINLF+EEF E+  ++PTFVYGHP ++SPL+K +  +P FT RFELFI  +EYANAF+ELNDPIDQYERF+AQ++E+S GNDEA +MD+DFIEALE+ +PPTAG+G+GIDR++ML T   SI+DVLLFP MK ++
  S:     5 RKFSEQELVRRNKYKTLVEQNKDPYKVTNWKRNTTLLKLNEKYKDYSKEDLLNLNQELVVVAGRIKLYREAGKKAAFVNIDDQDSSIQLYVRLDEIGDQSFEDFRN-FDLGDIIGVKGIMMRTDHGELSIRCKEVVLLSKALRPLPDKHAGIQDIEEKYRRRYVDLIVNHDVRKTFQARTKIIRTLQNFLDNKGYMEVETPILHSLKGGASAKPFITHYNVLNTDVYLRIATELHLKRLIVGGFEGVYEIGRIFRNEGMSTRHNPEFTSIELYVAYEDMFFLMNLTEEIFRVCNAAVNSNSIIEYNNVKIDLSKPFKRLHMVDGIKQVTGVDFWKEMTVQQALELAKKHKVHVEKHQESVGHIINLFYEEFVESTIVEPTFVYGHPKEISPLAKSNPSDPRFTDRFELFILGREYANAFSELNDPIDQYERFKAQIEEESKGNDEANDMDIDFIEALEHAMPPTAGIGIGIDRLVMLLTNSESIKDVLLFPQMKPRE 500
>gi|77409348|ref|ZP_00786050.1| lysyl-tRNA synthetase [Streptococcus agalactiae COH1] >gi|77172050|gb|EAO75217.1| lysyl-tRNA synthetase [Streptococcus agalactiae COH1] (496 aa)
Score = 1277, Expect = 1.6e-138, Identities = 264/483 (54%), Positives = 341/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT T G  N K+A   K   H+      +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R R++DLI N+DS   FV R +I+  IR+FMDS  +LEVETPVLH   GGA+ARPFIT HN  + +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+E Y AY + + +M LTE + ++V K++K   P+   G  EI + + F+R+HMVD +K+ T +DFW+  + +EAQ LA++ NV  EKH +T+GHIIN FFEEF E   IQPTFV+GHP++VSPL+KK+  +P FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ   K LG+DEA  +D D++EALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALTEQGIDPFG-KRFERTATSGQLNEKYADKSKEDLHDIEETATIAGRLMTKRGKGKVGFAHIQDREGQIQIYVRKDSVGEENYEIFKKA-DLGDFLGVEGQVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDIETIYRKRHLDLISNRDSFDRFVTRSKIISEIRRFMDSNGFLEVETPVLHNEAGGASARPFITHHNAQDIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEAYQAYADYQDIMDLTEGIIQHVTKTVKGDGPINYQG-TEIKINEPFKRVHMVDAVKEITDIDFWKEMTLEEAQALAQEKNVPLEKHFTTVGHIINAFFEEFVEDTLIQPTFVFGHPVEVSPLAKKNDTDPRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQASAKELGDDEATGVDYDYVEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|110003925|emb|CAK98265.1| lysyl-trna synthetase protein [Spiroplasma citri] (500 aa)
Score = 1271, Expect = 8.3e-138, Identities = 250/487 (51%), Positives = 353/487 (72%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLK-----THNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           +R F +QE IRR+KLK L     +P+ I K  RT T    N +F  L      T + N  +K+AGR+   R+    +F  ++D  G  Q Y+   +V     + F    DLGDI+ + G   +T  GELT+ VK+  +++KAL+ LP+K+ G+ D E + R RYVDLI + ++  +F+ R +I+ ++R F +S+ YLEVETPVL PI GGA A+PF+T HNTL+ +FYLR+ATELPLK+LIVGGF+ VYE+GR+FRNEGMD+ HNPEFT++E+Y AY++M +MM+LTE+   Y+AK+ L K   +     I   Q ++R HMVD IK+  G+DFW+  +  EA++++K+  V  EK  +++GHIINLFFEEF E K IQPTF+YGHP++VSPL+K + ++P FT RFELFI  +EYANA++ELN+P++QY+RF +Q+ E+  GNDEA E+D+DFIEALEYG+PPT GLG+GIDR++ML T + SI+DVLLFPHM+ +
  S:     3 KRNFTEQEQIRRDKLKKLVNDGHNPFIIAKFDRTHTSKVLNEQFNHLSKEILATSSDNMTVKIAGRIKTFREVGKASFATVQDQNGIFQIYVRNDEVGDEKYQEFIN-FDLGDIIGVTGIMMKTNTGELTVRVKEFVLLAKALRALPDKYRGMTDIEEKYRRRYVDLITSTETKDIFIKRSKIIALMRDFFNSKGYLEVETPVLQPIHGGAAAKPFVTHHNTLDMDFYLRVATELPLKRLIVGGFEGVYEMGRLFRNEGMDTRHNPEFTTVEIYVAYQDMNFMMQLTEDTICYIAKNILNKNETEYDGVMISFQQPWKRWHMVDAIKELVGIDFWKPMTFAEAKKISKEKKVPIEKFHTSVGHIINLFFEEFVEDKLIQPTFIYGHPVEVSPLAKTNAEDPRFTDRFELFIKGREYANAYSELNNPVEQYDRFVSQLAERDNGNDEAQELDIDFIEALEYGMPPTGGLGIGIDRLVMLLTGQDSIKDVLLFPHMRSR 498
>gi|146318173|ref|YP_001197885.1| lysyl-tRNA synthetase [Streptococcus suis 05ZYH33] >gi|146320358|ref|YP_001200069.1| lysyl-tRNA synthetase [Streptococcus suis 98HAH33] >gi|166230593|sp|A4VZY0|SYK_STRS2 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|166230595|sp|A4VTP6|SYK_STRSY Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|145688979|gb|ABP89485.1| Lysyl-tRNA synthetase (class II) [Streptococcus suis 05ZYH33] >gi|145691164|gb|ABP91669.1| Lysyl-tRNA synthetase (class II) [Streptococcus suis 98HAH33] (496 aa)
Score = 1270, Expect = 9.9e-138, Identities = 262/483 (54%), Positives = 341/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  R+    +  +++   +K           +AGR++  R      F  I+D  G  Q Y+ K  VS+   E F K  DLGD + + G  F+T  GEL++  +K+  +SKAL+PLPEK+HGL D E R R RY+DLI N++S   FV R +I+  IR+++D   +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AK++    PV   G  EI + + F+RIHMVD IK++TGVDFW+  S +EA+ LA +H V  EKH + +G IIN FFEE+ EA  IQPTFVYGHP+ VSPL+KK+ ++P FT RFELFI TKEY NAF ELNDPIDQ ERFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMTALAEQGIDPFG-KRFERSANSAELKAQYEDKSKEDLEELGQTAIIAGRIMTKRGKGKAGFAHIQDREGQIQIYVRKDDVSEENYEIFKKA-DLGDFIGVEGDVFKTNVGELSIHARKLTHLSKALRPLPEKFHGLTDIETRYRKRYLDLITNRESFDRFVTRSKIISEIRRYLDGLGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYQDIMDLTEGIIQHTAKAVVGDGPVTYQG-TEIAIHEPFKRIHMVDAIKEQTGVDFWQEMSFEEAKALAAEHKVPVEKHHTEVGQIINSFFEEYVEATLIQPTFVYGHPVAVSPLAKKNDEDPRFTDRFELFIMTKEYGNAFTELNDPIDQLERFEAQAKAKELGDDEATGVDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|46906461|ref|YP_012850.1| lysyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] >gi|153165206|ref|ZP_01926208.1| lysyl-tRNA synthetase [Listeria monocytogenes FSL N1-017] >gi|153200663|ref|ZP_01942770.1| lysyl-tRNA synthetase [Listeria monocytogenes HPB2262] >gi|167013682|ref|ZP_02276215.1| lysyl-tRNA synthetase [Listeria monocytogenes FSL J1-194] >gi|67461802|sp|Q724I4|SYK_LISMF Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|46879725|gb|AAT03027.1| lysyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] >gi|133728405|gb|EBA30103.1| lysyl-tRNA synthetase [Listeria monocytogenes FSL N1-017] >gi|133736611|gb|EBA38309.1| lysyl-tRNA synthetase [Listeria monocytogenes HPB2262] (498 aa)
Score = 1268, Expect = 2.1e-137, Identities = 263/485 (54%), Positives = 343/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA   K +       + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MD+Q +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE  + LT  +RRIHM D +K+  GVDFW V S++EA+ELAKKHNV   +H  T GHI+N FFE + E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+GIDR++ML T+  SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAVF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTEITYGEYNVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEARELAKKHNVPVTEHM-TYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKEDDRFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHR 497
>gi|55822661|ref|YP_141102.1| lysyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] >gi|55738646|gb|AAV62287.1| lysyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] (511 aa)
Score = 1268, Expect = 2.2e-137, Identities = 261/483 (54%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT T G    K+A   K + H  N    +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S   FV R +I+  IR+++D+Q +LEVETPVLH   GGA A+PFIT HN    +  LRIATEL LK+LIVGG ++VYEIGR+FRNEGMD+THNPEFT++EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+RIHMVD IK+ TGVDFW+  + +EA+ +A + NV  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++P FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ   K LG+DEA  +D D++EALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:    23 ELNDQQIVRREKMAALAEQGIDPFG-KRFERTATSGQLKEKYADKTKEELHEINETATIAGRLMTKRGKGKVGFAHIQDRDGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEIMRTDMGELSIKATHITHLSKALRPLPEKFHGLSDIETIYRKRYLDLISNRESFDRFVTRSKIISEIRRYLDAQGFLEVETPVLHNEAGGAAAKPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRVFRNEGMDATHNPEFTTIEVYQAYADFHDIMNLTEGIIQHAAKAVKGDGPINYQG-TEIKINEPFKRIHMVDAIKEITGVDFWQDMTLEEAKAVAAEKNVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDPRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAAAKELGDDEATGIDYDYVEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 511
>gi|47093173|ref|ZP_00230948.1| lysyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] >gi|47018480|gb|EAL09238.1| lysyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] (498 aa)
Score = 1267, Expect = 2.7e-137, Identities = 263/485 (54%), Positives = 343/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA   K +       + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MD+Q +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE  + LT  +RRIHM D +K+  GVDFW V S++EA+ELAKKHNV   +H  T GHI+N FFE + E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+GIDR++ML T+  SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAVF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTEITYGEYNVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEARELAKKHNVPVTEHM-TYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKEDDRFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKRR 497
>gi|55820759|ref|YP_139201.1| lysyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] >gi|55736744|gb|AAV60386.1| lysyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] (511 aa)
Score = 1267, Expect = 2.7e-137, Identities = 261/483 (54%), Positives = 337/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT T G    K+A   K + H  N    +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S   FV R +I+  IR+++D+Q +LEVETPVLH   GGA A+PFIT HN    +  LRIATEL LK+LIVGG ++VYEIGR+FRNEGMD+THNPEFT++EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+RIHMVD IK+ TGVDFW+  +  EA+ +A + NV  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++P FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ   K LG+DEA  +D D++EALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:    23 ELNDQQIVRREKMAALAEQGIDPFG-KRFERTATSGQLKEKYADKTKEELHEINETATIAGRLMTKRGKGKVGFAHIQDRDGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEIMRTDMGELSIKATHITHLSKALRPLPEKFHGLSDIETIYRKRYLDLISNRESFDRFVTRSKIISEIRRYLDAQGFLEVETPVLHNEAGGAAAKPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRVFRNEGMDATHNPEFTTIEVYQAYADFHDIMNLTEGIIQHAAKAVKGDGPINYQG-TEIKINEPFKRIHMVDAIKEITGVDFWQDMTLDEAKAIAAEKNVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDPRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAAAKELGDDEATGIDYDYVEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 511
>gi|157151486|ref|YP_001450052.1| lysyl-tRNA synthetase [Streptococcus gordonii str. Challis substr. CH1] >gi|189082972|sp|A8AW92|SYK_STRGC Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|157076280|gb|ABV10963.1| lysyl-tRNA synthetase [Streptococcus gordonii str. Challis substr. CH1] (496 aa)
Score = 1266, Expect = 3.5e-137, Identities = 263/483 (54%), Positives = 339/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ++IRREK+  L E   DP+  ++  RT   G    K+A   K + H+  +   +AGR++  R      F  I+D  G  Q Y+ K +V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S   FV R +I+  IR+++D Q +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ A S+    P+   G  EI + + F+R+HMVD IK+ TGVDFW+  S +EA  LAK+ NV  EKH + +GH+IN FFEEF E    QPTF+YGHP+ VSPL+KK+ ++P FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D++EALEYG+PPT GLG+GIDR++ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIIRREKMAALAEQGIDPFG-KRFERTANSGQLKEKYADKSKEELHDLADTATIAGRLMTKRGKGKVGFAHIQDREGQIQIYVRKDEVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFNRFVTRSKIISEIRRYLDGQGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAISVCGDGPINYQG-TEIKINEPFKRVHMVDAIKEITGVDFWQDMSFEEATALAKEKNVPLEKHFTEVGHVINAFFEEFVEETLTQPTFIYGHPVAVSPLAKKNPEDPRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYVEALEYGMPPTGGLGIGIDRLVMLLTDVTTIRDVLLFPTMK 496
>gi|116871612|ref|YP_848393.1| lysyl-tRNA synthetase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123460668|sp|A0AF28|SYK_LISW6 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|116740490|emb|CAK19610.1| lysS [Listeria welshimeri serovar 6b str. SLCC5334] (498 aa)
Score = 1266, Expect = 3.5e-137, Identities = 261/485 (53%), Positives = 343/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA   K +       + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++      ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MDSQ +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE ++ LT  +RR+HM D +K+  GVDFW V S++EA+ELAKKH+V   +H  T GHI+N FFE + E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+G+DR++ML T+  SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAIF-KLADLGDIIGIKGTIFRTNTGELSVKATDFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDSQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTEITYGEYKVDLTPNWRRVHMADVVKEYVGVDFWNVTSDEEARELAKKHDVAITEHM-TYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKEDERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGVDRLVMLLTDAPSIRDILLFPTMKHR 497
>gi|16799337|ref|NP_469605.1| lysyl-tRNA synthetase [Listeria innocua Clip11262] >gi|38258397|sp|Q92F47|SYK_LISIN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|16412689|emb|CAC95493.1| lysyl-tRNA synthetase [Listeria innocua] (498 aa)
Score = 1265, Expect = 4.3e-137, Identities = 261/485 (53%), Positives = 342/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN---NIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA     +       + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MD+Q +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE ++ LT  +RRIHM D +K+  GVDFW V S++EA ELAKKH+V   +H  T GHI+N FFE + E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+GIDR++ML T+  SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEDLEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAIF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTKITYGEYDVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEAHELAKKHDVAVTEHM-TYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKEDERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHR 497
>gi|81097344|ref|ZP_00875636.1| Lysyl-tRNA synthetase, class-2 [Streptococcus suis 89/1591] >gi|80976608|gb|EAP40199.1| Lysyl-tRNA synthetase, class-2 [Streptococcus suis 89/1591] (496 aa)
Score = 1264, Expect = 5.8e-137, Identities = 261/483 (54%), Positives = 340/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  R+    +  +++   +K +         +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + + G  F+T  GEL++  +K+  +SKAL+PLPEK+HGL D E R R RY+DLI N++S   FV R +I+  IR+++D   +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK++    PV   G  EI + + F+RIHMVD IK++TGVDFW+  S +EA+ LA +H V  EKH + +G IIN FFEE+ EA  IQPTFVYGHP+ VSPL+KK+ ++P FT RFELFI TKEY NAF ELNDPIDQ ERFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMTALAEQGIDPFG-KRFERSANSAELKAQYEDKSKEELEELGQTAIIAGRIMTKRGKGKAGFAHIQDREGQIQIYVRKDDVGEENYEIFKKA-DLGDFIGVEGDVFKTNVGELSIHARKLTHLSKALRPLPEKFHGLTDIETRYRKRYLDLITNRESFDRFVTRSKIISEIRRYLDGLGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMDLTEGIIQHTAKAVVGDGPVTYQG-TEIAIHEPFKRIHMVDAIKEQTGVDFWQEMSFEEAKALAAEHKVPVEKHHTEVGQIINSFFEEYVEATLIQPTFVYGHPVAVSPLAKKNDEDPRFTDRFELFIMTKEYGNAFTELNDPIDQLERFEAQAKAKELGDDEATGVDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|16802274|ref|NP_463759.1| lysyl-tRNA synthetase [Listeria monocytogenes EGD-e] >gi|167211264|ref|ZP_02281571.1| lysyl-tRNA synthetase [Listeria monocytogenes LO28] >gi|38258394|sp|Q8YAB8|SYK_LISMO Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|16409593|emb|CAD00755.1| lysyl-tRNA synthetase [Listeria monocytogenes] (498 aa)
Score = 1262, Expect = 8.5e-137, Identities = 262/485 (54%), Positives = 344/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA   K +       + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MD+Q +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE ++ LT  +RRIHM D +K+  GVDFW V S++EA+ELAKKH+V   +H  T GHI+N FFE + E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+GIDR++ML T+  SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAVF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTEITYGEYKVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEARELAKKHDVPVTEHM-TYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKEDERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHR 497
>gi|56418609|ref|YP_145927.1| lysyl-tRNA synthetase [Geobacillus kaustophilus HTA426] >gi|56378451|dbj|BAD74359.1| lysyl-tRNA synthetase (lysine--tRNA ligase) [Geobacillus kaustophilus HTA426] (494 aa)
Score = 1261, Expect = 1.3e-136, Identities = 251/485 (51%), Positives = 345/485 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RREKLK ++E   DP+    E+  +   + +     +K +       + +AGR++  R      F  I+D  G  Q Y+ +  V +   E F K+ DLGDIV + G+ F+T+ GEL++ V   + ++KAL+PLPEK+HGL+D E R R RY+DLI+N +S K F+ R  I++ +R+++DS+ YLEVETP++H + GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTENL  ++A   L    ++ GE+ + LT ++RR+HMVD IK+  GVDFW   S++EA+ELAK+H V+   H  T GHI+N FFE+  E+  IQPTF+YGHP+++SPL+KK+  +P FT RFELFI  +E+ANAF ELNDPIDQ +RFEAQ+KE+  GNDEA EMD DF+EALEYG+PPT GLG+G+DR++ML T   SIRDVLLFP M+ K
  S:     5 ELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAQELFELYGDLSKEELEEKQIEVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF-KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSRGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMELTENLIAHIATEVLGTTKIQYGEHVVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPHM-TFGHIVNEFFEQKVESHLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK 494
>gi|47097268|ref|ZP_00234828.1| lysyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] >gi|153172874|ref|ZP_01928848.1| lysyl-tRNA synthetase [Listeria monocytogenes FSL N3-165] >gi|153177883|ref|ZP_01931647.1| lysyl-tRNA synthetase [Listeria monocytogenes F6900] >gi|153186920|ref|ZP_01936975.1| lysyl-tRNA synthetase [Listeria monocytogenes J0161] >gi|47014368|gb|EAL05341.1| lysyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] >gi|126940888|gb|EBA18798.1| lysyl-tRNA synthetase [Listeria monocytogenes J0161] >gi|133731398|gb|EBA33096.1| lysyl-tRNA synthetase [Listeria monocytogenes FSL N3-165] >gi|133733907|gb|EBA35605.1| lysyl-tRNA synthetase [Listeria monocytogenes F6900] (498 aa)
Score = 1261, Expect = 1.3e-136, Identities = 262/485 (54%), Positives = 343/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA   K +       + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MD+Q +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE ++ LT  +RRIHM D +K+  GVDFW V S++EA ELAKKH+V   +H  T GHI+N FFE + E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+GIDR++ML T+  SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAVF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTEITYGEYKVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEALELAKKHDVPVTEHM-TYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKEDERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHR 497
>gi|153198614|ref|ZP_01942539.1| lysyl-tRNA synthetase [Listeria monocytogenes 10403S] >gi|127631903|gb|EBA21630.1| lysyl-tRNA synthetase [Listeria monocytogenes 10403S] (498 aa)
Score = 1259, Expect = 1.9e-136, Identities = 261/485 (53%), Positives = 343/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA   K +       + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MD+Q +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE ++ LT  +RRIHM D +K+  GVDFW V S++EA ELAKKH+V   +H  T GHI+N FFE + E K +QPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+GIDR++ML T+  SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAVF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTEITYGEYKVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEALELAKKHDVPVTEHM-TYGHILNEFFETYVEEKLVQPTFVYGHPVEISPLAKKNKEDERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHR 497
>gi|168264867|ref|ZP_02686832.1| lysyl-tRNA synthetase [Listeria monocytogenes FSL J2-071] (498 aa)
Score = 1259, Expect = 2.3e-136, Identities = 261/485 (53%), Positives = 341/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREK+  L+E   DP+  EK  R+++  +  +KFA         +   + +AGR++  R      F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MDSQ +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE ++ LT  +RRIHM D +K+  GVDFW V S++EA+ELAKKH+V   +H  T GHI+N FFE   E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+G+DR++ML T   SIRD+LLFP MK +
  S:     8 ELNDQLIVRREKVDTLREEGIDPFG-EKFIRSISPEEIETKFADKSKEELEEDAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAYAIF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDSQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMNLVEGLVSTVCKQVNGTTEITYGEYKVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEARELAKKHDVPVTEHM-TYGHILNEFFETHVEEKLIQPTFVYGHPVEISPLAKKNKEDERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGVDRLVMLLTNAPSIRDILLFPTMKHR 497
>gi|24379232|ref|NP_721187.1| lysyl-tRNA synthetase [Streptococcus mutans UA159] >gi|39932192|sp|Q8DUW8|SYK_STRMU Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|24377146|gb|AAN58493.1|AE014919_1 lysyl-tRNA synthetase [Streptococcus mutans UA159] (496 aa)
Score = 1258, Expect = 3.2e-136, Identities = 255/483 (52%), Positives = 340/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK++ L E   DP+  ++  RT T G    K+A   K + H+ N    +AGR++  R      F  ++D  G  Q Y+ K  V     + F K  D+GD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S++ F+ R +I+  IR+++D   +LEVETPVLH   GGA A+PF T HN  + +  LRIATEL LK+LIVGG ++VYE+GRIFRNEGMD+THNPEFTS+EVY AY + E +M LTE + ++ A ++K   P+   G  EI + + F+R H+VD IK+ TGVDFW+  +  EAQ LA++ NV  EKH +++GHIIN FFEEF E   IQP FVYGHP++VSPL+KK+  +P FT RFELFI TKEY NAF ELNDPIDQ ERF+AQ   K LG+DEA  +D D++EALEYG+PPT GLG+GIDR++ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMEALTEQGIDPFG-KRFERTATSGQLKEKYADKTKEELHDINETATIAGRLMTKRGKGKVGFAHLQDREGQIQIYVRKDTVGDDNYQIFKKA-DIGDFLGVEGEIMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESLERFITRSKIISEIRRYLDGLGFLEVETPVLHNEAGGAAAKPFTTHHNAQDMDMVLRIATELHLKRLIVGGMERVYEMGRIFRNEGMDATHNPEFTSIEVYQAYADFEDIMDLTEGIVQHAATAVKGDGPITYQG-TEIKINEPFKRAHIVDLIKEVTGVDFWKEMTLAEAQALAQEKNVPLEKHYTSVGHIINAFFEEFVEETLIQPIFVYGHPVEVSPLAKKNADDPRFTDRFELFIMTKEYGNAFTELNDPIDQLERFKAQAAAKELGDDEATGIDYDYVEALEYGMPPTGGLGIGIDRLVMLLTDTTTIRDVLLFPTMK 496
>gi|11387152|sp|Q9RHV9|SYK_BACST Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|6681368|dbj|BAA88691.1| lysyl-tRNA synthetase [Geobacillus stearothermophilus] (494 aa)
Score = 1256, Expect = 4.8e-136, Identities = 251/485 (51%), Positives = 344/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RREKLK ++E   DP+    E+  +   + +     +K +       + +AGR++  R      F  I+D  G  Q Y+ +  V +   E F K+ DLGDIV + G+ F+T+ GEL++ V   + ++KAL+PLPEK+HGL+D E R R RY+DLI+N +S K F+ R  I++ +R+++DS  YLEVETP++H + GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M+LTENL  ++A   L    ++ GE+ + LT ++RR+HMVD IK+  GVDFW   S++EA+ELAK+H V+   H  T GHI+N FFE+  E K IQPTF+YGHP+++SPL+KK+  +P FT RFELFI  +E+ANAF ELNDPIDQ +RFE Q+KE+  GNDEA EMD DF+EALEYG+PPT GLG+G+DR++ML T   SIRDVLLFP M+ K
  S:     5 ELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAEELFELYGDLSKEELEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF-KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPHM-TFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK 494
>gi|169825711|ref|YP_001695869.1| lysyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] >gi|168990199|gb|ACA37739.1| Lysyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] (500 aa)
Score = 1256, Expect = 4.9e-136, Identities = 255/483 (52%), Positives = 342/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIK---LAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ L+RR+K+  + E  QDP+   +  RT    +   +FA         N++   +AGR++  R      F  I+D  G  Q Y+ +  V +   E F +  DLGDIV I G+ FRTQ GEL++  ++   ++KAL+P+PEK+HGL+D E R R RY+DL+ N+DS   F+ R +I++ IR ++D+  YLEVETP+LH I GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M LTENL  +VA+  L    V+ GE+EI L   ++R+HMVD +K+ TGVDFW+  + ++AQ LAK+H V+  K    +GHIIN FFE+  E   +QPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF ELNDPIDQ +RFEAQ+ EK+ GNDEA EMD DFIEALEYG+PPT GLG+GIDR+IML T   SIRDVLLFP M+
  S:     9 ELNDQLLVRRQKMTTILENGQDPFG-SRFERTHLSTEVKEQFADQTKEQLEENLQEVIIAGRIMTKRGKGKAGFAHIQDLGGQIQIYVRQDHVGEEAYELFKQA-DLGDIVGIRGNVFRTQVGELSVKAEEFTFLTKALRPMPEKFHGLQDVEQRYRQRYLDLMTNEDSKLTFIARSKIIRAIRNYLDNAGYLEVETPMLHTIAGGAAARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYQDIMSLTENLIAHVAQEVLGTTTVQYGEDEINLAVGWKRVHMVDAVKEATGVDFWQPMTKEQAQALAKEHGVEV-KDVHEVGHIINEFFEQKIEETLVQPTFVYGHPVEISPLAKKNPEDERFTDRFELFIVRREHANAFTELNDPIDQRQRFEAQLAEKAAGNDEAHEMDNDFIEALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPTMR 496
>gi|126653301|ref|ZP_01725412.1| lysyl-tRNA synthetase [Bacillus sp. B14905] >gi|126589975|gb|EAZ84104.1| lysyl-tRNA synthetase [Bacillus sp. B14905] (500 aa)
Score = 1254, Expect = 8.4e-136, Identities = 255/483 (52%), Positives = 342/483 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIK---LAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ L+RR+K+  + E  QDP+   +  RT    +   +FA         N++   +AGR++  R      F  I+D  G  Q Y+ +  V +   E F +  DLGDIV I G+ FRTQ GEL++  ++   ++KAL+P+PEK+HGL+D E R R RY+DL+ N++S   F+ R +I++ IR ++D+  YLEVETP+LH I GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M LTENL  +VA+  L    V+ GE+EI L   +RR+HMVD +K+ TGVDFW+  + ++AQ LAK+H V+  K    +GHIIN FFE+  E   +QPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF ELNDPIDQ +RFEAQ+ EK+ GNDEA EMD DFIEALEYG+PPT GLG+GIDR+IML T   SIRDVLLFP M+
  S:     9 ELNDQLLVRRQKMTTILENGQDPFG-SRFERTHLSTEVKEQFADQTKEQLEENLQEVIIAGRIMTKRGKGKAGFAHIQDLGGQIQIYVRQDHVGEEAYELFKQA-DLGDIVGIRGNVFRTQVGELSVKAEEFTFLTKALRPMPEKFHGLQDVEQRYRQRYLDLMTNEESKLTFIARSKIIRAIRNYLDNSGYLEVETPMLHTIAGGAAARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYQDIMSLTENLIAHVAQEVLGTTTVQYGEDEINLAVGWRRVHMVDAVKEATGVDFWQPMTKEQAQALAKEHGVEV-KDVHEVGHIINEFFEQKIEETLVQPTFVYGHPVEISPLAKKNPEDERFTDRFELFIVRREHANAFTELNDPIDQRQRFEAQLAEKAAGNDEAHEMDNDFIEALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPTMR 496
>gi|171780089|ref|ZP_02920993.1| hypothetical protein STRINF_01877 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281437|gb|EDT46872.1| hypothetical protein STRINF_01877 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (496 aa)
Score = 1254, Expect = 9.1e-136, Identities = 259/483 (53%), Positives = 337/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+   +  RT T G    K+A   K + H  N    +AGR++  R      F  I+D  G  Q Y+ K  V     + F K  DLGD + I G   RT  GELT+    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D   +LEVETPVLH   GGA ARPF+T HN  + +  LRIA EL LK+LIVGG +KVYEIGR+FRNEGMD+THNPEFT +E+Y AY + + +M +TE + +  + ++    P+   G  EI + Q F+RIHMVD IK+ TGVDFW+  + +EAQELAK+ NV  EKH +++GHIIN FFEEF E   IQPTFVYGHP++VSPL+KK+ ++  FT RFELFI TKEY NA++ELNDPIDQ  RFEAQ K K LG+DEA  +D D++EALEYG+PPT GLG+GIDR++ML T+ ++IRD LLFP MK
  S:     8 ELNDQQIVRREKMAALAEQGIDPFGT-RFERTATSGQLKEKYADKTKEELHEINKTATIAGRLMTKRGKGKVGFAHIQDRDGQIQIYVRKDAVGDENYQIFKKA-DLGDFLGIEGEIMRTDMGELTIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISGIRRYLDGLGFLEVETPVLHNEAGGAAARPFVTHHNAQDMDMVLRIALELHLKRLIVGGMEKVYEIGRVFRNEGMDATHNPEFTMIELYEAYADFKDIMDITEGIIQNASAAVNGNGPITYQG-TEIAIDQPFKRIHMVDAIKEVTGVDFWKEMTLEEAQELAKEKNVPVEKHFTSVGHIINAFFEEFVEETLIQPTFVYGHPVEVSPLAKKNAEDTRFTDRFELFIMTKEYGNAYSELNDPIDQLSRFEAQAKAKELGDDEATGVDYDYVEALEYGMPPTGGLGIGIDRLVMLLTDTTTIRDALLFPTMK 496
>gi|182683632|ref|YP_001835379.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CGSP14] >gi|182628966|gb|ACB89914.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CGSP14] (496 aa)
Score = 1253, Expect = 9.8e-136, Identities = 260/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD IK+ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINKPFKRVHMVDAIKEITGVDFWQDMTLEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|15672355|ref|NP_266529.1| lysyl-tRNA synthetase [Lactococcus lactis subsp. lactis Il1403] >gi|38258400|sp|Q9CII7|SYK_LACLA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|12723244|gb|AAK04471.1|AE006274_5 lysyl-tRNA synthetase (EC 6.1.1.6) [Lactococcus lactis subsp. lactis Il1403] (494 aa)
Score = 1253, Expect = 1.1e-135, Identities = 262/483 (54%), Positives = 348/483 (72%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ  +RREK++NL+EA  DP+   K +RT    + +  +    K + H    +  +AGR++  R      F  ++D  G  Q Y+ K +V +   E F K  DLGD + + G   +T  GEL++  KK+  +SKAL+PLPEK+HGL D E R R RY+DLI NK+S   FV R +I+  IR++MD + YLEVETPVL+   GGA ARPF T HN+L+ +  LRIATEL LK+LIVGG +KVYE+GR+FRNEGMD THNPEFT+ME Y AY + E +M LTE +F++VAK++  + V++    EI +  KF+R+HMVD IK+  GVDFW   + +EA  LAK+H++  EKH +++GHIIN FFE++ E   IQPTFV+GHP ++SPL+K + K+P FT RFELFIN KEYANAF+ELNDPIDQ ERFEAQ K K LG+DEA  +D D++EALE+G+PPT GLG+GIDR++MLFT  +SIRDVLLFP MK
  S:     6 ELNDQMKVRREKMENLREAGIDPFG-HKFTRTHNSQELHEAYDEKTKEELHELALSGIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDEVGEENYEIFKKA-DLGDFLGVEGEIMKTDMGELSIKAKKLTFLSKALRPLPEKFHGLTDTETRYRKRYLDLISNKESFNRFVTRSKIISEIRRYMDGRGYLEVETPVLNNEAGGAAARPFYTHHNSLDIDMALRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFEDIMDLTEGIFQHVAKTVVGQDVLEYDGKEINVGGKFKRVHMVDAIKEVAGVDFWPEMTFEEATALAKEHDIHVEKHFTSVGHIINEFFEKYVEETLIQPTFVFGHPKEISPLAKMNEKDPRFTDRFELFINGKEYANAFSELNDPIDQLERFEAQAKAKELGDDEATGVDYDYVEALEHGMPPTGGLGIGIDRLVMLFTGTTSIRDVLLFPTMK 494
>gi|138893753|ref|YP_001124206.1| lysyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2] >gi|134265266|gb|ABO65461.1| Lysyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2] (494 aa)
Score = 1252, Expect = 1.3e-135, Identities = 249/485 (51%), Positives = 342/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RREKLK ++E   DP+    E+  +   +       +K +       + +AGR++  R      F  I+D  G  Q Y+ +  V +   E F K+ DLGDIV + G+ F+T+ GEL++ V   + ++KAL+PLPEK+HGL+D E R R RY+DL +N  S + F+ R  I++ +R+++DSQ YLEVETP++H I GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M+LTENL  ++A   L    ++ GE+ + LT ++RR+HMVD IK+  GVDFW    ++EA+ LAK+H V+   H  T GHI+N FFE+  E++ IQPTF+YGHP+++SPL+KK+  +P FT RFELFI  +E+ANAF ELNDPIDQ +RFEAQ+KE+  GNDEA EMD DF+EALEYG+PPT GLG+G+DR++ML T   SIRDVLLFP M+ K
  S:     5 ELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAEELFKLYGDLSKEELEEQQIEVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF-KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDVEQRYRQRYLDLTMNPQSKQTFITRSLIIQSMRRYLDSQGYLEVETPMMHAIAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHTVDLTPEWRRLHMVDAIKEYVGVDFWRHMDDEEARALAKEHGVEIAPHM-TFGHIVNEFFEQKVESQLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK 494
>gi|116511230|ref|YP_808446.1| lysyl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11] >gi|122940346|sp|Q031U8|SYK_LACLS Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|116106884|gb|ABJ72024.1| Lysyl-tRNA synthetase (class II) [Lactococcus lactis subsp. cremoris SK11] (494 aa)
Score = 1252, Expect = 1.3e-135, Identities = 261/483 (54%), Positives = 347/483 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ  +RREK+ NL +A  DP+   K +RT    + +  +    K + H    +  +AGR++  R      F  ++D  G  Q Y+ K +V +   E F K  DLGD + + G   +T  GEL++  KK+  +SKAL+PLPEK+HGL D E R R RY+DLI NK+S   FV R +I+  IR++MD + YLEVETPVL+   GGA+ARPF T HN+L+ +  LRIATEL LK+LIVGG +KVYE+GR+FRNEGMD THNPEFT+ME Y AY + E +M LTE +F++VAK++  + V++    EI +  KF+R+HMVD IK+  GVDFW   + +EA  LAK+H++  EKH +++GHIIN FFE++ E   IQPTFV+GHP ++SPL+K + K+P FT RFELFIN KEYANAF+ELNDPIDQ ERFEAQ K K LG+DEA  +D D++EALE+G+PPT GLG+GIDR++MLFT  +SIRDVLLFP MK
  S:     6 ELNDQMKVRREKMGNLHDAGIDPFG-HKFTRTHNSQELHEAYDEKTKEELHELALSGIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDEVGEENYEIFKKA-DLGDFLGVEGEIMKTDMGELSIKAKKLTFLSKALRPLPEKFHGLTDTETRYRKRYLDLISNKESFNRFVTRSKIISEIRRYMDGRGYLEVETPVLNNEAGGASARPFYTHHNSLDIDMALRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFEDIMDLTEGIFQHVAKTVVGQDVLEYDGKEINVGGKFKRVHMVDAIKEVAGVDFWPEMTFEEATALAKEHDIHVEKHFTSVGHIINEFFEKYVEETLIQPTFVFGHPKEISPLAKMNEKDPRFTDRFELFINGKEYANAFSELNDPIDQLERFEAQAKAKELGDDEATGVDYDYVEALEHGMPPTGGLGIGIDRLVMLFTGTTSIRDVLLFPTMK 494
>gi|125623258|ref|YP_001031741.1| lysyl-tRNA synthetase [Lactococcus lactis subsp. cremoris MG1363] >gi|166229809|sp|A2RIA0|SYK_LACLM Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|124492066|emb|CAL96994.1| lysyl-tRNA synthetase [Lactococcus lactis subsp. cremoris MG1363] (494 aa)
Score = 1252, Expect = 1.4e-135, Identities = 261/483 (54%), Positives = 349/483 (72%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ  +RREK++NL++A  DP+   K +RT    + +  +    K + H    +  +AGR++  R      F  ++D  G  Q Y+ K +V +   E F K  DLGD + + G   +T  GEL++  KK+  +SKAL+PLPEK+HGL D E R R RY+DLI NK+S   FV R +I+  IR++MD + YLEVETPVL+   GGA+ARPF T HN+L+ +  LRIATEL LK+LIVGG +KVYE+GR+FRNEGMD THNPEFT+ME Y AY + E +M LTE +F++VAK++  + V++    EI +  KF+R+HMVD IK+  GVDFW   + +EA  LAK+H++  EKH +++GHIIN FFE++ E   IQPTFV+GHP ++SPL+K + K+P FT RFELFIN KEYANAF+ELNDPIDQ ERFEAQ K K LG+DEA  +D D++EALE+G+PPT GLG+GIDR++MLFT  +SIRDVLLFP MK
  S:     6 ELNDQMKVRREKMENLRDAGIDPFG-HKFTRTHNSQELHEAYDEKTKEELHELALSGIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDEVGEENYEIFKKA-DLGDFLGVEGEIMKTDMGELSIKAKKLTFLSKALRPLPEKFHGLTDTETRYRKRYLDLISNKESFNRFVTRSKIISEIRRYMDGRGYLEVETPVLNNEAGGASARPFYTHHNSLDIDMALRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFEDIMDLTEGIFQHVAKTVVGQDVLEYDGKEINVGGKFKRVHMVDAIKEVAGVDFWPEMTFEEATALAKEHDIHVEKHFTSVGHIINEFFEKYVEETLIQPTFVFGHPKEISPLAKMNEKDPRFTDRFELFINGKEYANAFSELNDPIDQLERFEAQAKAKELGDDEATGVDYDYVEALEHGMPPTGGLGIGIDRLVMLFTGTTSIRDVLLFPTMK 494
>gi|148989077|ref|ZP_01820477.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] >gi|147925574|gb|EDK76651.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] (496 aa)
Score = 1252, Expect = 1.5e-135, Identities = 259/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYTNLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|15902670|ref|NP_358220.1| lysyl-tRNA synthetase [Streptococcus pneumoniae R6] >gi|116517090|ref|YP_816116.1| lysyl-tRNA synthetase [Streptococcus pneumoniae D39] >gi|148985286|ref|ZP_01818509.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] >gi|149005821|ref|ZP_01829560.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|168482937|ref|ZP_02707889.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] >gi|168486793|ref|ZP_02711301.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] >gi|194397421|ref|YP_002037362.1| lysyl-tRNA synthetase (classII) [Streptococcus pneumoniae G54] >gi|122278998|sp|Q04LI2|SYK_STRP2 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|39932186|sp|Q8CWS5|SYK_STRR6 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|15458210|gb|AAK99430.1| Lysyl-tRNA synthetase (lysine--tRNA ligase) (LYSRS) [Streptococcus pneumoniae R6] >gi|116077666|gb|ABJ55386.1| lysyl-tRNA synthetase [Streptococcus pneumoniae D39] >gi|147762761|gb|EDK69721.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|147922484|gb|EDK73603.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] >gi|172043813|gb|EDT51859.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] >gi|183570273|gb|EDT90801.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] >gi|194357088|gb|ACF55536.1| lysyl-tRNA synthetase (classII) [Streptococcus pneumoniae G54] (496 aa)
Score = 1252, Expect = 1.5e-135, Identities = 259/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|149003320|ref|ZP_01828209.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] >gi|147758503|gb|EDK65501.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] (496 aa)
Score = 1252, Expect = 1.6e-135, Identities = 259/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKTIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|169832789|ref|YP_001694171.1| lysyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] >gi|168995291|gb|ACA35903.1| lysyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] (496 aa)
Score = 1251, Expect = 1.7e-135, Identities = 259/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINEPFKRVHMVDAIREITGVDFWQDMTLKEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|149010667|ref|ZP_01832038.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|147765148|gb|EDK72077.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] (496 aa)
Score = 1251, Expect = 1.7e-135, Identities = 259/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINKPFKRVHMVDAIREITGVDFWQDMTLEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|166996997|ref|ZP_02263456.1| lysyl-tRNA synthetase [Bacillus cereus AH820] (499 aa)
Score = 1251, Expect = 1.8e-135, Identities = 254/486 (52%), Positives = 346/486 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ L+RREKL NL+E   DP+    E+ + T  +     +F+K +      ++ +AGR++  R      F  I+D +G  Q Y+ K  V     E F K  DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M+LTEN+  ++AK  L    ++ G+ EI L  K+ R+HMVD IK+ +G DFW   S +EA+ELAK+HNV+  K    +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNDLLSLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEYELF-KTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPKWTRLHMVDAIKEHSGADFWNPMSVEEARELAKEHNVEI-KDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 498
>gi|14972186|gb|AAK74854.1| lysyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] (491 aa)
Score = 1251, Expect = 2.0e-135, Identities = 258/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     3 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLITKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 491
>gi|111656835|ref|ZP_01407683.1| hypothetical protein SpneT_02001903 [Streptococcus pneumoniae TIGR4] >gi|149020353|ref|ZP_01835245.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|161410734|ref|NP_345214.2| lysyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] >gi|168492226|ref|ZP_02716369.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] >gi|168492864|ref|ZP_02717007.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] >gi|39932232|sp|Q97RS9|SYK_STRPN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|147930655|gb|EDK81637.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|183573509|gb|EDT94037.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] >gi|183576861|gb|EDT97389.1| lysyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] (496 aa)
Score = 1250, Expect = 2.1e-135, Identities = 258/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLITKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|167757477|ref|ZP_02429604.1| hypothetical protein CLORAM_03027 [Clostridium ramosum DSM 1402] >gi|167702474|gb|EDS17053.1| hypothetical protein CLORAM_03027 [Clostridium ramosum DSM 1402] (494 aa)
Score = 1250, Expect = 2.3e-135, Identities = 263/487 (54%), Positives = 356/487 (73%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPY----EIEKVSRTM--TIGDFNSKFAKLKTHNTNNN----IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ERKF++QEL+RREKL+ L +   DP+    ++   S+ +  T GD        KTH         +K+AGR++  R+     F  I+D  G  Q Y+ K  V + + E   K  D+GDIV + G+ F T  GE ++ V++   ++KAL+PLPEK+HGL D E R R RYVDLI+N+++ K+   R +I++ I+ ++D+Q Y+EVETPVL+PILGGA+ARPF+T HN L+ NFYLRIATEL LK+LIVGG D VYEIGR+FRNEGMD THNPEFT++EVY A+ ++E MM LTE +    A  +     ++   N+I L   F+RI M D IK++TG+DF +  S  +A++LA++H+++ E H    GHIIN FFE++ E   I+PTFVYGHPI++SPL+KK+  +P FT+RFELFI   EYANAF ELNDPIDQYERF  Q+KEK LGNDEA EMD+D++EALEYGLPPT G+G+GIDR++ML T + SIR+V+LFPHMK+K
  S:     3 ERKFSEQELVRREKLQELVDKGIDPFGQRFDVTAYSKEIKETYGD--------KTHEELEEMAVEVKVAGRIMTKRRKGKVCFMHIQDRDGQIQLYVRKDAVGEDVYEIIKKG-DIGDIVGVKGTVFMTNTGECSIKVEEYTHLTKALRPLPEKYHGLSDVEERYRRRYVDLIMNEEARKIAFARPKIIRSIQHYLDNQGYVEVETPVLNPILGGASARPFVTHHNALDMNFYLRIATELGLKRLIVGGMDAVYEIGRLFRNEGMDRTHNPEFTTIEVYKAFSDLEGMMDLTEGIISNAANEVCGTYELEYKGNKISLAPGFKRISMTDAIKEKTGIDFADQLSFDDAKKLAEEHHIEVEPHFG-YGHIINEFFEKYVEETIIEPTFVYGHPIEISPLAKKNLDDPRFTQRFELFICGNEYANAFTELNDPIDQYERFANQLKEKELGNDEANEMDLDYVEALEYGLPPTGGMGMGIDRLVMLLTGQESIREVILFPHMKNK 494
>gi|148994403|ref|ZP_01823626.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|168488382|ref|ZP_02712581.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP195] >gi|147927239|gb|EDK78273.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|183572998|gb|EDT93526.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP195] (496 aa)
Score = 1250, Expect = 2.6e-135, Identities = 257/483 (53%), Positives = 336/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L+E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K    V     EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQSTEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|148997215|ref|ZP_01824869.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|168575371|ref|ZP_02721307.1| lysyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] >gi|147756915|gb|EDK63955.1| lysyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|183578679|gb|EDT99207.1| lysyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] (496 aa)
Score = 1248, Expect = 3.8e-135, Identities = 259/483 (53%), Positives = 337/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+    E+ + +  + D  +   K + H+ N    +AGR+V  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D + +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ AKS+K   PV   G  EI + + F+R+HMVD I++ TGVDFW+  + +EA+ +A +  V  EKH + +GHIIN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++  FT RFELFI TKEY NAF ELNDPIDQ  RFEAQ K K LG+DEA  +D D+IEALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALCEQGIDPFGKRFERTANSQELKDKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAKSVKGDGPVNYQG-TEIKINEPFKRVHMVDAIREITGVDFWQDMTLEEAKVIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|47458879|ref|YP_015741.1| lysyl-tRNA synthetase [Mycoplasma mobile 163K] >gi|47458207|gb|AAT27530.1| lysyl-tRNA synthetase [Mycoplasma mobile 163K] (487 aa)
Score = 1248, Expect = 4.4e-135, Identities = 265/488 (54%), Positives = 350/488 (71%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSK---FAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M +K ++QELIRR+K++ LQ+   + +  E V   + I     K   F+K +      ++   GR++ +R +F V++      Q YL  K++ K  LE  + +LD+GDI+ + G   +TQ GELTL   ++K++SK+LK LP+K+HGL D E R RHRYVDLIVN D  K F+ R RI+ +IR++ D+  YLEV+TPVL PILGGA+A+PFIT  N L  NFYLRIATELPLKKL+VGGFD+VYEIGRIFRNEG+D+THNPEFTS+E Y AY N E MM  TE+LFK++AK L    +     EI L + FRR++MV+ + ++ G+D +++ S ++A+ LAKKH++K E +   +GHIIN  FE F E   IQPTFVYGHPI++SPL+ K+ KNP FT R ELFI TKEYAN F EL DPIDQ ERF+ Q  EK  GN+EA E+D DF+EALEYGLPPT G G+GIDR++MLFT   SIR+VLLFPH+K+K
  S:     1 MNQKLSEQELIRRQKIEKLQKLGVEVFH-ETVKFDLNINKIIQKYNSFSKDELAKDEFSLSTTGRIITIRSSFLVLKSQGSKFQIYLPIKELDKKYLELID-LLDIGDIIFVNGKLMKTQTGELTLRANELKLLSKSLKVLPDKFHGLNDIEERYRHRYVDLIVNDDVRKTFLLRSRIISLIRKYFDNLEYLEVDTPVLQPILGGASAKPFITKFNALNSNFYLRIATELPLKKLVVGGFDRVYEIGRIFRNEGVDTTHNPEFTSIEYYEAYSNNEGMMNRTEDLFKFIAKELNLKTIFFNGYEIDLNKPFRRLNMVEALNEKLGIDLYKI-SFEDAKVLAKKHHIKVESY-FKIGHIINELFELFIEKDLIQPTFVYGHPIEISPLANKNKKNPNFTDRAELFIGTKEYANMFTELTDPIDQLERFKDQQNEKDNGNEEANEIDYDFVEALEYGLPPTGGCGIGIDRLVMLFTNNESIREVLLFPHLKNK 487
>gi|30260268|ref|NP_842645.1| lysyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47525330|ref|YP_016679.1| lysyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183111|ref|YP_026363.1| lysyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|49481679|ref|YP_034430.1| lysyl-tRNA synthetase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145139|ref|YP_081689.1| lysyl-tRNA synthetase [Bacillus cereus E33L] >gi|65317538|ref|ZP_00390497.1| COG1190: Lysyl-tRNA synthetase (class II) [Bacillus anthracis str. A2012] >gi|118475848|ref|YP_892999.1| lysyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam] >gi|165872546|ref|ZP_02217178.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0488] >gi|167635062|ref|ZP_02393379.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|167641503|ref|ZP_02399751.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|170688911|ref|ZP_02880113.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0465] >gi|170707537|ref|ZP_02897990.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|177655622|ref|ZP_02936985.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|190568953|ref|ZP_03021854.1| lysyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] >gi|196036416|ref|ZP_03103813.1| lysyl-tRNA synthetase [Bacillus cereus W] >gi|196041753|ref|ZP_03109043.1| lysyl-tRNA synthetase [Bacillus cereus NVH0597-99] >gi|196047399|ref|ZP_03114612.1| lysyl-tRNA synthetase [Bacillus cereus 03BB108] >gi|81397490|sp|Q6HPU0|SYK_BACHK Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|81689861|sp|Q63HC2|SYK_BACCZ Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|166229793|sp|A0R8E9|SYK_BACAH Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|39932145|sp|Q81VW3|SYK_BACAN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|30253589|gb|AAP24131.1| lysyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47500478|gb|AAT29154.1| lysyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177038|gb|AAT52414.1| lysyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|49333235|gb|AAT63881.1| lysine--tRNA ligase (lysyl-tRNA synthetase) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978608|gb|AAU20158.1| lysine--tRNA ligase (lysyl-tRNA synthetase) [Bacillus cereus E33L] >gi|118415073|gb|ABK83492.1| lysine--tRNA ligase [Bacillus thuringiensis str. Al Hakam] >gi|164711674|gb|EDR17219.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0488] >gi|167510488|gb|EDR85886.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|167529536|gb|EDR92286.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|170127533|gb|EDS96407.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|170667135|gb|EDT17896.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0465] >gi|172080033|gb|EDT65132.1| lysyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|190559877|gb|EDV13861.1| lysyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] >gi|195991046|gb|EDX55017.1| lysyl-tRNA synthetase [Bacillus cereus W] >gi|196021801|gb|EDX60495.1| lysyl-tRNA synthetase [Bacillus cereus 03BB108] >gi|196027373|gb|EDX65990.1| lysyl-tRNA synthetase [Bacillus cereus NVH0597-99] (499 aa)
Score = 1247, Expect = 5.0e-135, Identities = 253/486 (52%), Positives = 346/486 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ L+RREKL NL+E   DP+    E+ + T  +     +F+K +      ++ +AGR++  R      F  I+D +G  Q Y+ K  V     E F K  DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M+LTEN+  ++AK  L    ++ G+ EI L  ++ R+HMVD IK+ +G DFW   S +EA+ELAK+HNV+  K    +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNDLLSLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEYELF-KTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMSVEEARELAKEHNVEI-KDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 498
>gi|42779156|ref|NP_976403.1| lysyl-tRNA synthetase [Bacillus cereus ATCC 10987] >gi|166984654|ref|ZP_02255989.1| lysyl-tRNA synthetase [Bacillus cereus AH187] >gi|168163551|ref|ZP_02598784.1| lysyl-tRNA synthetase [Bacillus cereus H3081.97] >gi|81411375|sp|Q73FD1|SYK_BACC1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|42735071|gb|AAS39011.1| lysyl-tRNA synthetase [Bacillus cereus ATCC 10987] (499 aa)
Score = 1246, Expect = 7.0e-135, Identities = 253/486 (52%), Positives = 346/486 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ L+RREKL NL+E   DP+    E+ + T  +     +F+K +      ++ +AGR++  R      F  I+D +G  Q Y+ K  V     E F K  DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M+LTEN+  ++AK  L    ++ G+ EI L  ++ R+HMVD IK+ +G DFW   S +EA+ELAK+HNV+  K    +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNELLSLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEYELF-KTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMSVEEARELAKEHNVEI-KDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 498
>gi|47570201|ref|ZP_00240855.1| lysyl-tRNA synthetase [Bacillus cereus G9241] >gi|47553145|gb|EAL11542.1| lysyl-tRNA synthetase [Bacillus cereus G9241] (499 aa)
Score = 1246, Expect = 7.7e-135, Identities = 253/486 (52%), Positives = 346/486 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ L+RREKL NL+E   DP+    E+ + T  +     +F+K +      ++ +AGR++  R      F  I+D +G  Q Y+ K  V     E F K  DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M+LTEN+  ++AK  L    ++ G+ EI L  ++ R+HMVD IK+ +G DFW   S +EA+ELAK+HNV+  K    +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNELLSLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEYELF-KTADLGDLVGIEGKIFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMSVEEARELAKEHNVEI-KDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 498
>gi|89100492|ref|ZP_01173353.1| lysyl-tRNA synthetase [Bacillus sp. NRRL B-14911] >gi|89084758|gb|EAR63898.1| lysyl-tRNA synthetase [Bacillus sp. NRRL B-14911] (496 aa)
Score = 1245, Expect = 9.9e-135, Identities = 252/485 (51%), Positives = 348/485 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + ND   +RREK+ +L+E   DP+    E+  ++  + D   +  K      N ++ LAGR++  R      F  I+D  G  Q Y+ +  + +   E FN   DLGD+V + G+ F+T+ GEL++ V+  ++++K+L+PLPEK+HGL+D E R R RY+DLI++++S K F+ R RI++ +R+++DS  YLEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTENL  ++A+  L    V+ G+ E+ L  ++ R+HMVD IK+ TGVDFW+  S +EAQ LAK+HNV+  K     GHI+N FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DFIEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ +
  S:     7 ELNDLMRVRREKMNSLREKGMDPFGKRFERSHQSQDLIDEYGEQEKEAIEEQNISVTLAGRIMTKRGKGKAGFAHIQDLKGQIQIYVRQDAIGEESYEIFNSA-DLGDLVGVTGTLFKTKVGELSIKVEAFELLTKSLRPLPEKFHGLKDVEQRYRQRYLDLIMSQESKKTFITRSRIIQSMRRYLDSHGYLEVETPMMHSIAGGASARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYRDIMSLTENLVAHIAEEVLGTTTVQYGDYEVNLKPEWTRLHMVDAIKEHTGVDFWKQMSKEEAQALAKEHNVEI-KETMEYGHIVNEFFEQKVEEKLIQPTFIYGHPVEISPLAKKNEEDPRFTDRFELFIVAREHANAFTELNDPIDQRERFEAQLKEREQGNDEAHMMDDDFIEALEYGMPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPLMRHR 496
>gi|168144472|ref|ZP_02587701.1| lysyl-tRNA synthetase [Bacillus cereus G9842] (499 aa)
Score = 1244, Expect = 1.0e-134, Identities = 252/486 (51%), Positives = 342/486 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ L+RREKL NL+E   DP+    E+ + T  +     +F+K +       + +AGR++  R      F  I+D +G  Q Y+ K  V     E F    DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPF T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M+LTEN+  ++AK  L    ++ G+ EI L  ++ R+HMVD IKQ +G DFW   S +EA+ELAK+HNV+  K    +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLLVRREKLHNLREQGIDPFGKRFERTNSTTDLVSLYGEFSKEELEEKEITVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDTVGDEEYELFTTA-DLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFTTHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYNDIMKLTENMVAHIAKKVLGTTTIQYGDYEINLEPEWTRLHMVDAIKQHSGADFWNPMSVEEARELAKEHNVEI-KDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 498
>gi|125718339|ref|YP_001035472.1| lysyl-tRNA synthetase [Streptococcus sanguinis SK36] >gi|166230594|sp|A3CP17|SYK_STRSV Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|125498256|gb|ABN44922.1| Lysyl-tRNA synthetase, putative [Streptococcus sanguinis SK36] (496 aa)
Score = 1244, Expect = 1.2e-134, Identities = 263/483 (54%), Positives = 336/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ++IRREK+  L E   DP+  ++  RT        K+    K + +  N    +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + I G   RT  GEL++    +  +SKAL+PLPEK+HGL D E   R RY+DLI N++S + FV R +I+  IR+++D Q +LEVETPVLH   GGA ARPFIT HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY + + +M LTE + ++ A S+    PV   G  EI + + F+R+HMVD IK+ TGVDFW+  S +EA  LA++  V  EKH + +GH+IN FFEEF E   IQPTFVYGHP+ VSPL+KK+ ++P FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ K K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR++ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIIRREKMAALAEQGIDPFG-KRFERTANSAQLKEKYNDKDKEELNELNETAIIAGRLMTKRGKGKVGFAHIQDREGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGIEGEIMRTDMGELSIKATHLTHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFVTRSKIISEIRRYLDGQGFLEVETPVLHNEAGGAAARPFITHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGIIQHAAVSVNGDGPVNYQG-TEIKINEPFKRVHMVDAIKEITGVDFWQDMSFEEAAALAQEKKVPLEKHFTEVGHVINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDPRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLVMLLTDVTTIRDVLLFPTMK 496
>gi|12044988|ref|NP_072798.1| lysyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|1351162|sp|P47382|SYK_MYCGE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|3844726|gb|AAC71353.1| lysyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|166078779|gb|ABY79397.1| lysyl-tRNA synthetase [synthetic Mycoplasma genitalium JCVI-1.0] (490 aa)
Score = 1241, Expect = 2.8e-134, Identities = 248/489 (50%), Positives = 337/489 (68%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN--NIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  + NDQ   R +KL  L++ N DPY + K S T +   F  +F K           + LAGR++A+RQTF +I+DF G  Q Y+NKK +   + +YFN+ +D+GD + + G P  T+   LTL V+++KI++K L   PEKWHGL D E RAR R++DL  N     VF+ R +I+K IR F+D   ++EVETP L  +LGGANA+PF T +N L+ +FYLRIA E+ LKKLI+GGF+KVYE+G++FRNEG+D+THNPEFTS+E+Y AY + E M+ L E L + + +SL +         I L   F +I MV+ IK+ TG+DF  VK +Q A  LA+KH+VK  KHQ    HIINLFFE+FCE   I+PTFV  +P  VSPL+K+D  NP FT+RFELFIN KE ANA++ELNDP++Q +RFE Q++EK LGNDE  E+D  F+EAL +G+  TAGLG+GIDR++ML  E +SIRDV+ FP +++ K
  S:     1 MSDRLNDQAQHRLQKLLRLKQTNNDPYLVTKTSLTHSSKSFQVEFEKCSEEELKKKATVSLAGRIIAIRQTFLIIQDFDGQVQLYINKK-IHPKLFDYFNEFVDIGDQIVVSGKPMLTKTKVLTLAVEEMKIIAKCLLVPPEKWHGLTDIETRARKRFLDLTYNLAMRDVFLKRTKIIKSIRSFLDQNGFIEVETPTLQAVLGGANAKPFKTHYNALKADFYLRIANEIALKKLIIGGFNKVYEMGKMFRNEGVDTTHNPEFTSIEIYQAYADFEVMLVLVEKLIQSLCESLNQFSFNWNNKTINLKTPFHKITMVELIKKVTGIDFNSVKDDQSAILLAEKHHVKLAKHQQNKQHIINLFFEQFCEQTLIEPTFVTHYPKAVSPLAKQDPSNPEFTQRFELFINGKEIANAYSELNDPLEQRKRFEQQLEEKQLGNDETSELDESFLEALSFGMVNTAGLGIGIDRLVMLLCECNSIRDVVFFPQLREHK 490
>gi|163938085|ref|YP_001642969.1| lysyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] >gi|163860282|gb|ABY41341.1| lysyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] (499 aa)
Score = 1241, Expect = 2.9e-134, Identities = 252/486 (51%), Positives = 342/486 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ L+RREKL NL+E   DP+    E+ + T  +     +F+K +       + +AGR++  R      F  I+D  G  Q Y+ K  V     E F    DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPF T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M+LTEN+  ++AK  L    ++ G+ EI L  ++ R+HMVD IKQ +G DFW   S +EA+ELAK+HNV+  K+   +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLLVRREKLHNLREQGIDPFGKRFERTNSTTDLVSLYGEFSKEELEEKEITVSIAGRIMTKRGKGKAGFAHIQDLQGQVQIYVRKDTVGDEEYELFTTA-DLGDLVGIEGKVFKTNVGELSVKAIGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFTTHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYNDIMKLTENMVAHIAKKVLGTTTIQYGDYEINLEPEWTRLHMVDAIKQHSGADFWNPMSVEEARELAKEHNVEI-KNTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 498
>gi|172056108|ref|YP_001812568.1| lysyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] >gi|171988629|gb|ACB59551.1| lysyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] (497 aa)
Score = 1240, Expect = 3.3e-134, Identities = 251/488 (51%), Positives = 340/488 (69%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + + NDQ  +R  K+  ++E   DP+    E+ + T +I     +  K +      ++ +AGRV+  R+     F  ++D  G  Q Y+ K  V +   E + K  DLGDIV I G  F+T  GEL++ V    +++KAL+PLP+K+HGL+D E R R RY+DLI N +S + F+ R ++++ IRQ++DS  YLEVETP+LH I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTENL  +VA+  L    V  GE+ I L+  ++R HM D +K+ TGVDF+E  S + A ELA +H V+ + H +T GHI+N FFE+  E   +QPTFVYGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+ EK  GNDEA EMD DFIEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ ++
  S:     4 DMEMNDQMQVRLGKMNAMREQGLDPFGARFERTTDTTSIRAAYGEHEKEELAELKPDVSIAGRVMTTRRKGKVGFTNVQDVNGQIQLYVRKDDVGEEAYEIY-KTCDLGDIVGISGYVFKTNVGELSVHVTSFTLLTKALRPLPDKYHGLKDVEQRYRQRYLDLITNTESRETFIARSKVIRGIRQYLDSLGYLEVETPMLHTIAGGASARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYNDIMNLTENLIAHVAQEVLGTTQVTYGEDVIDLSVGWKRAHMADLVKEATGVDFFEEISKERAHELAHEHGVEVQAHMTT-GHILNEFFEQKIEESLVQPTFVYGHPVEISPLAKKNPEDPRFTDRFELFIVRREHANAFTELNDPIDQRERFEAQLVEKEAGNDEAHEMDNDFIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPTMRHQQ 496
>gi|116627566|ref|YP_820185.1| lysyl-tRNA synthetase [Streptococcus thermophilus LMD-9] >gi|122267836|sp|Q03LD3|SYK_STRTD Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|116100843|gb|ABJ65989.1| Lysyl-tRNA synthetase (class II) [Streptococcus thermophilus LMD-9] (496 aa)
Score = 1237, Expect = 6.6e-134, Identities = 259/483 (53%), Positives = 334/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT T G    K+A   K + H  N    +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++    I  +SKAL+PLPEK+HGL D E   R RY+DLI N++S   FV R +I+  IR+++D+Q +LEVETPVLH   GGA A+PFIT HN    +  LRIA EL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFT +EVY AY +   +M LTE + ++ AK++K   PV   G  EI + + F+RIHMVD IK+ TGVDFW+  + +EA  LA + +V  EKH + +G IIN FFEEF E    QPTFVYGHP+ VSPL+KK+ ++P FT RFELFI TKEY NA++ELNDPIDQ  RFEAQ   K LG+DEA  +D D++EALEYG+PPT GLG+GIDR+ ML T+ ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMAALAEQGIDPFG-KRFERTATSGQLKEKYADKTKEELHEINETATIAGRLMTKRGKGKVGFAHIQDRDGQIQIYVRKDAVGEENYEIFKKA-DLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLSDIETIYRKRYLDLISNRESFDRFVTRSKIISEIRRYLDAQGFLEVETPVLHNEAGGAAAKPFITHHNAQNIDMVLRIALELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTMIEVYQAYADFHDIMDLTEGIIQHAAKAVKGDGPVNYQG-TEIKINEPFKRIHMVDAIKEITGVDFWQDMTFEEAVALANEKHVPVEKHYTEVGQIINAFFEEFVEETLTQPTFVYGHPVAVSPLAKKNPEDPRFTDRFELFIMTKEYGNAYSELNDPIDQLSRFEAQAAAKELGDDEATGIDYDYVEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK 496
>gi|30018348|ref|NP_829979.1| lysyl-tRNA synthetase [Bacillus cereus ATCC 14579] >gi|167938095|ref|ZP_02525170.1| lysyl-tRNA synthetase [Bacillus cereus AH1134] >gi|168138232|ref|ZP_02581461.1| lysyl-tRNA synthetase [Bacillus cereus B4264] >gi|39932142|sp|Q81J70|SYK_BACCR Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|29893888|gb|AAP07180.1| Lysyl-tRNA synthetase [Bacillus cereus ATCC 14579] (499 aa)
Score = 1237, Expect = 6.9e-134, Identities = 250/486 (51%), Positives = 344/486 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ ++RREKL NL+E   DP+    E+ + T  +     +F+K +       + +AGR++  R      F  ++D +G  Q Y+ K  V     E F K  DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPF T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M+LTE++  ++AK  L    ++ G+ EI L  ++ R+HMVD IKQ +G DFW   S +EA+ELAK+HNV+  K    +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLIVRREKLHNLREQGIDPFGKRFERTNSTTDLVSLYGEFSKEELEEKEIAVSIAGRIMTKRGKGKAGFAHVQDLHGQVQIYVRKDAVGDDEYELF-KTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFTTHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTEDMVAHIAKKVLGTTTIQYGDYEINLEPEWTRLHMVDAIKQYSGADFWNPMSVEEARELAKEHNVEI-KDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 498
>gi|152973925|ref|YP_001373442.1| lysyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189082695|sp|A7GJY9|SYK_BACCN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|152022677|gb|ABS20447.1| lysyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] (499 aa)
Score = 1237, Expect = 8.3e-134, Identities = 252/486 (51%), Positives = 346/486 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + NDQ L+RREKL NL+E   DP+    E+   +  + +   +F+K +      ++ +AGR++  R      F  I+D +G  Q Y+ K  V     E F K  DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M+LTEN+  ++AK  L    ++ GE+EI L  ++ R+HMVD IKQ  GVDFW+  S +EA+ LAK+H+V+  K    +GHIIN FFE+  E K IQPTF+YGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:     8 ELNDQLLVRREKLHNLREQGIDPFGKRFERTHSSKELLNLYGEFSKEELEEKAISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEYELF-KTADLGDLVGIEGKVFKTNVGELSVKATSFTLLTKSLRPLPDKYHGLKDIEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHTIAGGASARPFITHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENMIAHIAKRVLGTTTIQYGEHEINLEPEWTRLHMVDAIKQYCGVDFWKPMSVEEARALAKEHDVEI-KDTMEVGHIINEFFEQKVEEKLIQPTFIYGHPVEISPLAKKNDEDSRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPTMRHKQ 498
>gi|193217041|ref|YP_002000283.1| lysyl-tRNA synthetase [Mycoplasma arthritidis 158L3-1] >gi|193002364|gb|ACF07579.1| lysyl-tRNA synthetase [Mycoplasma arthritidis 158L3-1] (490 aa)
Score = 1236, Expect = 1.0e-133, Identities = 255/486 (52%), Positives = 350/486 (72%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHN---TNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           MERKF++QE +RR+K+  L++ N   +  + +  T T  + ++ FA  +  +   TN    L GRV+A R  F V++      Q Y++KK +++  L    K LDLGDI+   G   +T  GEL +    IK+++K+L PLP+K+HGL D E R RHRYVD IVN+D  K F+ R +I+K+IR++ D+ N+LEV+TPVL PILGGA A+PFIT++N L  NFYLRIATELPLKKLIVGGF++VYEIGRIFRNEG+D+THNPEFTS+E Y AY +M  MM  TE +F+Y+A+ L    +     EI +T+ F +I+MVD + ++ GV+  E+  +++A ELAK+H++K EK+   LGH+I   FE++ E   IQPTFVYGHP+D+SPL+ KD  +P FT+R ELFI TKE+AN + ELNDP DQ +RFEAQ+ EK+ GN+EA E+D DF++ALEYG+PPT G G+GI+R+IM FTE  SIR+VLLFP +K
  S:     1 MERKFSEQEQVRRDKVTALEKQNIRAFS-QTIKPTHTSEEIHANFANKEREDIEKTNTIAVLNGRVIAQRGPFLVLQGRSSTLQIYVDKKALNEETLIIL-KQLDLGDIISATGLVSKTHTGELMIKASDIKLLTKSLIPLPDKFHGLVDREDRYRHRYVDTIVNEDVKKTFILRSKIIKLIREYFDNLNFLEVDTPVLQPILGGAAAKPFITYYNALNCNFYLRIATELPLKKLIVGGFERVYEIGRIFRNEGIDTTHNPEFTSIEFYEAYSDMWGMMERTEGVFRYIAEKLNVQKLNFAGKEIDITKPFAKINMVDAVSEKIGVNVREL-DDKKALELAKQHDIKVEKY-FKLGHVIEALFEKYIEETLIQPTFVYGHPLDISPLAFKDESDPRFTQRAELFICTKEFANMYTELNDPFDQLQRFEAQLDEKNAGNEEANEIDWDFVKALEYGMPPTGGCGIGIERLIMFFTENDSIREVLLFPQLK 485
>gi|168830126|gb|ACA34354.1| lysyl-tRNA synthetase [Paenibacillus polymyxa] (506 aa)
Score = 1234, Expect = 1.7e-133, Identities = 255/488 (52%), Positives = 347/488 (71%)
  Q:     2 ERKFNDQEL-----IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL---KTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E + N +EL     IRR KL  L+    DP+   K  RT   G   SK+  L   +    N  + +AGR++A R     +F  I+D  G  Q Y+ +  V +S  + F  +LDLGDIV + G  F+T+ GE T+ V  I+++SK+L PLPEK+HGL+D ELR R RYVDL++N +  K F+ R RI++ +R+++DS  YLEVETP LH I GGA A+PF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR++RNEG+ + HNPEFT +E+Y AY + + +M+LTEN+  ++A+  L    ++    E+ LT ++RR+ MVD +K+ TGVDF    SN+EA  LAK+H V  E H  T GHI+N FFE+F E   IQPTF+ GHP+++SPL+KK+ ++P FT RFELF+  +E+ANAF ELNDPIDQ +RFEAQ+ E+  GNDEA EMD DFI ALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFPHM++++
  S:     9 ESQENREELSELLQIRRAKLDELRSLGIDPFG-RKYIRTAEAGVLLSKYDSLTKEELEEKNIEVSIAGRIMAKRVMGKASFAHIQDLSGRIQIYVRQDTVPESKYKAFG-ILDLGDIVGVKGVLFKTKTGETTIKVLDIEVLSKSLYPLPEKYHGLKDVELRYRQRYVDLVMNPEVQKTFITRSRIIQSMRRYLDSLGYLEVETPTLHSIAGGAAAKPFVTHHNALDMQLYMRIAIELHLKRLIVGGMEKVYEIGRVYRNEGISTRHNPEFTMIELYEAYADYKDIMQLTENMVAHIAQEVLGTQHIQYQGQEVDLTPQWRRVSMVDAVKEVTGVDFSVQMSNEEAHRLAKEHKVSVEPHM-TFGHILNAFFEQFVEETLIQPTFITGHPVEISPLAKKNEQDPRFTDRFELFVVAREHANAFTELNDPIDQRQRFEAQLLEREHGNDEAHEMDDDFIRALEYGMPPTGGLGIGIDRLVMLLTDAPSIRDVLLFPHMRNQQ 506
>gi|15612661|ref|NP_240964.1| lysyl-tRNA synthetase [Bacillus halodurans C-125] >gi|11387139|sp|Q9KGG4|SYK_BACHD Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|10172710|dbj|BAB03817.1| lysyl-tRNA synthetase [Bacillus halodurans C-125] (501 aa)
Score = 1234, Expect = 1.8e-133, Identities = 252/487 (51%), Positives = 339/487 (69%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E   ND   +RREKL+NL+    +P+   K  RT T      K+   +K +     + + LAGRV+  R      F  I+D  G  Q Y+ K  V     + F  + D+GDIV + G  F+T+ GEL++ V+  ++++K+L+PLP+K+HGL+D E R R RY+DLIVN +    FV R +IL+ +R+++D + YLEVETP +H I GGA+ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE L  ++AK  L    +  GE+E+ L  K+RR+HMV+ IK+ETGVDFW   S++EA+ LAK+HNV   K   T GH++N FFE F E K IQPTFVYGHP+ +SPL+KK+  +P FT RFELFI  +E+ANAF+ELNDPIDQ  RFE Q+ E+  G+DEA  MD DF+E+LEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K
  S:     4 ELGLNDLLAVRREKLQNLEAEGANPFG-GKFERTDTAQSMKEKYDAKSKEELEEETHEVVLAGRVMTKRGKGKAGFAHIQDLTGQIQIYVRKDAVGDKSYDLFTSI-DIGDIVGVKGVAFKTKVGELSVKVQDFQLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLIVNPEVRDTFVLRSKILQSMRRYLDDRGYLEVETPTMHSIPGGASARPFVTHHNALDMTLYMRIAIELHLKRLIVGGMEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYNDIMELTELLIAHIAKDVLGTTTITYGEHEVNLEPKWRRVHMVEAIKEETGVDFWNEMSDEEARALAKEHNVPV-KETMTYGHVVNEFFEHFVEEKLIQPTFVYGHPVAISPLAKKNPDDPRFTDRFELFIVGREHANAFSELNDPIDQRHRFEQQLVEREQGDDEAHMMDEDFVESLEYGMPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPQMRHK 495
>gi|19745706|ref|NP_606842.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS8232] >gi|139474193|ref|YP_001128909.1| lysyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] >gi|166230592|sp|A2RFR7|SYK_STRPG Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|39932219|sp|Q8P1X6|SYK_STRP8 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|73919758|sp|Q5XD62|SYK_STRP6 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|19747842|gb|AAL97341.1| putative lysyl-tRNA synthetase [Streptococcus pyogenes MGAS8232] >gi|134272440|emb|CAM30696.1| lysyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] (497 aa)
Score = 1232, Expect = 2.8e-133, Identities = 256/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT    +   K+A   K + H  N    +AGR++  R      F  ++D  G  Q Y+ K  VS+   E F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N++S   FV R +++  IR+++D  ++LEVETPVLH   GGA ARPF+T HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+R+HMVD IK+ TGVDFW   + +EA  LAK+  V  EKH +++GHIIN FFEEF E   +QPTFV+GHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ + K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMMALAEQGIDPFG-KRFDRTANSAELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVSEDNYEIFKKA-DLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMNLTEGIIQHAAKAVKGDGPIDYQG-TEIRINEPFKRVHMVDAIKEVTGVDFWPEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 496
>gi|187606404|ref|ZP_02992558.1| lysyl-tRNA synthetase [Exiguobacterium sp. AT1b] >gi|187481531|gb|EDU19581.1| lysyl-tRNA synthetase [Exiguobacterium sp. AT1b] (496 aa)
Score = 1232, Expect = 3.1e-133, Identities = 251/488 (51%), Positives = 344/488 (70%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTH---NTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E + NDQ  +R EK+ +++E   DP+   +  R+   G+ + ++  ++       +  + LAGR++  R      F  I+D  G  Q Y+ K  V     + F K  DLGDIV + G  F+T  GEL++ V++ ++++KAL+PLP+K+HGL+D E R R RY+DLI N+DS + F+ R RI+  IR F++ + YLEVETP+LH I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG ++VYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE L  +VAK  L    V+ GE+ I+L   ++R HMVD +K+ETGVDFW+  S++EA+ LAK+H V+ + H  T GHI+N FFE+  E   +QPTFV GHP++VSPL+KK+  +P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+ EK  GNDEA E+D DF+EALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ ++
  S:     4 ELEMNDQMQVRFEKMTDMRERGLDPFG-HRFDRSAHAGELHEQYESIEKEALAEQDVEVTLAGRIMTKRGKGKVFFAHIQDVTGQIQIYVRKNDVGDEPFDLF-KSSDLGDIVGVKGKLFKTNVGELSIHVEEFELLTKALRPLPDKYHGLKDVEQRYRQRYLDLITNQDSRQTFILRSRIISEIRNFLNQKGYLEVETPMLHTIAGGAAARPFLTHHNALDMELYMRIAIELHLKRLIVGGLERVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYNDIMDLTEELVAHVAKEVLGTTDVQYGEDTIHLGIGWKRAHMVDLVKEETGVDFWQQMSDEEARALAKEHGVEVQDHM-TFGHIVNEFFEQKVEETLLQPTFVTGHPVEVSPLAKKNETDPRFTDRFELFIVRREHANAFTELNDPIDQRERFEAQLLEKEAGNDEAHELDNDFLEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPTMRHQQ 496
>gi|52078577|ref|YP_077368.1| lysyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52783938|ref|YP_089767.1| lysyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52001788|gb|AAU21730.1| lysyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52346440|gb|AAU39074.1| LysS [Bacillus licheniformis DSM 13] (499 aa)
Score = 1231, Expect = 3.7e-133, Identities = 246/485 (50%), Positives = 346/485 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RR+K+  L+E+ +DP+    ++  ++  + +  ++F+K +       + +AGR++  R      F  I+D  G  Q Y+ K  V +   E+F K  DLGDIV + G  F+T  GEL++      +++KAL+PLP+K+HGL+D E R R RY+DLIVN +S   F+ R +I++ +R+++D   YLEVETP +H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +MRLTENL  ++A+  L    V+ G+ E+ L  +++R+HMVD +K+ TGVDFW+  S +EA+  AK+H ++  +  S +GHIIN FFE+  E   IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYG+PPT GLG+GIDR+IML T   SIRDVLLFP M+ +
  S:    10 ELNDQLQVRRDKMNQLRESGKDPFGQRFDRTHQSTDLIESYNEFSKEELEEKAIEVTIAGRMMTKRGKGKAGFAHIQDLKGQIQIYVRKDSVGEEQYEWF-KSSDLGDIVGVTGVMFKTNVGELSVKATSFDLLTKALRPLPDKYHGLKDIEQRYRQRYLDLIVNPESKNTFITRSKIIQSMRRYLDDHGYLEVETPTMHAIPGGASARPFITHHNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMRLTENLIAHIAQEVLGTTTVQYGDYEVDLKPEWKRLHMVDAVKEATGVDFWKEVSVEEARAYAKEHGIEISEGMS-VGHIINEFFEQKVEETLIQPTFIYGHPVEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQKERFEAQLKEREEGNDEAHMMDEDFVEALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPQMRHR 499
>gi|50913862|ref|YP_059834.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS10394] >gi|50902936|gb|AAT86651.1| Lysyl-tRNA synthetase [Streptococcus pyogenes MGAS10394] (501 aa)
Score = 1230, Expect = 4.7e-133, Identities = 256/483 (53%), Positives = 338/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT    +   K+A   K + H  N    +AGR++  R      F  ++D  G  Q Y+ K  VS+   E F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N++S   FV R +++  IR+++D  ++LEVETPVLH   GGA ARPF+T HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+R+HMVD IK+ TGVDFW   + +EA  LAK+  V  EKH +++GHIIN FFEEF E   +QPTFV+GHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ + K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:    12 ELNDQQIVRREKMMALAEQGIDPFG-KRFDRTANSAELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVSEDNYEIFKKA-DLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMNLTEGIIQHAAKAVKGDGPIDYQG-TEIRINEPFKRVHMVDAIKEVTGVDFWPEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 500
>gi|169189775|ref|ZP_02849771.1| lysyl-tRNA synthetase [Paenibacillus sp. JDR-2] >gi|169003427|gb|EDS50295.1| lysyl-tRNA synthetase [Paenibacillus sp. JDR-2] (505 aa)
Score = 1230, Expect = 5.2e-133, Identities = 250/487 (51%), Positives = 338/487 (69%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN---NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E++ ++   IRR+KL  L+    DP+ + K  RT    D  S + +L           + +AGR++  R     +F  I+D  G  Q Y+ K  V  +    F ++LD+GDIV I G  F+T  GE+++   ++++++K+L PLP+K+HGL+D ELR R RYVDLIVN D  + F+ R RI++ +R+++DS+ YLEVETP LH I GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR++RNEG+ + HNPEFT +E+Y AY + + +M LTENL  ++A+  L    +     EI LT ++RR+ MVD +K+ TGVDF    S++EA  LAK H V  E H  T GHI+N FFE  CE   IQPTFV GHP+ +SPL+KK+  +P FT RFELF+  +E+ANAF ELNDPIDQ +RFEAQ+ EK  GNDEA EMD DFI ALEYG+PPT GLG+G+DR++ML T+  SIRDVLLFPHM+++
  S:    11 EQELSELLQIRRDKLDELRALGVDPFGV-KFERTHNAKDIVSAYEELSKEELEEKAIKVSVAGRIMQKRGMGKASFAHIQDLSGKIQIYVRKDTVEANKYAAF-EMLDIGDIVGITGVVFKTNTGEVSVKAYEVEVLTKSLLPLPDKYHGLKDVELRYRQRYVDLIVNPDVQQTFITRSRIIQSMRRYLDSKGYLEVETPTLHSIAGGAAARPFITHHNALDMQLYMRIAIELHLKRLIVGGLEKVYEIGRVYRNEGISTRHNPEFTMIELYEAYADYKDIMALTENLIAHIAQEVLGTMKISYQGQEIDLTPQWRRVSMVDLVKEVTGVDFSVEMSDEEAHALAKVHKVPVEPHM-TFGHILNAFFETHCEHTLIQPTFVTGHPVAISPLAKKNPVDPRFTDRFELFVVAREHANAFTELNDPIDQRQRFEAQLVEKEQGNDEAHEMDDDFIRALEYGMPPTGGLGIGVDRLVMLLTDAPSIRDVLLFPHMRER 502
>gi|71903140|ref|YP_279943.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] >gi|71802235|gb|AAX71588.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] (501 aa)
Score = 1226, Expect = 1.3e-132, Identities = 255/483 (52%), Positives = 337/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT    +   K+A   K + H  N    +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N++S   FV R +++  IR+++D  ++LEVETPVLH   GGA ARPF+T HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+R+HMVD IK+ TGVDFW   + +EA  LAK+  V  EKH +++GHIIN FFEEF E   +QPTFV+GHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ + K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:    12 ELNDQQIVRREKMTALAEQGIDPFG-KRFDRTANSAELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVGEDNYEIFKKA-DLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMNLTEGIIQHAAKAVKGDGPIDYQG-TEIRINEPFKRVHMVDAIKEVTGVDFWPEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 500
>gi|21909956|ref|NP_664224.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS315] >gi|39932216|sp|Q8K880|SYK_STRP3 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|21904145|gb|AAM79027.1| putative lysyl-tRNA synthetase [Streptococcus pyogenes MGAS315] (497 aa)
Score = 1226, Expect = 1.3e-132, Identities = 254/483 (52%), Positives = 336/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT    +    +A   K + H  N    +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N++S   FV R +++  IR+++D  ++LEVETPVLH   GGA ARPF+T HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+R+HMVD IK+ TGVDFW   + +EA  LAK+  V  EKH +++GHIIN FFEEF E   +QPTFV+GHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ + K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMMALAEQGIDPFG-KRFGRTANSAELKENYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVGEDNYEIFKKA-DLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMNLTEGIIQHAAKAVKGDGPIDYQG-TEIRINEPFKRVHMVDAIKEVTGVDFWPEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 496
>gi|157690864|ref|YP_001485326.1| lysyl-tRNA synthetase [Bacillus pumilus SAFR-032] >gi|157679622|gb|ABV60766.1| lysine--tRNA ligase [Bacillus pumilus SAFR-032] (499 aa)
Score = 1226, Expect = 1.4e-132, Identities = 245/485 (50%), Positives = 347/485 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RR+K+  ++E   DP+    ++  ++  I     +F+K      +  + +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGDI+ + G+ F+T  GEL++     ++++KAL+PLP+K+HGL+D E R R RY+DLIVN +S + F+ R +I++ +R+++DS+ YLEVETP +H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M LTENL  ++A+  L    ++ GE+EI L  +++R+HMV+ +K+ TGVDFW+  S +EAQ+ A  H ++  K+  T+GHIIN FFE+  E   +QPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYG+PPT GLG+GIDR+IML T   SIRDVLLFP M+++
  S:    10 ELNDQFQVRRDKMNKMREEGIDPFGERYDRSHQSAQIIAEYDEFSKEDLEEKSAQVTIAGRMMTKRGKGKAGFAHIQDLEGQIQIYVRKDSVGEEAYELF-KSSDLGDIIGVTGTVFKTNVGELSIKATSFEVLTKALRPLPDKYHGLKDVEQRYRQRYLDLIVNPESKQTFIMRSKIIQSMRRYLDSKGYLEVETPTMHSIPGGASARPFITHHNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMNLTENLIAHIAEEVLGTTTIQYGEDEIDLKPEWKRLHMVEAVKEATGVDFWQEMSVEEAQQHAADHGIEITKNM-TVGHIINEFFEQKVEETLVQPTFIYGHPVEISPLAKKNPEDPRFTDRFELFIVRREHANAFTELNDPIDQRERFEAQLKEREEGNDEAHLMDDDFVEALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPQMRNR 499
>gi|94988116|ref|YP_596217.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94989997|ref|YP_598097.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] >gi|94992003|ref|YP_600102.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS2096] >gi|94993910|ref|YP_602008.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS10750] >gi|94541624|gb|ABF31673.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94543505|gb|ABF33553.1| Lysyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] >gi|94545511|gb|ABF35558.1| Lysyl-tRNA synthetase [Streptococcus pyogenes MGAS2096] >gi|94547418|gb|ABF37464.1| Lysyl-tRNA synthetase [Streptococcus pyogenes MGAS10750] (501 aa)
Score = 1226, Expect = 1.5e-132, Identities = 255/483 (52%), Positives = 337/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT    +   K+A   K + H  N    +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N++S   FV R +++  IR+++D  ++LEVETPVLH   GGA ARPF+T HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+R+HMVD IK+ TGVDFW   + +EA  LAK+  V  EKH +++GHIIN FFEEF E   +QPTFV+GHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ + K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:    12 ELNDQQIVRREKMMALAEQGIDPFG-KRFDRTANSAELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVGEDNYEIFKKA-DLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMNLTEGIIQHAAKAVKGDGPIDYQG-TEIRINEPFKRVHMVDAIKEVTGVDFWPEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 500
>gi|28896347|ref|NP_802697.1| lysyl-tRNA synthetase [Streptococcus pyogenes SSI-1] >gi|28811598|dbj|BAC64530.1| putative lysyl-tRNA synthetase [Streptococcus pyogenes SSI-1] (501 aa)
Score = 1223, Expect = 2.8e-132, Identities = 254/483 (52%), Positives = 336/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT    +    +A   K + H  N    +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N++S   FV R +++  IR+++D  ++LEVETPVLH   GGA ARPF+T HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK++K   P+   G  EI + + F+R+HMVD IK+ TGVDFW   + +EA  LAK+  V  EKH +++GHIIN FFEEF E   +QPTFV+GHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ + K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:    12 ELNDQQIVRREKMMALAEQGIDPFG-KRFGRTANSAELKENYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVGEDNYEIFKKA-DLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMNLTEGIIQHAAKAVKGDGPIDYQG-TEIRINEPFKRVHMVDAIKEVTGVDFWPEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 500
>gi|15674679|ref|NP_268853.1| lysyl-tRNA synthetase [Streptococcus pyogenes M1 GAS] >gi|71910308|ref|YP_281858.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] >gi|39932234|sp|Q9A0V7|SYK_STRP1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|13621797|gb|AAK33574.1| putative lysyl-tRNA synthetase [Streptococcus pyogenes M1 GAS] >gi|71853090|gb|AAZ51113.1| lysyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] (497 aa)
Score = 1222, Expect = 4.7e-132, Identities = 253/483 (52%), Positives = 335/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT    +   K+A   K + H  N    +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N++S   FV R +++  IR+++D  ++LEVETPVLH   GGA ARPF+T HN    +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   +M LTE + ++ AK+++   P+   G  EI + + F+R+HMVD IK+ TG DFW   + +EA  LAK+  V  EKH  ++GHIIN FFEEF E   +QPTFV+GHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RFEAQ + K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:     8 ELNDQQIVRREKMTALAEQGIDPFG-KRFDRTANSAELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVGEDNYEIFKKA-DLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFVTHHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADYLDIMNLTEGIIQHAAKAVRGDGPIDYQG-TEIRINEPFKRVHMVDAIKEVTGADFWPEMTVEEAIALAKEKQVPLEKHFISVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLAKKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 496
>gi|169351684|ref|ZP_02868622.1| hypothetical protein CLOSPI_02465 [Clostridium spiroforme DSM 1552] >gi|169291906|gb|EDS74039.1| hypothetical protein CLOSPI_02465 [Clostridium spiroforme DSM 1552] (496 aa)
Score = 1221, Expect = 5.2e-132, Identities = 253/487 (51%), Positives = 352/487 (72%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI----KLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ERKF++QEL+RREKL+ L +   DP+  +K   T    +   K+   KTH     +    KLAGR++  R+     F  I+D  G  Q Y+ K  + + + E   K  D+GDI+ + G+ F T  GE ++ V++   ++KAL+PLPEK+HGL D E R R RYVDLI+N+D+ K+   R +I++ I+ ++D++ Y+EVETPVL+PILGGA+ARPF+T HNTL+ NFYLRIATEL LK+LIVGG D VYEIGR+FRNEGMD THNPEFT++EVY A+ ++E MM LTE +    A  +     ++   ++I L   F+RI M D IK++TG+DF    + ++A++LA++H+++ E H    GHIIN FFE++ E   + PTFVYGHP+++SPL++K+ ++P FT+RFELFI   EYANAF ELNDP DQYERF  Q+KEK LGNDEA EMD+D++EALEYGLPPT G+G+GIDR++ML T + SI++V+LFP MK +
  S:     3 ERKFSEQELVRREKLQELIDKGIDPFG-QKFDVTAYSKEIKEKYGD-KTHEELEEMVVEVKLAGRIMTKRRKGKVCFMHIQDREGQIQLYVRKDAIGEDVYELVKKG-DIGDIIGVKGTVFMTNTGECSVKVEEYTHLTKALRPLPEKYHGLTDVEERYRRRYVDLIMNEDARKIAFTRPKIIRSIQHYLDNKGYVEVETPVLNPILGGASARPFVTHHNTLDVNFYLRIATELSLKRLIVGGMDAVYEIGRLFRNEGMDRTHNPEFTTIEVYKAFSDLEGMMDLTEGIISNAANEVCGTYEIEYKGHKISLAPGFKRISMTDAIKEKTGIDFAGDMTFEDAKKLAEEHHIEIEPHYE-YGHIINEFFEKYVEETIVDPTFVYGHPVEISPLARKNPEDPRFTQRFELFICGNEYANAFNELNDPDDQYERFANQLKEKELGNDEANEMDLDYVEALEYGLPPTGGMGMGIDRLVMLLTGQESIQEVILFPQMKPR 494
>gi|194017974|ref|ZP_03056581.1| lysyl-tRNA synthetase [Bacillus pumilus ATCC 7061] >gi|194010311|gb|EDW19886.1| lysyl-tRNA synthetase [Bacillus pumilus ATCC 7061] (499 aa)
Score = 1220, Expect = 6.7e-132, Identities = 244/485 (50%), Positives = 347/485 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RR+K+  ++E   DP+    ++  ++  I     +F+K      +  + +AGR++  R      F  I+D  G  Q Y+ K  V +   E F K  DLGDI+ + G+ F+T  GEL++     ++++KAL+PLP+K+HGL+D E R R RY+DLIVN +S + F+ R +I++ +R+++DS+ YLEVETP +H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M LTENL  ++A+  L    ++ GE+EI L  +++R+HMV+ +K+ TGVDFW+  S +EA++ A  H ++  K+  T+GHIIN FFE+  E   +QPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYG+PPT GLG+GIDR+IML T   SIRDVLLFP M+++
  S:    10 ELNDQFQVRRDKMNKMREEGIDPFGERYDRSHQSAQIIAEYDEFSKEDLEEKSAQVTIAGRMMTKRGKGKAGFAHIQDLEGQIQIYVRKDSVGEEAYELF-KSSDLGDIIGVTGAVFKTNVGELSIKATSFEVLTKALRPLPDKYHGLKDVEQRYRQRYLDLIVNPESKQTFIMRSKIIQSMRRYLDSKGYLEVETPTMHSIPGGASARPFITHHNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMNLTENLIAHIAEEVLGTTTIQYGEDEIDLKPEWKRLHMVEAVKEATGVDFWQEMSIEEAKQHAADHGIEITKNM-TVGHIINEFFEQKVEETLVQPTFIYGHPVEISPLAKKNPEDPRFTDRFELFIVRREHANAFTELNDPIDQRERFEAQLKEREEGNDEAHLMDDDFVEALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPQMRNR 499
>gi|70727492|ref|YP_254408.1| lysyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435] >gi|123762274|sp|Q4L3H5|SYK_STAHJ Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|68448218|dbj|BAE05802.1| Lysyl-tRNA synthetase class II [Staphylococcus haemolyticus JCSC1435] (496 aa)
Score = 1219, Expect = 9.4e-132, Identities = 244/488 (50%), Positives = 350/488 (71%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSK---FAKLKTHNTNN--NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ  +RR+KL+ L +   DP+  ++  R+ T  +  S+   F+K + H+  +  ++ +AGR++  R      F  ++D  G  Q Y+ K ++ +   +   K  DLGDIV I G  F+T  GEL++  K   ++SKAL+PLP+K+HGL+D E R R RY+DLI N+DS + F++R +I++ +R +++ Q +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE++ +++A+ +     V+  E EI L   + R+H+VD +K+ TGVDF+++KS++EA   AK+H ++   +    GHI+N FFE+  E   IQPTF+YGHPI++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+ EK+ GNDEA EMD D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP+M+ K
  S:     1 MSEEMNDQMQVRRQKLQELIDLGIDPFG-KRFERSATASELKSQWDEFSKEELHDKEDESHVSIAGRLMTKRGKGKAGFAHVQDLTGQIQIYVRKDQIGEEDFDNLWKGADLGDIVGIEGVMFKTNTGELSVKAKTFTLLSKALRPLPDKFHGLQDIEQRYRQRYLDLITNQDSTQTFINRSKIIQEMRNYLNKQGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESMVRHIAQEVFGSAKVQYNEEEIDLESAWTRLHIVDAVKEATGVDFYQIKSDEEAIAAAKEHGIEITNNMK-YGHILNEFFEQKVEETLIQPTFIYGHPIEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLVEKAQGNDEAHEMDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK 496
>gi|56961899|ref|YP_173621.1| lysyl-tRNA synthetase [Bacillus clausii KSM-K16] >gi|56908133|dbj|BAD62660.1| lysyl-tRNA synthetase [Bacillus clausii KSM-K16] (502 aa)
Score = 1218, Expect = 1.1e-131, Identities = 242/486 (49%), Positives = 346/486 (71%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + +D   +RR+KL  L +   +P+   K  RT T  +   +FA   K +    ++++ LAGR++  R      F  I+D  G  Q Y+ +  V +     F K LD+GD+V + G PF+T+ GE+++ V ++ I+ K+L+PLP+K+HGL+D E R R RY+DLI + +S   F+ R +I++++R+++D + +LEVETP++H I GGA+ARPF+T HNTL+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE +  ++AK  L    V+ GE+ + L   ++R+HMVD IK++TGVDFW+  S+ EA+ LAK+H V   K   T GH++N FFE F E   IQPTFVYGHP+ +SPL+KK+ ++P FT RFELFI  +E+ANAF+ELNDPIDQ +RFEAQ+ E+  G+DEA  MD DFIEALEYG+PPT GLG+GIDR++ML T   SIRDV+LFP M++++
  S:     9 EMHDLLAVRRDKLNQLYDEGINPFG-GKFERTHTSNEVIEQFAAFTKEELEEKDDHVVLAGRLMTKRGKGKAGFAHIQDIGGQIQIYVRQDAVGEEAYGLF-KSLDIGDMVGVGGRPFKTKVGEMSVKVTELVILGKSLRPLPDKYHGLKDVEQRYRQRYLDLITSPESRTAFITRSKIIQVMRRYLDEKGFLEVETPMMHSIPGGASARPFVTHHNTLDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYHDIMELTEGVIAHIAKEVLGTTTVQYGEHTVELAPSWKRVHMVDAIKEKTGVDFWQQMSDGEARALAKEHGVPV-KETMTFGHVVNEFFEHFIEETLIQPTFVYGHPLAISPLAKKNEEDPRFTDRFELFIVGREHANAFSELNDPIDQRKRFEAQLIEREQGDDEAHRMDEDFIEALEYGMPPTGGLGIGIDRLVMLLTNSPSIRDVILFPQMRNRE 499
>gi|16077150|ref|NP_387963.1| lysyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] >gi|586058|sp|P37477|SYK_BACSU Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|467470|dbj|BAA05316.1| lysyl-tRNA thynthetase [Bacillus subtilis] >gi|2632349|emb|CAB11858.1| lysyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] (499 aa)
Score = 1218, Expect = 1.2e-131, Identities = 244/485 (50%), Positives = 338/485 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RR+K+  L++   DP+    E+  ++  +        K +       + +AGR++  R      F  ++D  G  Q Y+ K  V     E F K  DLGD++ + G  F+T  GEL++     ++++KAL+PLP+K+HGL+D E R R RY+DLIVN DS   F+ R +I++ +R+++D   YLEVETP +H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M LTENL  ++A+  L    ++ GE +I L  +++RIHMVD +K+ TGVDFWE  + ++A+E AK+H V+  K   T+GHIIN FFE+  E   IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ +
  S:    10 ELNDQLQVRRDKMNQLRDNGIDPFGARFERTHQSQEVISAYQDLTKEELEEKAIEVTIAGRMMTKRGKGKAGFAHLQDLEGQIQIYVRKDSVGDDQYEIF-KSSDLGDLIGVTGKVFKTNVGELSVKATSFELLTKALRPLPDKYHGLKDVEQRYRQRYLDLIVNPDSKHTFITRSKIIQAMRRYLDDHGYLEVETPTMHSIPGGASARPFITHHNALDIPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMSLTENLVAHIAQEVLGTTTIQYGEEQIDLKPEWKRIHMVDAVKEATGVDFWEEVTVEQAREYAKEHEVEI-KDSMTVGHIINEFFEQKIEETLIQPTFIYGHPVEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREAGNDEAHLMDEDFVEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPQMRQR 499
>gi|154684600|ref|YP_001419761.1| lysyl-tRNA synthetase [Bacillus amyloliquefaciens FZB42] >gi|154350451|gb|ABS72530.1| LysS [Bacillus amyloliquefaciens FZB42] (499 aa)
Score = 1215, Expect = 2.7e-131, Identities = 244/485 (50%), Positives = 341/485 (70%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ  +RR+K+  L+E   DP+    E+  ++  I D   + +K +       + +AGR++  R      F  ++D  G  Q Y+ K  V +   E F K  DLGD++ I G  F+T  GEL++     ++++KAL+PLP+K+HGL+D E R R RY+DLIVN DS + F+ R +I++ +R+++D   YLEVETP +H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY + + +M LTENL  ++A+  L    ++ GE +I L  +++R+HMVD +K+ TGVDFW   + +EA+  AK+H ++   +  T+GHIIN FFE+  E   IQPTF+YGHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ +
  S:    10 ELNDQLQVRRDKMNQLRENGIDPFGERFERTHQSQQIIDAYQELSKEELEEKAVEVTIAGRMMTKRGKGKAGFAHLQDLEGQIQIYVRKDSVGEEQYEIF-KSSDLGDVIGITGKVFKTNVGELSVKATSFELLTKALRPLPDKYHGLKDVEQRYRQRYLDLIVNPDSKQTFITRSKIIQAMRRYLDDHGYLEVETPTMHSIPGGASARPFITHHNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMSLTENLVAHIAQEVLGSTTIQYGEEQIDLKPEWKRLHMVDAVKEATGVDFWNEMTVEEARGHAKEHGIEI-TNSMTVGHIINEFFEQKIEETLIQPTFIYGHPVEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREEGNDEAHMMDEDFVEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPQMRQR 499
>gi|195978451|ref|YP_002123695.1| Lysyl-tRNA synthetase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975156|gb|ACG62682.1| Lysyl-tRNA synthetase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (501 aa)
Score = 1215, Expect = 3.0e-131, Identities = 253/483 (52%), Positives = 332/483 (68%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ+++RREK+  L E   DP+  ++  RT   G+   K++   K           +AGR++  R      F  ++D  G  Q Y+ K  V     + F K  DLGD + + G   RT  GEL++   K+  +SK+L+PLPEK+HGL D E   R R++DLI N+ S + FV R +++  IR+++D   +LEVETPVLH   GGA ARPFIT HN  + +  LRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+THNPEFTS+EVY AY +   MM LTE + ++ AK+++   PV   G  EI + + F+RIHMVD IK+ TG+DFW   + +EA  LA + +V  EKH +++GHIIN FFE F E   IQPTFVYGHP++VSPL+KK+ ++  FT RFELFI TKEYANAF ELNDPIDQ  RF+AQ   K LG+DEA  +D DF+EALEYG+PPT GLG+GIDR+ ML T  ++IRDVLLFP MK
  S:    12 ELNDQQIVRREKMAALAEQGIDPFG-KRFDRTTNSGELKEKYSDKTKEDLQELQATAIIAGRLMTKRGKGKVGFAHLQDRQGQIQIYVRKDSVGDENYDIFKKA-DLGDFIGVEGDIMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIETIYRKRHLDLISNRSSFERFVTRSKMISEIRRYLDGLGFLEVETPVLHNEAGGAAARPFITHHNAQDIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYEAYADYLDMMNLTEGIIQHAAKAVRGEGPVDYQG-TEIKINEPFKRIHMVDAIKEVTGIDFWPEMTFEEATALANEKHVPLEKHFTSVGHIINAFFEAFVEDTLIQPTFVYGHPVEVSPLAKKNPEDSRFTDRFELFIMTKEYANAFTELNDPIDQLSRFKAQAAAKELGDDEATGIDYDFVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMK 500
>gi|167216511|ref|ZP_02286147.1| lysyl-tRNA synthetase [Listeria monocytogenes FSL J1-175] (430 aa)
Score = 1214, Expect = 3.9e-131, Identities = 241/419 (57%), Positives = 305/419 (72%)
  Q:    70 FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           F  I+D +   Q Y+ K  + +     F K+ DLGDI+ I G+ FRT  GEL++   +  ++SK+L+PLP+K+HGL+D E R R RY+DLI N++S   FV R +ILK  R +MD+Q +LEVETPVLH I GGA A+PFIT HN L+   YLRIA EL LK+LIVGG DKVYEIGR+FRNEG  + HNPEFT +E YAAYE+ E +M L E L   V K +     +  GE  + LT  +RRIHM D +K+  GVDFW V S++EA+ELAKKHNV   +H  T GHI+N FFE + E K IQPTFVYGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ ERFEAQ+KE+  GNDEA  MD DF+EALEYGLPPT GLG+GIDR++ML T+  SIRD+LLFP MK +
  S:    12 FTHIQDRFHQLQIYIRKDAIGEDAYAVF-KLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQRYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHNALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGLVSTVCKQVNGTTEITYGEYNVDLTPNWRRIHMADAVKEYVGVDFWNVTSDEEARELAKKHNVPVTEHM-TYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKEDDRFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEALEYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHR 429
>gi|196250797|ref|ZP_03149484.1| lysyl-tRNA synthetase [Geobacillus sp. G11MC16] >gi|196209747|gb|EDY04519.1| lysyl-tRNA synthetase [Geobacillus sp. G11MC16] (447 aa)
Score = 1212, Expect = 5.7e-131, Identities = 235/432 (54%), Positives = 318/432 (73%)
  Q:    57 IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + +AGR++  R      F  I+D  G  Q Y+ +  V +   E F K+ DLGDIV + G+ F+T+ GEL++ V   + ++KAL+PLPEK+HGL+D E R R RY+DL +N  S + F+ R  I++ +R+++DSQ YLEVETP++H I GGA ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M+LTENL  ++A   L    ++ GE+ + LT ++RR+HMVD IK+  GVDFW    ++EA+ LAK+H V+   H  T GHI+N FFE+  E++ IQPTF+YGHP+++SPL+KK+  +P FT RFELFI  +E+ANAF ELNDPIDQ +RFEAQ+KE+  GNDEA EMD DF+EALEYG+PPT GLG+G+DR++ML T   SIRDVLLFP M+ K
  S:    13 VAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF-KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDVEQRYRQRYLDLTMNPQSKQTFITRSLIIQSMRRYLDSQGYLEVETPMMHAIAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHTVDLTPEWRRLHMVDAIKEYVGVDFWRHMDDEEARALAKEHGVEIAPHM-TFGHIVNEFFEQKVESQLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK 447
>gi|23097543|ref|NP_691009.1| lysyl-tRNA synthetase [Oceanobacillus iheyensis HTE831] >gi|39932206|sp|Q8EU10|SYK_OCEIH Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|22775766|dbj|BAC12044.1| lysine-tRNA ligase [Oceanobacillus iheyensis HTE831] (493 aa)
Score = 1212, Expect = 6.1e-131, Identities = 241/488 (49%), Positives = 341/488 (69%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + N+   +RR+KL    E   DP+  + E+  +   + +    ++K +   T + + +AGR++  R      F  I+D  G  Q Y+ K  +     E F K  DLGDIV + G  F+T  GE+++  K+ ++++K+L+PLPEK+HGL+D E R R RY+DLI N DS   FV R +I++ +R++++ Q +LEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+L+VGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTENL  ++AK +     +  GE+EI L  K+ R+H+VD +K  TGVDFW+  S++EA+ LAK+H V+  +  S  GH++N FFE+  E   IQPTF++GHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF+ELNDPIDQ  RFEAQVKE++ GNDEA  MD DF+EALEYG+PPT GLG+G+DR++ML T   SIRDVLLFP M+ K
  S:     1 MSEELNEHMQVRRDKLAEHMEKGLDPFGGKFERSHQATDLIEKYDSYSKEELEETTDEVTIAGRLMTKRGKGKAGFAHIQDLSGQIQLYVRKDMIGDDAYEVF-KSADLGDIVGVTGVMFKTNVGEISVKAKQFQLLTKSLRPLPEKYHGLKDIEQRYRQRYLDLITNPDSRGTFVSRSKIIQSMREYLNGQGFLEVETPMMHSIPGGASARPFITHHNALDIELYMRIAIELHLKRLMVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMELTENLVAHIAKQVHGSTTITYGEHEINLEPKWTRLHIVDAVKDATGVDFWKEVSDEEARALAKEHGVQVTESMS-YGHVVNEFFEQKVEETLIQPTFIHGHPVEISPLAKKNKEDERFTDRFELFIVGREHANAFSELNDPIDQRARFEAQVKERAEGNDEAHYMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRTK 493
>gi|163791063|ref|ZP_02185484.1| lysyl-tRNA synthetase [Carnobacterium sp. AT7] >gi|159873708|gb|EDP67791.1| lysyl-tRNA synthetase [Carnobacterium sp. AT7] (499 aa)
Score = 1209, Expect = 1.5e-130, Identities = 245/485 (50%), Positives = 336/485 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + NDQ ++RREKL  L+E N DP+    E+   +  + +   KF K +         +AGR++  R      F  ++D  G  Q Y+ K  V +     F K  DLGD + + G+  +T  GE+T+    +  +SKAL+PLP+K+HGL + E R R RY+DLI N++S   F  R +I++ +R +++ Q+YLEVETP LH + GGA ARPFIT HN L+   YLRIA EL LK+LIVGG ++VYEIGR+FRNEG+D+THNPEFT +E Y AY + E +M L E L + VA+  L    +   E  I L   ++R HMVD IK+ +GVDFW+  +N+EA+ LAK+H+V   +H S  GH++N FFE+F E K IQPTF+YGHP+++SPL+KK+ ++P FT RFE FI   EY NAF+ELNDPIDQ ERFEAQ++E++LGNDEA  +D DFIE+LEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP M+++
  S:    10 ELNDQLIVRREKLDVLRERNVDPFGGRFERSHLSNELHEAYDKFTKEEIAEKEETATVAGRIMTKRGKGKVGFAHLQDRKGQIQIYVRKDAVGEEDYATF-KSADLGDFIGVTGTIMKTDTGEVTIKPTSVTQLSKALRPLPDKYHGLTNVEQRYRQRYLDLISNRESFDRFTKRSQIIREVRNYLNEQDYLEVETPTLHNLAGGAAARPFITHHNALDMELYLRIALELHLKRLIVGGMERVYEIGRVFRNEGVDTTHNPEFTMLEAYTAYTDFEDVMDLVEGLIRTVAQRVLGTGKITYNEQAIDLESPWKRQHMVDAIKEHSGVDFWQQMTNEEARALAKEHDVPVTEH-SQFGHVVNEFFEKFVEDKLIQPTFIYGHPLEISPLAKKNVEDPRFTDRFEAFIVGHEYGNAFSELNDPIDQRERFEAQMQERALGNDEAHMIDEDFIESLEYGMPPTGGLGIGIDRLVMLLTDAQSIRDVLLFPTMRNQ 499
>gi|73663548|ref|YP_302329.1| lysyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123761498|sp|Q49V26|SYK_STAS1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|72496063|dbj|BAE19384.1| lysyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (495 aa)
Score = 1208, Expect = 1.7e-130, Identities = 242/488 (49%), Positives = 340/488 (69%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN-----IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ  +RR+KL+ L +   DP+  +K  RT      +  + +      +       + +AGR++  R      F  ++D  G  Q Y+ K +V +     +N   DLGDIV + G  F+T  GEL++  +   +++KAL+PLP+K+HGL+D E R R RY+DLI N+DS + F+ R +IL+ +R +++ Q +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M +TEN+ ++++ K L    V  GE  I L  K++RIHM D +K+ETGVDF+ ++S+++A+  AK+H ++   +    GHI+N FFE+  E   IQPTFVYGHPI++SPL+KK+ ++P FT RFELFI  +E+ NAF ELNDPIDQ  RFEAQ+ EK  GNDEA EMD DFIEALEYG+PPT GLG+GIDR++ML T+ +SIRDVLLFP+M+ K
  S:     1 MSEEMNDQMQVRRQKLQELYDLGIDPFG-QKFDRTSMATPLHEDWDQFSKEELHEKEEESHVSIAGRLMTKRGKGKAGFAHVQDLSGQIQIYVRKDQVGEDQFAIWNSA-DLGDIVGVEGVMFKTNTGELSVKAQSFTLLTKALRPLPDKFHGLQDIEQRYRQRYLDLITNQDSTQTFIKRSKILQEMRNYLNQQGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDITENMIRHISEKVLGTAKVTYGEETIDLESKWKRIHMADAVKEETGVDFFNIQSDEDAKIAAKEHGIEITDNMK-YGHILNEFFEQKVEETLIQPTFVYGHPIEISPLAKKNAEDPRFTDRFELFIVGREHGNAFTELNDPIDQRARFEAQLVEKEQGNDEAHEMDEDFIEALEYGMPPTGGLGIGIDRLVMLLTDSASIRDVLLFPYMRQK 495
>gi|148266976|ref|YP_001245919.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|150393023|ref|YP_001315698.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|151220691|ref|YP_001331513.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|147740045|gb|ABQ48343.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|149945475|gb|ABR51411.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|150373491|dbj|BAF66751.1| lysyl-tRNA synthetase, class-2 [Staphylococcus aureus subsp. aureus str. Newman] (515 aa)
Score = 1204, Expect = 5.3e-130, Identities = 242/488 (49%), Positives = 345/488 (70%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF-----AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ L+RR+KL+ L +   DP+   K  R+    D   ++      +L     ++++ +AGR++  R      F  ++D  G  Q Y+ K +V     + + K  DLGDIV + G  F+T  GEL++  KK  +++K+L+PLP+K+HGL+D E R R RY+DLI N+DS + F++R +I++ +R +++++ +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE++ +++A   L    V+     I L   + R+H+VD +K+ TGVDF+EVKS++EA+ LAK+H ++  K     GHI+N FFE+  E   IQPTF+YGHP ++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ  RFEAQ+ EK+ GNDEA EMD D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP+M+ K
  S:    21 MSEEMNDQMLVRRQKLQELYDLGIDPFG-SKFDRSGLSSDLKEEWDQYSKEELVEKEADSHVAIAGRLMTKRGKGKAGFAHVQDLAGQIQIYVRKDQVGDDEFDLW-KNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKSLRPLPDKFHGLQDIEQRYRQRYLDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIVDAVKEATGVDFYEVKSDEEAKALAKEHGIEI-KDTMKYGHILNEFFEQKVEETLIQPTFIYGHPTEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQKGRFEAQLVEKAQGNDEAHEMDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK 515
>gi|49482744|ref|YP_039968.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749426|sp|Q6GJF4|SYK_STAAR Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|49240873|emb|CAG39540.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] (495 aa)
Score = 1202, Expect = 8.0e-130, Identities = 242/488 (49%), Positives = 345/488 (70%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF-----AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ L+RR+KL+ L +   DP+   K  R+    D   ++      +L     ++++ +AGR++  R      F  ++D  G  Q Y+ K +V     + + K  DLGDIV + G  F+T  GEL++  KK  +++K+L+PLP+K+HGL+D E R R RY+DLI N+DS + F++R +I++ +R +++++ +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE++ +++A   L    V+     I L   + R+H+VD +K+ TGVDF+EVKS++EA+ LAK+H ++  K     GHI+N FFE+  E   IQPTF+YGHP ++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ  RFEAQ+ EK+ GNDEA EMD D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP+M+ K
  S:     1 MSEEMNDQMLVRRQKLQELYDLGIDPFG-SKFDRSGLSSDLKEEWDQYSKEELVEKEADSHVAIAGRLMTKRGKGKAGFAHVQDLAGQIQIYVRKDQVGDDEFDLW-KNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKSLRPLPDKFHGLQDIEQRYRQRYLDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIVDAVKEATGVDFYEVKSDEEAKALAKEHGIEI-KDTMKYGHILNEFFEQKVEETLIQPTFIYGHPTEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQKGRFEAQLAEKAQGNDEAHEMDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK 495
>gi|116495963|ref|YP_807697.1| lysyl-tRNA synthetase (class II) [Lactobacillus casei ATCC 334] >gi|116106113|gb|ABJ71255.1| Lysyl-tRNA synthetase (class II) [Lactobacillus casei ATCC 334] (498 aa)
Score = 1201, Expect = 1.3e-129, Identities = 247/483 (51%), Positives = 330/483 (68%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ + RREK++ L+EA  DP+   +  RT T      +F    K    +    + +AGR+++ R      F  IRD  G  Q Y+ K  V       F K  DLGDI+ I G   +T  GELT+    +  ++KAL+PLP+KWHGL D E + R RY+DLI N+DS   FV R +I+  +R+++D+  +LEVETPVLH   GGANARPF+T HN L+ + YLRIA EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY ++  +M  TE +F++ A K L    +      I L   F RI+M+D IK +TGVDFW   S  +A++LA +H+V +E +   +GHII+ FF++F E   IQPTF+ GHPI+VSPL+KK+ K+P F +RFELF+   EYANAF ELNDPIDQ +RFEAQ  EKS GNDEA  +D D++EALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP ++
  S:    10 EMNDQMIARREKMEALREAGIDPFG-HRFDRTHTAAKVREEFGEDDKETLLDEKPEVTIAGRMMSKRGKGKVGFADIRDRSGKMQIYVRKDVVGDDNYMIFKKA-DLGDILGISGEVMKTDSGELTVKANHVTHLAKALRPLPDKWHGLTDVEQKYRKRYLDLISNEDSFDRFVKRTKIVSAVREYLDNNGFLEVETPVLHNQAGGANARPFVTHHNALDIDLYLRIALELHLKRLIVGGMERVYEIGRVFRNEGIDTKHNPEFTELETYAAYRDLTDVMTETEGIFRFAAHKVLDTGKLTYQGMAIDLDAPFARINMLDAIKDKTGVDFWPEMSVDDARKLADEHDVHYETYWK-VGHIISAFFDQFVEETLIQPTFITGHPIEVSPLAKKNPKDPRFVERFELFVGGGEYANAFTELNDPIDQRQRFEAQAAEKSAGNDEAQGIDDDYVEALEYGMPPTGGLGIGIDRLVMLLTDAPSIRDVLLFPTLR 497
>gi|21282201|ref|NP_645289.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49485381|ref|YP_042602.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|38258393|sp|Q8NXZ0|SYK_STAAW Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|56749397|sp|Q6GBX1|SYK_STAAS Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|21203637|dbj|BAB94337.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49243824|emb|CAG42249.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] (495 aa)
Score = 1200, Expect = 1.5e-129, Identities = 242/488 (49%), Positives = 344/488 (70%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF-----AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ L+RR+KL+ L +   DP+   K  R+    D   ++      +L     ++++ +AGR++  R      F  ++D  G  Q Y+ K +V     + + K  DLGDIV + G  F+T  GEL++  KK  +++K+L+PLP+K+HGL+D E R R RY+DLI N+DS + F++R +I++ +R +++++ +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE++ +++A   L    V+     I L   + R+H+VD +K+ TGVDF+EVKS+ EA+ LAK+H ++  K     GHI+N FFE+  E   IQPTF+YGHP ++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ  RFEAQ+ EK+ GNDEA EMD D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP+M+ K
  S:     1 MSEEMNDQMLVRRQKLQELYDLGIDPFG-SKFDRSGLSSDLKEEWDQYSKEELVEKEADSHVAIAGRLMTKRGKGKAGFAHVQDLAGQIQIYVRKDQVGDDEFDLW-KNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKSLRPLPDKFHGLQDIEQRYRQRYLDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIVDAVKEATGVDFYEVKSDDEAKALAKEHGIEI-KDTMKYGHILNEFFEQKVEETLIQPTFIYGHPTEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQKGRFEAQLVEKAQGNDEAHEMDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK 495
>gi|15923507|ref|NP_371041.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926194|ref|NP_373727.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315] >gi|57651394|ref|YP_185450.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|82750224|ref|YP_415965.1| lysyl-tRNA synthetase [Staphylococcus aureus RF122] >gi|87161440|ref|YP_493205.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300] >gi|88194278|ref|YP_499070.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|156978845|ref|YP_001441104.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3] >gi|168728162|ref|ZP_02760439.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123098061|sp|Q2G0Q3|SYK_STAA8 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|123727449|sp|Q2YVW8|SYK_STAAB Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|123749646|sp|Q2FJC3|SYK_STAA3 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|166230591|sp|A7WYS8|SYK_STAA1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|54039675|sp|P67610|SYK_STAAN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|54042058|sp|P67609|SYK_STAAM Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|71153565|sp|Q5HIF7|SYK_STAAC Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|13700407|dbj|BAB41705.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315] >gi|14246285|dbj|BAB56679.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|57285580|gb|AAW37674.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|82655755|emb|CAI80154.1| lysyl-tRNA synthetase [Staphylococcus aureus RF122] >gi|87127414|gb|ABD21928.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201836|gb|ABD29646.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|156720980|dbj|BAF77397.1| lysyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3] (495 aa)
Score = 1200, Expect = 1.5e-129, Identities = 242/488 (49%), Positives = 345/488 (70%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF-----AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ L+RR+KL+ L +   DP+   K  R+    D   ++      +L     ++++ +AGR++  R      F  ++D  G  Q Y+ K +V     + + K  DLGDIV + G  F+T  GEL++  KK  +++K+L+PLP+K+HGL+D E R R RY+DLI N+DS + F++R +I++ +R +++++ +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE++ +++A   L    V+     I L   + R+H+VD +K+ TGVDF+EVKS++EA+ LAK+H ++  K     GHI+N FFE+  E   IQPTF+YGHP ++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ  RFEAQ+ EK+ GNDEA EMD D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP+M+ K
  S:     1 MSEEMNDQMLVRRQKLQELYDLGIDPFG-SKFDRSGLSSDLKEEWDQYSKEELVEKEADSHVAIAGRLMTKRGKGKAGFAHVQDLAGQIQIYVRKDQVGDDEFDLW-KNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKSLRPLPDKFHGLQDIEQRYRQRYLDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIVDAVKEATGVDFYEVKSDEEAKALAKEHGIEI-KDTMKYGHILNEFFEQKVEETLIQPTFIYGHPTEISPLAKKNPEDPRFTDRFELFIVGREHANAFTELNDPIDQKGRFEAQLVEKAQGNDEAHEMDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK 495
>gi|191639442|ref|YP_001988608.1| Lysyl-tRNA synthetase [Lactobacillus casei] >gi|190713744|emb|CAQ67750.1| Lysyl-tRNA synthetase [Lactobacillus casei BL23] (498 aa)
Score = 1198, Expect = 2.4e-129, Identities = 247/483 (51%), Positives = 330/483 (68%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + NDQ + RREK++ L+EA  DP+   +  RT T      +F    K    +    + +AGR+++ R      F  IRD  G  Q Y+ K  V       F K  DLGDI+ I G   +T  GELT+    +  ++KAL+PLP+KWHGL D E + R RY+DLI N+DS   FV R +I+  +R+++D+  +LEVETPVLH   GGANARPF+T HN L+ + YLRIA EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY ++  +M  TE +F++ A K L    +      I L   F RI+M+D IK +TGVDFW   S  +A++LA +H+V +E +   +GHII+ FF++F E   IQPTF+ GHPI+VSPL+KK+ K+P F +RFELF+   EYANAF ELNDPIDQ +RFEAQ  EKS GNDEA  +D D++EALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP ++
  S:    10 EMNDQMIARREKMEALREAGIDPFG-HRFDRTHTAAKVREEFGEDDKETLLDEKPEVTIAGRMMSKRGKGKVGFADIRDRSGKMQIYVRKDVVGDDNYMIFKKA-DLGDILGISGEVMKTDSGELTVKANHVTHLAKALRPLPDKWHGLTDVEQKYRKRYLDLISNEDSFDRFVKRTKIVSAVREYLDNNGFLEVETPVLHNQAGGANARPFVTHHNALDIDLYLRIALELHLKRLIVGGMERVYEIGRVFRNEGIDTKHNPEFTELETYAAYWDLTDVMTETEGIFRFAAHKVLDTGKLTYQGMAIDLDAPFARINMLDAIKDKTGVDFWPEMSVDDARKLADEHDVHYEPYWK-VGHIISAFFDQFVEETLIQPTFITGHPIEVSPLAKKNPKDPRFVERFELFVGGGEYANAFTELNDPIDQRQRFEAQAAEKSAGNDEAQGIDDDYVEALEYGMPPTGGLGIGIDRLVMLLTDAPSIRDVLLFPTLR 497
>gi|28377434|ref|NP_784326.1| lysyl-tRNA synthetase [Lactobacillus plantarum WCFS1] >gi|38258343|sp|Q88Z28|SYK_LACPL Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|28270266|emb|CAD63167.1| lysine--tRNA ligase [Lactobacillus plantarum WCFS1] (499 aa)
Score = 1192, Expect = 1.4e-128, Identities = 247/488 (50%), Positives = 332/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E+  NDQ  +RREK+  L+E   DP+   +  RT    D   K+  +     +       +AGR++A R      F  I D  G  Q Y+ K  V +     F +  D+GD + I G  F+T  GELT+ V  +  +SKAL+PLP+K+HGL++ E   R RY+DLI N+DS   F+ R +I+  IR  +D Q + EVETP+LH   GGA ARPF+T HN L  + YLRIA EL LK+LIVGG +KVYEIGR+FRNEGMD  HNPEFT ME Y AY +   +M  TE +FK  A+++    +V   + ++   Q F++IHMVD IK++TG+DFW+  S ++AQ+LA +H+VK+E +   +GHIIN FFEEF E    +PTFVYGHP+++SPL+KK+ ++P FT RFELFI   EYANAF+ELNDPIDQ +RFEAQ  E++ GNDEA  +D DF+EALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP M+ ++
  S:     5 EQTMNDQLKVRREKMDELREEGIDPFG-HRFERTDLAQDLQDKYGDMDKDELDAKQVVATIAGRMLAKRGKGKVGFADIWDRSGKMQLYIRKDVVGEDTYHIFKRS-DIGDFLGITGQVFKTDFGELTIKVTGLTFLSKALRPLPDKFHGLQNVEQIYRQRYLDLISNRDSFDRFLKRTKIISAIRHHLDDQGFTEVETPMLHNQAGGAAARPFVTHHNALNIDLYLRIALELHLKRLIVGGMEKVYEIGRVFRNEGMDREHNPEFTMMETYVAYFDFHDVMAETEGIFKAAAQAVTDDGIVTYHDQKVDFNQPFKQIHMVDAIKEKTGIDFWQPMSIEDAQKLADEHHVKYEPYWK-VGHIINAFFEEFVEDTLNEPTFVYGHPVEISPLAKKNEEDPRFTDRFELFILGNEYANAFSELNDPIDQRQRFEAQAAERTAGNDEAEHIDEDFVEALEYGMPPTGGLGIGIDRLVMLMTDADSIRDVLLFPTMRPEE 497
>gi|104773527|ref|YP_618507.1| lysyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513522|ref|YP_812428.1| lysyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422608|emb|CAI97211.1| Lysyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092837|gb|ABJ57990.1| Lysyl-tRNA synthetase (class II) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (501 aa)
Score = 1190, Expect = 1.9e-128, Identities = 243/488 (49%), Positives = 338/488 (69%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI---KLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + + NDQ L+RR+KL+ L+E   +P+   K  R     D + K+  L     N N+   K+AGR++A R      F  + D  G  Q Y+ K  V +   + F K  DLGD + + G  F+T  GEL++  + +  +SKAL+PLP+K+HGL+D E   R RY+DLI N +S + FV+R +I++ IR +++ Q++LEVETPVLH I GGA ARPFIT HN L+ N Y+RIA ELPLK+LIVG  ++VYEIGR+FRNEGMD  HNPEFT +E YAAY +   +M   E + +  AK + +   +     ++ L + FRR+HMVD IK+ TGVDFW+  + +EA+++A +H+V+ E +   +GHIIN FFE+F E   + PTFVYGHP++VSPL+KK+  +P FT RFE+FI   EY NAF+ELNDP+DQ ERFEAQ+ E+  GNDEA  +D D++ A+EYG+PPT GLG+GIDR++ML T  +SIRDVLLFP M+ +K
  S:     3 KNEINDQLLVRRQKLEELKEMGIEPFG-RKYDREALARDLDEKYLGLDKDELNANMPKTKIAGRMLAKRGKGKVGFADLYDRSGKIQIYVRKDMVGEENYQIFKKA-DLGDFLGVEGEVFKTDSGELSVRAQHVTFLSKALRPLPDKYHGLKDVESIYRQRYLDLITNHESYQRFVNRTKIIQAIRDYLNGQDFLEVETPVLHNIPGGAEARPFITHHNALDINLYMRIALELPLKRLIVGDMERVYEIGRVFRNEGMDLKHNPEFTELETYAAYYDFHDVMDEAEGIIRAAAKVVSEDGKINYQGTDLDLGKPFRRVHMVDLIKELTGVDFWQPMTLEEARKVAAEHHVEVEPYWQ-VGHIINAFFEKFGEKTIVDPTFVYGHPVEVSPLAKKNADDPRFTDRFEIFIMGNEYGNAFSELNDPLDQRERFEAQMAERDAGNDEADIIDEDYLRAMEYGMPPTGGLGIGIDRLVMLLTNAASIRDVLLFPTMRPEK 495
>gi|148377884|ref|YP_001256760.1| lysyl-tRNA synthetase [Mycoplasma agalactiae PG2] >gi|148291930|emb|CAL59321.1| Lysyl-tRNA synthetase [Mycoplasma agalactiae PG2] (489 aa)
Score = 1189, Expect = 2.6e-128, Identities = 247/483 (51%), Positives = 334/483 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDP----YEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           K+ +QE +RR KL    E N  P    Y++ K+  +  I +    F++ +    N ++ +AGR++ +R  F V+ D  G  Q Y NKK  S   +       D+GDI+ + G+  +T    LTL   KI++++KALKPLPEK+HGL D E R R R+VDLI N++S   F+ R +I+K I+++ D+ +YLEVETP L   + GA A+PF T HN+L + F LRIATE+PLKK +VGG ++VYE+GRIFRNEG D+THNPEFT++E Y AY N+E MM  TE LFK + + L K V      E+ L++ F+RI+MVD + ++TG DF  +  ++   E AKKHN+K EK  +T GHIIN  +EE  E+  IQPTF+YGHPI+VSPLS K   +P FT+R ELFINTKEYAN + EL+DPIDQ ERF++Q+ EK  GNDEA ++D DF++ALEYG+PPT G G+GIDR+IML TE SSIRDVLLFP +K
  S:     3 KYTEQEQVRRNKLNFYNENNIAPFKKAYDLGKLVLSQEIVNNYDSFSREELEEKNISVNVAGRLMTVRGPFLVLNDSKGLVQVYFNKK--SDENVAKIVGTFDIGDILWVSGTVMKTHTNALTLKCNKIELLTKALKPLPEKYHGLVDTEERYRRRWVDLITNEESKNKFILRTKIIKWIKEYFDNLDYLEVETPFLQDYVSGAAAKPFTTHHNSLNQEFVLRIATEIPLKKCVVGGLERVYELGRIFRNEGYDTTHNPEFTTIEFYEAYSNVEGMMDRTEELFKVLCQKLGKSVFVNNGTEVDLSKPFKRINMVDAVNEKTGKDFKNISLDEAILE-AKKHNIKIEKFWTT-GHIINALYEELVESSLIQPTFIYGHPIEVSPLSAK-ASDPRFTERAELFINTKEYANMYTELSDPIDQLERFKSQIDEKKAGNDEASDIDWDFVDALEYGMPPTGGCGIGIDRLIMLLTETSSIRDVLLFPTLK 484
>gi|81429206|ref|YP_396207.1| lysyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] >gi|78610849|emb|CAI55901.1| Lysyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] (505 aa)
Score = 1189, Expect = 2.8e-128, Identities = 244/488 (50%), Positives = 338/488 (69%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHN---TNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +++ NDQ  +RREK++ L++   DP+   +  RT      + +F  ++  +    N  + +AGR+++ R      F  IRD  G  Q Y+ K +V +   + F K  DLGD + I G   +T  GELT+    +  +SKAL+PLP+K+HGL + E   R RY+DLI N +SM  F  R +I+  +R+++D+ ++ EVETPVLH   GGA+ARPFIT HN L+ N YLRIA EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY + + +M  TE + ++ A K L    +      I L   F R+HMVD IK ETGVDFW+  + + A+ELA +H+VK+E++   +GHIIN FFEEF E   +QPTF+YGHP+++SPL+KK+ ++  FT R+ELF++  EYANAF ELNDPIDQ ERFEAQ KE+  GNDEA  +D D++EALEYG+PPT GLG+GIDR++ML T+ +SIRDVLLFP M+  K
  S:     7 QKEMNDQLKVRREKMQFLKDEGIDPFG-SRFERTHLAAALHEEFEAIEKDDLDVKNQEVTIAGRMMSKRGKGKVGFADIRDRSGKIQIYVRKDEVGEDNYKIFKKA-DLGDHLGITGQIMKTDMGELTVKATHLTFLSKALRPLPDKYHGLTNVEQIYRQRYLDLIANPESMDRFTKRSKIISAVREYLDTHDFTEVETPVLHGQAGGASARPFITHHNALDINLYLRIALELHLKRLIVGGMERVYEIGRVFRNEGIDTKHNPEFTMLETYAAYFDYKDVMDETEGIIRFAAHKVLGTGQISYQGQAIDLDSDFARVHMVDAIKAETGVDFWQPMTVESARELADQHHVKYEEYWQ-VGHIINAFFEEFVEDTLVQPTFIYGHPVEISPLAKKNAEDDRFTDRWELFMHGNEYANAFTELNDPIDQRERFEAQAKERENGNDEAEGIDEDYVEALEYGMPPTGGLGIGIDRLVMLLTDAASIRDVLLFPTMRPDK 499
>gi|163764845|ref|ZP_02171897.1| parB-like partition protein [Bacillus selenitireducens MLS10] >gi|160354622|gb|EDP81283.1| parB-like partition protein [Bacillus selenitireducens MLS10] (423 aa)
Score = 1188, Expect = 4.1e-128, Identities = 230/417 (55%), Positives = 309/417 (74%)
  Q:    73 IRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           ++D  G  Q Y+ K +V     E F K  D+GDIV + G  F+T+ GEL++ V   ++++K+L+PLP+K+HGL+D E R R RY+DLIVN +    FV R +IL+ +R+++D   YLEVETP++H I GGA+A+PFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTENL  ++A+  L    V  G++EI L  K+RR+HMVD IK+ETGVDFW+  +++EA++LAKKH V   K     GHI+N FFE F E K I+PTFVYGHP+D+SPL+KK+ ++P FT RFELFI  +E+ANAF+ELNDP+DQ  RFEAQ+ E+  G+DEA  MD DF+E+LEYGLPPT GLG+GIDR++ML T   SIRDVLLFP M++ +
  S:     1 MQDLTGQIQIYVRKDQVGDEAYELFTKT-DIGDIVGVSGVLFKTKVGELSIKVSSFEMLTKSLRPLPDKYHGLKDVEQRYRQRYLDLIVNPEVRDTFVLRSKILQSMRRYLDDHGYLEVETPMMHAIPGGASAKPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDVMALTENLIAHIAQDVLGTTKVHYGDSEIDLEPKWRRLHMVDAIKEETGVDFWQEMTDEEARDLAKKHGVP-HKDTMKFGHIVNEFFEHFIEEKLIEPTFVYGHPLDISPLAKKNDEDPRFTDRFELFIVGREHANAFSELNDPVDQRARFEAQLLEREQGDDEAHMMDEDFVESLEYGLPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPQMRNSQ 416
>gi|2501020|sp|Q53638|SYK_STAAU Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|567884|gb|AAA53114.1| lysyl-tRNA synthetase (495 aa)
Score = 1187, Expect = 4.2e-128, Identities = 240/488 (49%), Positives = 343/488 (70%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF-----AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ L+RR+KL+ L +   DP+   K  R+    D   ++      +L     ++++ +AGR++  R      F  ++D  G  Q Y+ K +V     + + K  DLGDIV + G  F+T  GEL++  KK  +++K+L+PLP+K+HGL+D E R R RY+DLI N+DS + F++R +I++ +R +++++ +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTE++ +++A   L    V+     I L   + R+H+VD +K+ TGVDF+EVKS++E + LAK+H ++  K     GHI+N FFE+  E   IQPTF+YGHP ++SPL+KK+ ++P FT RFELFI  +E+AN F ELNDPIDQ  RFEAQ+ EK+ GNDEA EMD D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP+M+ K
  S:     1 MSEEMNDQMLVRRQKLQELYDLGIDPFG-SKFDRSGLSSDLKEEWDQYSKEELVEKEADSHVAIAGRLMTKRGKGKAGFAHVQDLAGQIQIYVRKDQVGDDEFDLW-KNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKSLRPLPDKFHGLQDIEQRYRQRYLDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIVDAVKEATGVDFYEVKSDEERKALAKEHGIEI-KDTMKYGHILNEFFEQKVEETLIQPTFIYGHPTEISPLAKKNPEDPRFTDRFELFIVGREHANRFTELNDPIDQKGRFEAQLVEKAQGNDEAHEMDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK 495
>gi|116617530|ref|YP_817901.1| lysyl-tRNA synthetase (class II) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272269|sp|Q03Z44|SYK_LEUMM Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|116096377|gb|ABJ61528.1| Lysyl-tRNA synthetase (class II) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (495 aa)
Score = 1187, Expect = 5.4e-128, Identities = 249/485 (51%), Positives = 330/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNL-QEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVI----RDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  NDQ L RR+KL  +  + + DP+    E+ ++   + +     +  +  N  + + +AGR+VA R    VI    RD  G  Q Y  +  ++ +      K  DLGD + I G   +T+ GELT+   ++  +SKAL+P+P+K+HG+ D E R R RY+DLI N+DS K F +R  I+  IR +MD  ++LEVETP+L    GGA ARPFIT HN L  + Y+RIATEL LK+L+VGG ++VYEIGRIFRNEGMD  HNPEFT+ME YAAY +   +M  TE +FK  A  +   + +     EI L  KF R H+VD IK++TG+DFW+  S +EAQ+LA  ++VK+EK+   +GHIIN FFEEF E   +QPTFVYGHP++VSPL+KK+  +P FT RFELFI   EYANAF ELNDPIDQ  RFEAQ  E+  GNDEA  +D DFIEALEYG+PPT GLGVGIDR++ML T+  +IRDV+LFP M+
  S:     4 EKALNDQMLARRQKLATIVSDLHLDPFGKRFERTAKAQELHNLYDASSLEELENAKHEVVIAGRMVAKRGAGKVIFADFRDVSGKIQVYARRDDLADNYP--IIKRADLGDFLGIKGIMMKTEAGELTVLATELTHLSKALRPMPDKFHGISDVETRYRKRYLDLIANEDSFKKFQERSHIISAIRAYMDRNDFLEVETPILQTEAGGAAARPFITHHNALNIDMYMRIATELYLKRLVVGGMERVYEIGRIFRNEGMDPKHNPEFTTMESYAAYMDFTDVMDETEGIFKAAASVVSDDLKITYQGTEIDLGTKFARKHLVDLIKEQTGIDFWQEMSVEEAQKLADDNHVKYEKYWG-VGHIINAFFEEFVEDTLVQPTFVYGHPVEVSPLAKKNTDDPRFTDRFELFIMGSEYANAFTELNDPIDQRARFEAQAAERENGNDEAEGIDEDFIEALEYGMPPTGGLGVGIDRLVMLLTDSDTIRDVVLFPTMR 493
>gi|90962323|ref|YP_536239.1| lysyl-tRNA synthetase [Lactobacillus salivarius UCC118] >gi|90821517|gb|ABE00156.1| Lysyl-tRNA synthetase [Lactobacillus salivarius UCC118] (495 aa)
Score = 1186, Expect = 5.8e-128, Identities = 244/485 (50%), Positives = 339/485 (69%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-KLKTHNTNNNIK--LAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ++  NDQ  +RR+K++ L++   DP+   +  R     + + KF  K K    + ++K  +AGR+VA R      F  ++D  G  Q Y+ K +V + M   F +  DLGD + + G   +T  GELT+ V K+  +SKAL+PLP+K+HGL++ E   R RY+DLI N++S   FV+R +I+  +R ++DS  +LEVETPVLH   GGA ARPFIT HN L+   YLRIA EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY + + +M  TE +FK  AK +     +     ++   ++F+R+HMVD IK++TGVDFW+  S +EA+++A +H V +E +   +GHIIN FFE+FCE   + PTFVYGHP+++SPL+KK+  +P FT RFELFI   EYANAF ELNDPIDQ +RFEAQV E+  GNDEA  +D D+IEA+EYG+PPT GLG+GIDR++ML T+  SIRDVLLFP ++
  S:     4 QQSMNDQLRVRRQKMQELRDEGVDPFG-HRFERDFLNKELHDKFEDKTKEELIDLDVKATIAGRMVAKRGKGKVGFADLQDKTGRMQLYIRKDEVGEEMYHIFKRS-DLGDFLGVTGDVIKTDMGELTIKVTKLTFLSKALRPLPDKFHGLQNVEQIYRQRYLDLITNRESYNRFVNRSKIVTAVRNYLDSNGFLEVETPVLHNQAGGAAARPFITHHNALDIQLYLRIALELHLKRLIVGGMERVYEIGRVFRNEGIDTKHNPEFTMLETYAAYFDFKDVMDETEGIFKAAAKVVTSDGKINYQGTDVDFNKEFKRVHMVDLIKEKTGVDFWKEMSLEEARKIADEHKVHYEPYWQ-VGHIINEFFEQFCEDTIVDPTFVYGHPVEISPLAKKNADDPRFTDRFELFILGNEYANAFTELNDPIDQRQRFEAQVAERQAGNDEAEGIDEDYIEAMEYGMPPTGGLGIGIDRLVMLLTDAPSIRDVLLFPTLR 493
>gi|27469184|ref|NP_765821.1| lysyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57866087|ref|YP_187752.1| lysyl-tRNA synthetase [Staphylococcus epidermidis RP62A] >gi|38258353|sp|Q8CQV5|SYK_STAES Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|71153566|sp|Q5HRN7|SYK_STAEQ Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|27316733|gb|AAO05908.1|AE016751_203 lysyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57636745|gb|AAW53533.1| lysyl-tRNA synthetase [Staphylococcus epidermidis RP62A] (495 aa)
Score = 1184, Expect = 1.2e-127, Identities = 238/488 (48%), Positives = 346/488 (70%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNN--NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  + NDQ  +RR+KL+ L +   DP+     + S +  + +   +F+K + H   +  ++ +AGR++  R      F  I+D  G  Q Y+ K +V       + K+ DLGDI+ + G  F+T  GE+++  K   ++SK+L+PLP+K+HGL+D E R R RY+DLI N+DS + F++R +I++ +R +++ Q +LEVETP++H I GGA ARPF+T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTEN+ +++A+ +     V+  + EI L   ++R+H+VD +K+ TGVDF+ V S++EA  LAK+H+++  ++    GHI+N FFE+  E   IQPTF+YGHPI++SPL+KK+  +  FT RFELFI  +E+ANAF ELNDPIDQ +RFEAQ+ EK  GNDEA +MD D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP+M+ K
  S:     1 MSEEMNDQMQVRRQKLQELIDLGIDPFGHRFNRSSTSSELKEQWDQFSKEELHEKEDESHVSIAGRLMTKRGKGKAGFAHIQDLKGQIQIYVRKDQVGDDQFNIW-KMADLGDIIGVEGVMFKTNTGEISVKAKSFTLLSKSLRPLPDKFHGLQDIEQRYRQRYLDLITNEDSTQTFINRSKIIQEMRNYLNKQGFLEVETPMMHQIAGGAAARPFVTHHNALDATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTENMVRHIAQEVFGSAKVQYNDEEIDLESSWKRLHIVDAVKEVTGVDFYNVNSDEEAIRLAKEHDIEITENMK-YGHILNEFFEQKVEETLIQPTFIYGHPIEISPLAKKNPNDERFTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLVEKEQGNDEAHDMDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK 495
>gi|29374909|ref|NP_814062.1| lysyl-tRNA synthetase [Enterococcus faecalis V583] >gi|39932158|sp|Q839A8|SYK_ENTFA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|29342367|gb|AAO80133.1| lysyl-tRNA synthetase [Enterococcus faecalis V583] (498 aa)
Score = 1183, Expect = 1.4e-127, Identities = 248/482 (51%), Positives = 330/482 (68%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            NDQ L+RREK++ L+E   DP+  ++  RT    + + ++    K +    N  + +AGR++  R      F  ++D  G  Q Y+ K +V     E F K  DLGD   + G   +T  GE+T+  + I +++KAL+PLP+K+HGL + E R R RY+DLI NK+S   F+ R +I+  IR+++D   Y+EVETPVLH   GGA ARPFIT HN L+ + YLRIA EL LK+LIVGG +KVYEIGR+FRNEG+D+THNPEFT +E Y AY + + +M LTE + +  A K L    +      + L   F+R+HMVD +K++TGVDFW+  + +EA+ LAK+HNV+      T+GHIIN FFE F E    QPTF+YGHP+ VSPL+KK+ ++  FT RFELFI  KE+ANAF ELNDPIDQ ERFE Q KE+  GNDEA  +D DFIEALEYGLPPT GLG+GIDR++ML T+  SIRDVLLFP M+
  S:    12 LNDQMLVRREKMEALREEGIDPFG-KRFDRTHNSAELHEQYDNHTKEELSEMNTEVSVAGRMMTKRGKGKAGFAHLQDREGQIQIYVRKDQVGDEAYELF-KHADLGDFFGVTGQVMKTNTGEVTVKAQTITLLTKALRPLPDKYHGLTNVEQRYRQRYLDLISNKESFDRFMKRSQIISEIRRYLDGNGYVEVETPVLHNEAGGAAARPFITHHNALDMDLYLRIALELHLKRLIVGGMEKVYEIGRVFRNEGIDTTHNPEFTMLEAYTAYTDYQDVMDLTEGIIRNAAEKVLGTTDITYDGQAVDLGSPFKRLHMVDAVKEQTGVDFWQEMTIEEARALAKEHNVEITDAM-TVGHIINEFFETFVEDTLQQPTFIYGHPVAVSPLAKKNPEDGRFTDRFELFIIGKEFANAFTELNDPIDQRERFEEQEKEREQGNDEAHGVDEDFIEALEYGLPPTGGLGIGIDRLVMLLTDAQSIRDVLLFPTMR 498
>gi|188587577|ref|YP_001919618.1| lysyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] >gi|188497858|gb|ACD50994.1| lysyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] (501 aa)
Score = 1178, Expect = 5.5e-127, Identities = 245/489 (50%), Positives = 339/489 (69%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGE-NEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL--GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +E ++N+QE +RR KL +LQEA +DP+++ KV RT T  +  S + +L+      N+ +AGR+++ R      F  I D  G  Q ++    V +  L+ + K  DLGD V   G  F T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +  + F+ R +I+  IR+F+D++ +LEVETP+L PI GGA A+PFIT HNTL+ + YLRIATEL LK+LIV GF+KVYEIGR FRNEGM   HNPEFT +E+Y AY +   MM +TEN+  YV + +      M E  EI  T  +RRI MVD +K+  GVDF EVK+N+EAQ +AK+ +++F K  +T+  G ++N  +EEF EA  IQPTFV  +P++VSPL+KK   NP  T+RFE F+  +E  NA++ELNDPI Q +RFE Q K++ LG+DEA  MD  F+ ALE G+PPT GLG+GIDR+IM  T+ +SIRDVLLFP M+ +K
  S:    11 LESQYNEQEALRRAKLADLQEAGKDPFDVYKVERTHTSEEVKSNYEELE----GKNVTVAGRIMSKRGQGKVVFSDIHDRDGKIQLFIKIDLVGEESLKSY-KTYDLGDWVVATGEVFTTKTGEVSIKVSNFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKETFIKRSKIISGIREFLDNRGFLEVETPILSPIAGGAAAKPFITHHNTLDMDMYLRIATELYLKRLIVAGFEKVYEIGRNFRNEGMSVRHNPEFTVIELYEAYSDYNDMMEITENMVAYVCEKVNGTTKVMYEGTEIDFTPPWRRITMVDVVKEYAGVDFNEVKTNEEAQAIAKEKHLEFAKPLNTITKGEVLNSLYEEFGEANMIQPTFVTDYPVEVSPLTKKKRGNPELTERFEGFVFGREICNAYSELNDPIVQRQRFEQQEKDRELGDDEAYMMDEQFMSALETGMPPTGGLGIGIDRLIMFLTDSTSIRDVLLFPTMRPQK 501
>gi|124524403|ref|ZP_01697917.1| lysyl-tRNA synthetase [Bacillus coagulans 36D1] >gi|124495069|gb|EAY42842.1| lysyl-tRNA synthetase [Bacillus coagulans 36D1] (394 aa)
Score = 1175, Expect = 1.1e-126, Identities = 225/387 (58%), Positives = 299/387 (77%)
  Q:   102 DLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           DLGDIV + G+ FRT+ GEL++ VK+  +++KAL+PLP+K+HGL D E R R RY+DLI++++S   F+ R RI++ IR ++D   YLEVETP++H I GGA ARPFIT HN L+ + Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+D+ HNPEFT +E+Y AY +   +M+LTEN+  + AK  L    ++ GE+E+ L  ++RR+HMVD IK+ TGVDFW V S +EA+ LAK+H+++  +H    GHI+N FFE+  E K IQPTFVYGHP+++SPL++K+ K+P FT RFELFI  +E+ANAF ELNDPIDQ ERF  Q+KE+  GNDEA +MD DFIEALEYG+PPT GLG+G+DR++ML T   SIRDVLLFP MK +
  S:     7 DLGDIVGLKGTVFRTKVGELSVKVKEFILLTKALRPLPDKFHGLRDIEQRYRQRYLDLIMSEESKNTFITRSRIIQSIRNYLDKNGYLEVETPMMHAIAGGAAARPFITHHNALDIDLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGIDTRHNPEFTMLELYEAYADFNDIMQLTENMIVHTAKEVLGTTTIRYGEHEVNLEPEWRRLHMVDAIKEYTGVDFWNVTSTEEARALAKEHHIEITEHME-YGHIVNEFFEQRVEEKLIQPTFVYGHPVEISPLARKNEKDPRFTDRFELFIVGREHANAFTELNDPIDQRERFVNQLKEREQGNDEAHQMDEDFIEALEYGMPPTGGLGIGVDRLVMLLTNAPSIRDVLLFPLMKSR 393
>gi|170017769|ref|YP_001728688.1| lysyl-tRNA synthetase [Leuconostoc citreum KM20] >gi|169804626|gb|ACA83244.1| Lysyl-tRNA synthetase [Leuconostoc citreum KM20] (493 aa)
Score = 1174, Expect = 1.5e-126, Identities = 249/485 (51%), Positives = 332/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNL-QEANQDPY--EIEKVSRTMTIGDF--NSKFAKLKTHNTNNNIKLAGRVVALRQTFGVI----RDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  NDQ L RR+KL  +  + + DP+    E+ ++   + D   NS    L++    + + +AGR++A R    VI    RD  G  Q Y  +  + ++      K  DLGD + I G   +T+ GELT+   ++  ++KAL+P+P+K+HG+ D E R R RY+DLI N++S K F  R +I+  IR +MDSQ+++EVETP+L    GGA ARPFIT HN L  + Y+RIATEL LK+L+VGGF++VYEIGRIFRNEGMD  HNPEFT+ME YAAY +   +M  TE +FK  A  +   + V     EI L   F R HMVD IK++TG+DFW+  S + AQ+LA   +VK+EK+   +GHIIN FFEEF E   +QPTFVYGHP++VSPL+K++ ++  FT RFELFI   EY NAF ELNDPIDQ  RFEAQV E+  GNDEA  +D DFIEALEYG+PPT GLG+GIDR++ML T+  +IRDVLLFP M+
  S:     4 EKALNDQMLARRQKLATIVDDLHLDPFGKRFERTAKAQELHDLYDNSTLETLESEQ--HEVVIAGRMIAKRGAGKVIFADFRDVSGKIQVYAKRDDLGENYP--IIKRADLGDFLGIKGIIMKTEAGELTVLATELTHLTKALRPMPDKFHGIADVETRYRKRYLDLIANEESFKKFQLRSKIISAIRAYMDSQDFMEVETPILQTEAGGAAARPFITHHNALNIDMYMRIATELYLKRLVVGGFERVYEIGRIFRNEGMDPKHNPEFTTMETYAAYMDFTDVMDETEGIFKAAASVVSDDLKVTYQGTEIDLGSNFARKHMVDLIKEQTGIDFWQDMSVEAAQKLADDKHVKYEKYWG-VGHIINAFFEEFVEDTLVQPTFVYGHPVEVSPLAKRNAEDSRFTDRFELFIMGSEYGNAFTELNDPIDQRARFEAQVAERENGNDEAENIDEDFIEALEYGMPPTGGLGIGIDRLVMLLTDSDTIRDVLLFPTMR 493
>gi|162448223|ref|YP_001621355.1| lysyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] >gi|161986330|gb|ABX81979.1| lysyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] (495 aa)
Score = 1173, Expect = 1.8e-126, Identities = 244/484 (50%), Positives = 338/484 (69%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN---NIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
            N+Q+ IR +K+++L++   DP+   +  RT    + ++ +  L          ++ +AGR+V LR+T G      ++D  G  Q Y+    V +   E F K  DLGDIV I G  FRT+  ELT+   +   ++KA+ PLP+K+HGL+D+E   R RYVDLIVN+DSM+V   R RI++  + + DS  ++EVETPVLHPILGGA ARPF+T HNTL+ +FYLRIATELPLK+LIVGG ++VYEIGR+FRNEG+ + HNPEFT++E Y A+ ++  MM+L E+    VA  +      +  ++    + F+R HMVD IK++TG DF+   S +EA+++AKKHNV+ E H  T+GHII  FF ++ E   IQPT V+GHP+++SPL+K + K+P FT RFELFI   EYANAF+ELNDP+DQ  RF  Q+K+K  G+DEA EMD+DF+EALEYG+PPT G+G+GIDR IML T   +IRDV+LFPH + K
  S:     6 LNEQQKIRLQKVEDLRKLGVDPFG-HRFDRTHLSNEIHTTYGSLTREELEAKEVHVIIAGRIV-LRRTQGKAGFIQLQDKEGRIQVYVRLDAVGEFQFELF-KHSDLGDIVGIKGVLFRTKTDELTVKASEFVHLTKAITPLPDKFHGLQDKEEARRRRYVDLIVNEDSMRVARTRPRIIRAFQHYFDSNGFIEVETPVLHPILGGAAARPFVTHHNTLDMDFYLRIATELPLKRLIVGGMERVYEIGRLFRNEGISAKHNPEFTTVEAYQAFGDVTDMMKLVEDCLSSVAFEVNGSYDVVFNDQTIHLKDFKRAHMVDLIKEQTGEDFFNQYSLEEAKQIAKKHNVQVEPH-FTVGHIIEAFFNDYVEKTIIQPTIVFGHPVEISPLAKSNDKDPRFTDRFELFIMGSEYANAFSELNDPVDQKNRFLDQLKQKEKGDDEASEMDIDFVEALEYGMPPTGGIGIGIDRFIMLLTNTPNIRDVILFPHARIK 493
>gi|42518374|ref|NP_964304.1| lysyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] >gi|41582659|gb|AAS08270.1| lysyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] (513 aa)
Score = 1172, Expect = 2.4e-126, Identities = 239/488 (48%), Positives = 331/488 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI---KLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + + NDQ + RREK+  ++E   +P+ + K  R       N K++       N ++   K+AGR++A R      F  + D  G  Q Y+ K  V +   + F K  D+GD + I G   +T  GELT+    I  +SKAL+PLP KW GL+D E   R RY+DLI N DS   FV R +I++ IR +++++++LEVETPVLH I GGA ARPFIT HN L+ + Y+RIA ELPLK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY +   +M   E + +  AK +     +     +I L + FRR+HMVD IK++TGVDFW+  + +EA+++A +HNV +E +   +GHIIN FFEEF E   +QPTFVYGHP++VSPL+KK+  +P FT RFE+FI   EY NAF+ELNDP DQ  RFE Q+ E+  GNDEA  +D D++ A+E+G+PPT GLG+GIDR++ML T+  +IRDVLLFP M+ +K
  S:     3 KNEMNDQLIARREKMDEMRENGIEPFGVRKFDRQDLARTLNEKYSNEDKDELNADMPMTKIAGRMLAKRGKGKVGFADLYDRTGKIQIYVRKDIVGEDNYKIFKKS-DIGDFLGIDGEVMKTDTGELTIRATHITFLSKALRPLPNKWDGLKDVEQIYRQRYLDLITNHDSYMRFVHRTQIIQAIRDYLNNRDFLEVETPVLHNIPGGAEARPFITHHNALDIDLYMRIALELPLKRLIVGGMERVYEIGRVFRNEGLDTKHNPEFTELETYAAYWDFHDVMDEAEGIIRAAAKVVSPDGKITYQGTDIDLGKPFRRVHMVDLIKEKTGVDFWKPMTIEEARKVADEHNVHYESYWK-VGHIINAFFEEFGEGSIVQPTFVYGHPVEVSPLAKKNADDPRFTDRFEIFIMGAEYGNAFSELNDPDDQRHRFEDQMAEREAGNDEADMIDEDYLRAMEFGMPPTGGLGIGIDRLVMLLTDAPAIRDVLLFPTMRPEK 496
>gi|116628954|ref|YP_814126.1| lysyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323] >gi|116094536|gb|ABJ59688.1| Lysyl-tRNA synthetase (class II) [Lactobacillus gasseri ATCC 33323] (504 aa)
Score = 1172, Expect = 2.6e-126, Identities = 235/488 (48%), Positives = 333/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI---KLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + + NDQ ++RREK+  ++E   +P+ + K  R       N K++K      N ++   K+AGR++A R      F  + D  G  Q Y+ K  V +   + F K  D+GD + I G   +T  GELT+    +  +SKAL+PLP KW GL+D E   R RY+DLI N +S   FV R +I++ IR +++ Q++LEVETPVLH I GGA ARPFIT HN L+ + Y+RIA ELPLK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY +   +M   E + +  AK +     +     +I L + FRR+HMVD IK++TGVDFW+  +++EA+++A++H +  E     +GH+IN FF+EFCE   + PTFVYGHP+++SPL+KK+  +P FT RFE+FI   EY NAF+ELNDP+DQ  RFE Q++E+  GNDEA  +D D+I A+E+G+PPT GLG+GIDR++ML T+  +IRDVLLFP M+ +K
  S:     3 KNEMNDQLIVRREKMDEMRENGIEPFGVRKFDRQDLARTLNEKYSKEDKDELNADMPTTKIAGRMLAKRGKGKVGFADLYDRTGKIQIYVRKDIVGEDNYKIFKKS-DIGDFLGIDGEVMKTDTGELTIRATHVTFLSKALRPLPNKWDGLKDVEQIYRQRYLDLITNHESYMRFVHRTQIIQAIRNYLNKQDFLEVETPVLHNIPGGAEARPFITHHNALDIDLYMRIALELPLKRLIVGGMERVYEIGRVFRNEGVDTRHNPEFTELETYAAYWDFHDVMDEAEEIIRAAAKVVSPDGKINYQGTDIDLGKPFRRVHMVDLIKEKTGVDFWKEMTDEEAKKIAEEHGIHTEPFWK-VGHVINAFFDEFCEKTIVDPTFVYGHPVEISPLAKKNADDPRFTDRFEIFILGMEYGNAFSELNDPVDQRHRFEEQMEEREAGNDEADMIDEDYIRAMEFGMPPTGGLGIGIDRLVMLLTDAPAIRDVLLFPTMRPEK 496
>gi|89892965|ref|YP_516452.1| hypothetical protein DSY0219 [Desulfitobacterium hafniense Y51] >gi|109647723|ref|ZP_01371626.1| lysyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] >gi|89332413|dbj|BAE82008.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109640813|gb|EAT50368.1| lysyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] (488 aa)
Score = 1172, Expect = 2.8e-126, Identities = 243/486 (50%), Positives = 335/486 (68%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ND   +R +KL  L+E   +PY  ++  RT    +    F  L+       +K+AGR+++ R      F  I+DF G  Q Y+ K  V +   E  +K  D+GDIV I G+ FRT++GE+++   +++I+SK+++PLPEK+HGL + ELR R RYVDLI+N +   VFV R +I++ +R F++ Q +LEVETP LH I GGA ARPFIT HNTL+ + YLRIA ELPLK+LIVGGFDKV+EIGR FRNEG+   HNPEFT ME+Y AY N E +M LTEN+   +AK +     V      I     +RR+ M++ I +  GVDF ++ +++EAQ+ AK+  +K E   S+ G IIN FFEEF E   IQPTFV GHP+++SPL+K++ ++P +T RFE F   +E  NAF+ELNDPIDQ +RFEAQV E+  G+DEA  MD DF++ALEYGLPPT GLG+GIDR++ML T+ +SIRDV+LFP M+ ++
  S:     3 EMNDLWRVRLDKLAQLRENGVEPYA-DRYQRTHMAQEILDGFDTLE----GQEVKIAGRMMSKRDQGKVVFTHIQDFSGQIQAYIRKDDVGEDWFELISK-FDIGDIVGIKGTVFRTRRGEISVHANEVQILSKSMRPLPEKFHGLTNVELRYRQRYVDLIMNPEVRNVFVMRSKIIRSMRNFLEGQGFLEVETPTLHTIPGGAAARPFITHHNTLDMDLYLRIALELPLKRLIVGGFDKVFEIGRNFRNEGISIKHNPEFTMMELYQAYANFEDIMELTENMISAIAKEVHGTTEVTYQGQMIDFKTPWRRLPMLEGILEYGGVDFSQIHTDEEAQQAAKEKGLKVEP-GSSRGKIINEFFEEFVEPNLIQPTFVIGHPVEISPLAKRNAEHPEYTDRFEAFAYGRELGNAFSELNDPIDQRQRFEAQVAERDKGDDEAHMMDEDFVQALEYGLPPTGGLGIGIDRLVMLLTDSASIRDVILFPTMRPRE 486
>gi|20808736|ref|NP_623907.1| lysyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4] >gi|39932223|sp|Q8R7N1|SYK_THETN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|20517378|gb|AAM25511.1| Lysyl-tRNA synthetase class II [Thermoanaerobacter tengcongensis MB4] (499 aa)
Score = 1170, Expect = 4.5e-126, Identities = 243/484 (50%), Positives = 331/484 (68%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK--KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
            N+   +RREKL  L+    +PY I++  RT    D  + +   +       + LAGR++  R     +F  I+D  G  Q Y+    V     E F K+LD+GDI+ + G  F+T+ GE+T++VK  K++ K+L+ LPEKWHGL+D +LR R RYVDLI+N    +VF+ R +I+K IR+F+D++ +LEVETPVLH I GGA ARPFIT HN L+ + YLRIA EL LK+LIVGGF+KVYEIGR+FRNEGMD  HNPEFT +E+Y AY +   MM LTE LF YVA+ +     ++  G  EI LT  ++RI MVD IK+  G+DF +V +++EA+++AK  N++ +K     G +I L F+E  E   IQPTFV  +P++VSPL+K+   NP FT RFE FI  +E ANAF+ELNDPIDQ ERF  Q++++  G++EA  MD DFI ALE G+PPT GLG+G+DR++M  T+  SIRDV+LFP MK K
  S:    15 LNELLRVRREKLNILRSMGIEPYGIDRFERTNLSSDIKNDYENFE----GKTVTLAGRIMTKRSHGKASFADIQDRDGRIQIYVRYDNVGGKNYEIF-KLLDIGDIIGVTGEVFKTKTGEITINVKDFKLLCKSLQVLPEKWHGLKDPDLRYRQRYVDLIINPSVREVFLKRTKIIKAIREFLDNRGFLEVETPVLHTIAGGAAARPFITHHNALDIDMYLRIALELHLKRLIVGGFEKVYEIGRVFRNEGMDIRHNPEFTLLELYEAYTDYHGMMELTEQLFAYVAEKVNGSTKIIYQG-TEIDLTPPWKRITMVDAIKEYVGIDFEKVATDEEARKIAKDLNLELKKPDMKKGEVIALVFDELVEKHLIQPTFVMDYPVEVSPLAKRKRDNPAFTSRFEAFIYGREVANAFSELNDPIDQKERFLEQLRQREAGDEEAHMMDEDFINALEVGMPPTGGLGIGVDRLVMFMTDSYSIRDVILFPTMKPK 498
>gi|167465842|ref|ZP_02330931.1| lysyl-tRNA synthetase [Paenibacillus larvae subsp. larvae BRL-230010] (432 aa)
Score = 1170, Expect = 4.8e-126, Identities = 226/423 (53%), Positives = 311/423 (73%)
  Q:    67 RQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + +F  ++D  G  Q Y+    V +   + F ++LDLGDI+ + G+ F+T+ GE ++ VK +++++K+L PLP+K+HGL+D ELR R RYVDLI+N+D  K F+ R +I++ +R ++DS  +LEVETP LH I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR++RNEG+ + HNPEFT +E+Y AY + + +M+LTE+L  ++AK  L    ++    E+ L   +RR+ MV+ +++ TGVDF    S++EA  LAK+HNV  E +  T GHI+N FFE F E   IQPTFVYGHP+ +SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPIDQ ERFEAQ++E+  GNDEA  MD DFI ALEYGLPPT GLG+G+DR+IML T   SIRDVLLFP M++++
  S:     9 KASFAHVQDISGQIQIYVRLDAVGEDKYKAF-EMLDLGDIIGVKGTVFKTKTGETSIKVKDLEVLTKSLIPLPDKFHGLQDVELRYRQRYVDLIMNQDVQKTFILRSKIIQSMRCYLDSLGFLEVETPTLHAIAGGASARPFITHHNALDMQLYMRIAIELHLKRLIVGGLEKVYEIGRVYRNEGVSTRHNPEFTMIELYEAYADYKDIMQLTEDLISHIAKEVLGSTTIEYQGKEVNLAGAWRRVSMVEAVREVTGVDFSVEMSDEEAHRLAKEHNVPVEPNM-TFGHIVNQFFETFVEETLIQPTFVYGHPVAISPLAKKNEEDPRFTDRFELFIVAREHANAFTELNDPIDQRERFEAQLREREQGNDEAHMMDEDFIRALEYGLPPTGGLGIGVDRLIMLLTNAPSIRDVLLFPTMRERQ 430
>gi|28209978|ref|NP_780922.1| lysyl-tRNA synthetase [Clostridium tetani E88] >gi|39932178|sp|Q899G7|SYK_CLOTE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|28202413|gb|AAO34859.1| lysyl-tRNA synthetase [Clostridium tetani E88] (502 aa)
Score = 1170, Expect = 5.0e-126, Identities = 244/485 (50%), Positives = 332/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E++FN     RR+K  +LQ   +DP+E+ KV RT T  +  S F +L+        +L  + V  +  F  I D YG  Q Y+    V +  L+ + K  D+GD V I G+ F+T+ GE+++ +   K+++K+LKPLPEKWHGL+D +LR R RYVDLIVN+D    F+ R +I+K +R+F+D+++Y+EVETPVL PI GGA ARPF T HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT +E+Y AY +   MM +TEN+  Y+A K      VK  E EI     ++RI MVD +K+ +GVDF E+K+++EA+EL K  + + +K     T   I+NLFFEE+ E   IQPTFV  +P+++SPLSKK   NP +T+RFE F+  +E  NA+ ELNDPI Q ERF  Q+KE+ LG+DEA  MD DFI ALE G+PPT GLG+G+DR++M  T+  SIRDV+LFP MK
  S:    12 EQEFNQLIQERRQKFFDLQAEGKDPFEVTKVERTHTSEEIKSNFEELEDKEVTVAGRLMSKRVHGKAGFSDIHDRYGKIQLYIKINDVGEERLKEY-KSFDIGDFVTITGTVFKTRTGEVSIHITDFKLIAKSLKPLPEKWHGLKDPDLRYRQRYVDLIVNEDVRDTFMKRTKIIKYMREFLDAKDYIEVETPVLSPIAGGAAARPFTTHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTMIELYEAYADYNDMMEITENMVAYIAEKVCGNTKVKYEETEIEFRPPWKRITMVDSVKEYSGVDFNEIKTDEEARELVKGKDFELKKKLEDCTKADILNLFFEEYVEKNLIQPTFVCDYPVEISPLSKKKNDNPEYTERFEGFVYGRELCNAYTELNDPIVQKERFIQQLKERELGDDEAFMMDEDFINALEIGMPPTGGLGIGVDRLVMFLTDSHSIRDVILFPTMK 498
>gi|148324255|gb|EDK89505.1| lysine--tRNA ligase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (493 aa)
Score = 1162, Expect = 3.7e-125, Identities = 242/488 (49%), Positives = 337/488 (69%)
  Q:     1 MERKFNDQE---LI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKL--AGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAV-EMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ME+ F+  E   LI  R +K++ L+     P+  +K  + + IGD       +  HN   N+K   AGR+++LR      F  I D  G  Q Y+ K ++ +   ++  K+L++GDI+ I G  F T   ELTL VK I +++K ++ LPEK+HGL D E+R R RYVDLI+N +    F+ R +I+K +R+++D + +LEVETP++HPILGGA A+PF+T HN L  + YLRIA EL LKKLIVGGF++VYE+GR FRNEG+ + HNPEFT +E+Y ++ N   MM L E +   V + +        +      + F R+HMVD IK+ TGVDFW+  + +EA+++AK+H+V+   H  ++GHIIN FFE+ CE + +QPTFVYGHP+++SPL+K++  NP FT RFELFIN +EYANAF ELNDP DQ  RFEAQV+E   GN+EA  E+D  F+EALEYGLPPT G+G+GIDR++ML T   SIRDV+LFP MK +
  S:     1 MEKYFDRLEKEPLIAERWKKIEELESYGIKPFG-KKYDKQIMIGD-------ILKHNPEENLKFKTAGRIMSLRGKGKVYFAHIEDQSGKIQIYIKKDELGEEQFDHIVKMLNVGDIIGIEGELFITHTEELTLRVKSIALLTKNVRSLPEKYHGLTDVEIRYRKRYVDLIMNPEVRDTFIKRTQIIKAVRKYLDDRGFLEVETPLMHPILGGAAAKPFVTHHNALNLDLYLRIAPELYLKKLIVGGFERVYELGRNFRNEGISTRHNPEFTMIELYQSHANFNDMMDLCEGIISSVCQEVNGTTDIEYDGVKLSLKNFARVHMVDMIKEVTGVDFWKEMTFEEAKKIAKEHHVEVADHMDSVGHIINEFFEQKCEERVVQPTFVYGHPVEISPLAKRNEDNPNFTDRFELFINKREYANAFTELNDPADQRGRFEAQVEEAMRGNEEATPEIDESFVEALEYGLPPTGGMGIGIDRLVMLLTGAPSIRDVILFPQMKPR 492
>gi|121535048|ref|ZP_01666865.1| lysyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] >gi|121306298|gb|EAX47223.1| lysyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] (498 aa)
Score = 1162, Expect = 3.7e-125, Identities = 231/488 (47%), Positives = 336/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + + N+   +RREKL  +   + +PY   K + +    D  + FA L+       ++LAGR++A+R     TF  + D  G  Q Y  +  + ++  ++F ++LD+GDI+ + G  F+TQ+GE+++     +I++K+L+PLPEKWHGL+D E R R RY+DLIVN +    FV R RI++ +R+++DS+ +LEVETP++HPI GGA ARPFIT+HN L+ N Y+RIA EL LK+LIVGGF++VYEIGR+FRNEG+   HNPEFT ME+Y AY + + +M++TE +   VA   L    +     EI LT  + R+ M + I + +GVDF  VK+ +EA+ +A +  V +EK +  +G+I+N  FEE  E   IQPTF+ GHP+++SPL+K++  NP  T RFE FI  +E AN F+ELNDPIDQ ERF AQV ++  G+DEA  MD D++ ALEYG+PPT GLG+GIDR++ML T+  SIRDV+LFPHM+ ++
  S:    12 QEELNELMRVRREKLAAIAAQDIEPYG-RKYNFSHHAADVLADFAALE----GQTVRLAGRIMAIRGHGKATFAHLMDMSGRIQVYFRQDVLGEAAYDFF-RLLDIGDIIGVEGVVFKTQRGEISVKATSFEILAKSLRPLPEKWHGLKDVETRYRQRYLDLIVNPEVRNTFVLRSRIIQAMRRYLDSKGFLEVETPMMHPIAGGAAARPFITYHNALDMNLYMRIAPELYLKRLIVGGFERVYEIGRVFRNEGISIRHNPEFTLMELYQAYADYQDIMKITEEIIAQVALDVLGTTKITYQGQEIDLTPPWTRMTMTEAILKYSGVDFSTVKTVEEARAIADRLGVVYEK-KDGIGNILNNVFEEVAEKHLIQPTFIIGHPVEISPLAKRNKDNPAITDRFEAFIFAREMANGFSELNDPIDQKERFLAQVAQRESGDDEAHMMDEDYVIALEYGMPPTGGLGIGIDRLVMLLTDSYSIRDVILFPHMRHRE 497
>gi|171853907|emb|CAM11870.1| Lysyl-tRNA synthetase (class II) [Candidatus Phytoplasma australiense] (497 aa)
Score = 1159, Expect = 8.8e-125, Identities = 240/484 (49%), Positives = 338/484 (69%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTH---NTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPH 484
           M +K  +QE IR +K++ L++   +P+  +  + + TI +    +  +          N+K+AGR++  R      F  ++DF    Q YL    +  + L Y N   DLGDIV I G  F+T+  ELT+       ++K+LKPLP+K+HGL++ E   + RY+DL+VN+ S +VF+ R  I+K IR F D++ +LEVETP+L P LGGA+A+PFIT HN L  +FYLRIATELPLKKLIVGG  KVYEIGRIFRNEGMD+THNPEF+++E Y AY +++ MM LT+   +Y+ +++ K +    +N+    Q F++I M D IK+ETG+DF +  S +   +LAK+H++    H S  GHII +FFE++ E K IQPTF+YGHP+++SPL+KK+  NP FT RFELFI  KE+ NAF+ELNDPI+Q +RF  Q+K+K LG+DEA EMD DF++AL YG+PPT GLG+GIDR++ML T+  +IRDV+LFPH
  S:     1 MNKKMTEQEGIRHQKIEELKKLKTEPFG-KNFTCSHTIENIILNYQNIDQEWFEENKVNVKIAGRIILKRGQGKAGFLHLQDFNFKIQVYLRSDLLGDAFLLYQN--CDLGDIVGIKGFLFKTKTKELTIKALDFIHLTKSLKPLPDKFHGLQNREEMRKKRYLDLMVNEKSRQVFLTRSLIIKSIRNFFDNEGFLEVETPILQPSLGGASAKPFITSHNALNSDFYLRIATELPLKKLIVGGMPKVYEIGRIFRNEGMDATHNPEFSTIEAYQAYSDIQGMMELTQKCLQYICQTVLKSLEINYQNKKISFQTFQKISMTDAIKKETGIDFQKKLSQETCLQLAKQHDINVMSHFSQ-GHIIEVFFEKYVEHKLIQPTFIYGHPLEISPLAKKNLNNPRFTDRFELFIAGKEFVNAFSELNDPIEQEKRFLNQLKQKELGDDEACEMDYDFLDALSYGMPPTGGLGMGIDRIVMLLTDTPNIRDVILFPH 487
>gi|167036745|ref|YP_001664323.1| lysyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855579|gb|ABY93987.1| lysyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] (499 aa)
Score = 1158, Expect = 9.7e-125, Identities = 245/485 (50%), Positives = 333/485 (68%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK--KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + N+   IRREKL  L+    +PY I++  RT    D  + +   +       + LAGR+++ R     +F  I+D  G  Q Y+    V +   E F K+LD+GDI+ + G  F+++ GE+T+ V   K++SK+L+ LPEKWHGL+D +LR R RY DLI+N +  +VF+ R +I+K IR+F+D++ +LEVETP+LH I GGA ARPFIT HN L+ + YLRIA EL LK+LIVGG +KVYE+GR+FRNEGMD  HNPEFT +E+Y AY +   MM LTE LF YVA+ +     +V  G  EI LT  ++RI MVD IK+  GVDF EVK+++EA E+AKK N++  K     G +I L F+E  E   IQPTFV  +P+++SPL+K+ + NP FT RFE FI  +E ANAF+ELNDPIDQ ERF  Q+K++  G++EA  MD DFI ALE G+PPT GLG+G+DR++M  T+  SIRDV+LFP MK K
  S:    14 ELNELLRIRREKLNILRSMGIEPYGIDRFERTNLSSDIKNDYENFE----GKVVTLAGRIMSKRSHGKASFADIQDRDGRIQIYVKYDTVGEKNYEIF-KILDIGDIIGVTGEVFKSKTGEITIRVTDFKLLSKSLQILPEKWHGLKDPDLRYRQRYTDLIINPEVKEVFLKRTKIIKAIREFLDNRGFLEVETPILHTIAGGAAARPFITHHNALDIDMYLRIALELHLKRLIVGGLEKVYEMGRVFRNEGMDIRHNPEFTLLELYEAYTDYYGMMELTEQLFAYVAQKVNGITKIVYQG-TEIDLTPPWKRITMVDAIKEYVGVDFNEVKTDEEAIEIAKKLNLE-TKEGMKKGEVIALVFDELVEQHLIQPTFVMDYPVEISPLAKRKHDNPAFTSRFEAFIYGREVANAFSELNDPIDQKERFLEQLKQREAGDEEAHMMDEDFINALEVGMPPTGGLGIGVDRLVMFMTDAYSIRDVILFPTMKPK 497
>gi|169335601|ref|ZP_02862794.1| hypothetical protein ANASTE_02016 [Anaerofustis stercorihominis DSM 17244] >gi|169258339|gb|EDS72305.1| hypothetical protein ANASTE_02016 [Anaerofustis stercorihominis DSM 17244] (491 aa)
Score = 1158, Expect = 1.0e-124, Identities = 244/476 (51%), Positives = 331/476 (69%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEY-FNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +R +K   L    + PY+  +        D N KF + +       +KLAGR+++ R      F  + D  G  Q ++ K  V +   EY   K  D+GDI+ + G  F+TQ+G++++ V+K+ ++SK+++ LPEK+HGL+D ELR R RYVDLI+N +   VF+ R +I+K +R FMD + ++EVETPVL  + GGANARPFIT HNTL+   Y+RIATELPLK+L+VGGFDKVYEIGRIFRNEGMD+THNPEFT+ME Y AY +   +M ++E +++Y+A K+L    V+ G+NEI L   FRR+ MVD I +ETGVDF ++   + A+E AKK NV  E+    +G II   FEE CEAK IQPTFV  HP+++SPL+KK   +  +T+RFELFI   EY N F+ELNDP DQ ERF AQ+++K+ G+DEA   D DFI ALE GLPPT G+G G+DR++ML T +SSIRDV+LFP MK
  S:    14 VRIDKFNELTNDGKYPYKESRFEYNAYCKDINEKFEEYE----GKKVKLAGRLMSKRGQGKVGFYDLMDSSGRIQLFIKKDVVGED--EYALIKAYDIGDILGVDGEVFKTQRGQISVRVEKVILLSKSIQVLPEKFHGLKDPELRYRQRYVDLIMNPEVKDVFLMRSKIVKCMRDFMDGEGFVEVETPVLGTLAGGANARPFITHHNTLDIPMYMRIATELPLKRLVVGGFDKVYEIGRIFRNEGMDATHNPEFTTMESYQAYADFNDVMNMSEKMYEYIASKTLGTTSVEFGDNEISLKAPFRRVKMVDLITEETGVDFDKITDIEVAREEAKKLNVVPEEEWG-IGKIIEEVFEEHCEAKLIQPTFVTHHPVEISPLAKKCMDDDRYTQRFELFIAGHEYCNGFSELNDPFDQRERFAAQMEKKATGDDEAHPYDTDFINALEVGLPPTGGVGFGVDRLVMLLTNQSSIRDVILFPTMK 488
>gi|167039464|ref|YP_001662449.1| lysyl-tRNA synthetase [Thermoanaerobacter sp. X514] >gi|166853704|gb|ABY92113.1| lysyl-tRNA synthetase [Thermoanaerobacter sp. X514] (499 aa)
Score = 1158, Expect = 1.2e-124, Identities = 244/485 (50%), Positives = 332/485 (68%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK--KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + N+   IRREKL  L+    +PY I++  RT    D  + +   +       + LAGR+++ R     +F  I+D  G  Q Y+    V +   E F K+LD+GDI+ + G  F+++ GE+T+ V   K++SK+L+ LPEKWHGL+D +LR R RY DLI+N +  +VF+ R +I+K IR+F+D++ +LEVETP+LH I GGA ARPFIT HN L+ + YLRIA EL LK+LIVGG +KVYE+GR+FRNEGMD  HNPEFT +E+Y AY +   MM LTE LF YVA+ +     +V  G  EI LT  ++RI MVD IK+  GVDF EVK++ EA E+AK+ N++  K     G +I L F+E  E   IQPTFV  +P+++SPL+K+ + NP FT RFE FI  +E ANAF+ELNDPIDQ ERF  Q+K++  G++EA  MD DFI ALE G+PPT GLG+G+DR++M  T+  SIRDV+LFP MK K
  S:    14 ELNELLRIRREKLNILRSMGIEPYGIDRFERTNVSSDIKNDYENFE----GKVVTLAGRIMSKRAHGKASFADIQDRDGRIQIYVKYDTVGEKNYEIF-KILDIGDIIGVTGEVFKSKTGEITIRVTDFKLLSKSLQILPEKWHGLKDPDLRYRQRYTDLIINPEVKEVFLKRTKIIKAIREFLDNRGFLEVETPILHTIAGGAAARPFITHHNALDIDMYLRIALELHLKRLIVGGLEKVYEMGRVFRNEGMDIRHNPEFTLLELYEAYTDYYGMMELTEQLFAYVAQKVNGTTKIVYQG-TEIDLTPPWKRITMVDAIKEYVGVDFNEVKADAEAVEIAKRLNLE-TKEGMKKGEVIALVFDELVEQHLIQPTFVMDYPVEISPLAKRKHDNPAFTSRFEAFIYGREVANAFSELNDPIDQKERFLEQLKQREAGDEEAHMMDEDFINALEVGMPPTGGLGIGVDRLVMFMTDAYSIRDVILFPTMKPK 497
>gi|187935723|ref|YP_001884425.1| lysyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] >gi|187723876|gb|ACD25097.1| lysyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] (501 aa)
Score = 1157, Expect = 1.3e-124, Identities = 236/489 (48%), Positives = 337/489 (68%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL--GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +E ++N+QE +RR KL +LQEA +DP+++ KV RT T  +  S + +L+      N+ +AGR+++ R      F  I D  G  Q ++    V +  L+ + K  DLGD V   G  F T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +  + F+ R +I+  IR+F+D++ +LEVETP+L PI GGA A+PF+T HNTL+ + YLRIATEL LK+L+V GF+KVYEIGR FRNEGM   HNPEFT++E+Y AY +   MM +TEN+  YV + +     V     EI     +RR+ MVD +K+  GVDF  +KS++EAQ +AK+ +++F K  +T+  G ++N  +EEF EA  IQPTFV  +P+++SPL+KK   N  FT+RFE F+  +E  NA++ELNDP+ Q +RFE Q KE+ LG+DEA  +D  F+ ALE G+PPT G+G+GIDR+IM  T+ SSIRDV+LFP MK +K
  S:    11 LESQYNEQEALRRTKLADLQEAGKDPFDVYKVERTHTSEEVKSNYEELE----GKNVTVAGRIMSKRGQGKVVFSDIHDRDGKIQLFIKIDLVGEESLKSY-KTYDLGDWVVATGEVFTTKTGEVSVKVSNFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKETFIKRSKIISGIREFLDTKGFLEVETPILAPIAGGAAAKPFVTHHNTLDIDMYLRIATELYLKRLVVAGFEKVYEIGRNFRNEGMSVRHNPEFTAIELYEAYSDYNDMMEITENMVAYVCEKVNGTTKVTYQGTEIDFMPPWRRVTMVDVVKEHAGVDFTTIKSDEEAQAIAKEKHLEFAKPLNTVTKGEVLNALYEEFGEANMIQPTFVMDYPVEISPLTKKKRGNEEFTERFEGFVFGRELCNAYSELNDPVVQRQRFEQQAKERELGDDEAYMLDEQFMSALETGMPPTGGMGMGIDRLIMFLTDASSIRDVILFPTMKPQK 501
>gi|58336620|ref|YP_193205.1| lysyl-tRNA synthetase [Lactobacillus acidophilus NCFM] >gi|58253937|gb|AAV42174.1| lys-tRNA synthetase lysrs [Lactobacillus acidophilus NCFM] (516 aa)
Score = 1157, Expect = 1.5e-124, Identities = 231/488 (47%), Positives = 334/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI---KLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + + NDQ  +RR+K+  ++E   +P+   K  R       + K+        NN++   K+AGR++A R      F  I D  G  Q Y+ K  V +   + F K  D+GD + I G   +T  GELT+    +  +SKAL+PLP+K+HGL+D E   R RY+DLI N+DS   FV R +I++ IR +++ Q+++EVETPVLH I GGA ARPFIT HN L+ + Y+RIA ELPLK+LIVG  ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY +   +M   E + +  AK +     +     +I L + FRR+HMVD IK++TGVDFW+  +++EA+++A++H++  E +   +GH+IN FFE++CE   + PTFVYGHP+++SPL+KK+  +P FT RFE++I  +EY NAF+ELNDP DQ  RFEAQ+ E+  GNDEA  +D D++ A+EYG+PPT GLG+GIDR++ML T+  +IRDVLLFP M+ ++
  S:     3 KNEMNDQLRVRRQKMDEMRENGIEPFGQRKFDRQDLAATLDEKYGNEDKDELNNDMPKTKVAGRMLAKRGKGKVGFADIYDRTGKIQIYVRKDIVGEENYKIFKKS-DIGDFLGIEGEVMKTDTGELTIRALHVTFLSKALRPLPDKYHGLKDVEAIYRQRYLDLITNRDSYMRFVHRTQIIQAIRDYLNKQDFMEVETPVLHNIPGGAEARPFITHHNALDIDLYMRIALELPLKRLIVGDMERVYEIGRVFRNEGLDTHHNPEFTELETYAAYWDFHDVMDEAEGIIRAAAKVVSPDGKITYQGTDIDLGKPFRRVHMVDLIKEKTGVDFWKPMTDEEAKKIAEEHDIHCESYWK-VGHVINAFFEKYCEETIVDPTFVYGHPVEISPLAKKNADDPRFTDRFEIYIMGEEYGNAFSELNDPDDQRARFEAQMAERDAGNDEADMIDEDYLRAMEYGMPPTGGLGIGIDRLVMLLTDAPAIRDVLLFPTMRPER 496
>gi|34763426|ref|ZP_00144374.1| Lysyl-tRNA synthetase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886895|gb|EAA24019.1| Lysyl-tRNA synthetase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (493 aa)
Score = 1157, Expect = 1.5e-124, Identities = 243/488 (49%), Positives = 337/488 (69%)
  Q:     1 MERKFNDQE---LI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKL--AGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAV-EMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ME+ F+  E   LI  R +K++ L+     P+  +K  + + IGD       +  H    N+K   AGR+++LR      F  I D  G  Q Y+ K ++ +   ++  K+L++GDI+ + G  F T   ELTL VK I +++K ++ LPEK+HGL D E+R R RYVDLI+N +    F+ R +I+K IR+++D + +LEVETP++HPILGGA A+PFIT HNTL  + YLRIA EL LKKLIVGGF++VY++ R FRNEG+ + HNPEFT +E+Y A+ +   MM L E +   V K +        +      + F R+HMVD IK+ TGVDFW+  + +EA+++AK+H+++   H +++GHIIN FFE+ CE K IQPTFVYGHP+++SPL+K++  NP FT RFELFIN +EYANAF ELNDP DQ  RFE+QV+E   GN+EA  E+D  F+EALEYGLPPT GLG+GIDR++ML T   SIRDV+LFP MK +
  S:     1 MEKYFDRLEKEPLIAERWKKIEELESYGIKPFG-KKYDKQIMIGD-------ILKHKPEENLKFKTAGRIMSLRGKGKVYFAHIEDQSGKIQIYIKKDELGEEQFDHIVKMLNVGDIIGLEGELFITHTEELTLRVKSIALLTKNVRSLPEKYHGLTDVEIRYRKRYVDLIMNPEVRDTFIKRTKIIKAIRKYLDDRGFLEVETPIMHPILGGAAAKPFITHHNTLNIDLYLRIAPELYLKKLIVGGFERVYDLNRNFRNEGISTRHNPEFTMVELYQAHADFHDMMDLCEGIISSVCKEVNGTTDIEYDGVKLSLKNFARVHMVDMIKEVTGVDFWKEMTFEEAKQIAKEHHIEVADHMNSVGHIINEFFEQKCEEKVIQPTFVYGHPVEISPLAKRNEDNPNFTDRFELFINKREYANAFTELNDPADQRGRFESQVEEAMHGNEEATPEIDESFVEALEYGLPPTGGLGIGIDRLVMLLTGAPSIRDVILFPQMKPR 492
>gi|161506863|ref|YP_001576817.1| lysyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] >gi|160347852|gb|ABX26526.1| Lysyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] (511 aa)
Score = 1155, Expect = 2.3e-124, Identities = 236/484 (48%), Positives = 331/484 (68%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI---KLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           NDQ  +RR+K+  ++E   +P+   K  R         K+ K      N+++   K+AGR++A R      F  + D  G  Q Y+ K  V +   + F K  D+GD + I G   +T  GELT+    +  +SKAL+PLP+K+HGL+D E   R RY+DLI N+DS   FV R +I++ IR +++ QN+LEVETPVLH I GGA ARPFIT HN L+   Y+RIA ELPLK+LIVG  ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY +   +M   E + +  AK +     +   G+ +I L + FRRIHMVD IK++TGVDFW+  + +EA ++A+ H++  EK    +GHIIN FFE++CE   + PTFVYGHP+++SPL+KK+  +P FT RFE++I  +EY NAF+ELNDP DQ  RFEAQ++E+  GNDEA  +D D++ A+EYG+PPT GLG+GIDR++ML T+  +IRDVLLFP M+ ++
  S:     2 NDQLRVRRQKMDEMRENGIEPFGQRKFDRQDLASTLEEKYGKEDEDELNDDMPKTKIAGRMLAKRGKGKVGFADLYDRTGKIQIYVRKDIVGEDNYKIFKKS-DIGDFLGIDGEVMKTDTGELTIRATHVTFLSKALRPLPDKYHGLKDVEAIYRQRYLDLITNRDSYMRFVHRTQIIQAIRDYLNKQNFLEVETPVLHNIPGGAEARPFITHHNALDIELYMRIALELPLKRLIVGDMERVYEIGRVFRNEGLDTHHNPEFTELESYAAYWDFHDVMDEAEGIIRAAAKVVSDDGKITYQGQ-DIDLGKPFRRIHMVDLIKEKTGVDFWKPMTLEEATKIAEDHDIHVEKFWK-VGHIINAFFEKYCEETIVDPTFVYGHPVEISPLAKKNADDPRFTDRFEIYIMGEEYGNAFSELNDPDDQRARFEAQMEEREAGNDEADMIDEDYLRAMEYGMPPTGGLGIGIDRLVMLLTDAPAIRDVLLFPTMRPER 491
>gi|182626013|ref|ZP_02953776.1| lysyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] >gi|177908720|gb|EDT71231.1| lysyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] (647 aa)
Score = 1155, Expect = 2.6e-124, Identities = 236/485 (48%), Positives = 334/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + ++QE++RR+KL  LQEA +DP+++ KV RT +  D    F +L+       +K+AGR+++ R      F  + D  G  Q ++    V +  L+ F K  DLGD V   G  F+T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +    F+ R +I+K IR+F+D++ +LEV+TP+L PI GGA ARPFIT HN L+ + YLRIATEL LK+LIV GF+KVYE+G+ FRNEG+   HNPEFT++E+Y AY +   MM + EN+  YV + +     V     EI  T  +RRI MVD +K+  G+DF E+KS++EAQ +AK+ N++F K   + T G ++N+ FEE+ E K IQPTF+  +P+++SPL+KK   N  FT+RFE F+  +E  NA++ELNDPI Q ERFE Q +E+  G+DEA  +D +F+ ALE G+PPT GLG+GIDRMIM  T+ SSIRDV+LFP MK
  S:    12 EEQLSEQEMLRRQKLAELQEAGKDPFDVYKVERTHSSADVKDNFEELE----GKEVKVAGRLMSKRGQGKVVFADLADLPGKIQLFIKIDNVGEEALKEF-KTFDLGDWVAATGEVFKTKMGEVSVKVTSFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKDTFIKRSQIVKAIREFLDNRGFLEVDTPILSPIAGGAAARPFITHHNALDIDMYLRIATELYLKRLIVAGFEKVYEMGKNFRNEGVSVRHNPEFTAIELYEAYADYNDMMEIMENMIAYVCEKVNGSTKVTYEGTEIDFTPPWRRITMVDAVKEFAGIDFNEIKSDEEAQAIAKEKNLEFPKPLDKVTKGEVLNMLFEEYGEDKLIQPTFLIDYPVEISPLTKKKRGNEMFTERFEGFVYGREVCNAYSELNDPIVQRERFEQQAREREYGDDEAYMLDEEFMSALETGMPPTGGLGIGIDRMIMFLTDSSSIRDVILFPTMK 498
>gi|110800440|ref|YP_697153.1| lysyl-tRNA synthetase [Clostridium perfringens ATCC 13124] >gi|123344474|sp|Q0TMI7|SYK_CLOP1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|110675087|gb|ABG84074.1| lysyl-tRNA synthetase [Clostridium perfringens ATCC 13124] (501 aa)
Score = 1154, Expect = 2.9e-124, Identities = 237/488 (48%), Positives = 336/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E + ++QE++RR+KL  LQEA +DP+++ KV RT +  D    F +L+       +K+AGR+++ R      F  + D  G  Q ++    V +  L+ F K  DLGD V   G  F+T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +    F+ R +I+K IR+F+D++ +LEV+TP+L PI GGA ARPFIT HN L+ + YLRIATEL LK+LIV GF+KVYE+G+ FRNEG+   HNPEFT++E+Y AY +   MM + EN+  YV + +     V     EI  T  +RRI MVD +K+  G+DF E+KS++EAQ +AK+ N++F K   + T G ++N+ FEE+ E K IQPTF+  +P+++SPL+KK   N  FT+RFE F+  +E  NA++ELNDPI Q ERFE Q +E+  G+DEA  +D +F+ ALE G+PPT GLG+GIDRMIM  T+ SSIRDV+LFP MK +K
  S:    12 EEQLSEQEMLRRQKLAELQEAGKDPFDVYKVERTHSSADVKDNFEELE----GKEVKVAGRLMSKRGQGKVVFADLADLPGKIQLFIKIDNVGEEALKEF-KTFDLGDWVAATGEVFKTKMGEVSVKVTSFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKDTFIKRSQIVKAIREFLDNRGFLEVDTPILSPIAGGAAARPFITHHNALDIDMYLRIATELYLKRLIVAGFEKVYEMGKNFRNEGVSVRHNPEFTAIELYEAYADYNDMMEIMENMIAYVCEKVNGSTKVTYEGTEIDFTPPWRRITMVDAVKEFAGIDFNEIKSDEEAQAIAKEKNLEFPKPLDKVTKGEVLNMLFEEYGEDKLIQPTFLIDYPVEISPLTKKKRGNEMFTERFEGFVYGREVCNAYSELNDPIVQRERFEQQAREREYGDDEAYMLDEEFMSALETGMPPTGGLGIGIDRMIMFLTDSSSIRDVILFPTMKPQK 501
>gi|19703801|ref|NP_603363.1| lysyl-tRNA synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|39932224|sp|Q8RG52|SYK_FUSNN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|19713947|gb|AAL94662.1| Lysyl-tRNA synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (493 aa)
Score = 1154, Expect = 2.9e-124, Identities = 243/488 (49%), Positives = 338/488 (69%)
  Q:     1 MERKFNDQE---LI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKL--AGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAV-EMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ME+ F+  E   LI  R +K++ L+     P+  +K  + + IGD       +  H    N+K   AGR+++LR      F  I D  G  Q Y+ K ++ +   ++  K+L++GDI+ + G  F T   ELTL VK I +++K ++ LPEK+HGL D E+R R RYVDLI+N +  + F+ R +I+K IR+++D + +LEVETP++HPILGGA A+PFIT HNTL  + +LRIA EL LKKLIVGGF++VY++ R FRNEG+ + HNPEFT +E+Y A+ +   MM L E +   V + +        +      + F R+HMVD IK+ TGVDFW+  + +EA++LAK+H+V+   H +++GHIIN FFE+ CE K IQPTFVYGHP+++SPL+K++  NP FT RFELFIN +EYANAF ELNDP DQ  RFEAQV+E   GN+EA  E+D  F+EALEYGLPPT G+G+GIDR++ML T   SIRDV+LFP MK +
  S:     1 MEKYFDRLEKEPLIAERWKKIEELESYGIKPFG-KKYDKQIMIGD-------ILKHKPEENLKFKTAGRIMSLRGKGKVYFAHIEDQSGKIQIYIKKDELGEEQFDHIVKMLNVGDIIGLEGELFITHTEELTLRVKSIALLTKNVRSLPEKYHGLTDVEIRYRKRYVDLIMNPEVRETFIKRTKIIKAIRKYLDDRGFLEVETPIMHPILGGAAAKPFITHHNTLNIDLFLRIAPELYLKKLIVGGFERVYDLNRNFRNEGISTRHNPEFTMVELYQAHADFNDMMDLCEGIISSVCQEINGTTDIEYDGVQLSLKNFNRVHMVDMIKEVTGVDFWKEMTFEEAKKLAKEHHVEVADHMNSVGHIINEFFEQKCEEKVIQPTFVYGHPVEISPLAKRNEDNPNFTDRFELFINKREYANAFTELNDPADQRGRFEAQVEEAMRGNEEATPEIDESFVEALEYGLPPTGGMGIGIDRLVMLLTGAPSIRDVILFPQMKPR 492
>gi|168215147|ref|ZP_02640772.1| lysyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] >gi|170713448|gb|EDT25630.1| lysyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] (501 aa)
Score = 1154, Expect = 3.4e-124, Identities = 237/488 (48%), Positives = 336/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E + ++QE++RR+KL  LQEA +DP+++ KV RT +  D    F +L+       +K+AGR+++ R      F  + D  G  Q ++    V +  L+ F K  DLGD V   G  F+T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +    F+ R +I+K IR+F+D++ +LEV+TP+L PI GGA ARPFIT HN L+ + YLRIATEL LK+LIV GF+KVYE+G+ FRNEG+   HNPEFT++E+Y AY +   MM + EN+  YV + +     V     EI  T  +RRI MVD +K+  G+DF E+KS++EAQ +AK+ N++F K   + T G ++N+ FEE+ E K IQPTF+  +P+++SPL+KK   N  FT+RFE F+  +E  NA++ELNDPI Q ERFE Q +E+  G+DEA  +D +F+ ALE G+PPT GLG+GIDRMIM  T+ SSIRDV+LFP MK +K
  S:    12 EEQLSEQEMLRRQKLAELQEAGKDPFDVYKVERTHSSADAKDNFEELE----GKEVKVAGRLMSKRGQGKVVFADLADLPGKIQLFIKIDNVGEEALKEF-KTFDLGDWVAATGEVFKTKMGEVSVKVTSFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKDTFIKRSQIVKAIREFLDNRGFLEVDTPILSPIAGGAAARPFITHHNALDIDMYLRIATELYLKRLIVAGFEKVYEMGKNFRNEGVSVRHNPEFTAIELYEAYADYNDMMEIMENMIAYVCEKVNGSTKVTYEGTEIDFTPPWRRITMVDAVKEFAGIDFNEIKSDEEAQAIAKEKNLEFPKPLDKVTKGEVLNMLFEEYGEDKLIQPTFLIDYPVEISPLTKKKRGNEMFTERFEGFVYGREVCNAYSELNDPIVQRERFEQQAREREYGDDEAYMLDEEFMSALETGMPPTGGLGIGIDRMIMFLTDSSSIRDVILFPTMKPQK 501
>gi|110803200|ref|YP_699721.1| lysyl-tRNA synthetase [Clostridium perfringens SM101] >gi|123047148|sp|Q0SQ86|SYK_CLOPS Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|110683701|gb|ABG87071.1| lysyl-tRNA synthetase [Clostridium perfringens SM101] (501 aa)
Score = 1153, Expect = 3.7e-124, Identities = 237/488 (48%), Positives = 336/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E + ++QE++RR+KL  LQEA +DP+++ KV RT +  D    F +L+       +K+AGR+++ R      F  + D  G  Q ++    V +  L+ F K  DLGD V   G  F+T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +    F+ R +I+K IR+F+D++ +LEV+TP+L PI GGA ARPFIT HN L+ + YLRIATEL LK+LIV GF+KVYE+G+ FRNEG+   HNPEFT++E+Y AY +   MM + EN+  YV + +     V     EI  T  +RRI MVD +K+  G+DF E+KS++EAQ +AK+ N++F K   + T G ++N+ FEE+ E K IQPTF+  +P+++SPL+KK   N  FT+RFE F+  +E  NA++ELNDPI Q ERFE Q +E+  G+DEA  +D +F+ ALE G+PPT GLG+GIDRMIM  T+ SSIRDV+LFP MK +K
  S:    12 EEQLSEQEMLRRQKLVELQEAGKDPFDVYKVERTHSSADVKDNFEELE----GKEVKVAGRLMSKRGQGKVVFADLADLPGKIQLFIKIDNVGEEALKEF-KTFDLGDWVAATGEVFKTKMGEVSIKVTSFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKDTFIKRSQIVKAIREFLDNRGFLEVDTPILSPIAGGAAARPFITHHNALDIDMYLRIATELYLKRLIVAGFEKVYEMGKNFRNEGVSVRHNPEFTAIELYEAYADYNDMMEIMENMIAYVCEKVNGSTKVTYEGTEIDFTPPWRRITMVDAVKEFAGIDFNEIKSDEEAQAIAKEKNLEFPKPLDKVTKGEVLNMLFEEYGEDKLIQPTFLVDYPVEISPLTKKKRGNEMFTERFEGFVYGREVCNAYSELNDPIVQRERFEQQAREREYGDDEAYMLDEEFMSALETGMPPTGGLGIGIDRMIMFLTDSSSIRDVILFPTMKPQK 501
>gi|18311447|ref|NP_563381.1| lysyl-tRNA synthetase [Clostridium perfringens str. 13] >gi|168218225|ref|ZP_02643850.1| lysyl-tRNA synthetase [Clostridium perfringens NCTC 8239] >gi|169343177|ref|ZP_02864198.1| lysyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] >gi|39932227|sp|Q8XHL8|SYK_CLOPE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|18146131|dbj|BAB82171.1| lysine-tRNA ligase [Clostridium perfringens str. 13] >gi|169298729|gb|EDS80805.1| lysyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] >gi|182379764|gb|EDT77243.1| lysyl-tRNA synthetase [Clostridium perfringens NCTC 8239] (501 aa)
Score = 1153, Expect = 4.6e-124, Identities = 237/488 (48%), Positives = 336/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E + ++QE++RR+KL  LQEA +DP+++ KV RT +  D    F +L+       +K+AGR+++ R      F  + D  G  Q ++    V +  L+ F K  DLGD V   G  F+T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +    F+ R +I+K IR+F+D++ +LEV+TP+L PI GGA ARPFIT HN L+ + YLRIATEL LK+LIV GF+KVYE+G+ FRNEG+   HNPEFT++E+Y AY +   MM + EN+  YV + +     V     EI  T  +RRI MVD +K+  G+DF E+KS++EAQ +AK+ N++F K   + T G ++N+ FEE+ E K IQPTF+  +P+++SPL+KK   N  FT+RFE F+  +E  NA++ELNDPI Q ERFE Q +E+  G+DEA  +D +F+ ALE G+PPT GLG+GIDRMIM  T+ SSIRDV+LFP MK +K
  S:    12 EEQLSEQEMLRRQKLVELQEAGKDPFDVYKVERTHSSADVKDNFEELE----GKEVKVAGRLMSKRGQGKVVFADLADLPGKIQLFIKIDNVGEEALKEF-KTFDLGDWVAATGEVFKTKMGEVSVKVTSFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKDTFIKRSQIVKAIREFLDNRGFLEVDTPILSPIAGGAAARPFITHHNALDIDMYLRIATELYLKRLIVAGFEKVYEMGKNFRNEGVSVRHNPEFTAIELYEAYADYNDMMEIMENMIAYVCEKVNGSTKVTYEGTEIDFTPPWRRITMVDAVKEFAGIDFNEIKSDEEAQAIAKEKNLEFPKPLDKVTKGEVLNMLFEEYGEDKLIQPTFLIDYPVEISPLTKKKRGNEMFTERFEGFVYGREVCNAYSELNDPIVQRERFEQQAREREYGDDEAYMLDEEFMSALETGMPPTGGLGIGIDRMIMFLTDSSSIRDVILFPTMKPQK 501
>gi|168206860|ref|ZP_02632865.1| lysyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] >gi|168211213|ref|ZP_02636838.1| lysyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] >gi|170661760|gb|EDT14443.1| lysyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] >gi|170710776|gb|EDT22958.1| lysyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] (647 aa)
Score = 1152, Expect = 4.8e-124, Identities = 236/485 (48%), Positives = 334/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + ++QE++RR+KL  LQEA +DP+++ KV RT +  D    F +L+       +K+AGR+++ R      F  + D  G  Q ++    V +  L+ F K  DLGD V   G  F+T+ GE+++ V   +++ K+LKPLPEKWHGL+D +LR R R VD+I N +    F+ R +I+K IR+F+D++ +LEV+TP+L PI GGA ARPFIT HN L+ + YLRIATEL LK+LIV GF+KVYE+G+ FRNEG+   HNPEFT++E+Y AY +   MM + EN+  YV + +     V     EI  T  +RRI MVD +K+  G+DF E+KS++EAQ +AK+ N++F K   + T G ++N+ FEE+ E K IQPTF+  +P+++SPL+KK   N  FT+RFE F+  +E  NA++ELNDPI Q ERFE Q +E+  G+DEA  +D +F+ ALE G+PPT GLG+GIDRMIM  T+ SSIRDV+LFP MK
  S:    12 EEQLSEQEMLRRQKLVELQEAGKDPFDVYKVERTHSSADVKDNFEELE----GKEVKVAGRLMSKRGQGKVVFADLADLPGKIQLFIKIDNVGEEALKEF-KTFDLGDWVAATGEVFKTKMGEVSVKVTSFELICKSLKPLPEKWHGLKDPDLRYRQREVDIITNPEVKDTFIKRSQIVKAIREFLDNRGFLEVDTPILSPIAGGAAARPFITHHNALDIDMYLRIATELYLKRLIVAGFEKVYEMGKNFRNEGVSVRHNPEFTAIELYEAYADYNDMMEIMENMIAYVCEKVNGSTKVTYEGTEIDFTPPWRRITMVDAVKEFAGIDFNEIKSDEEAQAIAKEKNLEFPKPLDKVTKGEVLNMLFEEYGEDKLIQPTFLIDYPVEISPLTKKKRGNEMFTERFEGFVYGREVCNAYSELNDPIVQRERFEQQAREREYGDDEAYMLDEEFMSALETGMPPTGGLGIGIDRMIMFLTDSSSIRDVILFPTMK 498
>gi|184154700|ref|YP_001843040.1| lysyl-tRNA synthase [Lactobacillus fermentum IFO 3956] >gi|183226044|dbj|BAG26560.1| lysyl-tRNA synthase [Lactobacillus fermentum IFO 3956] (497 aa)
Score = 1152, Expect = 5.8e-124, Identities = 242/488 (49%), Positives = 329/488 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAK------LKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E   NDQ ++RREK++ L++    P+            D   K+        L  HN    + +AGR++  R     +F  + D  G  QFY+ +  V +   + F K  DLGD   I G   +T+ GELT+  +KI  +SKAL+PLP+K+HGL+D EL  R RY+DLI N++S + F  R +I+K +R++MD   +LEVETP+L  I  GA ARPF+T HN L  + Y+RIATEL LK+LIVGG ++VYE+GRIFRNEGMD  HNPEF +ME YAAY +   +M+ TE +FK  A  +   + +     E+  +  F+R+HMVD IK+ TG+DFW+  + +EA++LA  + +K+E     +GHIIN FFEE  +    QP F+YGHP++VSPL+K + ++  FT RFEL+I  KEYANAF+ELNDPIDQ +RFEAQ +E + GNDEA  +D DF+EALEYG+PPT GLGVGIDRM+ML T+  SIRDVLLFP M+ KK
  S:     4 EEHLNDQMVVRREKMQALRDQGVAPFGHRFDPDHDLSTDIRKKYENDSGELLLAQHNV---VTIAGRMIGKRGSGKASFADLLDRGGKIQFYVRQDMVGEEAYKLF-KESDLGDFWGITGDVIKTRMGELTVRAEKITFLSKALRPLPDKYHGLQDPELVYRQRYLDLITNRESFERFQTRTKIIKAVRRYMDDNGFLEVETPILENIASGAEARPFVTHHNALNIDMYMRIATELRLKRLIVGGMERVYELGRIFRNEGMDPYHNPEFDTMETYAAYFDFNDVMKETEGIFKAAAGVVADDLKITYQGTELDFSTSFKRLHMVDAIKEATGIDFWQEMTVEEARKLADDNGIKYESWWK-VGHIINAFFEEKVQDTLEQPIFIYGHPVEVSPLAKINEEDSRFTDRFELYILGKEYANAFSELNDPIDQRKRFEAQAQENAEGNDEAQPIDEDFVEALEYGMPPTGGLGVGIDRMVMLMTDAKSIRDVLLFPTMRPKK 497
>gi|182420117|ref|ZP_02951351.1| lysyl-tRNA synthetase [Clostridium butyricum 5521] >gi|182376154|gb|EDT73741.1| lysyl-tRNA synthetase [Clostridium butyricum 5521] (501 aa)
Score = 1149, Expect = 1.3e-123, Identities = 236/489 (48%), Positives = 334/489 (68%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL--GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +E +F++QE +RREKL  LQ+A++DP+++ KV+RT T G+    + +L+       + +AGR+++ R      F  I D  G  Q +L   KV +  L+ + K  D+GD V   G  F TQ+GE++++V   ++  K+LKPLPEKWHGL+D +LR R R +D+I N +    FV R RI+  +R+F+D++ +LEVETP+L PI GGA A+PF+T HNTL+ + +LRIA EL LK+LIV GF+KVYEIGR FRNEGM   HNPEFT++E+Y AY +   MM +TEN+  YV + +     V     EI     +RRI MVD +K+  GVDF  + S++EAQ +AK+ N++F K  +T+  G ++N  +EEF E K IQPTF+  +P++ SPL+KK   N  FT+RFE F+  +E  NA++ELNDPI Q ERFE Q   + LG+DEA  +D  F+ ALE G+PPT GLG+GIDR+IM  T+ +SIRDV+LFP MK +K
  S:    11 LESQFSEQEGLRREKLAELQKADKDPFDVYKVNRTHTTGEVRDNYEELE----GKEVTIAGRIMSKRGQGKVVFSDIHDKDGKMQLFLKIDKVGEENLKEY-KTYDIGDWVAATGEVFTTQRGEISINVNSFELTCKSLKPLPEKWHGLKDPDLRYRQRELDIITNSEVKDTFVKRSRIISAMREFLDNRGFLEVETPILSPIAGGAAAKPFVTHHNTLDMDMFLRIAPELYLKRLIVAGFEKVYEIGRNFRNEGMSVRHNPEFTAIELYEAYSDYNDMMEITENMVAYVCEKINGTTKVTYQGTEIDFMPPWRRITMVDAVKEYAGVDFTTINSDEEAQAIAKEKNLEFPKPLNTVTKGEVLNALYEEFGEEKMIQPTFIMDYPVENSPLTKKKRGNAEFTERFEAFVFGRELGNAYSELNDPIVQRERFEQQANARELGDDEAYMLDEQFMSALETGMPPTGGLGIGIDRLIMFLTDSASIRDVILFPTMKPQK 501
>gi|158319501|ref|YP_001512008.1| lysyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] >gi|158139700|gb|ABW18012.1| lysyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] (495 aa)
Score = 1148, Expect = 1.8e-123, Identities = 243/485 (50%), Positives = 333/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  N+   IRR+KLK+LQE  +DP++IEKV  T         F +L+  N      +AGR++  R     +F  I+D  G  Q Y+ + K+     E F    D+GDI+EI G  F+T K E+++   ++++++K+++ LP+KWHGL+D +LR R RYVDLIVN +  K FV R + +K I++F+D++ YLEVETP+L  + GGANARPFIT HNTL+ + YLRIA EL LK+LIVGGFDKVYE+GR+FRNEGM   HNPEFTS+E+Y AY +   MM +TEN+  Y A K+L    +     EI LT  + R+ MV+  ++   VDF EVK+++EA  +AKK  ++        GHII+L FEEF E   IQPTF+  HP+++SPL+K++ ++P FT RFE FINT E ANAF+ELNDPIDQ  RF  Q++++  G+DEA  +D DF+ A+E GLPPT GLG+GIDR++ML T   SIRDVLLFP MK
  S:     5 EQNLNELLKIRRDKLKHLQEIGKDPFKIEKVYVTHYSQQIIEDFEQLEGQNAT----IAGRIMTKRGHGKASFINIQDKDGQIQVYVREDKIGAEDYELF-VTYDIGDIIEIKGEIFKTNKDEISVRANEVRLLTKSIQILPDKWHGLKDHDLRYRQRYVDLIVNPEVKKTFVTRSKAIKAIKEFLDNRGYLEVETPILGTLAGGANARPFITHHNTLDIDMYLRIANELFLKRLIVGGFDKVYEMGRMFRNEGMSIKHNPEFTSIELYEAYADYNDMMDITENIVAYAAEKALGTTKINYQGQEIDLTPPWNRMTMVEACRKYANVDFDEVKTDEEAIAIAKKLGLEVNPAMKK-GHIISLVFEEFGEKHLIQPTFITQHPVEISPLAKRNPEDPAFTNRFEAFINTWEIANAFSELNDPIDQRGRFMDQLEQREAGDDEAHVLDEDFLNAIEVGLPPTGGLGIGIDRLMMLITNSPSIRDVLLFPTMK 488
>gi|169824684|ref|YP_001692295.1| lysyl-tRNA synthetase class II [Finegoldia magna ATCC 29328] >gi|167831489|dbj|BAG08405.1| lysyl-tRNA synthetase class II [Finegoldia magna ATCC 29328] (636 aa)
Score = 1146, Expect = 2.8e-123, Identities = 238/482 (49%), Positives = 337/482 (69%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKV--LDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            N+   IRR+KL+ L +AN++PY  EK        + +  F +         +K+AGR+++ R      F  ++D  G  Q +    KV++   E + KV  +D+GDIV + GS F+T  GE+++  K + ++SK+L+ LPEKWHGL+D +LR R RYVDLI+N +    FV R RI+  IR+F+D++ +LEV+TP+L+ I GGANARPFIT HNTL+ + YLRIA EL LK+LIVGGFDKVYE+GR+FRNEGMD THNPE+T++E+Y AY +   MM +TE L  +V + +   +  + GE EI  T  ++RI MVD IK+   ++F E++++++A+E+AK +NV  + + S  G +IN  FE FCE K +QPTFV GHP++VSPL+K++  +  +T RFE F+ TKE ANAF+ELN+PIDQ ERF  QV+ +  G+DEA  MD DF+ ALE GLPPT GLG+G+DR+IM+ T   SIRD++LFP MK
  S:     4 LNEMLQIRRQKLQELLDANENPYVHEKFDNANNTKEISDNFDEFD----GKEVKIAGRIMSKRGHGKVNFMDLQDSLGRIQLF---NKVNELGEENYAKVKNMDIGDIVGVEGSIFKTHSGEISIRTKSVVLLSKSLQILPEKWHGLKDPDLRYRQRYVDLIMNPEIKDTFVKRSRIISAIREFLDTRGFLEVDTPILNTIAGGANARPFITHHNTLDIDMYLRIANELYLKRLIVGGFDKVYEMGRMFRNEGMDHTHNPEYTAIELYQAYADYNDMMDITEQLVAFVCEKVNGSMKSQFGETEIDFTPPWKRITMVDAIKEYADINFDEIETDEQAREVAKANNVDIKDNMSR-GEVINECFEHFCEEKLVQPTFVLGHPVEVSPLAKRNPDDERYTHRFEAFVCTKEIANAFSELNNPIDQKERFLKQVEARENGDDEAQMMDYDFLNALEVGLPPTGGLGIGVDRLIMMLTNNESIRDIMLFPTMK 484
>gi|150392206|ref|YP_001322255.1| lysyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] >gi|149952068|gb|ABR50596.1| lysyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] (499 aa)
Score = 1143, Expect = 5.6e-123, Identities = 244/476 (51%), Positives = 326/476 (68%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           IRREKLK LQ++ QDP++IEKV  T         F  L+       + +AGR++A R     +F  I+D  G  Q Y+ + K+ +   E F    D GDI+EI G  F+T KGE+++   ++K+++K+L+ LPEKWHGL+D++LR R RYVDLIVN +  K F+ R R +K IR F+D + Y+EVETP+L  I GGA+A+PF T HNTL  + YLRIATEL LK+LIVGG D+VYEIGR+FRNEGM   HNPEFT++E+Y AY + + MM +TEN+  +VA+ +L    +     EI LT  +RRI M D  K+   VDF E+K+++EA ELAKK  ++        GH+IN  FE F E   +QPTF+  HP++VSPL+K++  NP  T RFE F+NT E ANAF+ELNDPIDQ  RF  Q+ ++  G+DEA  +D DF+ ALE GLPPT GLG+GIDR++ML T+  SIRDVLLFP MK
  S:    13 IRREKLKYLQDSGQDPFKIEKVHITHYSEQIQEDFEALE----GQKVTIAGRMMAKRGHGKASFINIQDKDGRIQVYVREDKIGEKAYELF-VTYDRGDILEIQGEIFKTNKGEVSVKALEVKLLTKSLQVLPEKWHGLKDQDLRYRQRYVDLIVNPEVKKTFMVRSRAIKSIRSFLDDRGYIEVETPILDTIAGGASAKPFTTHHNTLGIDMYLRIATELHLKRLIVGGLDRVYEIGRLFRNEGMSIKHNPEFTTIELYEAYADYKDMMDITENIVAHVAENALGTTKITYQGTEIDLTPPWRRISMTDSCKEYADVDFSEIKTDEEAIELAKKLGLEVRPGMKK-GHVINEVFETFVEKHLMQPTFITHHPVEVSPLAKRNPDNPEITNRFEAFVNTWEIANAFSELNDPIDQRARFMEQLVQREAGDDEAHMLDEDFLNALEVGLPPTGGLGIGIDRLMMLLTDSPSIRDVLLFPTMK 487
>gi|15828873|ref|NP_326233.1| lysyl-tRNA synthetase (lysine--tRNA ligase) (LysRS) [Mycoplasma pulmonis UAB CTIP] >gi|39932449|sp|Q98QG4|SYK2_MYCPU Lysyl-tRNA synthetase 2 (Lysine--tRNA ligase 2) (LysRS 2) >gi|14089816|emb|CAC13575.1| LYSYL-TRNA SYNTHETASE (LYSINE--TRNA LIGASE) (LYSRS) [Mycoplasma pulmonis] (491 aa)
Score = 1142, Expect = 7.0e-123, Identities = 252/486 (51%), Positives = 337/486 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYE-IEKVSRTMTIGDFNSKFAKL-KTHNTNNNIKL--AGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           K  +QE+IRREKLK  ++   + ++  +     +   + N K++ L K       IKL  AGR++  R  F VI+D  G  Q Y++KK++ +        +LD+GDI+ + G+  +T KGELT+ V    +++K L PL EK+HGL D E R R RY+DLI N +  ++F  R +I+  IR+F D QN++EVETP+LH ILGGA+ARPF T+HN+L  +F LRIATELPLKKL+VGG D+VYEIGRIFRNEG+D+THNPEFTS+E Y AY N+E MM  TENL K++AK L    +K  + EI L   F++I+MVD + + T VDF  +  N+ A E+AK + +K EK+   +GHIIN  FE   E   IQPTFV G+PI+VSPL+    K+  FT+R ELFINTKEYAN F ELNDP+DQ  RFEAQ +EK  GN+EA E+D DF+ ALEYGLPP  G G+GIDR++ML T+K SIR+V+LFP +K K+
  S:     6 KLTEQEIIRREKLKKYEDLGVETFKKFDHEKINIYSNEINQKYSNLTKDELLEKQIKLIVAGRILTQRGPFIVIQDTNGKIQLYIDKKELEERKETL--ALLDIGDIIYVKGTLMKTMKGELTIKVNFFDLLTKGLTPLAEKYHGLVDVEERYRKRYLDLISNPNIKEIFWTRTKIISKIREFFDKQNFMEVETPMLHSILGGASARPFKTYHNSLSSSFNLRIATELPLKKLLVGGIDRVYEIGRIFRNEGIDTTHNPEFTSIEFYQAYSNLEIMMEQTENLIKFIAKELGLSKIKNHDVEIDLLADFKKINMVDAVSEATKVDFRNIDLNK-AIEIAKSYKIKVEKY-FKVGHIINELFELLIEKTLIQPTFVMGYPIEVSPLAACS-KDKRFTERAELFINTKEYANMFTELNDPLDQRRRFEAQFEEKESGNEEASEIDEDFLNALEYGLPPAGGCGIGIDRLVMLLTQKESIREVILFPTLKKKQ 490
>gi|153952825|ref|YP_001393590.1| lysyl-tRNA synthetase [Clostridium kluyveri DSM 555] >gi|189082956|sp|A5N4L1|SYK_CLOK5 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|146345706|gb|EDK32242.1| LysS [Clostridium kluyveri DSM 555] (502 aa)
Score = 1141, Expect = 9.1e-123, Identities = 239/486 (49%), Positives = 326/486 (67%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKH--QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +E  FN     R +K KNLQE N+DP+E+ KV RT T  +    +  L   +     +L  + V  +  F  + D YG  Q Y+    V +  L+ + K  D+GDI+ + G  F+T+ GE+++ +   ++ +K+LKPLPEKWHGL+D +LR R RYVDLI+N+D    F+ R  +++ IR+F+D ++Y+EVETP+L  I GGA A+PFIT HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT+ME+Y A+ +   MM LTEN+  YV  K L    V   + EI     + RI MVD +KQ T VDF EV+S+ EA+++A + N++ +K     T G I+   FEEFCE K IQPTFV  +P+++SPL+KK   N  +T+RFE FI  +E  NA++ELNDPI Q ERF  Q++E+ LG+DEA  MD DFI ALE G+PPT GLG+G+DR+IM  T   SIRDV+LFP MK
  S:    11 LEENFNQLIRERIQKFKNLQEQNKDPFEVYKVERTHTSKEIKDNYETLDGTDVTVAGRLMSKRVHGKAGFSDLYDRYGKIQLYIKINDVGEEKLKEY-KSYDIGDILSVSGKVFKTRTGEVSIHITDFQLAAKSLKPLPEKWHGLKDPDLRYRQRYVDLIINQDVRDTFLKRTAVIRAIREFLDGRDYIEVETPILSSIAGGAAAKPFITHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDVRHNPEFTAMELYEAFSDYNDMMELTENMLAYVCEKVLGTTKVIYQDTEIDFKPPWNRITMVDAVKQFTKVDFNEVESDDEARKIAVEKNIELKKELKDCTKGDILVGMFEEFCEHKFIQPTFVMDYPVEISPLTKKKRGNDKYTERFEGFIFGREVCNAYSELNDPIVQRERFMQQIRERELGDDEAYMMDEDFINALEIGMPPTGGLGIGLDRIIMFLTNSYSIRDVILFPTMK 498
>gi|118444238|ref|YP_877136.1| lysyl-tRNA synthetase [Clostridium novyi NT] >gi|118134694|gb|ABK61738.1| lysyl-tRNA synthetase [Clostridium novyi NT] (510 aa)
Score = 1140, Expect = 1.5e-122, Identities = 247/488 (50%), Positives = 332/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGE-NEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS--TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E +FN     R +KL+NLQE  +DP+++ KV RT T       + +L+  N     +L  + V  +  F  IRD YG  Q Y+    V +  L+ + K  D+GD V I G+ F+T+ GE+TL +   +++SK+LKPLPEK+HGL+D +LR R RYVDLI+N+D  + F+ R  I+K IR+F+D++++LEVETP+L PI GGA ARPFIT HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT++E+Y AY +   MM +TEN+  YV + +      M E  EI     +RRI MVD +K+  GVDF EVK+++EA+E+AK   ++ +K     T G I+   FEEF E K +QPTFV  +P + SPL+KK   N   T+RFE F+  +E  NA++ELNDPI Q ERF  Q+KE+ LG+DEA  MD DFI ALE G+PPT GLG+GIDR+IM  T+ SSIRDV+LFP MK  K
  S:    21 EAEFNALVKERMQKLENLQEQGKDPFDVYKVERTHTSQQVKDNYDELEGKNVTVAGRLMSKRVHGKAGFSDIRDRYGKIQLYIKINDVGEEKLKEY-KTFDIGDFVSITGTVFKTKTGEITLHILDFQLLSKSLKPLPEKFHGLKDPDLRYRQRYVDLIMNEDVKETFMKRTAIIKAIREFLDNRDFLEVETPILSPIAGGAAARPFITHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDVRHNPEFTAIELYEAYADYNDMMEITENMVAYVCEKVNGTTKVMYEGTEIDFKPPWRRITMVDAVKEYAGVDFNEVKTDEEAREIAKSKELELKKELKDCTKGDILVALFEEFGEEKLMQPTFVCDYPKENSPLTKKKRGNDELTERFEGFVYGREICNAYSELNDPIVQKERFMQQLKERELGDDEAYMMDDDFINALEIGMPPTGGLGIGIDRLIMFLTDSSSIRDVILFPTMKPTK 510
>gi|167769659|ref|ZP_02441712.1| hypothetical protein ANACOL_00993 [Anaerotruncus colihominis DSM 17241] >gi|167668020|gb|EDS12150.1| hypothetical protein ANACOL_00993 [Anaerotruncus colihominis DSM 17241] (657 aa)
Score = 1139, Expect = 1.9e-122, Identities = 234/485 (48%), Positives = 333/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ++K ++   IRR+KL+ L+   +DP+     +RT         F   +    +   ++  R +  + +F  +RD  G  Q Y+ + ++       F K  D+GDIV I G  FRTQKGE+++   +I ++SK+L PLPEKWHGL+D ELR R RYVDLIVN +    FV R +I+  IR F++++ Y+EVETPVLH I GGA ARPFIT HN L+ + Y+RIA EL LK+LIVGGFDKVYEIGR+FRNEG+D+ HNPEFT +E+Y AY +   MM +TE L ++ A + L    +  G+ EI L + F R+ M + +K+ +GVDF ++++ ++A+ +AK+H++++E+     G I++LFFEE+CE   IQP F+  HP+D+SPLSK+  + P +T+RFELFI  +E+ANAF+ELNDPIDQ  RFE Q   K+ G+DEA ++D DF+ ALEYG+PPT GLG+G+DR++ML T  +SIRDVLLFP MK
  S:    18 QQKLSEVLQIRRDKLEALKNEGKDPFLTTSYTRTAYAQPIVDAFDDYEGREVSIAGRMMSRRIMGKASFIDVRDASGRIQSYVRRDEIGDEPYADFKK-WDIGDIVGIRGEVFRTQKGEISIKAHEITLLSKSLLPLPEKWHGLKDTELRYRQRYVDLIVNPEVKDTFVKRSKIITAIRSFLEAKGYIEVETPVLHAIAGGAAARPFITHHNALDIDMYMRIALELHLKRLIVGGFDKVYEIGRVFRNEGIDTRHNPEFTLLELYEAYTDYHGMMDITEGLVRHCAHAVLGTGKIVYGDVEIDLDKPFERLSMREAVKKYSGVDFAQIETLEQARAIAKEHHIEYEQRHGK-GDILSLFFEEYCEKHLIQPVFITDHPVDISPLSKRKPEEPEYTERFELFILGREHANAFSELNDPIDQRGRFEHQAALKAAGDDEANDIDEDFLTALEYGMPPTGGLGIGVDRLVMLLTNSASIRDVLLFPTMK 501
>gi|144575195|gb|AAZ44018.2| lysyl-tRNA synthetase [Mycoplasma synoviae 53] (491 aa)
Score = 1137, Expect = 2.9e-122, Identities = 245/489 (50%), Positives = 335/489 (68%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYE-IEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  K  +QE IR  KL   ++ N +P+E IEK    +   D   K++   K +  + +    L GR+ + R  F VI+D++   Q Y NKK+     L      LDLGDI+   G   +T  GEL + +K +K+++K LKPLP+K+HGL D E   RHRY+DLI N+ SM+VF  R +I+ +IR++ DS  YLEVETP L   + GA A+PF TFHN L + F LRIATE+PLKKL++GG D+VYE+GRIFRNEG+D+THNPEFT++E Y AY N+E MM+ TE LFK +AK L    ++    EI L + F+R+ M+D + + TGVDF  V + ++A ELAK+H VK +K+  T+GHI N  FE+  E   +QPTFV GHPI++SPL+  +  +P + +R ELFIN KEYAN + EL+ PI+Q +RFE Q+ EK+ GNDE+ ++D DFIEAL+YG+PP  G G+GIDR++MLFTEK SIRDVL FP +K+KK
  S:     1 MSIKLTEQEQIRLSKLDTYKKLNINPFEKIEKNLNYVYSKDLKEKYSSYSKEELESMDLYFDLYGRITSQRGPFIVIKDYFDKIQLYFNKKE--HLDLAELVSNLDLGDIIHAHGKLSKTNTGELVVKIKTLKLLTKVLKPLPDKFHGLSDIEEIYRHRYLDLISNEHSMEVFKKRSKIISLIRKYFDSNMYLEVETPFLSNYISGAAAKPFKTFHNALSQEFTLRIATEIPLKKLLIGGIDRVYEMGRIFRNEGIDTTHNPEFTTIEFYEAYSNLEKMMQRTEELFKLIAKELNLKTLQNKGEEINLEEPFKRVDMIDEVSKATGVDFRNV-TLEKALELAKEHGVKLKKYY-TVGHIANELFEKLIEKTLVQPTFVMGHPIEISPLT-YEASDPRYVERAELFINGKEYANMYTELSSPIEQLKRFEDQLNEKAQGNDESSDIDWDFIEALKYGMPPAGGCGIGIDRLVMLFTEKESIRDVLFFPTLKNKK 488
>gi|134298053|ref|YP_001111549.1| lysyl-tRNA synthetase [Desulfotomaculum reducens MI-1] >gi|134050753|gb|ABO48724.1| lysyl-tRNA synthetase [Desulfotomaculum reducens MI-1] (510 aa)
Score = 1136, Expect = 3.5e-122, Identities = 236/489 (48%), Positives = 330/489 (67%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M    N+   +RREKL+ L      P+  EK   T    D   +F +++       + +AGR+ A R     +F  I+D  G+ Q Y     +         K LD+GDI+  +G  FRT+KGE+T+ +   K++SK+L+PLPEKWHGL+D +LR R RYVDLIVN +  + F+ R R+++ IR ++D + +LEVETP++HPI GGA+ARPFIT HNTL+ N Y+RIA EL LK+L+VGGFDKVYEI R FRNEG+ + HNPEFT++E+Y AY +   MM LTE+L   VA+  L   +V+    EI L + +RR+ M++ +K+ +G+DF ++K  +EA E AK   +  E   ++ G I+N  FEE  E K IQPTFV  +P+D+SPL+K+  +NP  T RFELFI  +E ANAF+ELNDPIDQ  RF +QV++++ G++EA   D DFI+ALEYG+PP  GLG+GIDR++ML T  SSIRDV+LFP M+ K+
  S:    23 MLEDLNELMKVRREKLQELINQGIQPFG-EKFEVTHYTFDITERFEEME----GQTVTIAGRITAKRVMGKASFANIQDSRGNIQVYARLNDLGAEEYARLEK-LDIGDIIGCYGKVFRTRKGEITVHIDSYKLLSKSLRPLPEKWHGLKDVDLRYRQRYVDLIVNPEVKQTFITRSRVVRGIRNYLDQRGFLEVETPMMHPIAGGASARPFITHHNTLDMNLYMRIAPELYLKRLLVGGFDKVYEINRNFRNEGISTRHNPEFTTIELYQAYADYNDMMDLTEDLISQVAQDVLGTTMVEYEGVEISLAKPWRRVPMLEIVKEHSGLDFSQLKDAKEAFEAAKGLGLDVEP-SASWGDILNTVFEEKVEDKLIQPTFVIDYPVDISPLAKRQQENPELTYRFELFIYGRELANAFSELNDPIDQKGRFMSQVEKRNAGDEEAQMYDEDFIQALEYGMPPAGGLGIGIDRLVMLLTNSSSIRDVILFPLMRPKE 509
>gi|2501018|sp|Q49158|SYK_MYCFE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|1263074|gb|AAC43988.1| lysyl-tRNA synthetase (488 aa)
Score = 1136, Expect = 3.8e-122, Identities = 238/486 (48%), Positives = 338/486 (69%)
  Q:     4 KFNDQELIRREKLKNLQEANQDP----YEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           K+ +Q+ IRR+KL+  ++ +  P    Y + K+S +  +     +FA+ +         ++GR++  R  F V++D  G  Q Y NKK+  +  L    +  DLGDI+ + G   +T   E+T+  + I++++KALKPLP+K+HGL D E R RHRY+DLI N +S   F+ R +I++ IR + +  +YLE ETP LH  L GA A+PF T HN+L ++F LRIATE+PLKKL+VGGF++VYE+GRIFRNEG D+THNPEFT++E Y AY N+E MM  TE L K + K + K        E+ L++ F+R++M+D + ++TG +F ++ + +EA E+AK + +K EK   T+GHIIN  +EE  E   IQPTF+YGHPI++SPLS K   +P FT+R ELFINTKEYAN + EL+DPIDQ ERFE+Q++EK+ GNDEA ++D DF++ALEYG+PPT G G+GIDR++ML TE  SIRDVLLFP +K  K
  S:     3 KYTEQDQIRRDKLEFYKKFDVVPFKKAYGLGKLSTSDELNKKYGQFAREELEAKKVKKNISGRLITARGPFLVLKDRKGTIQVYFNKKENPE--LTKIVETFDLGDILWVRGLLMKTHTCEMTVRAQDIQLLTKALKPLPDKFHGLTDTEERYRHRYLDLITNPESRNTFIMRTKIVQWIRDYFNKLDYLEAETPFLHDYLSGAAAKPFTTHHNSLNQDFVLRIATEIPLKKLVVGGFERVYEMGRIFRNEGYDTTHNPEFTTIEFYEAYSNVEGMMNRTETLIKELCKKIGKSKFVTNGVEVDLSKPFKRVNMIDEVSKKTGKNFRKI-TLEEAIEVAKAYKIKIEKF-FTIGHIINALYEELVEPTLIQPTFLYGHPIEISPLSAKS-DDPRFTERAELFINTKEYANMYTELSDPIDQLERFESQLEEKNKGNDEASDIDYDFVDALEYGMPPTGGCGIGIDRLVMLLTETDSIRDVLLFPTLKRIK 487
>gi|116493270|ref|YP_805005.1| lysyl-tRNA synthetase [Pediococcus pentosaceus ATCC 25745] >gi|122265266|sp|Q03E09|SYK_PEDPA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|116103420|gb|ABJ68563.1| Lysyl-tRNA synthetase (class II) [Pediococcus pentosaceus ATCC 25745] (498 aa)
Score = 1136, Expect = 4.2e-122, Identities = 234/481 (48%), Positives = 323/481 (67%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFK-YVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           NDQ  +RREK++ L++   DP+   +  RT      + K++ +     +       +AGR+++ R      F  ++D  G  Q Y+ K  + + + + F +  D+GD + + G   +T  GELT+ V  +  +SKAL+PLP+K+HGL++ E   R RY+DLI N DSM  F  R +I+  +R+++D  ++ EVETPVLH   GGA+ARPFIT HN L+ N YLRIA EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT +E YAAY +   +M  TE +FK  VA       +     E+ L Q F R+HMVD IK+  GVDFW   S ++A++LA ++ + +E    T+GHIIN FFEE  + +  QP F+YGHP+++SPL+KK+ ++  FT RFEL+I   EY NAF ELNDPIDQ  RFEAQV E+  GNDEA  +D D+IEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP MK
  S:    10 NDQLRVRREKMQELRDKGIDPFG-HRFERTHLAAQLHEKYSDMTKEELDEQGVVATIAGRMISKRGKGKVGFADLKDRSGKMQLYVRKDVLGEDVYKVFKRS-DIGDFLGVTGDVMKTDMGELTIKVTGLTFLSKALRPLPDKFHGLQNVEQIYRQRYLDLIANDDSMDRFRKRTKIVSAVRRYLDGNDFAEVETPVLHTQAGGASARPFITHHNALDINLYLRIALELHLKRLIVGGMERVYEIGRVFRNEGIDTRHNPEFTMLETYAAYFDFHDVMDETEGIFKAAVAAVSDDGKITYQGTELDLGQDFERLHMVDAIKKYAGVDFWPKMSVEDAKKLADENGIHYESWW-TVGHIINEFFEEKVQDQLKQPVFIYGHPVEISPLAKKNAEDDRFTDRFELYILGNEYGNAFTELNDPIDQRARFEAQVAEREAGNDEAEGIDEDYIEALEYGMPPTGGLGIGIDRLVMLLTDAPSIRDVLLFPTMK 495
>gi|71894621|ref|YP_278729.1| lysyl-tRNA synthetase [Mycoplasma synoviae 53] (493 aa)
Score = 1135, Expect = 4.5e-122, Identities = 245/489 (50%), Positives = 335/489 (68%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYE-IEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  K  +QE IR  KL   ++ N +P+E IEK    +   D   K++   K +  + +    L GR+ + R  F VI+D++   Q Y NKK+     L      LDLGDI+   G   +T  GEL + +K +K+++K LKPLP+K+HGL D E   RHRY+DLI N+ SM+VF  R +I+ +IR++ DS  YLEVETP L   + GA A+PF TFHN L + F LRIATE+PLKKL++GG D+VYE+GRIFRNEG+D+THNPEFT++E Y AY N+E MM+ TE LFK +AK L    ++    EI L + F+R+ M+D + + TGVDF  V + ++A ELAK+H VK +K+  T+GHI N  FE+  E   +QPTFV GHPI++SPL+  +  +P + +R ELFIN KEYAN + EL+ PI+Q +RFE Q+ EK+ GNDE+ ++D DFIEAL+YG+PP  G G+GIDR++MLFTEK SIRDVL FP +K+KK
  S:     3 MSIKLTEQEQIRLSKLDTYKKLNINPFEKIEKNLNYVYSKDLKEKYSSYSKEELESMDLYFDLYGRITSQRGPFIVIKDYFDKIQLYFNKKE--HLDLAELVSNLDLGDIIHAHGKLSKTNTGELVVKIKTLKLLTKVLKPLPDKFHGLSDIEEIYRHRYLDLISNEHSMEVFKKRSKIISLIRKYFDSNMYLEVETPFLSNYISGAAAKPFKTFHNALSQEFTLRIATEIPLKKLLIGGIDRVYEMGRIFRNEGIDTTHNPEFTTIEFYEAYSNLEKMMQRTEELFKLIAKELNLKTLQNKGEEINLEEPFKRVDMIDEVSKATGVDFRNV-TLEKALELAKEHGVKLKKYY-TVGHIANELFEKLIEKTLVQPTFVMGHPIEISPLT-YEASDPRYVERAELFINGKEYANMYTELSSPIEQLKRFEDQLNEKAQGNDESSDIDWDFIEALKYGMPPAGGCGIGIDRLVMLFTEKESIRDVLFFPTLKNKK 490
>gi|149183582|ref|ZP_01862003.1| lysyl-tRNA synthetase [Bacillus sp. SG-1] >gi|148848698|gb|EDL62927.1| lysyl-tRNA synthetase [Bacillus sp. SG-1] (405 aa)
Score = 1134, Expect = 6.6e-122, Identities = 219/405 (54%), Positives = 302/405 (74%)
  Q:    84 LNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + K  V +   E FN   DLGD++ + G+ F+T+ GEL++  K+  +++KAL+PLPEK+HGL+D E R R RY+DLI +++S + F+ R +I++ +R+++D+  YLEVETP++H I GGA+ARPFIT HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M LTENL  ++AK +     V+ G+ E+ L  ++ R+HMVD +K+ TG DFW+  S++EA  LAK+H ++  K     GHI+N FFE+  E K IQPTF+YGHP+++SPL+KK+ ++  FT RFELFI  +E+ANAF ELNDPIDQ ERFE+Q+KE+  GNDEA  MD DFIEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ +
  S:     1 MRKDAVGEDEYEIFNTA-DLGDLIGVTGTVFKTKVGELSIKAKEFILLTKALRPLPEKFHGLKDVEQRYRQRYLDLITSQESKQTFIARSKIIQSMRRYLDNNGYLEVETPMMHAIAGGASARPFITHHNALDMQLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYRDIMALTENLIAHIAKEVFGSTTVQYGDYEVNLEPQWARLHMVDAVKEHTGADFWKEMSDEEAHALAKEHGIEV-KPTMQYGHILNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDEDGRFTDRFELFIVGREHANAFTELNDPIDQRERFESQLKEREEGNDEAHMMDDDFIEALEYGMPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPLMRHR 404
>gi|83589024|ref|YP_429033.1| lysyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] >gi|123739358|sp|Q2RM49|SYK_MOOTA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|83571938|gb|ABC18490.1| lysyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] (489 aa)
Score = 1134, Expect = 7.0e-122, Identities = 232/484 (47%), Positives = 328/484 (67%)
  Q:     6 NDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           ND   +R EKL  LQEA  +PY    E    T  I     +F +L+       + LAGR++A+R     +F  ++D  G  Q Y+    V   + E F K LD+GDIV + G  FRT +GE++++V+++ ++ K+L+PLPEKWHGL+D +LR R RY+DLIVN +  +VF+ R RI++ IR F+D++ +LEVETP +HPI GGA ARPFIT HN L+ + YLRIA EL LK+L+VGG +KVYE+GRIFRNEG+ + HNPEFT +E+Y AY +   MM L E +  YVA+ +L   VV    + + LT  + R+ M++ IK+  GVDF ++ + ++A+  A    ++ E      G IIN  FE   E   IQPTF+  +P+ +SPL+K+  +NP FT RFE FI  +E ANAF+ELNDPIDQ  RFEAQ+ E++ G++EA  MD DF++ALEYG+PP  G+G+GIDR++M+ T+  SIRDV+LFP M+ K+
  S:     7 NDLMAVRLEKLHQLQEAGIEPYGGPFEVTHSTTAI---RERFDELE----GQEVALAGRLLAIRSHGKASFADLQDREGRLQLYIRLDNVGPGIYELFQK-LDIGDIVGVRGKVFRTHRGEISVEVRQLTLLCKSLRPLPEKWHGLKDVDLRYRQRYLDLIVNPEVKQVFITRARIIRAIRSFLDNRGFLEVETPTMHPIAGGAAARPFITHHNALDIDLYLRIALELHLKRLLVGGLEKVYEMGRIFRNEGISTKHNPEFTMLELYQAYADYYVMMDLLEEMVAYVAREALGTTVVTYQGDRLDLTPPWPRLTMLEAIKKYYGVDFDQLPTAEDARRAAISLGLEIEPGMER-GKIINEVFEATVEPHLIQPTFILDYPVAISPLAKRKKENPDFTYRFEAFIAGRELANAFSELNDPIDQRRRFEAQMAERAAGDEEAHMMDEDFLQALEYGMPPAGGMGIGIDRLVMVLTDSPSIRDVILFPTMRPKE 488
>gi|168187058|ref|ZP_02621693.1| lysyl-tRNA synthetase [Clostridium botulinum C str. Eklund] >gi|169295090|gb|EDS77223.1| lysyl-tRNA synthetase [Clostridium botulinum C str. Eklund] (510 aa)
Score = 1134, Expect = 7.1e-122, Identities = 242/488 (49%), Positives = 333/488 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGE-NEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKH--QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E +FN     R +KL+NLQE  +DP+++ KV RT T       + +L+  N     +L  + V  +  F  IRD YG  Q Y+    V +  L+ + K  D+GD V I G+ F+T+ GE+TL +   ++++K+LKPLPEK+HGL+D +LR R RYVDLI+N++  + F+ R  I+K IR+F+D++++LEVETP+L PI GGA ARPF+T HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT++E+Y AY +   MM +TEN+  YV + +      M E  EI     +RR+ MVD +K+  GVDF EVK+++EA+E+AK+  ++ +K     T G I+   FEEF E K +QPTF+  +P + SPL+KK   N   T+RFE F+  +E  NA++ELNDPI Q ERF  Q+KE+ LG+DEA  MD DFI ALE G+PPT GLG+GIDR+IM  T+ SSIRDV+LFP MK  K
  S:    21 EAEFNALVKERMQKLQNLQEQGKDPFDVYKVERTHTSEQIKDNYDELEGKNVIVAGRLMSKRVHGKAGFSDIRDRYGKIQLYIKIDDVGEEKLKEY-KTFDIGDFVSITGTVFKTKTGEITLHIVDFQLLTKSLKPLPEKFHGLKDPDLRYRQRYVDLIMNEEVKETFMKRTAIIKAIREFLDNRDFLEVETPILSPIAGGAAARPFVTHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDVRHNPEFTAIELYEAYADYNDMMEITENMVAYVCEKVNGTTKVMYEGTEIDFKPPWRRVTMVDAVKEYAGVDFNEVKTDEEAREVAKEKGLELKKELKDCTKGDILVALFEEFGEEKLMQPTFICDYPKENSPLTKKKRGNDELTERFEGFVYGREICNAYSELNDPIVQKERFMQQLKERELGDDEAYMMDDDFINALEIGMPPTGGLGIGIDRLIMFLTDSSSIRDVILFPTMKPTK 510
>gi|15828861|ref|NP_326221.1| lysyl-tRNA synthetase (lysine--tRNA ligase) (LysRS) [Mycoplasma pulmonis UAB CTIP] >gi|14089804|emb|CAC13563.1| LYSYL-TRNA SYNTHETASE (LYSINE--TRNA LIGASE) (LYSRS) [Mycoplasma pulmonis] (510 aa)
Score = 1132, Expect = 1.0e-121, Identities = 248/486 (51%), Positives = 337/486 (69%)
  Q:     4 KFNDQELIRREKLKNLQE---ANQDPYEIEKVS-RTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           K  +QE+IRREKLK  +         ++ EK++  +  I +  + F+K +       + +AGR++  R  F VI+D  G  Q Y++KK++ +        +LD+GDI+ + G+  +T KGELT+ V    +++K L PL EK+HGL D E R R RY+DLI N +  ++F  R +++  IR+F D QN++EVETP+LH ILGGANARPF T+HN+L  +F LRIATELPLKKL+VGG D+VYEIGRIFRNEG+D+THNPEFTS+E Y AY N+E MM  TENL K++AK L    +K  + EI L   F++I+MVD + + T VDF  +  ++ A E+A ++ VK EK+   +GHIIN  FE   E   IQPTFV GHPI++SPL+    ++  FT+R ELFINTKEYAN F ELNDP+DQ  RFEAQ++EK  GN+EA E+D  F+ ALEYGLPP  G G+GIDR++ML TEK SIR+V+LFP +K K+
  S:    25 KLTEQEIIRREKLKKYESLGIKTFKKFDHEKINIYSNEIVEKYNHFSKDELLEKQIKLIIAGRILTQRGPFIVIQDTNGKIQLYVDKKELEEQKETL--ALLDIGDIIYVKGTLMKTMKGELTIKVNFFDLLTKGLTPLAEKYHGLVDVEERYRKRYLDLISNPNIKEIFWTRTKVISKIRKFFDEQNFMEVETPMLHSILGGANARPFKTYHNSLSSSFNLRIATELPLKKLLVGGIDRVYEIGRIFRNEGIDTTHNPEFTSIEFYQAYSNLEIMMEQTENLIKFIAKELGLSKIKNHDVEIDLLADFKKINMVDAVSEATKVDFRNIDLDK-AIEVAGRYKVKVEKY-FKVGHIINELFELLIEKTLIQPTFVTGHPIEISPLAATS-EDERFTERAELFINTKEYANMFTELNDPLDQRRRFEAQLEEKESGNEEASEIDESFLSALEYGLPPAGGCGIGIDRLVMLLTEKESIREVILFPTLKKKQ 509
>gi|39932450|sp|Q98QH1|SYK1_MYCPU Lysyl-tRNA synthetase 1 (Lysine--tRNA ligase 1) (LysRS 1) (491 aa)
Score = 1131, Expect = 1.3e-121, Identities = 248/486 (51%), Positives = 337/486 (69%)
  Q:     4 KFNDQELIRREKLKNLQE---ANQDPYEIEKVS-RTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           K  +QE+IRREKLK  +         ++ EK++  +  I +  + F+K +       + +AGR++  R  F VI+D  G  Q Y++KK++ +        +LD+GDI+ + G+  +T KGELT+ V    +++K L PL EK+HGL D E R R RY+DLI N +  ++F  R +++  IR+F D QN++EVETP+LH ILGGANARPF T+HN+L  +F LRIATELPLKKL+VGG D+VYEIGRIFRNEG+D+THNPEFTS+E Y AY N+E MM  TENL K++AK L    +K  + EI L   F++I+MVD + + T VDF  +  ++ A E+A ++ VK EK+   +GHIIN  FE   E   IQPTFV GHPI++SPL+    ++  FT+R ELFINTKEYAN F ELNDP+DQ  RFEAQ++EK  GN+EA E+D  F+ ALEYGLPP  G G+GIDR++ML TEK SIR+V+LFP +K K+
  S:     6 KLTEQEIIRREKLKKYESLGIKTFKKFDHEKINIYSNEIVEKYNHFSKDELLEKQIKLIIAGRILTQRGPFIVIQDTNGKIQLYVDKKELEEQKETL--ALLDIGDIIYVKGTLMKTMKGELTIKVNFFDLLTKGLTPLAEKYHGLVDVEERYRKRYLDLISNPNIKEIFWTRTKVISKIRKFFDEQNFMEVETPMLHSILGGANARPFKTYHNSLSSSFNLRIATELPLKKLLVGGIDRVYEIGRIFRNEGIDTTHNPEFTSIEFYQAYSNLEIMMEQTENLIKFIAKELGLSKIKNHDVEIDLLADFKKINMVDAVSEATKVDFRNIDLDK-AIEVAGRYKVKVEKY-FKVGHIINELFELLIEKTLIQPTFVTGHPIEISPLAATS-EDERFTERAELFINTKEYANMFTELNDPLDQRRRFEAQLEEKESGNEEASEIDESFLSALEYGLPPAGGCGIGIDRLVMLLTEKESIREVILFPTLKKKQ 490
>gi|168183599|ref|ZP_02618263.1| lysyl-tRNA synthetase [Clostridium botulinum Bf] >gi|182673242|gb|EDT85203.1| lysyl-tRNA synthetase [Clostridium botulinum Bf] (504 aa)
Score = 1129, Expect = 2.3e-121, Identities = 232/485 (47%), Positives = 327/485 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKH--QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + N+    R +KLK LQ   +DP+++ KV RT T  +    +  L+        +L  + V  +  F  I D YG  Q Y+    V +  L+ + K  D+GDI+ + G+ F+T+ GE ++ +   ++V K+L+PLPEKWHGL+D +LR R RYVDLI+N+D    F+ R  I+K +R+F+D++ +LEVETP+L PI GGA A+PFIT HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT++E+Y AY +   MM +TEN+  Y+  K L    V+    EI  T  +RR+ MVD +K+  GVDF  +K+++EA+ +AK+ +++F+K     T G ++   FEEFCE K +QPTF+  +P++ SPL+KK   N  FT+RFE F+  +E  NA++ELND I Q ERF  Q+KE+ LG+DEA  MD DFI +LE G+PPT GLG+GIDR+IM  T+  SIRDV+LFP MK
  S:    12 EEQANELMRERFQKLKELQSNGKDPFDVYKVERTHTSKEVKENYEDLEGKTVTVAGRLMSKRVHGKAGFSDIHDRYGKIQLYIKINDVGEEKLKEY-KTFDIGDIISVTGTVFKTKTGETSIHITDFQLVCKSLRPLPEKWHGLKDPDLRYRQRYVDLIINQDVRDTFIKRTAIIKAMREFLDNRGFLEVETPILSPIAGGAAAKPFITHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTAIELYEAYADYNDMMEITENMIAYICEKVLGTTKVEYEGAEIDFTPPWRRLTMVDAVKEYAGVDFNIIKNDEEARTIAKEKHIEFKKELKDCTKGDVLIGLFEEFCEDKLMQPTFICDYPVENSPLTKKKRGNEAFTERFEGFVFGREVCNAYSELNDSIVQKERFMQQLKERELGDDEAYMMDDDFITSLEVGMPPTGGLGIGIDRLIMFLTDTHSIRDVILFPTMK 498
>gi|187777499|ref|ZP_02993972.1| hypothetical protein CLOSPO_01074 [Clostridium sporogenes ATCC 15579] >gi|187774427|gb|EDU38229.1| hypothetical protein CLOSPO_01074 [Clostridium sporogenes ATCC 15579] (504 aa)
Score = 1129, Expect = 2.3e-121, Identities = 233/485 (48%), Positives = 325/485 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKH--QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + N+    R +KLK LQ   +DP+++ KV RT T  +    +  L+        +L  + V  +  F  I D YG  Q Y+    V +  L+ + K  D+GDI+ + G+ F+T+ GE ++ +   ++V K+L+PLPEKWHGL+D +LR R RYVDLI+N+D    F+ R  I+K +R+F+D++ +LEVETP+L PI GGA A+PFIT HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT++E+Y AY +   MM +TEN+  Y+  K L    V+    EI  T  +RR+ MVD +K+  GVDF  +K + EA+ +AK+ +V+F+K     T G ++   FEEFCE K +QPTF+  +P++ SPL+KK   N  FT+RFE F+  +E  NA++ELND I Q ERF  Q+KE+ LG+DEA  MD DFI +LE G+PPT GLG+GIDR+IM  T+  SIRDV+LFP MK
  S:    12 EEQANELMKERFQKLKELQANGKDPFDVYKVERTHTSKEVKENYEDLEGKTVTVAGRLMSKRVHGKAGFSDIHDRYGKIQLYIKINDVGEEKLKEY-KTFDIGDIISVTGTVFKTKTGETSIHITDFQLVCKSLRPLPEKWHGLKDPDLRYRQRYVDLIINQDVRDTFIKRTAIIKAMREFLDNRGFLEVETPILSPIAGGAAAKPFITHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTAIELYEAYADYNDMMEITENMVAYICEKVLGTTKVQYEGTEIDFTPPWRRLTMVDAVKEYAGVDFNSIKDDIEARTIAKEKHVEFKKELKDCTKGDVLIGLFEEFCEDKLMQPTFICDYPVENSPLTKKKRGNEAFTERFEGFVFGREVCNAYSELNDSIVQKERFMQQLKERELGDDEAYMMDDDFITSLEVGMPPTGGLGIGIDRLIMFLTDTHSIRDVILFPTMK 498
>gi|75764905|ref|ZP_00744256.1| Lysyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487607|gb|EAO51472.1| Lysyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] (430 aa)
Score = 1127, Expect = 4.3e-121, Identities = 224/420 (53%), Positives = 298/420 (70%)
  Q:    70 FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           F  I+D +G  Q Y+ K  V     E F    DLGD+V I G  F+T  GEL++      +++K+L+PLP+K+HGL+D E R R RY+DLI + +S + FV R +I++ +R+++D   YLEVETP++H I GGA+ARPF T HN L+   Y+RIA EL LK+LIVGG +KVYEIGR+FRNEG+ + HNPEFT +E+Y AY +   +M+LTEN+  ++AK  L    +  G+ EI L  ++ R+HMVD IKQ +G DFW   S +EA+ELAK+HNV+  K    +GHIIN FFE+  E K I      GHP+++SPL+KK+ ++P FT RFELFI  +E+ANAF ELNDPID  ERFEAQ+KE+  GNDEA  MD D+IEALEYG+PPT GLG+GIDR++ML T   SIRDVLLFP M+ K+
  S:    11 FAHIQDLHGQVQMYVRKDTVGDEEYELFTTA-DLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQRYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFTTHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYNDIMKLTENMVAHIAKKVLGTTTILYGDYEINLEPEWTRLHMVDAIKQHSGADFWNPMSVEEARELAKEHNVEI-KDTMEVGHIINEFFEQKVEDKLIHQHLFTGHPVEISPLAKKNDEDPRFTDRFELFIVAREHANAFTELNDPIDPKERFEAQLKEREQGNDEAHMMDDDYIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQ 429
>gi|194467683|ref|ZP_03073670.1| lysyl-tRNA synthetase [Lactobacillus reuteri 100-23] >gi|194454719|gb|EDX43616.1| lysyl-tRNA synthetase [Lactobacillus reuteri 100-23] (508 aa)
Score = 1126, Expect = 5.0e-121, Identities = 241/483 (49%), Positives = 324/483 (67%)
  Q:     7 DQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN---NIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFW-EVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           DQ  +RREK++ L+EA  +P+   +  R     D + KF +      N     + +AGR+   R +    F    D  G  Q Y  K  V       F +  D+GD + I G   +T  GELT+   KI  +SKAL+PLP KW G+ D E   R RY+DLI N +S K F  R  I+K +R++MD   + EVETP+L+   GGANARPFIT HN L+ + YLRIATEL LK+LIVGGF++VYE+GRIFRNEGMD  HNPEFT+ME YAAY + + +M  TE + K  AK +     +    NEI L   F+RI MVD +K++TG+DF  E  ++++A++LA +H V+++ +  T GHI+N FFEEF E   IQPTFVY  P++VSPL+K++  NP  T RFEL+++  E ANAF+ELNDPIDQ ERFE Q KEK+ GNDEA  +D+D+++ALEYG+PPT GLG+GIDR++ML T+  SIRDV+LFP M+ +K
  S:     6 DQMRVRREKMEELKEAGIEPFG-RRFKRDHLAQDLHDKFDQYDKEELNEMGAKVIIAGRMTRKRSSGKAGFADFVDRTGKIQVYARKDMVGDEPYHVFKRS-DIGDFLGIEGDVIKTDTGELTVRAHKITFLSKALRPLPNKWDGVTDPETIYRQRYLDLISNPESFKRFHQRTAIIKAVRKYMDDNGFTEVETPILNTQAGGANARPFITHHNALDIDMYLRIATELYLKRLIVGGFERVYELGRIFRNEGMDPHHNPEFTTMETYAAYFDFQDVMDETEGIVKAAAKVVSDDGKITYQGNEIDLGGNFKRITMVDAVKEKTGIDFSDESMTDEDAKKLADEHKVEYKPYW-TKGHILNAFFEEFVEDTLIQPTFVYEFPVEVSPLAKRNADNPAMTDRFELYVDGSELANAFSELNDPIDQKERFEMQAKEKANGNDEAEPVDLDYVQALEYGMPPTGGLGIGIDRLVMLLTDAKSIRDVILFPTMRPEK 494
>gi|15896444|ref|NP_349793.1| lysyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] >gi|39932231|sp|Q97EB7|SYK_CLOAB Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|15026267|gb|AAK81133.1|AE007815_3 Lysyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] (515 aa)
Score = 1125, Expect = 7.8e-121, Identities = 237/485 (48%), Positives = 332/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS--TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E K ND    RR+KL + QE  +DP+++ KV RT T       + +L+        +L  + V  +  F  I D YG  Q YL    V +  L+ F K  D+GD V I G  F+T+ GE+TL V K+++++K+LKPLPEK+HGL+D +L+ R RYVDLI+N+D  + F+ R  I+K +R+F+D+++YLEVETPVL  I  GA+ARPF T HN L+ + +LRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT +E+Y AY +   MM +TEN+  Y  + +     +     EI LT  +RR+ MVD +K+ +G+DF  VK+++EA+E+AK+  ++ +K     T G I+N  FEE+ E K IQPTFV  +P+++SPL+KK   NP +T+RFE FI  +E  NA++ELNDPI Q +RF  Q+KE+ LG+DEA +MD DFI ALE G+PPT G+G+G+DR++M  T+  SIRDV+LFP MK
  S:    23 EAKMNDLLKERRQKLSDAQERGKDPFDVYKVERTHTSKQIVDNYDELEDKIVTVAGRLMSKRVHGKAGFSDIYDRYGKIQLYLKIDDVGEEKLKEF-KTFDIGDFVVITGKVFKTKTGEITLHVTKLELIAKSLKPLPEKFHGLKDPDLKYRQRYVDLIINQDVRETFMKRTAIIKAVREFLDNKDYLEVETPVLSTIASGASARPFSTHHNALDLDMHLRIATELYLKRLIVGGFEKVYEIGKDFRNEGIDVRHNPEFTMIELYEAYADYNDMMEITENMVAYACQKVNGTTKITYEGTEIDLTPPWRRVTMVDIVKEHSGIDFSTVKTDEEAREIAKEKKLELKKELKDCTKGDILNALFEEYGEKKLIQPTFVCDYPVEISPLTKKKRGNPEYTERFEGFIYGREICNAYSELNDPIVQKDRFMQQLKERELGDDEAYQMDDDFINALEIGMPPTGGMGMGMDRLVMFLTDSPSIRDVILFPTMK 509
>gi|153940179|ref|YP_001392873.1| lysyl-tRNA synthetase [Clostridium botulinum F str. Langeland] >gi|168180988|ref|ZP_02615652.1| lysyl-tRNA synthetase [Clostridium botulinum NCTC 2916] >gi|170757532|ref|YP_001783159.1| lysyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] >gi|189082955|sp|A7GJB3|SYK_CLOBL Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|152936075|gb|ABS41573.1| lysyl-tRNA synthetase [Clostridium botulinum F str. Langeland] >gi|169122744|gb|ACA46580.1| lysyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] >gi|182668060|gb|EDT80039.1| lysyl-tRNA synthetase [Clostridium botulinum NCTC 2916] (504 aa)
Score = 1124, Expect = 9.4e-121, Identities = 232/485 (47%), Positives = 326/485 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKH--QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + N+    R +KLK LQ   +DP+++ KV RT T  +    +  L+        +L  + V  +  F  I D YG  Q Y+    V +  L+ + K  D+GDI+ + G+ F+T+ GE ++ +   ++V K+L+PLPEKWHGL+D +LR R RYVDLI+N+D    F+ R  I+K +R+F+D++ +LEVETP+L PI GGA A+PFIT HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT++E+Y AY +   MM +TEN+  Y+  K L    V+    EI  T  +RR+ MVD +K+  GVDF  +K++ EA+ +AK+ +++F+K     T G ++   FEEFCE K +QPTF+  +P++ SPL+KK   N  FT+RFE F+  +E  NA++ELND I Q ERF  Q+KE+ LG+DEA  MD DFI +LE G+PPT GLG+GIDR+IM  T+  SIRDV+LFP MK
  S:    12 EEQANELMKERFQKLKELQSNGKDPFDVYKVERTHTSKEVKDNYEDLEGKTVTVAGRLMSKRVHGKAGFSDIHDRYGKIQLYIKINDVGEEKLKEY-KTFDIGDIISVTGTVFKTKTGETSIHITDFQLVCKSLRPLPEKWHGLKDPDLRYRQRYVDLIINQDVRDTFIKRTAIIKSMREFLDNRGFLEVETPILSPIAGGAAAKPFITHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTAIELYEAYADYNDMMEITENMIAYICEKVLGTTKVEYEGAEIDFTPPWRRLTMVDAVKEYAGVDFNIIKNDIEARTIAKEKHIEFKKELKDCTKGDVLIGLFEEFCEDKLMQPTFICDYPVENSPLTKKKRGNEAFTERFEGFVFGREVCNAYSELNDSIVQKERFMQQLKERELGDDEAYMMDDDFITSLEVGMPPTGGLGIGIDRLIMFLTDTHSIRDVILFPTMK 498
>gi|148381459|ref|YP_001256000.1| lysyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|153932316|ref|YP_001385834.1| lysyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153936702|ref|YP_001389241.1| lysyl-tRNA synthetase [Clostridium botulinum A str. Hall] >gi|148290943|emb|CAL85079.1| lysyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|152928360|gb|ABS33860.1| lysyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|152932616|gb|ABS38115.1| lysyl-tRNA synthetase [Clostridium botulinum A str. Hall] (504 aa)
Score = 1124, Expect = 9.7e-121, Identities = 232/485 (47%), Positives = 323/485 (66%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKH--QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + N+    R +KLK LQ   +DP+++ KV RT T  +    +  L+        +L  + V  +  F  I D YG  Q Y+    V +  L+ + K  D+GDI+ + G+ F+T+ GE ++ +   ++V K+L+PLPEKWHGL+D +LR R RYVDLI+N+D    F+ R  I+K +R+++D++ +LEVETP+L PI GGA A+PFIT HN L  + YLRIATEL LK+LIVGGF+KVYEIGR FRNEGMD  HNPEFT +E+Y AY +   MM +TEN+  Y+  K L    V+    EI  T  +RR+ MVD +++  GVDF  +K + EA+ +AK+ +++F+K     T G ++   FEEFCE K +QPTF+  +P++ SPL+KK   N  FT+RFE F+  +E  NA++ELND I Q ERF  Q+KE+ LG+DEA  MD DFI +LE G+PPT GLG+GIDR+IM  T+  SIRDV+LFP MK
  S:    12 EEQANELMKERFQKLKELQSNGKDPFDVYKVERTHTSKEVKENYEDLEGKTVTVAGRLMSKRVHGKAGFSDIHDRYGKIQLYIKINDVGEEKLKEY-KTFDIGDIISVTGTVFKTKTGETSIHITDFQLVCKSLRPLPEKWHGLKDPDLRYRQRYVDLIINQDVRDTFMKRTAIIKTMREYLDNKGFLEVETPILSPIAGGAAAKPFITHHNALNIDMYLRIATELYLKRLIVGGFEKVYEIGRNFRNEGMDIRHNPEFTVIELYEAYADYNDMMEITENMIAYICEKVLGTTKVQYEGTEIDFTPPWRRLTMVDAVREYAGVDFNTIKDDIEARTIAKEKHIEFKKELKDCTKGDVLIGLFEEFCEDKLMQPTFICDYPVENSPLTKKKRGNEAFTERFEGFVFGREVCNAYSELNDSIVQKERFMQQLKERELGDDEAYMMDDDFITSLEVGMPPTGGLGIGIDRLIMFLTDTHSIRDVILFPTMK 498
>gi|1174528|sp|P46191|SYK_MYCHO Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|581319|emb|CAA52877.1| putative lysyl-tRNA synthetase [Mycoplasma hominis] (488 aa)
Score = 1124, Expect = 1.1e-120, Identities = 238/489 (48%), Positives = 329/489 (67%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           MERK ++QE IRR K+  L++ N   +  + +  T    + N K+  L   +T   N      GR++ +R  F V++D  G  Q Y NKK +++S  + F+ ++D GDI+ + G+  +T    L +  + +  ++K+LKPLP+K+HGL D E R R RYVDL++N+ +   FV R +I+K IR++ DS NY+EV+TP+L+P+LGGA A+PFITF+N   RNFYLRIATELPLKKLIVGG D+VYEIGR+FRNEG+D+THNPEFTS+E Y AY ++  MM  TE +FK++        VK    ++     F+R++M+D + ++  VD  ++   Q   ELAKKH +K EK     GHIIN  FE++ E   ++PTFVYGHPI++SP +  D  +  FT R E FI TKE+AN F ELNDPIDQ +RFE Q+ EK  GN+EA E+D DF+ ALEYG+PPT G G+GIDR IM  T+  SIRDV+LFP +KD K
  S:     1 MERKTSEQEEIRRNKIAELEKNNLQAFH-KTMKPTANSKELNEKYKNLSREDTDKQNTEFVFNGRIMTIRGPFIVLQDNCGQMQIYANKKTLNESSAKTFS-LMDFGDILSVRGTLSKTNTDALVMKAQDMVTLTKSLKPLPDKFHGLVDPEERRRQRYVDLMMNEKTRNTFVMRTQIIKGIREYFDSLNYIEVDTPILNPMLGGAAAKPFITFYNATNRNFYLRIATELPLKKLIVGGLDRVYEIGRMFRNEGVDTTHNPEFTSIEFYEAYSDLWGMMERTEGVFKHLMNKFNIKEVKFNGFDMTFNFPFKRVNMIDAMSEKINVDIRKLNEEQ-MFELAKKHGIKIEKF-FRYGHIINELFEKYVEETLMEPTFVYGHPIEISPTAAIDPDDKRFTTRAETFIGTKEFANMFTELNDPIDQLQRFENQLLEKENGNEEANEIDWDFVNALEYGMPPTGGSGMGIDRTIMTLTQNDSIRDVVLFPQLKDLK 488
>gi|148543508|ref|YP_001270878.1| lysyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|184152915|ref|YP_001841256.1| lysyl-tRNA synthase [Lactobacillus reuteri F275] >gi|148530542|gb|ABQ82541.1| lysyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|183224259|dbj|BAG24776.1| lysyl-tRNA synthase [Lactobacillus reuteri F275] (508 aa)
Score = 1123, Expect = 1.1e-120, Identities = 240/483 (49%), Positives = 324/483 (67%)
  Q:     7 DQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN---NIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFW-EVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           DQ  +RREK++ L+EA  +P+   +  R     D + KF +      N     + +AGR+   R +    F    D  G  Q Y  K  V       F +  D+GD + I G   +T  GELT+   KI  +SKAL+PLP KW G+ D E   R RY+DLI N +S K F  R  I+K +R++MD   + EVETP+L+   GGANARPFIT HN L+ + YLRIATEL LK+LIVGGF++VYE+GRIFRNEGMD  HNPEFT+ME YAAY + + +M  TE + K  AK +     +    +EI L   F+RI MVD +K++TG+DF  E  ++++A++LA +H V+++ +  T GHI+N FFEEF E   IQPTFVY  P++VSPL+K++  NP  T RFEL+++  E ANAF+ELNDPIDQ ERFE Q KEK+ GNDEA  +D+D+++ALEYG+PPT GLG+GIDR++ML T+  SIRDV+LFP M+ +K
  S:     6 DQMRVRREKMEELKEAGIEPFG-RRFKRDHLAQDLHDKFDQYDKEELNEMGAKVIIAGRMTRKRSSGKAGFADFVDRTGKIQVYARKDMVGDEPYHVFKRS-DIGDFLGIEGDVIKTDTGELTVRAHKITFLSKALRPLPNKWDGVTDPETIYRQRYLDLISNPESFKRFHQRTAIIKAVRKYMDDNGFTEVETPILNTQAGGANARPFITHHNALDIDMYLRIATELYLKRLIVGGFERVYELGRIFRNEGMDPHHNPEFTTMETYAAYFDFQDVMDETEGIVKAAAKVVSDDGKITYQGHEIDLGGNFKRITMVDAVKEKTGIDFSDESMTDEDAKKLADEHKVEYKPYW-TKGHILNAFFEEFVEDTLIQPTFVYEFPVEVSPLAKRNADNPAMTDRFELYVDGSELANAFSELNDPIDQKERFEMQAKEKANGNDEAEPVDLDYVQALEYGMPPTGGLGIGIDRLVMLLTDAKSIRDVILFPTMRPEK 494
>gi|170759400|ref|YP_001788859.1| lysyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] >gi|169406389|gb|ACA54800.1| lysyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] (504 aa)
Score = 1123, Expect = 1.2e-120, Identities = 232/485 (47%), Positives = 325/485 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKH--QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + N+    R +KLK LQ   +DP+++ KV RT T  +    +  L+        +L  + V  +  F  I D YG  Q Y+    V +  L+ + K  D+GDI+ + G+ F+T+ GE ++ +   ++V K+L+PLPEKWHGL+D +LR R RYVDLI+N+D    F+ R  I+K +R+F+D++ +LEVETP+L PI GGA A+PFIT HN L+ + YLRIATEL LK+LIVGGF+KVYEIG+ FRNEG+D  HNPEFT++E+Y AY +   MM +TEN+  Y+  K L    V+    EI  T  +RR+ MVD +K+  GVDF  +K + EA+ +AK+ +++F+K     T G ++   FEEFCE K +QPTF+  +P++ SPL+KK   N  FT+RFE F+  +E  NA++ELND I Q ERF  Q+KE+ LG+DEA  MD DFI +LE G+PPT GLG+GIDR+IM  T+  SIRDV+LFP MK
  S:    12 EEQANELMKERFQKLKELQSNGKDPFDVYKVERTHTSKEVKDNYEDLEGKTVTVAGRLMSKRVHGKAGFSDIHDRYGKIQLYIKINDVGEEKLKEY-KTFDIGDIISVTGTVFKTKTGETSIHITDFQLVCKSLRPLPEKWHGLKDPDLRYRQRYVDLIINQDVRDTFIKRTAIIKSMREFLDNRGFLEVETPILSPIAGGAAAKPFITHHNALDIDMYLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTAIELYEAYADYNDMMEITENMIAYICEKVLGTTKVEYEGAEIDFTPPWRRLTMVDAVKEYAGVDFNIIKDDIEARAIAKEKHIEFKKELKDCTKGDVLIGLFEEFCEDKLMQPTFICDYPVENSPLTKKKRGNEAFTERFEGFVFGREVCNAYSELNDSIVQKERFMQQLKERELGDDEAYMMDDDFITSLEVGMPPTGGLGIGIDRLIMFLTDTHSIRDVILFPTMK 498
>gi|39939075|ref|NP_950841.1| lysyl-tRNA synthetase class II [Onion yellows phytoplasma OY-M] >gi|39722184|dbj|BAD04674.1| lysyl-tRNA synthetase class II [Onion yellows phytoplasma OY-M] (511 aa)
Score = 1121, Expect = 2.0e-120, Identities = 235/488 (48%), Positives = 339/488 (69%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAK---LKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M  K ++QE+IR +K+  L++ N DP+  +K   + +I     ++ K   L    +  ++ +AGR+V  R      F  ++DF    Q Y+    V K   + +    DLGDI+ I G  F+T+  ELT+   +   ++KALKPLP+K+HGL++ E   ++RYVDLIVN+ + +VF+ R  I+K IR F D+Q +LEVETP+L P LGGA+A+PFIT HN L  +FYLRIATELPLKKLIVGG +KVYEIGR+FRNEG+D+THNPEF+++E Y AY +M+ +M LT+   + +A+ L   +    +N+      F ++ MV  IK++TG+DF +  + ++   LAKKH ++   H S  GHII  FF ++ E   IQPTFVYGHP+++SPL+K++  +P FT RFELFI  KE+ANAF+ELNDPI+Q +RF  Q+++K LGNDEA +MD DF+ AL YG+PPT GLG+G+DR++ML T+ ++IRDV+LFPH K++
  S:     1 MATKLSEQEIIRHQKMNELKKINIDPFG-KKFVPSHSIEQILLQYQKADSLALEQSQIHVCVAGRIVLKRGQGKAGFLHLQDFNFRMQAYIKLDLVGKDAFQIYQNC-DLGDIIGIKGFLFKTKTQELTIKALEFIHLTKALKPLPDKFHGLQNREEMRKNRYVDLIVNEKTRQVFLTRSLIMKYIRNFFDNQGFLEVETPILQPTLGGASAKPFITHHNALNCDFYLRIATELPLKKLIVGGMNKVYEIGRLFRNEGIDATHNPEFSTIEAYLAYADMQDIMDLTKQCLQELAQKLFGKLQFTYQNQEIDFSHFAKVSMVASIKEKTGIDFTDNFTLEQCLSLAKKHQIEVMPHFSQ-GHIIEAFFGKYVENTLIQPTFVYGHPLEISPLAKQNEADPRFTDRFELFIVGKEFANAFSELNDPIEQEKRFLNQLQQKQLGNDEANDMDYDFLNALNYGMPPTGGLGMGLDRLVMLLTDTANIRDVILFPHCKNQ 492
>gi|146295866|ref|YP_001179637.1| lysyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409442|gb|ABP66446.1| lysyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] (495 aa)
Score = 1121, Expect = 2.1e-120, Identities = 238/487 (48%), Positives = 329/487 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + + N+Q   R +KL+ LQ+   +PYE  K   T    +    F K +       + +AGR+++ R     +F  I D  G  Q Y+   +V +   + F +  D+GDI+ + G  F+T KGE+++  K+I++++K L+PLPEKWHGL D + R R RY+DLIVN      F+ R  +++ IR+++D + +LEVETPVL PI GGA ARPFIT HN L+ + YLRIATEL LK+LIVGGFDKVYE+GR+FRNEG+   HNPEFT++E+Y AY + + MM LTE L   VAK +   + +     EI LT  ++R+ M+D IK+  GVDF +V S  EA+++AK   ++ E++   +GHIIN  FE+  E   +QPTF+  +P++VSPL+K+   NP FT+RFELFI  +E ANAF+ELNDP DQ ERF  Q+KE+  GN EA  MD DFIEALEYG+PPT GLG+GIDR++ML T+  SIRDVLLFP M+ K
  S:     8 QEELNEQIQNRIKKLRELQQNKYNPYEKVKYDSTHYSTEIKENFEKFE----GQFVSVAGRMLSKRGHGKASFVDILDPKGKIQIYIKIDEVGEEKYQEFKEYYDIGDIIGVKGEVFKTHKGEISIKAKEIEMLTKCLRPLPEKWHGLRDVDTRYRKRYLDLIVNHQVRDTFIKRSLMIRSIRKYLDDRGFLEVETPVLSPIAGGAAARPFITHHNALDIDLYLRIATELHLKRLIVGGFDKVYELGRVFRNEGISIKHNPEFTTIEIYQAYADYKDMMNLTEELITTVAKEVLGTLKITYQGQEIDLTPPWQRLTMIDAIKKYVGVDFSQVSSLDEARKIAKDLGIEVEENWQ-VGHIINEVFEQKVEDFLVQPTFIMDYPVEVSPLAKRKKDNPQFTERFELFITCREIANAFSELNDPFDQKERFLEQLKERQRGNQEAHMMDEDFIEALEYGMPPTGGLGIGIDRLVMLLTDSYSIRDVLLFPTMRPK 494
>gi|126701178|ref|YP_001090075.1| lysyl-tRNA synthetase [Clostridium difficile 630] >gi|115252615|emb|CAJ70458.1| lysyl-tRNA synthetase [Clostridium difficile 630] (509 aa)
Score = 1120, Expect = 2.8e-120, Identities = 238/476 (50%), Positives = 327/476 (68%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RR+KLK LQE+ +DP++  +  RT    D    F  L+   T    K+AGR+++ R      F  I+D  G  Q Y+    + +     F+   D+GDIV I G  F+T+KGE+++  K + ++ K+L+ LPEK+HGL+D+ELR R RYVDLIVN +    F+ R + LK +R ++D + +LEVETP+L+ I GGANARPFIT HNTL    YLRIA EL LK+LIVGGFDKVYE+GR+FRNEGMD  HNPE+T++E+Y AY +   MM +TEN+  ++A+ +    +V     EI  T  ++R+ M D +K+ +GVDF  + +++EA E+A++  ++  K     G +IN FFEEF E K IQPTF+  HP++VSPLSK++ ++P  T RFE F N  E ANAF+ELNDPIDQ  RF  Q++++ LG+DEA EMD DF++ALE GLPPT GLG+GIDR+IML T   SIRDVLLFP MK
  S:    23 VRRDKLKKLQESGRDPFKESRYDRTHYSMDIKDNFDSLEGKTT----KIAGRIMSKRIQGKAGFIDIQDQEGRIQSYVRLDAIGEEEYSVFS-TYDIGDIVGIEGEIFKTKKGEISVKAKSVVLLCKSLQVLPEKYHGLKDQELRYRQRYVDLIVNPEVKNAFLIRTKALKALRAYLDDRGFLEVETPILNTIAGGANARPFITNHNTLHIPMYLRIANELYLKRLIVGGFDKVYEMGRMFRNEGMDLKHNPEYTAIELYQAYADYTDMMEITENVIAHMAEVATGSMIVNYQGTEINFTPPWKRMSMEDCVKEYSGVDFSTINTDEEALEVAREKGIEI-KPGMRRGEVINAFFEEFGEDKLIQPTFITHHPVEVSPLSKRNVEDPRRTDRFEAFANKWELANAFSELNDPIDQKGRFIDQLRKRELGDDEAFEMDEDFLKALEVGLPPTGGLGIGIDRVIMLLTNSPSIRDVLLFPTMK 497
>gi|145952350|ref|ZP_01801360.1| hypothetical protein CdifQ_04004096 [Clostridium difficile QCD-32g58] >gi|168697431|ref|ZP_02729708.1| lysyl-tRNA synthetase [Clostridium difficile QCD-37x79] >gi|168713570|ref|ZP_02745847.1| lysyl-tRNA synthetase [Clostridium difficile QCD-63q42] >gi|168723556|ref|ZP_02755833.1| lysyl-tRNA synthetase [Clostridium difficile QCD-76w55] >gi|168732008|ref|ZP_02764285.1| lysyl-tRNA synthetase [Clostridium difficile QCD-97b34] >gi|196127350|ref|ZP_03119099.1| lysyl-tRNA synthetase [Clostridium difficile ATCC 43255] >gi|196162188|ref|ZP_03122749.1| lysyl-tRNA synthetase [Clostridium difficile CIP 107932] (509 aa)
Score = 1120, Expect = 2.8e-120, Identities = 238/476 (50%), Positives = 327/476 (68%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RR+KLK LQE+ +DP++  +  RT    D    F  L+   T    K+AGR+++ R      F  I+D  G  Q Y+    + +     F+   D+GDIV I G  F+T+KGE+++  K + ++ K+L+ LPEK+HGL+D+ELR R RYVDLIVN +    F+ R + LK +R ++D + +LEVETP+L+ I GGANARPFIT HNTL    YLRIA EL LK+LIVGGFDKVYE+GR+FRNEGMD  HNPE+T++E+Y AY +   MM +TEN+  ++A+ +    +V     EI  T  ++R+ M D +K+ +GVDF  + +++EA E+A++  ++  K     G +IN FFEEF E K IQPTF+  HP++VSPLSK++ ++P  T RFE F N  E ANAF+ELNDPIDQ  RF  Q++++ LG+DEA EMD DF++ALE GLPPT GLG+GIDR+IML T   SIRDVLLFP MK
  S:    23 VRRDKLKKLQESGRDPFKESRYDRTHYSMDIKDNFDSLEGKTT----KIAGRIMSKRIQGKAGFIDIQDQEGRIQSYVRLDAIGEEEYSVFS-TYDIGDIVGIEGEIFKTKKGEISVKAKSVVLLCKSLQVLPEKYHGLKDQELRYRQRYVDLIVNPEVKNAFLIRTKALKALRAYLDDRGFLEVETPILNTIAGGANARPFITNHNTLHIPMYLRIANELYLKRLIVGGFDKVYEMGRMFRNEGMDLKHNPEYTAIELYQAYADYTDMMEITENVIAHMAEVATGSMIVNYQGTEINFTPPWKRMSMEDCVKEYSGVDFSTINTDEEALEVAREKGIEI-KPGMRRGEVINAFFEEFGEDKLIQPTFITHHPVEVSPLSKRNVEDPRRTDRFEAFANKWELANAFSELNDPIDQKGRFIDQLRKRELGDDEAFEMDEDFLKALEVGLPPTGGLGIGIDRVIMLLTNSPSIRDVLLFPTMK 497
>gi|160946714|ref|ZP_02093917.1| hypothetical protein PEPMIC_00672 [Peptostreptococcus micros ATCC 33270] >gi|158447098|gb|EDP24093.1| hypothetical protein PEPMIC_00672 [Peptostreptococcus micros ATCC 33270] (493 aa)
Score = 1119, Expect = 3.3e-120, Identities = 236/485 (48%), Positives = 334/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENL-FKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  N+  L+RR+KL+ L ++ +DP+EIEK   T+   +    +   +       ++LAGR+   R      F  ++DF G  Q +     + +S  E   K LD+GDIV + G  F T  GE+++   K+ +++K+L+ LPEK+HGL+D +LR R RYVDLIVN +   VFV R +I+  IR+++DS+ +LEVETP+L+ I GGANARPFIT HNTL+ + YLRIA EL LK+LIVGGFDKVYE+GR+FRNEGMD  HNPE+T++E+Y AY + E MM+L E + +    + + K  V++    I     +RRI MVD +K+  GVDF  + +++EA+++A +  ++  +H +T G II+LFFEEFCE   +QPTFV  HP+++SPL+K+D K+  +T+RFE F+N  E ANAF+ELND IDQ +RF  QV+ +  G+DEA  MD DFI ALE GLPPT G+G+GIDR+IM  T + +IRDVLLFP MK
  S:     3 EQNLNEMLLVRRQKLQELVDSGRDPHEIEKFEGTIYAKEIKDNYENYE----GKVVRLAGRIRTKRGHGKVCFMDLQDFSGKIQLFNKLDVLGESYEEV--KTLDIGDIVGVEGEVFTTHAGEISIRSSKVVLLTKSLQLLPEKFHGLKDVDLRYRQRYVDLIVNPEIKDVFVMRSKIISSIRKYLDSRGFLEVETPILNTIPGGANARPFITHHNTLDIDMYLRIANELYLKRLIVGGFDKVYEMGRMFRNEGMDKLHNPEYTAIELYQAYVDYEEMMKLCEEMVYTVCMEVVGKSEVELQGKVIDFKPPWRRISMVDAVKEYAGVDFETILTDEEARKIAIEKKIEITEH-TTRGEIISLFFEEFCEEYMVQPTFVTKHPVEISPLAKRDPKDKRYTQRFEAFVNCGEIANAFSELNDAIDQKQRFLKQVEARENGDDEAQMMDYDFINALEIGLPPTGGMGIGIDRLIMYLTNQDTIRDVLLFPTMK 485
>gi|196165453|ref|ZP_03125984.1| lysyl-tRNA synthetase [Clostridium difficile QCD-23m63] (509 aa)
Score = 1117, Expect = 6.9e-120, Identities = 237/476 (49%), Positives = 328/476 (68%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RR+KLK LQE+ +DP++  +  RT    +    F  L+   T    K+AGR+++ R      F  I+D  G  Q Y+    + +     F+   D+GDIV I G  F+T+KGE+++  K + ++ K+L+ LPEK+HGL+D+ELR R RYVDLIVN +    F+ R + LK +R ++D + +LEVETP+L+ I GGANARPFIT HNTL    YLRIA EL LK+LIVGGFDKVYE+GR+FRNEGMD  HNPE+T++E+Y AY +   MM +TEN+  ++A+ +    +V     EI  T  ++R+ M D +K+ +GVDF  + +++EA E+A++  ++  K     G +IN FFEEF E K IQPTF+  HP++VSPLSK++ ++P  T RFE+F N  E ANAF+ELNDPIDQ  RF  Q++++ LG+DEA EMD DF++ALE GLPPT GLG+GIDR+IML T   SIRDVLLFP MK
  S:    23 VRRDKLKKLQESGRDPFKESRYDRTHYSMEIKDNFESLEGKTT----KIAGRIMSKRIQGKAGFIDIQDQEGRIQSYVRLDAIGEEEYSVFS-TYDIGDIVGIEGEIFKTKKGEISVKAKSVVLLCKSLQVLPEKYHGLKDQELRYRQRYVDLIVNPEVKNAFLIRTKALKALRAYLDDRGFLEVETPILNTIAGGANARPFITNHNTLHIPMYLRIANELYLKRLIVGGFDKVYEMGRMFRNEGMDLKHNPEYTAIELYQAYADYTDMMEITENVIAHMAEVATGSMIVNYQGTEINFTPPWKRMSMEDCVKEYSGVDFSTINTDEEALEVAREKGIEI-KPGMRRGEVINAFFEEFGEDKLIQPTFITHHPVEVSPLSKRNAEDPRRTDRFEVFANKWELANAFSELNDPIDQKGRFIDQLRKRELGDDEAFEMDEDFLKALEVGLPPTGGLGIGIDRVIMLLTNSPSIRDVLLFPTMK 497
>gi|194246497|ref|YP_002004136.1| Lysyl-tRNA synthetase [Candidatus Phytoplasma mali] >gi|193806854|emb|CAP18283.1| Lysyl-tRNA synthetase [Candidatus Phytoplasma mali] (497 aa)
Score = 1116, Expect = 8.4e-120, Identities = 236/489 (48%), Positives = 337/489 (68%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  K ++Q +IRR+K+ +L++   +P+   K  RT  I +   +F    KL     N  + +AGR++  R+     F  ++D++   Q Y+    +     E + K  DLGDI+ I G  F+T+  ELT+       ++KAL PLP+K+ GL+++E+  + RY+DLI+N  + ++F  R +I+K IR F D++N+LEVETP L  ILGGA A+PF+T+HN LE NFYLRIATEL LKKLIVGG + VYEIG++FRNEG+D++HNPEFTS+E+Y A+ +M  MM LT+   K V K   K +    +N I    KF  IH++D IKQ+TG++FW   + + A+ L+ +H +    H S +GHII  FFE++ E + IQPTF+YGHPI++SPL+K + K+   T RFELFI  KE+ANAF+ELNDPI+Q +RF  Q+++K LGN EA EMD+DFIEALEYG+PPT G+G+GIDR++ML T   +I DV+LFPH K++K
  S:     1 MTYKTSEQYIIRRKKIDHLKKLKINPFG-NKFIRTHCIKNIIEEFQNYDKLDLVKKNEQVTIAGRIILKREQGKAGFLHLQDYHYKIQIYIKLDLIGDKAFELY-KNSDLGDIIGISGILFKTKTNELTIKANDFIHLTKALLPLPDKYKGLKNKEIIRKRRYIDLIMNSKTREIFFLRSQIIKNIRNFFDNKNFLEVETPTLQSILGGATAKPFVTYHNDLESNFYLRIATELSLKKLIVGGLEAVYEIGKVFRNEGIDASHNPEFTSLEIYLAFADMRDMMNLTKQCLKDVCKKTLKTLEFKYQNHIINFNKFEEIHILDAIKQKTGINFWNDMNLETAKNLSLQHQINILPHFS-IGHIIEAFFEKYVEKELIQPTFIYGHPIEISPLAKTNQKDKRLTDRFELFIVGKEFANAFSELNDPIEQEKRFLNQLEQKKLGNQEANEMDLDFIEALEYGMPPTGGMGLGIDRLVMLLTNVDNINDVILFPHFKNQK 493
>gi|85057408|ref|YP_456324.1| lysyl-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789513|gb|ABC65245.1| lysyl-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] (496 aa)
Score = 1114, Expect = 1.4e-119, Identities = 235/488 (48%), Positives = 339/488 (69%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAK---LKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M++K ++QE+IR +K+  L++ N DP+  +K+  + +I     ++ K   L    +  N+ +AGR+V  R      F  ++DF    Q Y+    V K   + +    DLGDI+ I G  F+T+  ELT+   +   ++KALKPLP+K+HGL++ E   + RYVDLIVN+ + +VF+ R  I+K IR F D+Q +LEVETP+L P LGGA+A+PFIT HN L  +FYLRIATELPLKKLIVGG +KVYEIGR+FRNEG+D+THNPEF+++E Y AY +M+ +M LT+   + + + +   +    +N+      F ++ MV  IK++TG+DF +  + ++   LAKKH ++   H S  GHII  FF ++ E   IQPTFVYGHP+++SPL+K++  +P FT RFELFI  KE+ANAF ELNDPI+Q +RF  Q+K+K LGN+EA +MD DF+ AL YG+PPT GLG+GIDR++ML T+ ++IRDV+LFPH K++
  S:     1 MKKKISEQEIIRHQKMNELKKINIDPFG-KKIVPSHSIKQIILQYQKEDSLAFEQSQINVCVAGRIVLKRGQGKAGFLHLQDFDFRIQAYVKLDLVGKDAFQIYQNC-DLGDIIGIKGFLFKTKTQELTIKALEFIHLTKALKPLPDKFHGLQNREDMRKKRYVDLIVNEKTRQVFLTRSLIMKYIRNFFDNQGFLEVETPILQPTLGGASAKPFITHHNALNCDFYLRIATELPLKKLIVGGMNKVYEIGRLFRNEGIDATHNPEFSTIEAYLAYADMQDIMDLTKQCLQELVQKIFGKLQFTYQNQEIDFSHFAKVSMVASIKEKTGIDFTDHFTLEQCLSLAKKHKIEVMPHFSQ-GHIIEAFFGKYVENALIQPTFVYGHPLEISPLAKQNEFDPRFTDRFELFIVGKEFANAFRELNDPIEQEKRFLNQLKQKQLGNEEANDMDYDFLNALNYGMPPTGGLGMGIDRLVMLLTDTANIRDVILFPHCKNQ 492
>gi|114565688|ref|YP_752842.1| lysyl-tRNA synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336623|gb|ABI67471.1| lysyl-tRNA synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (493 aa)
Score = 1109, Expect = 4.9e-119, Identities = 233/487 (47%), Positives = 327/487 (67%)
  Q:     2 ERKFNDQEL--IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E + N  EL  +R EKL  L+E   +P+   +  R     +    F++L+       I +AGR+++ R+     F  + D  G  Q Y  +  +     E + K LD+GDI+ I G  FRTQKGE+++ V+ +  +SK+L PLPEKWHGL+D ELR R RYVDLIVN +  +VFV R RI+K +R ++D + +LEVETP++ PI GGA ARPFIT HN L+   YLRIA EL LK+LIVGG +KVYEI R FRNEG+ + HNPEFT +E+Y AY + E MM+L E+L   V   +   + +     ++  T  +RR+ M+D IK+  G+DF  +KS+++A + A +  ++  K  ++ G +IN  FE+F E K IQPTFVYGHP++VSPL+K++ + P FT RFELFI  +E ANAF+ELNDPIDQ ERF  QV++++ G+ EA  MD D+I ALEYG+PP  G+G+GIDR++ML T   SIRDV+LFP ++ +
  S:     3 ESELNISELKKVRLEKLAELKEMGIEPFG-RRFERDSMAQNIKEAFSELE----GKTIAIAGRIMSKRRHGKAGFANLADLSGSIQLYFRQDDLGPEKYELYKK-LDIGDILGIQGEVFRTQKGEISIHVRDLYYLSKSLTPLPEKWHGLKDVELRYRQRYVDLIVNPEVKEVFVKRSRIIKEMRNYLDDRGFLEVETPMMQPIPGGATARPFITHHNALDMELYLRIAPELYLKRLIVGGLEKVYEINRNFRNEGISTRHNPEFTMLEIYQAYGDYEVMMQLCEDLISAVMLKVNGSMQIDFEGEQLDFTPPWRRVTMLDAIKEAAGLDFSLIKSDEDACQAAWQLGLEV-KAGASRGELINEIFEQFVEDKLIQPTFVYGHPVEVSPLAKRNLETPEFTDRFELFIMQREIANAFSELNDPIDQKERFIKQVEKRAGGDAEAHMMDEDYINALEYGMPPAGGMGIGIDRLVMLMTGSPSIRDVILFPTLRPR 489
>gi|150014997|ref|YP_001307251.1| lysyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] >gi|149901462|gb|ABR32295.1| lysyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] (501 aa)
Score = 1109, Expect = 5.7e-119, Identities = 235/489 (48%), Positives = 335/489 (68%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL--GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +E ++N+QE +RR KL  LQ A +DP+++ KV+RT T  +  + +  L+       + +AGR+++ R      F  I D  G  Q +L   KV +  L+ + K  DLGD +   G  F T+ GE++++V   ++  K+LKPLPEKWHGL+D +LR R R VD+I N +    F+ R +I+  IR+F+D+++++EVETP+L  I GGA A+PFIT HNTL+ + YLRIATEL LK+LIV GF+KVYEIGR FRNEGM   HNPEFT++E+Y AY +   MM +TEN+  Y+ + +     V     EI     +RRI MVD +K+  GVDF E+KS+ EAQ +AK+ +++F K  +T+  G ++N  +EEF EA  IQPTFV  +P+++SPL+KK   NP FT+RFE F+  +E  NA++ELNDPI Q +RFE Q KE+ LG+DEA  +D  F+ ALE G+PPT G+G+GIDR+IM  T+ +SIRDV+LFP M+ +K
  S:    11 LESQYNEQEGLRRAKLAELQGAGKDPFDVYKVNRTHTSEEVKANYDALE----GKEVTVAGRLMSKRGQGKVVFSDIHDKDGKIQLFLKIDKVGEENLKQY-KTFDLGDWIAATGEVFTTKTGEVSVNVNTFELTCKSLKPLPEKWHGLKDPDLRYRQREVDIITNTEVKDTFIKRSKIISAIREFLDAKSFIEVETPILGAIAGGAAAKPFITHHNTLDMDMYLRIATELYLKRLIVAGFEKVYEIGRNFRNEGMSVRHNPEFTAIELYEAYSDYNDMMEITENMVAYICEKVNGTTKVAYQGTEIDFKPPWRRITMVDAVKEYAGVDFNEIKSDDEAQTIAKEKHLEFAKPLNTVTKGEVLNALYEEFGEANMIQPTFVTDYPVEISPLTKKKRGNPEFTERFEGFVFGRELCNAYSELNDPIVQRQRFEQQAKERELGDDEAYMLDEQFMSALETGMPPTGGMGMGIDRLIMFLTDSASIRDVILFPTMRPQK 501
>gi|154505279|ref|ZP_02042017.1| hypothetical protein RUMGNA_02793 [Ruminococcus gnavus ATCC 29149] >gi|153794477|gb|EDN76897.1| hypothetical protein RUMGNA_02793 [Ruminococcus gnavus ATCC 29149] (655 aa)
Score = 1104, Expect = 2.3e-118, Identities = 231/487 (47%), Positives = 330/487 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E   N    +RREKL +LQ   +DP+ I K  +T    +    F +L        + +AGR+++ R     +F  ++D  G+ Q Y+ +  + +   + F K +D+GD++ I G  F T+ GE ++    + ++SK+L+ LPEK+HGL + ++R R RYVDLI+N D  + F++R +IL  IR+++D Q +LEVETP+L    GGA ARPF T  N L+ +F LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTENL+++VA+  L   V++    ++ L + F RI MVD +K+  GVD+ EV++ ++A+ LAK+H+V+FE+     G I+ LFFEEF E   IQPTFV  HPI++SPL+KK  +NP +T+RFE F+N  E ANA++ELNDPIDQ ERF+AQ +  + G+DEA   D DF+ ALE G+PPT G+G GIDRM ML T  ++IRDVLLFP MK +
  S:    20 EPDLNQLRKVRREKLADLQANGKDPFVITKYDQTHHSLEIKENFEEL----AGKEVSIAGRMMSKRVMGKASFCNVQDLQGNIQSYVARDSIGEEAYKEFKK-MDVGDVIGITGEVFETKTGEKSIHASSVTLLSKSLQILPEKFHGLTNTDIRYRQRYVDLIMNPDVKQTFINRSKILSAIRRYLDGQGFLEVETPMLVSNAGGAAARPFETHFNALDEDFKLRISLELYLKRLIVGGMERVYEIGRVFRNEGLDTRHNPEFTLMELYQAYTDYNGMMDLTENLYRHVAQEVLGTTVIEYNGVQMDLGKPFERITMVDAVKKYAGVDWNEVETLEQARALAKEHHVEFEERHKK-GDILALFFEEFAEEHLIQPTFVMDHPIEISPLTKKKPENPEYTERFEFFMNGWEMANAYSELNDPIDQRERFKAQEELLAQGDDEANTTDEDFLNALEIGMPPTGGIGFGIDRMCMLLTNSAAIRDVLLFPTMKSQ 505
>gi|116490302|ref|YP_809846.1| lysyl-tRNA synthetase (class II) [Oenococcus oeni PSU-1] >gi|116091027|gb|ABJ56181.1| Lysyl-tRNA synthetase (class II) [Oenococcus oeni PSU-1] (496 aa)
Score = 1103, Expect = 2.3e-118, Identities = 233/487 (47%), Positives = 329/487 (67%)
  Q:     1 MERKFNDQELIRREKLKNLQE-ANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKD 487
           ++ + NDQ  +RR+KL+ L++    DP+    E+ S    I  F    +K +      ++ +AGR++A R      F  IRD  G  Q Y  +  ++ +      +  DLGDI+   G+  +T  GE T+ + K+  +SKAL+PLP+K+HGL D + R R RY+DLI N  S +VF+ R +I+K IR +MDS  +LEVETP+L    GGA ARPF+T HN L+ + YLRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+ HNPEFT++E Y AY ++  +M  TEN+ +  AKS+ +  V+    ++I L++ F +  M + IK++TG+DF +    + A++LA ++NVK+E     +GHII  FF+ F E   I+PTFVY  P++VSPL+KK+  NP F +RFEL+I   EY NAF ELNDPIDQ +RFEAQ  E+  GNDEA  +D D+IEALE+G+ PT GLG+GIDR+ ML T ++S+RDVLLFP M++
  S:     5 IDTELNDQLRVRRQKLQALKDDLGIDPFGHRFERDSYAKDIHSFADNKSKEELDAAKKHVIIAGRIMAKRGAGKIIFADIRDVSGTVQIYARRDDLADNYA--LIRRADLGDILGFSGTVMKTDAGETTILIDKLTWLSKALRPLPDKYHGLTDIDTRYRKRYLDLISNPKSFEVFIKRSKIVKAIRNYMDSIGFLEVETPILQNSAGGAAARPFVTHHNALDIDMYLRIATELYLKRLIVGGMERVYEIGRIFRNEGMDTRHNPEFTTLESYGAYWDLSDVMIETENIIRAAAKSINEDGVIDYQGHKIDLSKDFAKRSMTELIKEKTGIDFDKKIDLETARKLANENNVKYESFWG-VGHIIAEFFDTFVEKSLIEPTFVYHFPLEVSPLAKKEDNNPDFVQRFELYIAGGEYGNAFTELNDPIDQRQRFEAQAAERENGNDEAESIDEDYIEALEHGMAPTGGLGIGIDRLTMLLTNQTSVRDVLLFPTMRN 496
>gi|118587147|ref|ZP_01544576.1| lysyl-tRNA synthetase [Oenococcus oeni ATCC BAA-1163] >gi|118432426|gb|EAV39163.1| lysyl-tRNA synthetase [Oenococcus oeni ATCC BAA-1163] (496 aa)
Score = 1103, Expect = 2.4e-118, Identities = 233/487 (47%), Positives = 328/487 (67%)
  Q:     1 MERKFNDQELIRREKLKNLQE-ANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKD 487
           ++ + NDQ  +RR+KL+ L++    DP+    E+ S    I  F    +K +      ++ +AGR++  R      F  IRD  G  Q Y  +  ++ +      +  DLGDI+   G+  +T  GE T+ + K+  +SKAL+PLP+K+HGL D + R R RY+DLI N  S +VF+ R +I+K IR +MDS  +LEVETP+L    GGA ARPF+T HN L+ + YLRIATEL LK+LIVGG ++VYEIGRIFRNEGMD+ HNPEFT++E Y AY ++  +M  TEN+ +  AKS+ +  V+    ++I L++ F +  M + IK++TG+DF +    + AQ+LA ++NVK+E     +GHII  FF+ F E   I+PTFVY  P++VSPL+KK+  NP F +RFEL+I   EY NAF ELNDPIDQ +RFEAQ  E+  GNDEA  +D D+IEALE+G+ PT GLG+GIDR+ ML T ++S+RDVLLFP M++
  S:     5 IDTELNDQLRVRRQKLQALKDDLGIDPFGHRFERDSYAKDIHSFADNKSKEELDAAKKHVIIAGRIMTKRGAGKIIFADIRDVSGTVQIYARRDDLADNYA--LIRRADLGDILGFSGTVMKTDAGETTILIDKLTWLSKALRPLPDKYHGLTDIDTRYRKRYLDLISNPKSFEVFIKRSKIVKAIRNYMDSIGFLEVETPILQNSAGGAAARPFVTHHNALDIDMYLRIATELYLKRLIVGGMERVYEIGRIFRNEGMDTRHNPEFTTLESYGAYWDLSDVMIETENIIRAAAKSINEDGVIDYQGHKIDLSKDFAKRSMTELIKEKTGIDFDKKIDLETAQKLANENNVKYESFWG-VGHIIAEFFDTFVEKSLIEPTFVYHFPLEVSPLAKKEDNNPDFVQRFELYIAGGEYGNAFTELNDPIDQRQRFEAQAAERENGNDEAESIDEDYIEALEHGMAPTGGLGIGIDRLTMLLTNQTSVRDVLLFPTMRN 496
>gi|118727403|ref|ZP_01576005.1| lysyl-tRNA synthetase [Clostridium cellulolyticum H10] >gi|118663230|gb|EAV69889.1| lysyl-tRNA synthetase [Clostridium cellulolyticum H10] (499 aa)
Score = 1102, Expect = 3.6e-118, Identities = 240/487 (49%), Positives = 341/487 (70%)
  Q:     2 ERKFNDQEL-----IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E + N+++L     +RR KLK+LQE N DP++I K   T +  +  + F  L+  N +    +AGR+++ R      F  ++D  G  Q Y+ K +V   + E F K  D+GDIV + G  F+T KGE+++ VK+I ++SK+L PLPEKWHGL+D +LR R RYVDLIVN +    F+ R +I+K IR+F+D + +LEV+TP+L+ I GGA ARPFIT HNTL+ + YLRIA EL LK+LIVGG +KVYE+GR+FRNEGM   HNPEFT MEVY AY + + MM LTENL   VA ++L    ++    EI LT  + R+ M++ +K+ TG+DF  +K+++EA+  A+   V   K     G I+NL FEEF E+  +QPTF+Y +P+++SPL+K+    P  T+RFE FI  +E  NA++ELNDPIDQ ERF +QVK++  G++EA  MD D++ ALEYG+PPT GLG+G+DR+++L T+ +SIRD+LLFP MK +
  S:     8 ENQQNEEDLSEILRVRRAKLKDLQEKNSDPFKIVKYDVTNSSQNIINNFDSLEGQNAS----IAGRLMSKRGMGKAGFCDLQDRDGRIQLYVRKDEVGDEVYEMFKK-YDIGDIVGVQGEIFKTHKGEISIKVKEITLLSKSLLPLPEKWHGLKDTDLRYRQRYVDLIVNPEVKNTFILRSKIIKSIRKFLDDRGFLEVDTPLLNTIPGGAAARPFITHHNTLDIDMYLRIAPELYLKRLIVGGMEKVYEMGRMFRNEGMSVKHNPEFTMMEVYEAYNDYKGMMELTENLVSTVAMETLGTTKIQYQGQEIDLTPPWNRMTMIEAVKEYTGIDFDTIKTDEEAKAAAESKKVHV-KEGMVRGEILNLMFEEFVESNLVQPTFIYDYPVEISPLTKRKPDCPELTERFEFFITGREMGNAYSELNDPIDQKERFVSQVKKRDSGDEEANMMDEDYVTALEYGMPPTGGLGIGVDRLVILLTDSASIRDILLFPTMKPR 498
>gi|78044571|ref|YP_361162.1| lysyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|123756728|sp|Q3A9M2|SYK_CARHZ Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|77996686|gb|ABB15585.1| lysyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] (488 aa)
Score = 1100, Expect = 5.8e-118, Identities = 236/486 (48%), Positives = 323/486 (66%)
  Q:     3 RKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ++ N+   +R EKL  L++   +PY   K  RT T  +    F +L     +  +K+AGR++A R     +F  I+D  G  Q Y  + ++     + F K LD+GDI+ + G  F+TQKGE+T+ +   +I++K+L+PLPEKWHGL D ELR R RYVDLIVN +  + F+ R RI+K IR+F+D + +LEVETP++HPI GGA ARPFIT HN L+   YLRIA EL LK+L+VGGF+KVYEI R FRNEG+ + HNPEFT +E+Y AY +   MM +TE L  +VA K L    +      I L + ++RI M+  I++ TGVDF  VK   +A   AK+  V  E+     G II   FEE  E   I PTFV  +P++VSPL+K+  +NP  T RFELFI  +E ANAF+ELNDPIDQ ERF  Q++ ++ GN+EA  MD D+I ALEYG+PP  GLG+GIDR++ML T+++SIRDV+LFP M+ +
  S:     4 QELNELVKVRLEKLSELRKMGIEPYG-GKFERTHTAKEILDNFEQL----VDKTVKIAGRIMAKRGHGKASFAHIQDMSGKIQIYARQNELGIDAYKLFEK-LDIGDIIGVTGHVFKTQKGEITVWLSSFEILAKSLRPLPEKWHGLTDVELRYRQRYVDLIVNPEVRETFILRSRIVKTIREFLDQKGFLEVETPMMHPIAGGAAARPFITHHNALDMKLYLRIAPELYLKRLLVGGFEKVYEINRNFRNEGISTKHNPEFTMLELYQAYADYHDMMDITEELITHVAEKVLGTLEITYQGTPINLHRPWKRIPMLKAIEEATGVDFAGVKDPVQAYAKAKELGVPVEEGMG-WGEIITAVFEEKVEPTLINPTFVIDYPVEVSPLAKRQKENPDLTYRFELFIYGREMANAFSELNDPIDQKERFLKQLEARAKGNEEAHMMDEDYITALEYGMPPAGGLGIGIDRLVMLLTDQASIRDVILFPLMRPR 487
>gi|164686646|ref|ZP_02210674.1| hypothetical protein CLOBAR_00239 [Clostridium bartlettii DSM 16795] >gi|164604375|gb|EDQ97840.1| hypothetical protein CLOBAR_00239 [Clostridium bartlettii DSM 16795] (507 aa)
Score = 1099, Expect = 7.0e-118, Identities = 233/476 (48%), Positives = 330/476 (69%)
  Q:    11 IRREKLKNLQEANQDPYEIEK---VSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RREKL+NL +  ++P+E  K      +M I D F +K           N+K+AGR+++ R      F  I+D  G  Q Y+ K  + +     F K  D+GDI+ + G+ F+T+K E+++    + ++SK+L+ LPEK+HGL+D +LR R RYVDLIVN +  + F+ R + LK +R ++D + +LEVETP+L+ I GGANARPFIT HNTL+   YLRIA EL LK+LIVGGFDKVYE+GR+FRNEGMD  HNPE+T++E+Y AY +   MM LTEN+  ++A+ +    VV     EI     ++R+ M++ +K+ +GVDF  +++++EA  +A++  ++        G +IN FFEEF E K IQPTF+  HP++VSPL+K++ ++P  T RFE F N  E ANAF+ELNDPIDQ ERF  Q+++K LG+DEA +MD DFI ALE GLPPT GLG+GIDR++ML T  +SIRDV+LFP MK
  S:    21 VRREKLQNLIDMGRNPFEQTKYDVTDHSMHIKDNFEAK--------EGENVKIAGRIMSKRIQGKAGFIDIQDSEGRIQCYVRKDAIGEEEYPVF-KTYDIGDIIGVEGTVFKTKKEEISVKATSVVLLSKSLQVLPEKYHGLKDVDLRYRQRYVDLIVNPEVKQAFLTRTKALKALRSYLDDRGFLEVETPILNTIAGGANARPFITHHNTLDIPMYLRIANELYLKRLIVGGFDKVYEMGRMFRNEGMDVNHNPEYTAIEMYQAYADFNDMMELTENVIAHMAEVATGSTVVNFQGTEIDFKPPWKRMTMIECVKEYSGVDFDTIETDEEALAVAREKGIEITPGMRR-GEVINAFFEEFGEDKLIQPTFITHHPVEVSPLAKRNAEDPRKTDRFEAFANKWELANAFSELNDPIDQKERFMDQLRKKELGDDEACDMDEDFINALEVGLPPTGGLGIGIDRVMMLLTNSASIRDVILFPTMK 495
>gi|167758612|ref|ZP_02430739.1| hypothetical protein CLOSCI_00952 [Clostridium scindens ATCC 35704] >gi|167663808|gb|EDS07938.1| hypothetical protein CLOSCI_00952 [Clostridium scindens ATCC 35704] (656 aa)
Score = 1098, Expect = 9.2e-118, Identities = 230/485 (47%), Positives = 324/485 (66%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E   N    +RREKL +LQ   +DP+ I K   T    +    +  ++       + +AGR++  R     +F  I D  G+ Q Y+ +  V +   + F K LD+GDIV I G  F+T+ GE+++    + ++SK+L+ LPEK+HGL + ++R R RYVDLI+N +S   F+ R RI+  IR+++D Q +LEVETP+L    GGA ARPF T  N L+ +F LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTENL+++VA+  L   ++     E+ L + F RI M+D +K+  GVD+ EV + +EA+ LA KH+V++E      G I++LFFEEF E   IQPTFV  HPI++SPL+KK  ++P + +RFE F+N  E ANA++ELNDPIDQ ERF+AQ +  + G++EA   D DF+ ALE G+PPT G+G GIDRM ML T+ ++IRDVLLFP MK
  S:    16 EPDLNQLRKVRREKLADLQANGKDPFLITKYDVTAHAAEIKDNYETME----GKQVSVAGRIMQKRVMGKASFCNILDQSGNIQSYVARDSVGEDSYKDFKK-LDIGDIVGIEGEVFKTKTGEISIHASAVNLLSKSLQILPEKYHGLTNTDMRYRQRYVDLIMNTESRDTFIKRSRIVSAIRRYLDGQGFLEVETPMLVSNAGGAAARPFETHFNALDEDFKLRISLELYLKRLIVGGLERVYEIGRVFRNEGLDTRHNPEFTLMELYQAYTDYNGMMDLTENLYRHVAQEVLGTTIITYNGVEMDLGKPFERITMIDAVKKYAGVDWNEVSTLEEARALADKHHVEYEDRHKK-GDILSLFFEEFAEEHLIQPTFVMDHPIEISPLTKKKPEDPNYVERFEFFMNGWEMANAYSELNDPIDQRERFKAQEELLAQGDEEANTTDEDFLNALEIGMPPTGGIGFGIDRMCMLMTDSAAIRDVLLFPTMK 499
>gi|167745533|ref|ZP_02417660.1| hypothetical protein ANACAC_00224 [Anaerostipes caccae DSM 14662] >gi|167655254|gb|EDR99383.1| hypothetical protein ANACAC_00224 [Anaerostipes caccae DSM 14662] (637 aa)
Score = 1097, Expect = 1.1e-117, Identities = 226/476 (47%), Positives = 327/476 (68%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RR KL+ LQ A ++P+EI K   T    +    F +L+    +   ++  + V  + +F  I+D  G  Q Y+ + ++     + F K +D+GDI+ I G+ F T+ GE ++  K++ ++SK+LKPLPEK+HGL+D + R R RYVDLI+N++S   F+ R +I+  IR F+D Q ++EVETP+L P  GGA ARPF T +N L+ +  LRI+ EL LK+LIVGG +KVYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTENL++Y+A+  +    +     E+ L + F +I MVD +K+  GVDF E+ + ++A++ A +H+V++E+     G I+NLFFEEF E K +QPTFV  HP+++SPL+KK  +NP + +RFE F+N  E ANA++ELNDPIDQ ERF+AQ +  + G++EA   D DF+ ALE G+PPT G+G GIDRM+ML T+ S+IRDVLLFP MK
  S:    14 VRRNKLEELQSAGKNPFEIMKYDTTHHSMEIKDHFEELEGKEVSVAGRMMFKRVMGKASFCNIQDLEGRIQAYVARDEIGVEEYKDFKK-MDIGDIIGIKGTVFVTKTGEKSIHAKEVVLLSKSLKPLPEKFHGLKDTDARYRQRYVDLIMNEESKGTFIKRSKIISKIRSFLDGQGFMEVETPMLVPNAGGAAARPFETHYNALDEDVKLRISLELYLKRLIVGGLEKVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYNGMMELTENLYRYLAQEVVGSTTITYNGIEMDLGKPFEKITMVDAVKKYAGVDFDEIHTVEDARKAADEHHVEYEERHKK-GDILNLFFEEFVEDKLVQPTFVLDHPVEISPLTKKKPENPDYVERFEFFMNGWEMANAYSELNDPIDQRERFKAQEELLAQGDEEANSTDEDFLNALEIGMPPTGGIGFGIDRMVMLLTDSSAIRDVLLFPTMK 488
>gi|89211127|ref|ZP_01189504.1| Lysyl-tRNA synthetase, class-2 [Halothermothrix orenii H 168] >gi|89159286|gb|EAR78957.1| Lysyl-tRNA synthetase, class-2 [Halothermothrix orenii H 168] (491 aa)
Score = 1089, Expect = 1.0e-116, Identities = 222/433 (51%), Positives = 310/433 (71%)
  Q:    57 IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + L+GR++A R     +F  I+D  G  Q Y+    V +   E F   LD+GDI+ + G  F+T++G++++ V   ++++K+L+PLPEKWHGL D+ELR R RY+DLIVN +  K F+ R +I++ IR++++ + +LEVETP++HPI GGANARPFIT HN L+ + YLRIA EL LK+LIVGGF++V+EI R FRNEGM   HNPEFT +E+Y A  +   MM LTE+L   VAK  L    +     EI LT  + R+ MV+ +K+ TGVDF E+KS++EA++ A+   ++ E   S  G ++N  FEE  E K +QPTF+  +PI+VSPL+K+   NP FT RFE FIN+ E ANAF+ELN+PIDQ ERFE QVK+++ G+DEA  MD D++ ALEYG+PPT GLG+GIDR+IM+ T+  SIRDV+LFP M+ +K
  S:    56 VSLSGRIMAKRTHGKASFADIQDVTGKIQLYVKVDIVGEKEYELFTG-LDIGDIIGVTGEVFKTRRGQISVKVHSFRLLTKSLRPLPEKWHGLRDKELRYRQRYLDLIVNPEVRKTFITRSKIIREIRKYLEDKGFLEVETPMMHPIAGGANARPFITHHNALDIDLYLRIAPELYLKRLIVGGFERVFEINRNFRNEGMSYKHNPEFTMLELYQAQADYHDMMDLTEDLIYNVAKKVLGTTKISYQGQEIDLTPPWNRVTMVEAVKEHTGVDFNEIKSDEEARKAAEGLGIELEGKPSR-GKVLNEIFEEKVEDKLVQPTFIMDYPIEVSPLAKRKDDNPDFTYRFEAFINSWEIANAFSELNNPIDQRERFEEQVKQRAQGDDEAQMMDEDYVRALEYGMPPTGGLGIGIDRLIMVLTDSPSIRDVILFPTMRPEK 491
>gi|72080546|ref|YP_287604.1| lysyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] (489 aa)
Score = 1086, Expect = 2.7e-116, Identities = 236/489 (48%), Positives = 326/489 (66%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK--SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  K NDQ+  RR+KLKNL +   + P    +    + I +  S+ +K         I  AGR++  R  F +I       Q Y++KK   K+   + N  LDLGDI+E+ G  F+TQ G+L++ V    +++K+L PLP++++G+E+ + + R RY+DL+VN +S K F  R +I+ +IR F DSQ +LEV+TPVLHP+LGGA+A+PFIT++N+L +NFYLRIATELPLKKL+V GFD+VYEIG+IFRNEG DSTHNPEFTS+E Y AY N+E +M  TENLF+++ +  +L          +I   +KF R  M++   +    D  +  +  +  E AKK  VK E      GH+IN FFE+F E   I PTF+ GHPI++SPL+K +  NP FT R ELFI  KE+AN F ELNDPIDQ  RF+AQ+ EK+ GN EA E+D +F++ALEYG+PP  G G+GIDR+ ML T+  SIR+V+LFP +K KK
  S:     1 MMSKLNDQQQFRRDKLKNLVKNGFNFPSSTFEHDNLVEINEKFSQKSKEFFLENQVKIAFAGRLIRQRGPFFIIFSQNLQIQAYISKKFQKKNEFIFAN--LDLGDIIEVSGYLFKTQTGQLSIKVNNFSLLTKSLHPLPDQYYGIENPDEKYRKRYLDLLVNSESAKTFRLRSKIISLIRTFFDSQGFLEVDTPVLHPVLGGASAKPFITYYNSLSQNFYLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKIMDQTENLFRFLFEKLNLDPANFDFSNKKINFLEKFARYDMIEITSKLMNFDL-KSANFADLVEKAKKEGVKIEPFFKK-GHLINKFFEKFVEPTLINPTFIIGHPIEISPLAKSNPNNPNFTLRAELFICGKEFANMFDELNDPIDQLSRFQAQIIEKNQGNQEASEIDNEFVQALEYGMPPAGGCGIGIDRLTMLLTKNESIREVILFPQLKPKK 488
>gi|147676598|ref|YP_001210813.1| lysyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] >gi|146272695|dbj|BAF58444.1| lysyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] (506 aa)
Score = 1085, Expect = 3.4e-116, Identities = 233/488 (47%), Positives = 321/488 (65%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           E   N+   +RREKL  L++   +PY   +  RT T       F +++    N  + +AGR+++ R     TF  I+D  G  Q Y+    V     E F + LD+GDI+ + GS F+T+ GE+T+  +  KI+SK+L+PLPEKWHGL D ELR R RYVDLIVN +  +VF  R +I++  R F+D + +LEVETP++  I GGA ARPFIT HN L+ + YLRIA EL LK+L+VGGF+KVYEI R FRNEG+ + HNPEFT +E+Y AY +   MM LTE L   VA ++L    ++    EI L   + RI M++ IK   G+DF  +KS +EA +  ++  +  E   S + G I+N  FEE  E K IQPTFV  +P+++SPL+K+  ++P  T RFELFI  +E ANAF+ELNDPIDQ  RF  QV+++  G++EA  MD D+I ALEYG+PP  GLG+GIDR++ML T  +SIRDV+LFP MK ++
  S:    19 EEDLNELMRVRREKLAELRDKGIEPYG-GRFERTHTARYILDNFVEME----NRPVVIAGRIMSRRGMGKATFAHIQDGTGQIQIYVRLNDVGPESYELFGR-LDIGDIIGVQGSVFKTRMGEITVAAESFKILSKSLRPLPEKWHGLRDVELRYRQRYVDLIVNPEVKEVFETRSKIIRACRNFLDGKGFLEVETPMMQVIPGGAAARPFITHHNALDMDLYLRIAPELYLKRLLVGGFEKVYEINRNFRNEGISTKHNPEFTMLELYQAYADYTDMMNLTEELISAVAVEALGTTKIEYQGTEIDLAPPWPRIPMLETIKVHAGLDFGALKSAEEAFKAVEQAGIGLELDPSDSWGTIVNKVFEEVVEPKLIQPTFVVDYPVEISPLAKRKAEDPELTYRFELFIYGREIANAFSELNDPIDQKGRFLKQVEKRKAGDEEAHMMDEDYINALEYGMPPAGGLGIGIDRLVMLLTNSASIRDVILFPLMKPRE 506
>gi|166229887|sp|Q4A8F8|SYK_MYCH7 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|144575320|gb|AAZ53581.2| lysyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] (491 aa)
Score = 1083, Expect = 6.2e-116, Identities = 235/486 (48%), Positives = 325/486 (66%)
  Q:     4 KFNDQELIRREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK--SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           K NDQ+  RR+KLKNL +   + P    +    + I +  S+ +K         I  AGR++  R  F +I       Q Y++KK   K+   + N  LDLGDI+E+ G  F+TQ G+L++ V    +++K+L PLP++++G+E+ + + R RY+DL+VN +S K F  R +I+ +IR F DSQ +LEV+TPVLHP+LGGA+A+PFIT++N+L +NFYLRIATELPLKKL+V GFD+VYEIG+IFRNEG DSTHNPEFTS+E Y AY N+E +M  TENLF+++ +  +L          +I   +KF R  M++   +    D  +  +  +  E AKK  VK E      GH+IN FFE+F E   I PTF+ GHPI++SPL+K +  NP FT R ELFI  KE+AN F ELNDPIDQ  RF+AQ+ EK+ GN EA E+D +F++ALEYG+PP  G G+GIDR+ ML T+  SIR+V+LFP +K KK
  S:     6 KLNDQQQFRRDKLKNLVKNGFNFPSSTFEHDNLVEINEKFSQKSKEFFLENQVKIAFAGRLIRQRGPFFIIFSQNLQIQAYISKKFQKKNEFIFAN--LDLGDIIEVSGYLFKTQTGQLSIKVNNFSLLTKSLHPLPDQYYGIENPDEKYRKRYLDLLVNSESAKTFRLRSKIISLIRTFFDSQGFLEVDTPVLHPVLGGASAKPFITYYNSLSQNFYLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKIMDQTENLFRFLFEKLNLDPANFDFSNKKINFLEKFARYDMIEITSKLMNFDL-KSANFADLVEKAKKEGVKIEPFFKK-GHLINKFFEKFVEPTLINPTFIIGHPIEISPLAKSNPNNPNFTLRAELFICGKEFANMFDELNDPIDQLSRFQAQIIEKNQGNQEASEIDNEFVQALEYGMPPAGGCGIGIDRLTMLLTKNESIREVILFPQLKPKK 490
>gi|160881676|ref|YP_001560644.1| lysyl-tRNA synthetase [Clostridium phytofermentans ISDg] >gi|160430342|gb|ABX43905.1| lysyl-tRNA synthetase [Clostridium phytofermentans ISDg] (503 aa)
Score = 1082, Expect = 6.4e-116, Identities = 229/476 (48%), Positives = 323/476 (67%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ++ +KL +LQEA +DP++I K   T    D    F  L+       + +AGR++  R     +F  I+D  G+ Q Y+ +  + +     F K  D+GDIV I G  F+T  GE+++   +I ++SK L+ LPEK+HGL D + R R RYVDL++N +  + F+ R  I++ IR ++D ++++EVETPVL    GGA ARPF+T HN+L+ +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+   HNPEFT +E+Y AY +   MM LTE LF+ VA K +    +     EI L + F RI MV+ +K+  G+DF +VK+ +EA+ LAK+H+V FE      G I++LFFEEF E   IQPTFV  HP+++SPL+KK  +NP +T+RFELF+  +E ANA++ELNDPIDQ ERF AQ   K+ G++EA  MD DF+ AL YG+PPT G+G+GIDR++ML T+ S+IRDVLLFP MK
  S:    25 VKMQKLADLQEAGKDPFQIMKYDVTHHTIDVKDNFENLE----GQIVAIAGRIMTKRVMGKASFINIQDKLGNIQSYIQRDSIGEEEYAGFKK-FDIGDIVGIKGEVFKTHAGEISVRANEILLLSKCLQVLPEKFHGLTDTDTRYRQRYVDLMMNPEVKETFIKRSAIIREIRNYLDGEDFIEVETPVLVKNAGGAAARPFMTHHNSLDEDLNLRISLELYLKRLIVGGLERVYEIGRVFRNEGLSVRHNPEFTLLELYQAYTDYNGMMDLTEKLFRTVAEKVIGTTKISYEGVEIDLGKPFERITMVEAVKKYKGIDFDQVKTEEEAKALAKEHHVSFEDRHKK-GDILSLFFEEFVEEHLIQPTFVIDHPVEISPLTKKKPENPEYTERFELFVTKREMANAYSELNDPIDQRERFVAQEALKAAGDEEANSMDEDFLNALAYGMPPTGGIGIGIDRLVMLLTDSSAIRDVLLFPTMK 499
>gi|116332751|ref|YP_794278.1| lysyl-tRNA synthetase (class II) [Lactobacillus brevis ATCC 367] >gi|116098098|gb|ABJ63247.1| Lysyl-tRNA synthetase (class II) [Lactobacillus brevis ATCC 367] (502 aa)
Score = 1080, Expect = 1.1e-115, Identities = 222/482 (46%), Positives = 319/482 (66%)
  Q:     5 FNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            NDQ  +RR+K+  LQE    P+    ++   + ++ +   K+ K +     + + +AGR+   R +    F  + D  G  Q Y  + ++ +     + K LDLGD +   G   +T  G LTL + + + +SK+L+PLP+K+HGL + E   R RY+DLI N++S   F+   +I K IR+++D + YLEV+TPVL    GGA ARPFIT  N  +   YLRIATEL LK+LIVGGF+KVYE+G+ FRNEG D  HNPEF  +EVY AY +   +M L ENLF++VA  +     +     +I L   F+R+HMVD +K  TG+DFW+  S+++A +LA+++ +  E +   +GHIIN FFEE  +   I PTF+YGHP+++SPL+KK+ K+  FT RFEL+I+  EY NAF ELNDPIDQ +RFE+Q  E++ GN+EA  +D D++EA+EYG+PPT GLG+GIDRM ML T+ +SIRDV+LFP M+
  S:    13 LNDQMQVRRDKMNKLQEQGIAPFGHRFDRTDNSQSLIEKYDKYDKEELMEDKHYVAVAGRITGKRGSGKAGFIDLLDRTGVVQGYARQDELGEETYALY-KTLDLGDFIGAKGYVIKTNTGALTLRMTEFEFLSKSLRPLPDKYHGLTNPETIYRQRYLDLISNRESFDRFLKVTKIKKAIREYLDGEGYLEVDTPVLQTEAGGAEARPFITHSNAFDIPLYLRIATELYLKRLIVGGFEKVYELGKDFRNEGTDLRHNPEFNMVEVYTAYTDYTDVMDLVENLFRFVANKVNGSGKLTYQGKDIDLDSDFKRLHMVDAVKDVTGIDFWQPMSDEDAHKLAEENGIHCEPYWK-VGHIINAFFEEKVQDTLINPTFIYGHPLEISPLAKKNPKDGRFTDRFELYIDGNEYGNAFTELNDPIDQRQRFESQDAERAAGNEEAHGIDEDYVEAMEYGMPPTGGLGIGIDRMTMLLTDSTSIRDVMLFPTMR 499
>gi|167768163|ref|ZP_02440216.1| hypothetical protein CLOSS21_02719 [Clostridium sp. SS2/1] >gi|167709687|gb|EDS20266.1| hypothetical protein CLOSS21_02719 [Clostridium sp. SS2/1] (646 aa)
Score = 1079, Expect = 1.4e-115, Identities = 227/476 (47%), Positives = 329/476 (69%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RR+KL +LQ A ++P+EI K   T    +    F +L+        +L  + V  + +F  ++D  G  Q Y+ + ++     + F K +D+GDIV I G  F T+ GE ++  +++ ++SK+LKPLPEK+HGL D + R R RYVDLI+N++S +VF+ R +I+  IR ++D Q ++EVETP+L    GGA+ARPF T +N L  +  LRI+ EL LK+LIVGG +KVYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTENL++Y+A+ +     ++  + EI L + F RI MVD +K+ +GVDF E+K+ +EA+  A++H+V++E+     G I+NLFFEEF E K IQPTFV  HP+++SPL+K+  ++P + +RFE F+N  E ANA++ELNDPIDQ ERF+AQ +  + G++EA   D DF+ ALE G+PPT G+G GIDRM+ML T  ++IRDVLLFP MK
  S:    14 VRRQKLADLQAAGKNPFEIMKYDVTHHSKEIKDNFEELEGKEVAVAGRLMFKRVMGKASFCNVQDLQGGIQAYVARDEIGVESYQDFKK-MDIGDIVGIKGKVFATKTGEKSIHAEEVILLSKSLKPLPEKFHGLTDTDTRYRQRYVDLIMNEESKEVFIKRSKIISKIRSYLDGQGFMEVETPMLVSNAGGASARPFETHYNALSEDVKLRISLELYLKRLIVGGLEKVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYHGMMDLTENLYRYLAEEVCGGTKIQYKDFEIDLGKPFERITMVDAVKKYSGVDFKEIKTLEEARAAAEEHHVEYEERHKR-GDILNLFFEEFVEDKLIQPTFVMDHPVEISPLTKRKPEDPDYVERFEFFMNGWEMANAYSELNDPIDQRERFKAQEELLAQGDEEANTTDEDFLNALEIGMPPTGGIGFGIDRMVMLLTNSTAIRDVLLFPTMK 488
>gi|160944697|ref|ZP_02091924.1| hypothetical protein FAEPRAM212_02211 [Faecalibacterium prausnitzii M21/2] >gi|158443881|gb|EDP20885.1| hypothetical protein FAEPRAM212_02211 [Faecalibacterium prausnitzii M21/2] (503 aa)
Score = 1078, Expect = 2.1e-115, Identities = 225/481 (46%), Positives = 322/481 (66%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN-IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKE-KSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ++Q  +RR+KL +LQ A  DP+ + K  +     D   +F +L     +   + LAGR+++ R     +F  +RD  GD Q Y+ + ++       F K LD+GDI+ + G  FRT+ GEL++   ++ +++K+L+PLPEK+HGL D E+R R RYVDLI N +    F+ R RILK IR ++D + +LEV+TP+L P   GA+ARPF T HNTL  +  LRI TEL LK+LIVGG D+VYE+GRIFRNEGMD  HNPEFT++E+Y A+ +   MM L E L+K +A  +   +V   + +      + R+ MV+ +K+ +GVDF + +++ +A   AK HNV+  +   T G I+  FF+ F E K IQPTF+Y +P+++SPL+K+   +P FT+RFE FI+  EY NAF+ELNDPIDQ  RFE QV E K+L  +   ++D D++ ALEYGLPPT GLG G+DR++ML T+ +SIRDVLLFP MK
  S:    15 SEQVQVRRQKLADLQAAGNDPFTLTKFPQDAYSADLKEEFKELPNETDSGKLVALAGRMMSKRVMGKASFAHLRDDKGDIQLYVRRDELGDEAYAAFKK-LDVGDIIGVKGEVFRTKTGELSVRATELTLLAKSLRPLPEKFHGLTDTEMRYRQRYVDLIANPEVKDTFIKRSRILKEIRAYLDEKGFLEVDTPILTPFEIGASARPFYTHHNTLNMDMVLRIETELYLKRLIVGGMDRVYEVGRIFRNEGMDPKHNPEFTTIELYQAFTDFHGMMDLVEELYKRLALKICGSLVIPYQGKQIDMSHWERLTMVEAVKKYSGVDFNDWQTDADAIAAAKAHNVELPE-VPTKGAILAEFFDAFVEDKLIQPTFIYDYPVEISPLAKRKPDDPAFTERFEYFIDCTEYGNAFSELNDPIDQKGRFERQVAERKALEPECKAQVDYDYVNALEYGLPPTGGLGFGVDRLVMLLTDSASIRDVLLFPTMK 499
>gi|75909357|ref|YP_323653.1| lysyl-tRNA synthetase [Anabaena variabilis ATCC 29413] >gi|123731434|sp|Q3M8C8|SYK_ANAVT Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|75703082|gb|ABA22758.1| Lysyl-tRNA synthetase, class-2 [Anabaena variabilis ATCC 29413] (561 aa)
Score = 1078, Expect = 2.3e-115, Identities = 227/480 (47%), Positives = 321/480 (66%)
  Q:     7 DQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLE-------YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           D    R EK++ L++   +PY   +   T        KFA L +    +  + +AGR++A R+ FG      + D  G  Q YL K ++ +SM E       +  ++ D+GDI+   G+  RT+KGEL++ VK+  I++K+L PLP+KWHGL D   R R RYVDLIVN +  + F  R +I   IR++++ +++LE+ETPVL    GGA+ARPFIT+HNTLE   YLRIATEL LK+LIVGGF+KV+E+GR+FRNEG+ + HNPEFTS+E+Y AY +   MM LTE +   VA+ +     +   GE  + LT  +RR+ M D +K+ TG+DF   ++ +EA+  +K   +       T+G I+NL FEE  EA  IQPTFV  +P+++SPL+K     PG  +RFELFI  +E AN+F+EL DPIDQ ER EAQ  +K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+ +SIRDV+ FP +K
  S:     5 DIRAARLEKVEQLKQLGTNPYAY-RWESTHHAAQLQEKFADLTSGEEVDTEVAIAGRIMA-RRVFGKLAFFTLEDETGTIQLYLEKNRIQESMAETDADAFNHLKQLTDVGDILGAKGTIKRTEKGELSIYVKEYTILTKSLLPLPDKWHGLTDVAKRYRQRYVDLIVNPEVRQTFRRRAQITAGIRRYLEQRDFLEIETPVLQSETGGADARPFITYHNTLEMELYLRIATELHLKRLIVGGFEKVFELGRVFRNEGISTRHNPEFTSIEIYQAYADYNDMMALTEGIITTVAQDVLGTLQITYQGET-VDLTPPWRRVTMHDLVKEYTGLDFHSFQTLEEAKSASKNAGIPGVDEAQTIGKILNLAFEEKVEANLIQPTFVIDYPVEISPLAKPHRSQPGLVERFELFIVGRETANSFSELTDPIDQRERLEAQAAKKAAGDLEAQGVDEDFLTALEYGMPPTGGLGIGIDRLVMLLTDSASIRDVIAFPLLK 496
>gi|166030715|ref|ZP_02233544.1| hypothetical protein DORFOR_00389 [Dorea formicigenerans ATCC 27755] >gi|166029507|gb|EDR48264.1| hypothetical protein DORFOR_00389 [Dorea formicigenerans ATCC 27755] (647 aa)
Score = 1077, Expect = 2.4e-115, Identities = 231/485 (47%), Positives = 326/485 (67%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E   N    +RREKL +LQ   ++P+EI K   T    D    F +++      ++ +AGRV+  R     +F  I D  G+ Q Y+ +  + +   + F K LD+GDI+ I G  F+T+ GE+++    +K++SK+L+ LPEK+HGL + + R R RYVDLIVN +    F+ R RI+  +R+++D Q ++EVETP+L    GGA ARPF T  N L  +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTENL+++VA+ +     +V  G  E+ L + F RI MVD +K+  GVD+ EV++ ++A+ELAK+HN++FE+     G I+NLFFEE+ E   +QPTFV  HP+++SPL+KK  +NP + +RFE F+N  E ANA++ELNDPIDQ ERF AQ +  + G++EA   D DF+ ALE G+PPT G+G GIDRM ML T   +IRDVLLFP MK
  S:    10 EPDVNQLRKVRREKLADLQANGKNPFEITKYDVTCHATDIKENFEEME----GKHVSVAGRVMQKRVMGKASFCNILDLSGNIQSYVARDSIGEESYKDFKK-LDIGDIIGIEGEVFKTKTGEISIHASAVKLLSKSLQILPEKFHGLTNTDTRYRQRYVDLIVNPEVRDTFIKRSRIISAVRRYLDGQGFMEVETPMLVANAGGAAARPFETHFNALNEDLKLRISLELYLKRLIVGGLERVYEIGRVFRNEGLDTRHNPEFTLMELYQAYTDYNGMMDLTENLYRHVAQEVLGTTKIVYKGI-EMDLGEPFERITMVDAVKKYAGVDWNEVETLEQARELAKEHNLEFEERHKK-GDILNLFFEEYVEEHLLQPTFVMDHPVEISPLTKKKPENPNYVERFEFFMNGWEMANAYSELNDPIDQRERFAAQEEAFAAGDEEANHTDEDFLNALEIGMPPTGGIGFGIDRMCMLLTGAEAIRDVLLFPTMK 493
>gi|17231563|ref|NP_488111.1| lysyl-tRNA synthetase [Nostoc sp. PCC 7120] >gi|39932230|sp|Q8YPW9|SYK_ANASP Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|17133206|dbj|BAB75770.1| lysyl-tRNA synthetase [Nostoc sp. PCC 7120] (561 aa)
Score = 1077, Expect = 2.9e-115, Identities = 228/480 (47%), Positives = 319/480 (66%)
  Q:     7 DQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLE-------YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           D    R EK++ L++   +PY   +   T        KFA L +       + +AGR++A R+ FG      + D  G  Q YL K ++ +SM E       +  ++ D+GDI+   G+  RT+KGEL++ VK+  I++K+L PLP+KWHGL D   R R RYVDLIVN +  + F  R +I   IR++++ +++LE+ETPVL    GGA+ARPF+T+HNTLE   YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE +   VA+ +     +   GE  + LT  +RR+ M D +K+ TG+DF   ++ +EA+   K   +       T+G I+NL FEE  E K IQPTFV  +P+++SPL+K     PG  +RFELFI  +E AN+F+EL DPIDQ ER EAQ  +K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+ +SIRDV+ FP +K
  S:     5 DIRAARLEKVEQLKQLGTNPYAY-RWESTHHAAQLQEKFADLTSGEEVETEVAIAGRIMA-RRVFGKLAFFTLEDETGTIQLYLEKNRIQESMAEIDANAFNHLKQLTDVGDILGAKGTIKRTEKGELSVYVKEYTILTKSLLPLPDKWHGLTDVAKRYRQRYVDLIVNPEVRQTFRRRAQITAGIRRYLEQRDFLEIETPVLQSEAGGADARPFVTYHNTLEMELYLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTSIEVYQAYADYNDMMALTEGIITTVAQDVLGTLQITYQGET-VDLTPPWRRVTMHDLVKEYTGLDFHSFQTLEEAKSAGKNAGIPGVDEAQTIGKILNLAFEEKVETKLIQPTFVIDYPVEISPLAKPHRSQPGLVERFELFIVGRETANSFSELTDPIDQRERLEAQAAKKAAGDLEAQGVDEDFLTALEYGMPPTGGLGIGIDRLVMLLTDSASIRDVIAFPLLK 496
>gi|71893559|ref|YP_279005.1| lysyl-tRNA synthetase [Mycoplasma hyopneumoniae J] (489 aa)
Score = 1072, Expect = 1.1e-114, Identities = 234/489 (47%), Positives = 325/489 (66%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK--SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  K NDQ+  RR+KLKNL +   + P    +    + I +  S+ +K         I  AGR++  R  F +I       Q Y++K+   K+   + N  LDLGDI+E+ G  F+TQ G+L++ V    +++K+L PLP++++G+E+ + + R RY+DL+VN +S K F  R +I+ +IR F DSQ +LEV+TPVL P+LGGA+A+PFIT++N+L +NFYLRIATELPLKKL+V GFD+VYEIG+IFRNEG DSTHNPEFTS+E Y AY N+E +M  TENLF+++ +  +L          +I   +KF R  M++   +    D  +  +  +  E AKK  VK E      GH+IN FFE+F E   I PTF+ GHPI++SPL+K +  NP FT R ELFI  KE+AN F ELNDPIDQ  RF+AQ+ EK+ GN EA E+D +F++ALEYG+PP  G G+GIDR+ ML T+  SIR+V+LFP +K KK
  S:     1 MMSKLNDQQQFRRDKLKNLVKNGFNFPSSTFEHDNLVEINEKFSQKSKEFFLENQVKIAFAGRLIRQRGPFFIIFSQNLQFQAYISKEFQKKNEFIFAN--LDLGDIIEVSGYLFKTQTGQLSIKVNNFSLLTKSLHPLPDQYYGIENPDEKYRKRYLDLLVNSESAKTFRLRSKIISLIRTFFDSQGFLEVDTPVLQPVLGGASAKPFITYYNSLSQNFYLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKIMDQTENLFRFLFEKLNLDPANFDFSNKKINFLEKFARYDMIEITSKLMNFDL-KSANFADLVEKAKKEGVKIEPFFKK-GHLINKFFEKFVEPTLINPTFIIGHPIEISPLAKSNPNNPNFTLRAELFICGKEFANMFDELNDPIDQLSRFQAQIIEKNQGNQEASEIDNEFVQALEYGMPPAGGCGIGIDRLTMLLTKNESIREVILFPQLKPKK 488
>gi|160939908|ref|ZP_02087255.1| hypothetical protein CLOBOL_04799 [Clostridium bolteae ATCC BAA-613] >gi|158437342|gb|EDP15107.1| hypothetical protein CLOBOL_04799 [Clostridium bolteae ATCC BAA-613] (654 aa)
Score = 1070, Expect = 1.9e-114, Identities = 218/475 (45%), Positives = 315/475 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFE-KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR+KL  LQ A +DP++I K   T    D    + + +        ++  + V  + +F  ++D  G  Q Y+ +  V +   + F K +D+GDIV + G+ F T+ GE+++   ++ ++SK+L+ LPEK+HGL D ++R R RYVDLI+N +    F+ R RIL  IR+++  + ++EVETP+L    GGA ARPF T  N L+ +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTE L+++VA+  L    +     E+ L + F RI MVD +K+  GVDF ++ + +EA+ +AK+  V+FE +H+   G I+NLFFEEF E   +QPTFV  HP+++SPL+KK   NP + +RFE F+N  E ANA++E+NDPIDQ ERF AQ +  + G++EA   D DF+ ALE G+PPT G+G GIDRM+ML T+  +IRDVLLFP MK
  S:    21 RRDKLAELQTAGKDPFQITKYDVTAHSMDIKDSYEQWEGKEAAIAGRMMFKRVMGKASFCNVQDLKGSIQVYVARDSVGEESYKDFKK-MDIGDIVGVKGTAFTTKTGEISIHATEVTLLSKSLQVLPEKFHGLTDTDMRYRQRYVDLIMNAEVKDTFIKRSRILAAIRKYLGGEGFMEVETPMLVSNAGGAAARPFETHFNALDEDLKLRISLELYLKRLIVGGLERVYEIGRVFRNEGLDTRHNPEFTLMELYQAYTDYNGMMDLTEKLYRFVAQEVLGTTTITYKGVEMDLGKPFARITMVDAVKKYAGVDFDQIHTLEEARAVAKEKGVEFEGRHKK--GDILNLFFEEFAEEHLVQPTFVLDHPVEISPLTKKKPGNPDYVERFEFFMNGWEMANAYSEINDPIDQRERFRAQEELLAQGDEEANHTDEDFLNALEVGMPPTGGIGFGIDRMVMLLTDSPAIRDVLLFPTMK 494
>gi|166229888|sp|Q4AAC7|SYK_MYCHJ Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|144227509|gb|AAZ44294.2| lysyl-tRNA synthetase [Mycoplasma hyopneumoniae J] (491 aa)
Score = 1068, Expect = 2.8e-114, Identities = 233/486 (47%), Positives = 324/486 (66%)
  Q:     4 KFNDQELIRREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK--SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           K NDQ+  RR+KLKNL +   + P    +    + I +  S+ +K         I  AGR++  R  F +I       Q Y++K+   K+   + N  LDLGDI+E+ G  F+TQ G+L++ V    +++K+L PLP++++G+E+ + + R RY+DL+VN +S K F  R +I+ +IR F DSQ +LEV+TPVL P+LGGA+A+PFIT++N+L +NFYLRIATELPLKKL+V GFD+VYEIG+IFRNEG DSTHNPEFTS+E Y AY N+E +M  TENLF+++ +  +L          +I   +KF R  M++   +    D  +  +  +  E AKK  VK E      GH+IN FFE+F E   I PTF+ GHPI++SPL+K +  NP FT R ELFI  KE+AN F ELNDPIDQ  RF+AQ+ EK+ GN EA E+D +F++ALEYG+PP  G G+GIDR+ ML T+  SIR+V+LFP +K KK
  S:     6 KLNDQQQFRRDKLKNLVKNGFNFPSSTFEHDNLVEINEKFSQKSKEFFLENQVKIAFAGRLIRQRGPFFIIFSQNLQFQAYISKEFQKKNEFIFAN--LDLGDIIEVSGYLFKTQTGQLSIKVNNFSLLTKSLHPLPDQYYGIENPDEKYRKRYLDLLVNSESAKTFRLRSKIISLIRTFFDSQGFLEVDTPVLQPVLGGASAKPFITYYNSLSQNFYLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKIMDQTENLFRFLFEKLNLDPANFDFSNKKINFLEKFARYDMIEITSKLMNFDL-KSANFADLVEKAKKEGVKIEPFFKK-GHLINKFFEKFVEPTLINPTFIIGHPIEISPLAKSNPNNPNFTLRAELFICGKEFANMFDELNDPIDQLSRFQAQIIEKNQGNQEASEIDNEFVQALEYGMPPAGGCGIGIDRLTMLLTKNESIREVILFPQLKPKK 490
>gi|154499801|ref|ZP_02037839.1| hypothetical protein BACCAP_03458 [Bacteroides capillosus ATCC 29799] >gi|150271399|gb|EDM98656.1| hypothetical protein BACCAP_03458 [Bacteroides capillosus ATCC 29799] (500 aa)
Score = 1066, Expect = 5.4e-114, Identities = 222/485 (45%), Positives = 321/485 (66%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKF-EKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  ++   IRR+KLK LQ+A  DP++  K S T    +    F  ++       + +AGR+++ R      F  ++D  G  Q Y+   ++ +     F KV D+GDIV + G  FRT++GE+++   K+ ++SK+L+PLPEK+HGL D+E R R RYVDL+VN +  + FV R R ++ +R ++D+  Y+EVETPVL+ I GGA ARPFIT HNTL+ + Y+RIATELPLK+LIVGG D+VYEIGRIFRNEGMD  HNPEFT++E+Y AY +   MM + E +    A+S L    V+    ++ L   +RR+ MVD +K+  GVDF  +  + EA   AK   V+  E    T G+ +   F++  E + IQPTF+  +P++VSPL+K+  ++P  T+RFELF+   E ANA++ELNDPIDQ  RFE Q++ +  G++E   +D DF+ ALEYG+PPT G+G+GIDR +M+ T   +IRDV+LFP MK
  S:    12 EQSLSELLQIRRDKLKELQDAGMDPFQQTKYSVTAHSQEIKDNFETME----GQTVSVAGRLMSKRGMGKAVFCDLQDAQGRIQLYVRIDELGEEPFARFKKV-DIGDIVGVEGEAFRTKRGEISVKANKVTLLSKSLRPLPEKFHGLTDKETRYRQRYVDLMVNPEVKRNFVVRSRFIQFMRSYLDNMGYIEVETPVLNTIAGGAAARPFITHHNTLDIDMYMRIATELPLKRLIVGGMDRVYEIGRIFRNEGMDPKHNPEFTTVELYQAYTDFHGMMDIAEGILSGAAQSILGTYEVEWQGEKLNLAPGWRRLTMVDAVKEYAGVDFGAITDDAEAVAAAKAIGVELAETADKTWGNALYACFDQKVEEQLIQPTFITMYPVEVSPLTKRSPQDPRLTERFELFVCHSELANAYSELNDPIDQRSRFEKQLELRERGDEETEMLDEDFLTALEYGMPPTGGMGMGIDRCVMMLTNADTIRDVILFPTMK 497
>gi|188584759|ref|YP_001916304.1| lysyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349446|gb|ACB83716.1| lysyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] (489 aa)
Score = 1063, Expect = 1.1e-113, Identities = 230/483 (47%), Positives = 327/483 (67%)
  Q:     7 DQELI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           D ELI  R EK ++++  N  P+  +K S T    +    + +L    T   + L+GR++A R      F  I+D  G  Q Y     V +   E + K LD+GDI+ + G  F T+KGE+T++VK+  + SK+L+PLPEKWHGL+D +LR R RY+DLI+N+D    FV R +I++ +R+++D + + E+ETP LH I GGANARPF T+HN LE   Y+RIATEL LK+LIVGGFDKVYE+GRIFRNEG+ + HNPEFTS+E+Y +  +   MM LTEN+   +A K    PVV+     I  T  + R  M+D +K+ TG+DF E+ ++++A+E A++  ++ EK  +T G  +N  FEE  E   +QPTF+  +P++VSPL+K+  ++   T RFE F+   E ANAF ELNDP DQ ERFE+QV+++  G++EA  MD DF+EALEYG+PPT GLG+GIDR++M  T  +SIRDV+LFP M+ K+
  S:     4 DHELINVRYEKARDMENRNIQPFG-DKYSATYYAQEVKDNYEQLL--ETKEEVSLSGRIMAKRGHGKAGFAHIQDSSGQVQIYTRVDNVGEEDYELY-KELDIGDIIALKGPVFMTRKGEITVEVKEFHLQSKSLRPLPEKWHGLKDVDLRYRKRYLDLIMNQDVKDTFVIRSKIIREMRRYLDDRGFFEMETPTLHTIPGGANARPFKTYHNALEMKLYMRIATELHLKRLIVGGFDKVYELGRIFRNEGISTKHNPEFTSIELYQSNSDYHDMMELTENMIYEIANKIFGTPVVEYQGTNIDFTPPWPRKTMIDAVKEATGIDFSEL-NHEKAREKAEQAGIEVEK-DATWGEALNEIFEEKVEDSLVQPTFILDYPVEVSPLAKRHEEDSRLTYRFEGFLWGSEIANAFTELNDPRDQRERFESQVEKRDAGDEEAHMMDEDFVEALEYGMPPTGGLGIGIDRLVMFMTNSTSIRDVILFPTMRPKQ 487
>gi|56751700|ref|YP_172401.1| lysyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81301224|ref|YP_401432.1| lysyl-tRNA synthetase [Synechococcus elongatus PCC 7942] >gi|81561805|sp|Q5N1D9|SYK_SYNP6 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|123769185|sp|Q31KH4|SYK_SYNP7 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|56686659|dbj|BAD79881.1| lysyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81170105|gb|ABB58445.1| lysyl-tRNA synthetase [Synechococcus elongatus PCC 7942] (504 aa)
Score = 1063, Expect = 1.2e-113, Identities = 221/481 (45%), Positives = 312/481 (64%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSM-------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +D    R EK   L+E   +PY   +   + +     + +A L         + +AGR++A R+ FG      ++D  G  Q YL K+++S+SM         +   + D+GDI+ + GS  RT+KGEL++ V +  I++K+L+PLP+KWHGL D E R R RYVDLIVN +  + F  R +I   IR+ ++ Q ++E+ETPVL    GGA ARPFIT+HNTLE + YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY + E MMRLTE L   VA+ +   + V      I L   ++R  M + +   TG+DF  +K  +      K   +   +    LG ++N  FEE  EA  IQPTFV  +P+++SPL+K     PG  +RFELFI  +E AN+F+EL DP+DQ +R EAQ  +K+ GN EA ++D DF+ ALE+G+PPT GLG+GIDR++ML T+  SIRDV+ FP ++
  S:     2 SDLRATRLEKALQLRELGFEPYAY-RWDCSHSAAQLQALYADLPAGEEVAVEVAIAGRIMA-RRVFGKLAFFTLQDESGQIQLYLEKQRLSESMAAIDAEAFSHLKALTDVGDILGVKGSVRRTEKGELSIAVDQYAILTKSLQPLPDKWHGLTDVEKRYRQRYVDLIVNPEVRETFRRRAKITAAIRRHLEDQGFIEIETPVLQAEAGGAEARPFITYHNTLELDLYLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTSIEVYQAYADYEDMMRLTETLIAQVAEQVVGSLQVPYQGQTIDLAPPWKRATMAELVLAATGIDFESLKDLEAGIAAVKAAGIPVPEDCPNLGKLLNHCFEEKVEATLIQPTFVIDYPVEISPLAKPHRSKPGLVERFELFIVGRETANSFSELTDPVDQRQRLEAQAADKAAGNVEANDVDEDFLLALEHGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLR 494
>gi|22297756|ref|NP_681003.1| lysyl-tRNA synthetase [Thermosynechococcus elongatus BP-1] >gi|34222748|sp|Q8DMA9|SYK_SYNEL Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|22293933|dbj|BAC07765.1| lysyl-tRNA synthetase [Thermosynechococcus elongatus BP-1] (506 aa)
Score = 1062, Expect = 1.4e-113, Identities = 224/475 (47%), Positives = 308/475 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEY----FNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKY----VAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK K LQ     PY   +  RT T      K+A L       + + +AGR++A R+ FG      ++D  G  Q YL+K+ +S++M E        + D+GDI+   G+  RT+KGEL++ V+   +++K+L PLP+KWHGL D E R R RYVDLIVN      F  R  I   IR++++ Q ++E+ETPVL    GGA ARPFIT+HNTLE   YLRIATEL LK+LIVGGF+KVYE+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE +       V  +LK  +   GE  I LT  +RR+ M D +   TG+DF ++     A+  A+K  VK      T+G ++N  FE+  E   IQPTFV  +P+++SPL+K     PG  +RFELFI  +E+AN+F+EL DP+DQ +R E Q + K+ G+  A  +D DF+ ALE+G+PPT GLG+GIDR++ML T+  SIRDV+ FP ++
  S:    15 RIEKAKTLQAQGMSPYAY-RWERTHTAALLQDKYAHLAAGEAVGDRVSVAGRIMA-RRIFGKLAFFTLQDDSGTIQLYLDKQTISQTMGEAAFADLKHLTDVGDILGAVGTLKRTEKGELSVVVESYTMLTKSLLPLPDKWHGLTDVEKRYRQRYVDLIVNPQVRDTFRKRALITAAIRRYLNEQGFIEIETPVLQVEAGGAEARPFITYHNTLEMQLYLRIATELHLKRLIVGGFEKVYELGRIFRNEGISTKHNPEFTSIEVYQAYADYNDMMTLTEAIITTGAMEVLGTLK--ITYQGET-IDLTPPWRRVTMHDAVLAATGIDFRQLGDLTAAKIAAQKVGVKDLDTCDTIGRVLNEVFEQIVEPTLIQPTFVLDYPVEISPLAKPHRSQPGLVERFELFIVGREHANSFSELTDPLDQRQRLEEQARRKAAGDLAAHSVDEDFLTALEHGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLR 498
>gi|196238502|ref|ZP_03137277.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 7425] >gi|196217345|gb|EDY11989.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 7425] (509 aa)
Score = 1062, Expect = 1.6e-113, Identities = 219/485 (45%), Positives = 320/485 (65%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSM----LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
             D    R +K+  L++A  +PY   +   +    +   +FA L +       + LAGR++A R      F  ++D  G  Q YL K++++  M     +  +K++D GDIV + G+  RT+KGEL++ V +  I++K+L PLP+KWHGL D E R R RYVDLIVN +  + F  R  I   IR+++D Q+++E+ETPVL    GGA ARPFIT+HNTLE   YLRIATEL LK+LIVGGF+KV+E+GR+FRNEG+ + HNPEFT++E+Y AY + + MM LTENL    A++ L    +     EI LT  ++RI M + ++Q+TG+DF +  +  EA+  A +  +   +   ++G ++N  FE+  EA  +QPTFV  +P+++SPL+K     PG  +RFELFI  +E AN+F+EL DPIDQ +R E Q + K+ G+ EA  +D DF+ ALE+G+PPT GLG+GIDR++ML T  +SIRDV+ FP +K +K
  S:    16 LEDIRATRLDKVDKLKQAGCNPYAY-RWEVSHHAAELQRQFADLPSGAEVELEVGLAGRIMARRFMGKLAFATLQDETGTIQLYLEKQRLADHMDAEAFKRLDKLMDTGDIVGVRGTVKRTEKGELSIAVSEYAILTKSLLPLPDKWHGLTDVEKRYRQRYVDLIVNPEVRETFRRRALITAAIRRYLDQQDFIEIETPVLQLEAGGAEARPFITYHNTLEMQMYLRIATELHLKRLIVGGFEKVFELGRVFRNEGISTRHNPEFTTIEIYQAYADYQDMMALTENLIVTAAETVLGTLKIDYQGTEIDLTPPWQRITMWEVVQQKTGLDFSQFTTLDEAKAAADQAGIVDLEKCDSIGKVLNEAFEQKVEATLMQPTFVLDYPVEISPLAKPHRSQPGLVERFELFIVGRETANSFSELTDPIDQRQRLELQAERKAAGDLEAHSVDEDFLTALEHGMPPTGGLGIGIDRLVMLLTNAASIRDVIAFPVLKAEK 509
>gi|177668067|ref|ZP_02943425.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 8801] >gi|172073281|gb|EDT58710.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 8801] (573 aa)
Score = 1062, Expect = 1.7e-113, Identities = 227/477 (47%), Positives = 316/477 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEY---FN---KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           R EK++ LQ+    PY   K   T T  +   K+A LK     +  + +AGR++A R+ FG      ++D  G  Q YL+K+++  SM E    FN   K+ D GDI+ + G+  RT+KGEL++ V+   I++K+L PLP+KWHGL D E R R RYVDLIVN    + F  R +I   IR+++D   ++E+ETPVL    GGA ARPFIT+HNTL+   YLRIATEL LK+LI+GGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE L    A++ L    +   E EI L+  +RR+ M D +K++TG+DF      + A+E AKK  +       +LG ++N  FE+  E   IQPTF+   P+++SPL+K      G  +RFEL+I  +E AN+F+EL DPIDQ ER E Q ++K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+  SIRDV+ FP +K +
  S:    23 RLEKVEQLQQLGLVPYAY-KWESTHTAANLQDKYATLKDGEEVDLEVAIAGRIIA-RRVFGKLAFFSLQDETGTIQLYLDKQQIDTSMTEVTDAFNTLKKLTDTGDILGVVGTIKRTEKGELSVKVQTYTILTKSLLPLPDKWHGLTDTEKRYRQRYVDLIVNPQVRQTFRRRAQITASIRRYLDENGFIEIETPVLQSEAGGAEARPFITYHNTLDMELYLRIATELHLKRLIIGGFEKVFELGRIFRNEGVSTKHNPEFTSIEVYQAYADYFDMMELTEALITNAAQTVLGTLKLTYQETEIDLSTPWRRVTMTDIVKEKTGLDFDSFTDFESAKEAAKKAGIDVPDDCPSLGKLMNEAFEQKVEETLIQPTFILDFPVEISPLAKPHRSKKGLVERFELYIVGRELANSFSELTDPIDQRERLEKQAEQKAAGDLEAQGVDEDFLTALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLKSQ 510
>gi|196176679|gb|EDX71691.1| lysyl-tRNA synthetase [Microcoleus chthonoplastes PCC 7420] (516 aa)
Score = 1061, Expect = 1.8e-113, Identities = 224/475 (47%), Positives = 316/475 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFGVI-----RDFYGDTQFYLNKKKVSKSMLEYFN------KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK++ L+    +PY     S T    +   KFA L      +  + +AGR++A R+ FG +     +D  G  Q YL+KK+++ +M +  N      ++ D+GDI+ + G+  RT KGEL++ V +  I++K+L PLP+KWHGL D E R R RYVDL+VN    + F  R +I   IR++++ + ++E+ETPV     GGA ARPFIT+HNTLE   YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTENL   V + SL    +      I  T  +RR+ M + +++ TG+DF + K+  EA+  AKK  ++  +   +LG ++N  FE+ CE   IQPTF+   PI++SPL+K     PG  +RFELF+  +E AN+F+EL DPIDQ ER EAQ   K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+ +SIRDV+ FP +K
  S:    21 RLEKVQQLKALGIEPYAYHWQS-THQAAELQEKFADLGNGEEVDFEVAIAGRILA-RRVFGKLAFFNLQDETGTIQLYLDKKRITATMTDLPNPFTPLKQLTDIGDILGVKGTIKRTDKGELSVYVSEYAILTKSLLPLPDKWHGLTDTEKRYRQRYVDLMVNPTVRETFRRRAKITAAIRRYLEDRGFIEIETPVFSTEAGGAEARPFITYHNTLEMELYLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTSIEVYQAYADYNDMMTLTENLITTVTQESLTTLEITYQGETIDFTPPWRRVTMHELVQEVTGLDFNQFKTFDEAKIAAKKVGIEGVEDCPSLGKLLNECFEQKCEETLIQPTFIVDFPIEISPLAKPHRSKPGLVERFELFMAGRETANSFSELTDPIDQRERLEAQAARKAAGDLEAQGVDEDFLAALEYGMPPTGGLGIGIDRLVMLLTDSASIRDVIAFPLLK 506
>gi|54020381|ref|YP_115687.1| lysyl-tRNA synthetase [Mycoplasma hyopneumoniae 232] >gi|53987554|gb|AAV27755.1| lysine--tRNA ligase [Mycoplasma hyopneumoniae 232] (556 aa)
Score = 1060, Expect = 2.2e-113, Identities = 233/486 (47%), Positives = 324/486 (66%)
  Q:     4 KFNDQELIRREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK--SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           K NDQ+  RR+KLKNL +   + P    +    + I +  S+ +K         I  AGR++  R  F +I       Q Y++K+   K+   + N  LDLGDI+E+ G  F+TQ G+L++ V    +++K+L PLP++++G+E+ + + R RY+DL+VN +S K F  R +I+ +IR F DSQ +LEV+TPVL P+LGGA+A+PFIT++N+L +NFYLRIATELPLKKL+V GFD+VYEIG+IFRNEG DSTHNPEFTS+E Y AY N+E +M  TENLF+++ +  +L          +I   +KF R  M++   +    D  +  +  +  E AKK  VK E      GH+IN FFE+F E   I PTF+ GHPI++SPL+K +  NP FT R ELFI  KE+AN F ELNDPIDQ  RF+AQ+ EK+ GN EA E+D +F++ALEYG+PP  G G+GIDR+ ML T+  SIR+V+LFP +K KK
  S:    71 KLNDQQQFRRDKLKNLVKNGFNFPSSTFEHDNLVEINEKFSQKSKQFFLENQVKIAFAGRLIRQRGPFFIIFSQNLQFQAYISKEFQKKNEFIFAN--LDLGDIIEVSGYLFKTQTGQLSIKVNNFSLLTKSLHPLPDQYYGIENPDEKYRKRYLDLLVNSESAKTFRLRSKIISLIRTFFDSQGFLEVDTPVLQPVLGGASAKPFITYYNSLSQNFYLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKIMDQTENLFRFLFEKLNLDPANFDFSNKKINFLEKFARYDMIEITSKLMNFDL-KSANFADLVEKAKKEGVKIEPFFKK-GHLINKFFEKFVEPTLINPTFIIGHPIEISPLAKSNPNNPNFTLRAELFICGKEFANMFDELNDPIDQLSRFQAQIIEKNQGNQEASEIDNEFVQALEYGMPPAGGCGIGIDRLTMLLTKNESIREVILFPQLKPKK 555
>gi|160932786|ref|ZP_02080175.1| hypothetical protein CLOLEP_01627 [Clostridium leptum DSM 753] >gi|156867860|gb|EDO61232.1| hypothetical protein CLOLEP_01627 [Clostridium leptum DSM 753] (503 aa)
Score = 1060, Expect = 2.5e-113, Identities = 232/476 (48%), Positives = 322/476 (67%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQE-AQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           IRR+KL  LQEA QDP+EI      +   D   +F +L+    N ++ +AGR+++ R     +F  I D  G  Q YL    + + +    +K  D+GDI  + G  FRT++GE+++  K+++++SK+L PLP+K+HGL + +LR R RYVDLIVN +    F+ R +I+K IR+ +D+ +++EVETP+L+ I GGA ARPFIT HNTL+ + YLRIA EL LK+LIVGG ++VYEIGR+FRNEGMD  HNPEFT++E+Y AY +   MM LTENL    A K      +  G   + L   F+R+ M+D +K+ TG+DF   + + E A+E AK+  ++  K   T G+I+NL FEE  E   IQPTFV  +PI+VSPL+KK    P   +RFELFI  +E+ANA++ELNDPIDQ ERF  Q   +  G+DEA  +D DF+ ALEYG+ PT G+G+GIDR+ ML T+ +SIRDVLLFP MK
  S:    25 IRRDKLSALQEAGQDPFEITVCHPDIHAADIIERFEELE----NQDVCVAGRIMSWRDMGKASFIDIHDRTGRIQVYLRINDLGEEVYRGLDK-WDIGDIASVKGFVFRTRRGEISIHAKEVRLLSKSLLPLPDKFHGLTNTDLRYRQRYVDLIVNPEVKDTFIKRSQIIKSIREDLDNLDFIEVETPILNTIPGGAAARPFITHHNTLDIDLYLRIAPELYLKRLIVGGMERVYEIGRLFRNEGMDVKHNPEFTTIELYQAYTDYNGMMELTENLIHSAAIKVCGTEEISYGGQPVSLALPFKRVTMIDAVKEATGIDFGAFRGDTEKAREAAKELRLEI-KESDTWGNILNLAFEEKVEDTLIQPTFVCDYPIEVSPLTKKKKGMPELVERFELFITGREFANAYSELNDPIDQRERFLRQAALREAGDDEANMLDEDFLTALEYGMAPTGGMGMGIDRLAMLLTDSASIRDVLLFPTMK 500
>gi|51891663|ref|YP_074354.1| lysyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] >gi|51855352|dbj|BAD39510.1| lysyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] (495 aa)
Score = 1059, Expect = 3.7e-113, Identities = 217/477 (45%), Positives = 315/477 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVK-----FEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           RR K++ L+EA  DP+      R + +GD   ++ +      +      ++AGRVV +R      F  ++D  G  Q YL   ++S+     +   LDLGDIV   G   RT+ GELT+ V+ + +++KAL+PLP+K  GL D ELR R R++DL+VN +S  VF  R RI+  +R+ +D   ++EVETPVL P+ GGA ARPF+T+HN L+R   LRIATEL LK+L+VGG ++VYEIGR+FRNEG+ + HNPEFTS+E Y AY +   MM LTE L +  A+++      +   EI LT  FRRI M + +K+ TG+D   + S+ + +  A+          +E   +T G ++   FE + E + +QPTFV GHP++ SPL+++D ++P  T+RFEL++  +E ANAF+ELNDP DQ  RFEAQ+ ++  G++EA  MD DF+ ALE GLPPT GLG+G+DR++ML T   SIRDV+LFP M+++
  S:    12 RRAKMRTLREAGVDPFGTRFGDRRL-MGDLRRQYGEASAEELDAARIPARVAGRVVTVRSHGKIGFAHLQDGSGRLQIYLRLPELSERERLVWEH-LDLGDIVGAEGVLMRTRTGELTVKVESLTMLTKALRPLPDKHAGLRDVELRYRERHLDLLVNPESRAVFEARSRIVASLRRTLDELGFIEVETPVLVPLAGGAAARPFLTYHNALDRQLSLRIATELHLKRLVVGGMERVYEIGRVFRNEGLSTRHNPEFTSLEAYQAYADYRDMMDLTERLVQNAARAVNG---SLRAGEIDLTGPFRRITMAEAVKEATGIDVMALGSSGDERRDAEAVRAAAEAAGYEVEAATWGGLLAELFERYAEDRLVQPTFVLGHPVETSPLARRDPRDPRLTERFELYVQGREIANAFSELNDPEDQRRRFEAQLAQRQAGDEEAHPMDEDFLAALEVGLPPTGGLGIGVDRLVMLLTGAPSIRDVILFPTMRNR 495
>gi|186685281|ref|YP_001868477.1| lysyl-tRNA synthetase [Nostoc punctiforme PCC 73102] >gi|186467733|gb|ACC83534.1| lysyl-tRNA synthetase [Nostoc punctiforme PCC 73102] (561 aa)
Score = 1056, Expect = 6.5e-113, Identities = 223/480 (46%), Positives = 320/480 (66%)
  Q:     7 DQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSM-------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           D    R EK++ L++   +PY   +   T        +FA L +    +  + +AGR++A R+ FG      ++D  G  Q YL+K ++ +SM         +  ++ D GDI+ + G+  RT+KGEL++ VK+  I++K+L PLP+KWHGL D   R R RYVDLIVN +  + F  R +I   IR++++ +++LE+ETPVL    GGA+ARPFIT HNTLE   YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFT++EVY AY +   MM LTE +   VA+ +   +    + E I LT  +RR+ M D +K+ TG+DF   ++ +EA+  +K   +       ++G ++NL FEE  EA  IQPTFV  +P+++SPL+K     PG  +RFELFI  +E  N+F+EL DPIDQ ER EAQ + K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+ +SIRDV+ FP +K
  S:     5 DIRAARLEKVEQLKQLGTNPYAY-RWESTHHAAQLQEQFADLASGEEVDLEVAIAGRIMA-RRVFGKLAFFTLQDETGTIQLYLDKNRIQESMADIDADAFNHLKQLTDAGDILGVKGTIKRTEKGELSVYVKQYTILTKSLLPLPDKWHGLTDVAKRYRQRYVDLIVNPEVRQTFRRRAQITAGIRRYLEQRDFLEIETPVLQSEAGGADARPFITHHNTLEMELYLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTTIEVYQAYADYNDMMALTEGIITTVAQEVLGTLQITYQGEPIDLTPPWRRVTMHDLVKEFTGLDFNSFQTLEEAKTASKNAGIPGVDEAKSIGKLLNLAFEEKVEANLIQPTFVIDYPVEISPLAKPHRSQPGLVERFELFIVGRETGNSFSELTDPIDQRERLEAQAERKAAGDLEAQGVDEDFLTALEYGMPPTGGLGIGIDRLVMLLTDSASIRDVIAFPLLK 496
>gi|167752417|ref|ZP_02424544.1| hypothetical protein ALIPUT_00661 [Alistipes putredinis DSM 17216] >gi|167660658|gb|EDS04788.1| hypothetical protein ALIPUT_00661 [Alistipes putredinis DSM 17216] (574 aa)
Score = 1053, Expect = 1.4e-112, Identities = 221/489 (45%), Positives = 317/489 (64%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKS-----MLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M  + ++QE +RR+ L  L+E   DPY   +   T T  +    F   K  N    I++AGR+++ R     +F  ++D  G  Q Y+ +  +            F K+LD+GDIV + G  FRT  GEL++  +K+ ++SK+L+PLP       + +    D E+R R RYVDLIVN    +VF+ R +I+  +R++ +   Y+EVETP+L PI GGA ARPFIT HN L+ + YLRIA+EL LKKLIVGGFD VYE G+ FRNEGMD THNPEFT ME+Y AY++  +MM  TE + + VA +L     V++   EI     FRR+ M D I+++TG D    +S ++ +E  K+  V+ +      G +I+  F ++CE + IQPTF+  +P ++SPL K+   NP  T+RFELF+N KE  NA++ELNDPIDQ ERF+ Q++    G+DEA+ +DMDF+ ALEYG+P  +G+G+GIDR+ M  T  SSI+DVL FP M+ +K
  S:     1 MSIELSEQEQLRRQSLAALRELGIDPYPAARYEVTATAREIAENFDPAK--NNFQGIRIAGRIMSRRIMGSASFFELQDHTGRIQVYIRRDDICPEGDPTLYNTVFKKLLDIGDIVGVEGFAFRTNTGELSVHCQKLTLLSKSLRPLPVVKEKDGQTFDAFTDPEIRYRQRYVDLIVNPHVREVFIKRSKIISTMREYFNQFGYVEVETPILQPIPGGAAARPFITHHNALDIDQYLRIASELYLKKLIVGGFDGVYEFGKNFRNEGMDRTHNPEFTVMEIYVAYKDYLWMMEFTERMLEKVALALHGTTTVQIDGREISFKAPFRRLTMTDAIREKTGYDI-TGQSEEQLREACKRLEVEIDDTMGK-GKLIDAIFGQYCEEELIQPTFIMDYPCEMSPLCKRHRSNPDLTERFELFVNGKELCNAYSELNDPIDQLERFQEQLRLSEKGDDEAMFIDMDFVRALEYGMPTCSGMGIGIDRLTMFMTGNSSIQDVLFFPQMRPEK 502
>gi|196243484|ref|ZP_03142213.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 8802] >gi|196208401|gb|EDY03191.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 8802] (573 aa)
Score = 1052, Expect = 2.2e-112, Identities = 226/477 (47%), Positives = 315/477 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEY---FN---KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           R EK++ LQ+    PY   K   T T  +   K+A LK     +  + +AGR++A R+ FG      ++D     Q YL+K+++  SM E    FN   K+ D GDI+ + G+  RT+KGEL++ V+   I++K+L PLP+KWHGL D E R R RYVDLIVN    + F  R +I   IR+++D   ++E+ETPVL    GGA ARPFIT+HNTL+   YLRIATEL LK+LI+GGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE L    A++ L    +   E EI L+  +RR+ M D +K++TG+DF      + A+E AKK  +       +LG ++N  FE+  E   IQPTF+   P+++SPL+K      G  +RFEL+I  +E AN+F+EL DPIDQ ER E Q ++K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+  SIRDV+ FP +K +
  S:    23 RLEKVEQLQQLGLVPYAY-KWESTHTAANLQDKYATLKDGEEVDLEVAIAGRIIA-RRVFGKLAFFSLQDETATIQLYLDKQQIDTSMTEVTDAFNTLKKLTDTGDILGVVGTIKRTEKGELSVKVQTYTILTKSLLPLPDKWHGLTDTEKRYRQRYVDLIVNPQVRQTFRRRAQITASIRRYLDENGFIEIETPVLQSEAGGAEARPFITYHNTLDMELYLRIATELHLKRLIIGGFEKVFELGRIFRNEGVSTKHNPEFTSIEVYQAYADYFDMMELTEALITNAAQAVLGTLKLTYQEIEIDLSTPWRRVTMTDIVKEKTGLDFDSFTDFESAKEAAKKAGIDVPNDCPSLGKLMNEAFEQKVEETLIQPTFILDFPVEISPLAKPHRSKKGLVERFELYIVGRELANSFSELTDPIDQRERLEKQAEQKASGDLEAQGVDEDFLTALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLKSQ 510
>gi|139438509|ref|ZP_01772025.1| Hypothetical protein COLAER_01018 [Collinsella aerofaciens ATCC 25986] >gi|133776048|gb|EBA39868.1| Hypothetical protein COLAER_01018 [Collinsella aerofaciens ATCC 25986] (654 aa)
Score = 1052, Expect = 2.3e-112, Identities = 228/485 (47%), Positives = 314/485 (64%)
  Q:     5 FNDQELIRREKLKNLQEANQDPY----EIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            ND+   R  K  +L EA Q+PY    EIE       + D  +K+A+L    +T + +K+ GRVVA R      F VIRD  G+ Q +     + ++      K LDLGDI+ + G   RT++G+L++  K   ++SKA++PLPEK+HGL D+E R R RYVDLI N D  + F  R +IL   R+FM+S  Y+EVETP+L  I GGA A+PFIT  N L++  YLRIATEL LK+ IVGGF++V+EIGRIFRNEGMD THNPEFT+ME Y A+ ++E M  L + + K   K++  P V++     I L+ ++    M D +    G         +E    A++  ++  K + T G II   ++E  E   + PTFV  +PI+VSPL+K+   +P  T RFEL I   EYANAF+ELNDP+DQ ERF AQ+ EK+ G+DEA+E D D++ ALEYG+PP  G+G+GIDR++ML T ++SIRDVLLFPHMK +K
  S:    14 LNDERATRLAKRASLFEAGQNPYPEHSEIEDY-----VADIEAKYAELADGEDTEDVVKIGGRVVAKRGQGKIMFIVIRDATGEVQLFCRINDMDEAAWSTL-KALDLGDILGVTGVVVRTKRGQLSVAPKSATLLSKAVRPLPEKFHGLSDKETRYRQRYVDLIANDDVRETFRKRSQILSTFRRFMESDGYMEVETPILQTIQGGATAKPFITHFNALDQECYLRIATELHLKRCIVGGFERVFEIGRIFRNEGMDLTHNPEFTTMEAYRAFSDLEGMKALAQGVIKAANKAIGNPEVIEYQGQTIDLSGEWASRPMTDIVSDVLGKKVTIDTPAEELAAAAREKGLEI-KPEWTAGKIIAEIYDELGEDTIVNPTFVCDYPIEVSPLAKRFEDDPRLTHRFELVIAGHEYANAFSELNDPVDQAERFAAQMAEKAGGDDEAMEYDEDYVRALEYGMPPAGGIGIGIDRVVMLLTNQASIRDVLLFPHMKPEK 501
>gi|196255943|ref|ZP_03154481.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 7822] >gi|196203123|gb|EDX97940.1| lysyl-tRNA synthetase [Cyanothece sp. PCC 7822] (573 aa)
Score = 1049, Expect = 5.2e-112, Identities = 222/477 (46%), Positives = 326/477 (68%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFGVI-----RDFYGDTQFYLNKKKVSKSMLEYFN------KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK-SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           R EK++ L++   +PYE  K   T        K+A L+     +  + +AGR++A R+ FG +     +D  G  Q YL+KK++ ++M +  N      K+ D GDI+   G+  RT+KGEL++ V +  I++K+L PLP+K+HGL D E R R RYVDLI+N +  + F  R +I   IR++++ + +LE+ETPVL    GGA+ARPFIT+HNTLE + YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTEN+    AK +L    V   + EI LT  +RR+ M   ++++TG+DF + ++ +E ++ A+K  ++  +   TLG ++   FE+  E   I+PTFV   P+++SPL+K     PG  +RFEL+I  +E AN+F+EL DPIDQ ER EAQ ++K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+ +SIRDV+ FP +K +
  S:    23 RLEKVEQLKQLGLNPYEY-KWESTHHAAQLQEKYASLENGEEVDLEVAVAGRIIA-RRVFGKLAFFNLQDESGTIQLYLDKKRIGQTMADVPNAFNTVMKLTDTGDILGAKGTIKRTEKGELSIYVNEYAILTKSLLPLPDKFHGLTDIEKRYRQRYVDLIINPEVRETFRRRAQITASIRRYLEGEGFLEIETPVLQSEAGGADARPFITYHNTLEMDLYLRIATELHLKRLIVGGFEKVFEMGRIFRNEGVSTRHNPEFTSIEIYQAYADYHDMMVLTENIITNAAKDALGTLKVTYQDQEIDLTPPWRRLTMHQLVEEKTGIDFNQFQTFEEGKKAAQKAGIQVSEDCKTLGKLLYESFEQKVEESLIEPTFVLDFPVEISPLAKPHRNKPGLVERFELYIVGRELANSFSELTDPIDQRERLEAQAEKKAAGDLEAHSVDEDFLTALEYGMPPTGGLGIGIDRLVMLLTDSASIRDVIAFPLLKSQ 510
>gi|153853504|ref|ZP_01994884.1| hypothetical protein DORLON_00873 [Dorea longicatena DSM 13814] >gi|149753659|gb|EDM63590.1| hypothetical protein DORLON_00873 [Dorea longicatena DSM 13814] (610 aa)
Score = 1048, Expect = 6.2e-112, Identities = 217/434 (50%), Positives = 307/434 (70%)
  Q:    56 NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK----DKK 489
           ++ +AGR++  R     +F  I+D  G  Q Y+ +  +       F +  D+GDI  + G  FRT+ GE+++  +K+ ++SK+L+ LPEK+HGL D + R R RYVDLI+N +S + F+ R +ILK IR F+D + ++EVETP+L    GGA ARPF T +N L  +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY + E MM LTE++F+Y+A K     V+      I + + F RI M+D +K+  GVDF EVK+++EA+ LA KH+V++E+     G I+NLFF+EFCE K IQPTFV  HPI++SPL+KK+ ++P + +RFEL++  +E  NA++ELNDPIDQ ERF AQ +  + G++EA   D DF+ ALE G+PPT G+G GIDR++ML T+  +IRDVLLFP MK    DKK
  S:    27 HVAIAGRMMFKRVMGKASFCNIQDLQGSIQVYVARDAIGTESYADFKRS-DIGDIFGLEGFAFRTRTGEISIHAEKMTLLSKSLQILPEKFHGLTDTDTRYRQRYVDLIMNPESKETFIKRSKILKEIRNFLDGRGFMEVETPMLVSNAGGAAARPFETHYNALNEDVKLRISLELYLKRLIVGGLERVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYEGMMELTESMFRYLAEKVCGSAVISYNGTVIDMAKPFERISMIDAVKKYAGVDFSEVKTDEEAKALADKHHVEYEERHKK-GDILNLFFDEFCEEKMIQPTFVTDHPIEISPLTKKNPEDPNYVERFELYVYGREMCNAYSELNDPIDQRERFAAQEEAFAAGDEEANHTDEDFLNALEIGMPPTGGIGYGIDRLVMLLTDAQAIRDVLLFPTMKSLDADKK 467
>gi|149277988|ref|ZP_01884127.1| lysine--tRNA ligase [Pedobacter sp. BAL39] >gi|149231186|gb|EDM36566.1| lysine--tRNA ligase [Pedobacter sp. BAL39] (592 aa)
Score = 1048, Expect = 6.7e-112, Identities = 220/489 (44%), Positives = 321/489 (65%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           M    ++QEL+RR  L  L+E   DPY  E         D  + + + KT     NI +AGR+++ R     +F  ++D  G  Q YL +  +     K++    F K++DLGD + + G  F TQ GE++L V ++K++SK+LKPLP        + + G  D ELR R RYVDL VN D  ++F++R R++  +R + D Q ++EVETP+L PI GGA ARPF T HNTL+   YLRIA EL LK+LIV GFD VYE G++FRNEGMD THNPE+T ME+Y AY++  +MM + E   + VA ++  KPVV +G++EI     + ++ M + I++ TG+D     + +E + +    N++ +      G +I+  F E  EA  IQPTF+  +P++++PL+KK     G  +RFE+FIN KE  NA++ELNDPIDQ ERFE Q+K  + G+ EA+ MD DF+ ALEYG+PPT+GLG GIDR++ML T +S+I++VL FP M+ ++
  S:    20 MSTGLSEQELLRRNSLSQLRELGIDPYPAEAFEINANAADILANYERDKT--AYKNISIAGRIMSRRIMGSASFVELQDSTGRIQVYLKRDDLCPDEDKTLYNTVFKKLMDLGDFIGVRGYVFTTQTGEISLHVSELKLLSKSLKPLPIVKRDEEGKIYDGFTDPELRYRQRYVDLTVNPDFKQIFINRSRVISTMRNYFDEQGWMEVETPILQPIHGGAAARPFATHHNTLDMPLYLRIANELYLKRLIVAGFDGVYEFGKMFRNEGMDRTHNPEYTGMEIYVAYKDYIWMMGMVEECLEKVALAIHGKPVVTVGQHEINFEGPYEKLTMYESIEKYTGIDV-SAMTEEELKAVCASLNIEVDASMGR-GKLIDELFSEKVEANLIQPTFITDYPLEMTPLAKKHRTKDGLVERFEIFINGKEVGNAYSELNDPIDQKERFEDQLKLAARGDAEAMVMDDDFVRALEYGMPPTSGLGFGIDRLVMLMTNQSTIQEVLFFPQMRPER 522
>gi|163815695|ref|ZP_02207067.1| hypothetical protein COPEUT_01876 [Coprococcus eutactus ATCC 27759] >gi|158449000|gb|EDP25995.1| hypothetical protein COPEUT_01876 [Coprococcus eutactus ATCC 27759] (685 aa)
Score = 1047, Expect = 7.3e-112, Identities = 236/485 (48%), Positives = 333/485 (68%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKV------------------------------------SRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  N  +++RREKL +LQ A +DP+ I K                                      R +   D+N + A +     N  + +AGR++  R     +F  I+D  G+ Q Y+ + ++ +     F K  D+GDI  + G  FRT+ GE+++  ++I ++SK+L+ LPEK+HGL D ++R R RYVDLI+N+DS +VF+ R +ILK IR F+  ++++EVETP+L    GGA ARPF T +N L+ +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTE++F+Y+A K      +     EI   + F R+ MVD IK+ TGVDF +V  + EA+++A +H+V++E+     G I+NLFFEEFCE   IQPTF+  HPI++SPL+KK   +P   +RFELFINT E  NA++ELNDPIDQ ERF AQ    + G+DEA   D DF+ ALE G+PPT G+G GIDR++ML T+  +IRDVLLFP MK
  S:    10 EQDLNKLKMVRREKLADLQAAGKDPFVITKYDVQQHSIEVKDMYTALEAELLAGRQEPSVEGLDEAEKREVINNDYNERRAIMDASPIN--VSIAGRMMFKRVMGKASFCNIQDLKGNIQVYVARDQIGEESYADFKKS-DIGDIYGVKGYAFRTKMGEISIHAEEITLLSKSLQMLPEKFHGLTDTDMRYRQRYVDLIMNQDSKEVFIKRSQILKEIRNFLAGRDFMEVETPMLVSNAGGAAARPFETHYNALDEDVKLRISLELYLKRLIVGGLERVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYYGMMELTESMFRYLAEKVCGSTKISYNGIEIDFGKPFERLTMVDAIKKYTGVDFDQVADDAEAKKIADEHHVEYEERHKK-GDIVNLFFEEFCEENLIQPTFIMDHPIEISPLTKKKPSDPTKVERFELFINTWEMCNAYSELNDPIDQRERFAAQDANAAAGDDEAEHTDEDFLNALEIGMPPTGGIGYGIDRLVMLLTDSQAIRDVLLFPTMK 531
>gi|153813032|ref|ZP_01965700.1| hypothetical protein RUMOBE_03440 [Ruminococcus obeum ATCC 29174] >gi|149830834|gb|EDM85924.1| hypothetical protein RUMOBE_03440 [Ruminococcus obeum ATCC 29174] (586 aa)
Score = 1047, Expect = 8.7e-112, Identities = 213/433 (49%), Positives = 301/433 (69%)
  Q:    56 NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ++ +AGR++  R     +F  I+D  G+ Q Y+ +  + +     F K  D+GDI  + G  FRT+ GE+++  +K+ +++K+L+ LPEK+HGL D + R R RYVDLI+N+DS  VF+ R +ILK IR F+  ++++EVETP+L    GGA ARPF T +N L  +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY + E MM LTE++F+Y+A K      +     EI L + F R+ M + IK+  G+DF EV  ++ A++LA +H++++E H    G IINLFFEE+CE + IQPTF+  HPI++SPL+KK   +P   +RFELF NT E  NA++ELNDPIDQ ERF+AQ      G++EA   D DF+ ALE G+PPT G+G GIDR++ML T+  +IRDVLLFP MK +
  S:     7 HVAIAGRMMFKRVMGKASFCNIQDLQGNIQVYVARDAIGEESYADFKKS-DIGDIFGLEGFAFRTRTGEISIHAEKMTMLTKSLQILPEKFHGLTDTDTRYRQRYVDLIMNQDSKNVFIKRSQILKEIRNFLAGRDFMEVETPMLVSNAGGAAARPFETHYNALNEDVKLRISLELYLKRLIVGGLERVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYEGMMELTESMFRYLAEKVCGSTKISYNGVEIDLGKPFARMTMNEAIKKYAGIDFDEVADDEAAKKLADEHHIEYEAHHKK-GDIINLFFEEYCEKELIQPTFIMDHPIEISPLTKKKPSDPSKVERFELFCNTWEMCNAYSELNDPIDQRERFKAQDALADAGDEEANHTDEDFLNALEIGMPPTGGIGYGIDRLVMLLTDSQAIRDVLLFPTMKSQ 442
>gi|158338556|ref|YP_001519733.1| lysyl-tRNA synthetase [Acaryochloris marina MBIC11017] >gi|158308797|gb|ABW30414.1| lysyl-tRNA synthetase [Acaryochloris marina MBIC11017] (517 aa)
Score = 1044, Expect = 1.6e-111, Identities = 223/478 (46%), Positives = 317/478 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN-NIKLAGRVVALRQTFGVI-----RDFYGDTQFYLNKKKVSKSMLE-------YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAK----SLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           R +K++ L++A   PY     S T T      KF  L      +  + +AGR++A R+ FG +     +D  G  Q YL KK++ + M E       +  ++ D+GD + + G+  RT KGEL++ V+   +++K+L PLP+KWHGL D   R R RYVDLIVN    + F  R +I   IR+++D Q ++E+ETPVL+   GGA ARPFIT+HNT+E + YLRIATEL LK+LIVGGF+KV+E+GR+FRNEG+ + HNPEFT++EVY AY +   MM LTE L    A+    SLK P    GE  I LT  +RR+ M D ++++TG+DF   ++ + AQ+ A K  +       ++GH++N  FE+  EA  IQPTF+  +P+++SPL+K      G  +RFELFI  +E AN+F+EL DP+DQ +R EAQ   K  G+ EA  +D DFI ALEYG+PPT GLG+GIDR+ ML ++ +SIRDV+ FP +K +K
  S:    23 RLQKVEQLKQAGLTPYAYRWQS-THTAQALQEKFVDLANGEEEDFEVAIAGRILA-RRVFGKLAFFNLQDETGTIQLYLEKKRIQEQMGEQDEQAFNHLKQLTDVGDFIGVQGTIKRTDKGELSVYVQTYTVLTKSLLPLPDKWHGLTDIAKRYRQRYVDLIVNPSVRETFRRRAQITASIRRYLDEQGFIEIETPVLNSEAGGAEARPFITYHNTMEMDLYLRIATELHLKRLIVGGFEKVFELGRVFRNEGISTRHNPEFTTIEVYQAYADYNDMMDLTEALICTAAERSVGSLKVPY--QGET-IDLTSPWRRVTMHDAVQEKTGLDFTTFETVEAAQKAATKAGITGVDDCESVGHVLNEAFEQKVEATLIQPTFILDYPVEISPLAKPHRSQSGLVERFELFIVGRETANSFSELTDPVDQRQRLEAQAARKEAGDLEAHGVDEDFITALEYGMPPTGGLGIGIDRLAMLLSDAASIRDVIAFPLLKPEK 512
>gi|16330075|ref|NP_440803.1| lysyl-tRNA synthetase [Synechocystis sp. PCC 6803] >gi|2501021|sp|P73443|SYK_SYNY3 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|1652562|dbj|BAA17483.1| lysyl-tRNA synthetase [Synechocystis sp. PCC 6803] (510 aa)
Score = 1044, Expect = 1.7e-111, Identities = 218/478 (45%), Positives = 312/478 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFN------KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           R EK + L++   +PY       T    D    +  L      +  + +AGR++A R      F  ++D  G  Q YL K+++++ M E  N      K+ D+GDI+ + G+  RT+KGEL++ V+   +++K+L PLP+KWHGL D E R R RYVDLIVN    + F  R +I   IR+++D Q ++E+ETPVL    GGA ARPFIT HNTL    YLRIATEL LK+L+VGGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE L    A+++     +   GE EI LT  ++RI M + ++ ETG+DF +    + A++ A K  +   +   +LGH++N  FE+  E   +QPTF+   P+++SPL+K     PG  +RFELF+  +E AN+F+EL DPIDQ  R EAQ  +K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+  SIRDV+ FP +K+++
  S:    17 RLEKAEQLRQLGLNPYAY-TWEITHQAQDLQETYRDLSNGEEVDLKVAIAGRILARRVMGKLAFFTLQDESGTIQLYLEKQRLTEHMPELENAFNLLKKITDVGDILGVTGTLKRTEKGELSVYVQTYAVLTKSLLPLPDKWHGLTDTEKRYRQRYVDLIVNPTVRQTFRRRAQITAAIRRYLDKQGFIEIETPVLQGESGGAEARPFITHHNTLGMPLYLRIATELHLKRLVVGGFEKVFELGRIFRNEGVSTRHNPEFTSIEVYQAYVDYNEMMALTEALVTTAAQAVLGTLKITYQGE-EIDLTPPWKRITMHEAVQLETGIDFSQFTDLETAKQAATKAGIGVPEDCPSLGHLLNHAFEQKVEGTLMQPTFIIDFPVEISPLAKPHRSKPGLVERFELFVYGRELANSFSELTDPIDQRSRLEAQAAKKAAGDLEAHSVDEDFLTALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLKNQE 505
>gi|152990921|ref|YP_001356643.1| lysyl-tRNA synthetase [Nitratiruptor sp. SB155-2] >gi|151422782|dbj|BAF70286.1| lysyl-tRNA synthetase [Nitratiruptor sp. SB155-2] (502 aa)
Score = 1044, Expect = 2.1e-111, Identities = 232/481 (48%), Positives = 317/481 (65%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN----IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFE-KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           N  E +R +K + L+EA  +PY      + ++  +F  K+A +K      +    +KL GR+  LR      F  I D  G  Q Y N+  +     +   K++++GDI+E  G PF T+ GELTL   ++ +V+KA+ PLPEK+HGL+D+ELR R RYVDLI+N +  KVF+ R RI+ +IR F +S  +LEVETP++HPI GGANARPFIT HN L  + YLRIA EL LK+LIVGGF+ V+EI R FRNEGMD+THNPEFT +E Y AY   E +M+LTE+LF Y+ + L  P  +  GE+ I  +  F +I   D I +   V    V+  ++     K   ++ E  H+ +LG +    F+ F E K I PTF+   PID+SPL+++  +NP   +RFELFI  KE AN F ELNDP+DQYERF+AQV+ K + +DEA+ MD DF+ AL YG+PPTAG G+GIDR++ML T + SIRDV+LFP MK
  S:     5 NQYEQLRIQKAQELKEAGINPYG-HGFCKEISNNEFLEKYAYVKDLEEKKDEKACVKLNGRIKFLRHMGKAAFAKIEDESGIVQIYFNRDSLGDEWFKKVKKLIEVGDIIEAKGYPFVTKTGELTLHANELNLVTKAIVPLPEKFHGLQDKELRYRQRYVDLIMNPEVKKVFMLRSRIVSLIRDFFESHGFLEVETPMMHPIPGGANARPFITHHNALGVDRYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDATHNPEFTMIEFYWAYHTYEDLMKLTEDLFDYLFEKLSLPKKLTYGEHTIDFSTPFSKIKYKDAIIEIGEVPEDIVEDKEKIISFLKDKGIEPEFAHKMSLGALQAELFDNFVEEKLINPTFITHFPIDISPLARRSDENPEIAERFELFIAGKEIANGFNELNDPLDQYERFKAQVQAKEV-DDEAMHMDEDFVRALGYGMPPTAGEGIGIDRLVMLLTNQHSIRDVILFPAMK 493
>gi|160895077|ref|ZP_02075851.1| hypothetical protein CLOL250_02627 [Clostridium sp. L2-50] >gi|156863508|gb|EDO56939.1| hypothetical protein CLOL250_02627 [Clostridium sp. L2-50] (539 aa)
Score = 1041, Expect = 3.7e-111, Identities = 235/476 (49%), Positives = 326/476 (68%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA----------------------KLKTHNTNNN------------IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RREKL +LQ A +DP+EI K   T    D    +                       K +  N + N            + +AGR++  R     +F  I+D  G+ Q Y+ + ++ +     F K  D+GDI  + G  FRT+ GEL++  +++ ++SK+L+ LPEK+HGL D ++R R RYVDLI+N++S  VF+ R +ILK IR F+  ++++EVETP+L    GGA ARPF T +N L  +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY + E MM LTE++F+Y+A K      +     EI   + F R+ M D IK+ TG+DF +V+ +  A++LA +HN+ +E+     G IINLFFEEFCE K IQPTF+  HPI++SPL+KK   +P   +RFELFINT E  NA++ELNDPIDQ ERF AQ    + G+DEA   D DF+ ALE G+PPT G+G GIDR++ML T+  +IRDVLLFP MK
  S:    21 VRREKLADLQAAGKDPFEITKYDVTYHSTDVKEAYTAHEAELLAGRQEPDVEGLDDAQKKEVLNNDYNERRAIMDASPIHVSIAGRMMFKRVMGKASFCNIQDLKGNIQVYVARDQIGEEAYADFKKS-DIGDIYGVKGWAFRTKTGELSIHAEEMTLLSKSLQILPEKFHGLTDTDVRYRQRYVDLIMNQESKAVFIKRSQILKEIRNFLADRDFMEVETPMLVANAGGAAARPFETHYNALNEDVKLRISLELYLKRLIVGGLERVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYEGMMELTESMFRYLAEKVCGSTKISYNGIEIDFGKPFERLTMNDAIKKYTGIDFDQVEDDAAAKKLADEHNIAYEERHKK-GDIINLFFEEFCEEKLIQPTFIMDHPIEISPLTKKKPSDPSKVERFELFINTWEMCNAYSELNDPIDQRERFAAQDANAAAGDDEAEHTDEDFLNALEIGMPPTGGIGYGIDRLVMLLTDSQAIRDVLLFPTMK 533
>gi|172038375|ref|YP_001804876.1| lysyl-tRNA synthetase [Cyanothece sp. ATCC 51142] >gi|171699829|gb|ACB52810.1| lysyl-tRNA synthetase [Cyanothece sp. ATCC 51142] (573 aa)
Score = 1038, Expect = 8.0e-111, Identities = 222/476 (46%), Positives = 315/476 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFGVI-----RDFYGDTQFYLNKKKVSKSM------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKD 487
           R EK++ L++    PY  +  S T        K+  LK       ++ +AGR++A R+ FG +     +D  G  Q YL+KK++   M        +  K+ D GDI+ + GS  RT+KGEL++ VK+ +I++K+L PLP+KWHGL D E R R RYVDLIVN    + F  R  I   IR+++D Q ++E+ETPVL    GGA ARPFIT+HNTLE + YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE +    A+ +     +   GE +I L+  +RR+ M D +K+++G+DF + K  + A+   K+  +   +   +LG +IN  FE+  E   IQPTF+   P+++SPL+K      G  +RFEL+I  +E AN+F+EL DPIDQ  R E Q ++K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR+IML T+ +SIRDV+ FP +K+
  S:    23 RLEKVEQLKQLGLIPYAYQWQS-THDAATLQDKYTNLKDGEEVAVDVAIAGRIIA-RRVFGKLAFFNLQDETGTIQLYLDKKEIQAHMSDLDSAFNHLKKLTDTGDIIGVKGSIKRTEKGELSVKVKQYQILTKSLLPLPDKWHGLTDTEKRYRQRYVDLIVNPQVRQTFRRRAEITASIRRYLDKQGFIEIETPVLQSEAGGAEARPFITYHNTLEMDLYLRIATELHLKRLIVGGFEKVFELGRIFRNEGVSTKHNPEFTSIEVYQAYADYNDMMELTEAIITTAAEEVLGTLKITYQGE-DIDLSTPWRRVTMHDIVKEKSGLDFEQFKDFETAKNAVKEVGLDVPETCQSLGKLINEVFEQTVEETLIQPTFILDFPVEISPLAKPHRNKEGLVERFELYIVGRELANSFSELTDPIDQRNRLEKQAEQKAAGDLEAHSVDEDFLTALEYGMPPTGGLGIGIDRLIMLLTDSASIRDVIAFPLLKN 509
>gi|126658229|ref|ZP_01729379.1| lysyl-tRNA synthetase [Cyanothece sp. CCY0110] >gi|126620378|gb|EAZ91097.1| lysyl-tRNA synthetase [Cyanothece sp. CCY0110] (573 aa)
Score = 1037, Expect = 1.1e-110, Identities = 221/477 (46%), Positives = 321/477 (67%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFGVI-----RDFYGDTQFYLNKKKVSKSMLE------YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           R EK++ L++    PY  +  S T        K+A LK     + +I +AGR++A R+ FG +     +D  G  Q YL+KK++   M E      +  K+ D GDI+ + GS  RT+KGEL++ VK+ +I++K+L PLP+KWHGL D E R R RYVDLIVN    + F  R +I   IR+++D+Q ++E+ETPVL    GGA ARPFIT+HNTLE + YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE +    A+ +     +   GE +I ++  +RR+ M + +K+++G+DF + K  + A++  K   ++  +   +LG ++N  FE+  E   IQPTF+   P+++SPL+K      G  +RFEL+I  +E AN+F+EL DPIDQ  R E Q ++K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR+IML T+ +SIRDV+ FP +K +
  S:    23 RLEKVEKLKQLGLIPYAYQWQS-THDATTLQDKYASLKDGEEVDVDIAIAGRIIA-RRVFGKLAFFNLQDETGTIQLYLDKKEIQSHMSELENAFNHLKKLTDTGDIIGVKGSIKRTEKGELSVKVKQYQILTKSLLPLPDKWHGLTDTEKRYRQRYVDLIVNPQVRQTFRHRAQITASIRRYLDNQGFIEIETPVLQSEAGGAEARPFITYHNTLEMDLYLRIATELHLKRLIVGGFEKVFEMGRIFRNEGVSTKHNPEFTSIEIYQAYADYNDMMELTEAIITTAAQEVLGDSKITYQGE-KIDISTPWRRVTMHEIVKEKSGLDFEKFKDFESAKDAVKNAELEVPETCQSLGKLLNEVFEQTVEETLIQPTFILDFPVEISPLAKPHRSKQGLVERFELYIVGRELANSFSELTDPIDQRNRLEKQAEQKAAGDLEAHSVDEDFLTALEYGMPPTGGLGIGIDRLIMLLTDSASIRDVIAFPLLKSQ 510
>gi|168058919|ref|XP_001781453.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162667090|gb|EDQ53728.1| predicted protein [Physcomitrella patens subsp. patens] (589 aa)
Score = 1036, Expect = 1.5e-110, Identities = 219/482 (45%), Positives = 320/482 (66%)
  Q:     7 DQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN----NIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKF-----EKHQS-------TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVK---------------------EKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           D   +R +K+++L+    +PY      RT T  +   ++  L +    N    ++ +AGR++A R+ FG      +RD  GD Q Y  K K++    +    ++D+GD +   G+  RT+KGEL++ V ++ I++K+L PLP+KWHGL D E R R RYVD+I+N D   VF DR +I+  IR+ M+S  YLE+ETPVL    GGA+ARPF+T HN L ++ YLRIATEL LK+++VGGF++VYEIGRIFRNEG+ + HNPEFTS+E+Y AY + + MM L E + +  A ++   + +     EI L + ++R  M   +++ TG++F     + EA   AK   V F     E+H +       ++GH++N  FE   E   IQPTFV  HP+++SPL+K     PG  +RFELF+  +E ANAF+EL DPI+Q  RFEAQV+                       ++ +   V MD DF+ ALEYG+PPTAG+G+GIDR++ML T+ +SIRDV+ FP MK +
  S:    70 DIRTLRLKKVEDLRAGGFEPYGY-TWDRTHTAAELQKQYVDLPSATEANEEKDHVAVAGRIIA-RRVFGKLAFLTMRDDSGDIQLYCEKAKLTDEAFDQLKTLMDIGDFIGAKGTMKRTEKGELSVLVGELSILTKSLLPLPDKWHGLTDVEKRYRQRYVDMIMNPDVATVFRDRAKIISEIRRHMESLGYLEIETPVLQGEAGGADARPFVTHHNALGQDMYLRIATELHLKRMVVGGFERVYEIGRIFRNEGISTRHNPEFTSIELYQAYADYDDMMNLAEEIVEKCALTVNGSLSLTYQGTEISLQRPWKRASMHSLVEEVTGINFASFGDDIEA---AKNAAVSFFAGHIERHDTGTILKAPSIGHLVNEVFEMVVEKTLIQPTFVMDHPVEISPLAKPHRSKPGLVERFELFVYGREMANAFSELTDPIEQRSRFEAQVRTHNAAMAAAAEAAKAKGDTALTSAINDAYEVGMDEDFVTALEYGMPPTAGMGIGIDRLVMLLTDSASIRDVIAFPVMKSQ 589
>gi|67920132|ref|ZP_00513652.1| Lysyl-tRNA synthetase, class-2 [Crocosphaera watsonii WH 8501] >gi|67857616|gb|EAM52855.1| Lysyl-tRNA synthetase, class-2 [Crocosphaera watsonii WH 8501] (573 aa)
Score = 1034, Expect = 2.3e-110, Identities = 222/477 (46%), Positives = 320/477 (67%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLE------YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP--VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           R EK++ L++    PY  +  S +        K+A LK       ++ +AGR++A R+ FG      ++D  G  Q YL+KK++   M E      +  K+ D GDI+ + GS  RT+KGEL++ VK+ +I++K+L PLP+KWHGL D E R R RYVDLIVN    + F  R +I   IR+++D+Q ++E+ETPVL    GGA ARPFIT+HNTLE + YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE +    A+ +     +   GE +I L+  +RR+ M D +K+++G+DF      + A+   KK  ++  +   +LG ++N  FE+  E   IQPTF+   P+++SPL+K      G  +RFEL+I  +E AN+F+EL DPIDQ ER E Q ++K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR+IML T+ +SIRDV+ FP +K++
  S:    23 RLEKVEQLKKIGLIPYAYQWKS-SHDAASLQDKYASLKNGEEVEVDVAIAGRIIA-RRVFGKLAFFSLQDESGTIQLYLDKKEIQAHMSELESAFNHLKKLTDTGDIIGVKGSIKRTEKGELSVKVKEYEILTKSLLPLPDKWHGLTDTEKRYRQRYVDLIVNPQVRQTFRRRAQITASIRRYLDNQGFIEIETPVLQSEAGGAEARPFITYHNTLEMDLYLRIATELHLKRLIVGGFEKVFEMGRIFRNEGVSTKHNPEFTSIELYQAYADYNDMMELTEAIITTAAEEVLGTLNITYQGE-QIDLSTPWRRVTMNDIVKEKSGLDFEAFTDFETAKTEVKKAGLEVPETCQSLGKLLNEVFEQTVEESLIQPTFILDFPVEISPLAKPHRDKQGLVERFELYIVGRELANSFSELTDPIDQRERLEKQAEQKAAGDLEAHSVDEDFLTALEYGMPPTGGLGIGIDRLIMLLTDSASIRDVIAFPLLKNQ 510
>gi|39997369|ref|NP_953320.1| lysyl-tRNA synthetase [Geobacter sulfurreducens PCA] >gi|39984260|gb|AAR35647.1| lysyl-tRNA synthetase [Geobacter sulfurreducens PCA] (491 aa)
Score = 1033, Expect = 3.2e-110, Identities = 225/480 (46%), Positives = 308/480 (64%)
  Q:    10 LIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           L RR K+  L EA  +PY         T  DF   +  + T  +   +  +AGR++A R++FG      I+D  G  Q Y+ K  V     E F +  D+GDIV + G+PFRT+ GELTL+   I++++K+L+PLPEK+HGL D E R R RYVDLIVN +  +VFV R RI+ +IR+FM  +++LEVETP++ PI GGA ARPF+T HN L+   +LRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY   E +M  TE L  +VA+ +   +     E  I   + ++R+ +V+ I +   +D   +     A   A++  +         G +I   FEE  E K IQPTF+  +P +VSPLS+K  K+P    RFELFI  +E ANAF+ELNDP+DQ ERF AQV  K+ G+DEA  MD D+I ALE+GLPPTAG G+GIDR++ML T+  SIRDV+LFP ++ +K
  S:     9 LQRRRKVDALWEAGINPYP-NDFKPLHTSADFREAYGTVDTIEDDPRSFTVAGRIIA-RRSFGKAAFIQIQDRKGRMQVYVRKDTVGDEAFEAF-ETFDIGDIVGVGGTPFRTKTGELTLNAAFIRLLTKSLQPLPEKFHGLTDVETRYRQRYVDLIVNPEVREVFVKRSRIVNLIREFMVRKDFLEVETPMMQPIPGGATARPFVTHHNALDMQLFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMEFYQAYATFEDLMDFTEELLCHVAQEVLGTLDFTYQEMPISFQRPWKRLAVVEAILEYGDIDAKSLADRDLAYAYAQRLGLDLPA-DVGYGKLITEIFEEVAETKLIQPTFITAYPTEVSPLSRKSDKDPEIVDRFELFIAGREMANAFSELNDPVDQKERFLAQVAAKAKGDDEAHYMDEDYIRALEFGLPPTAGEGIGIDRLVMLLTDSPSIRDVILFPQLRKEK 491
>gi|170076670|ref|YP_001733308.1| lysyl-tRNA synthetase [Synechococcus sp. PCC 7002] >gi|169884339|gb|ACA98052.1| lysyl-tRNA synthetase [Synechococcus sp. PCC 7002] (538 aa)
Score = 1033, Expect = 3.3e-110, Identities = 213/484 (44%), Positives = 316/484 (65%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSM------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
            +D    R EK+  L+    +PY   K   +    +   K+  ++      + + +AGR++A R+ FG      ++D  G  Q YL+KK ++  M        +  K+ D+GDI+ + G   RT+KGEL++ V +  +++K+L PLP+KWHGL D E R R RYVDLI+N    + F  R +I   IR++++ +++LE+ETPVL    GGA ARPFIT HNTL+   YLRIATEL LK+L+VGGF++V+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE+L + +AK +  +  +  GE  + +   +RR  M + +++ TG++F        A++ A+   +   +   T+G ++N  FE+  EA  IQPTFV  +P++VSPL+K     PG T+RFELFI  +E AN F+EL DP+DQ +R E Q  +K+ G++EA ++D DF+ ALEYG+PPT GLG+GIDR++ML T   SIRDV+ FP +KD+
  S:     9 LDDIRATRLEKVDQLKAIAMNPYAY-KWEISHHTAELQEKYKDIEAGEEVEDTVSIAGRILA-RRVFGKLAFFSLQDETGTIQLYLDKKLINGGMPDLEGAFNHLKKLTDVGDIIGVKGIIKRTEKGELSIKVSQFAMLTKSLLPLPDKWHGLTDIEKRYRQRYVDLIINPQVKETFRRRAKITAAIRRYLEDRDFLEIETPVLQAEAGGAEARPFITHHNTLDMPLYLRIATELHLKRLVVGGFERVFELGRIFRNEGVSTKHNPEFTSIEVYQAYGDYFDMMDLTEDLIRTLAKDIVGQAQLPYGEVIVDVGTPWRRETMQNLVQEATGINFLSFDDLNAAKQAAESVGMHIPEKCKTIGQLLNEAFEQKVEATLIQPTFVTEYPVEVSPLAKPHRDKPGLTERFELFIVGRELANGFSELTDPVDQRQRLEEQAAKKAAGDEEACDVDEDFVTALEYGMPPTVGLGIGIDRLVMLLTNAESIRDVIAFPLLKDR 503
>gi|169830349|ref|YP_001716331.1| lysyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] >gi|169637193|gb|ACA58699.1| lysyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] (490 aa)
Score = 1033, Expect = 3.4e-110, Identities = 219/484 (45%), Positives = 315/484 (65%)
  Q:     6 NDQEL-----IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +DQEL     +RREKL  LQ     PY   +  RT         +A+L+       + LAGR++A R      FG ++D  G  Q Y     +     E F K LD+GD + I G+ F+T+ GE+T+ V    +++K+L+PLPEKWHGL+D ELR R RY+DLI+N  S +VFV R RI+  IR+++D   +LEVETP++  + GGA ARPF T+HN L  + +LRIA EL LK+L+VGGFDKVYEI R FRNEG+ + HNPEFT +E+Y AY +   MM LTE L   V + +    +   GE+ +     + R  M++ ++++TG+DF E  S +EA   A+   ++F+   S     +N  FE+  + + +QPTF+Y +P+++SPL+K+    P    RFELFI  +E ANAF+ELNDP+DQ ERF+AQ++++  G++EA   D DF+ ALEYG+PP  GLG+GIDR+IML T+  SIRDV+LFP ++ ++
  S:     4 HDQELHELLRVRREKLLQLQAQGVPPYG-GRYERTHLAAVVVDDYARLE----GRELSLAGRLMAKRGHGKAAFGDLQDGSGKVQAYFRLNDLGPEKYELF-KTLDIGDFIGIRGTVFKTRTGEVTVAVSDFVLLAKSLRPLPEKWHGLKDVELRYRQRYLDLIINPQSREVFVTRSRIIAAIRRYLDENGFLEVETPMMQTLAGGAVARPFKTYHNALGISLFLRIAPELYLKRLLVGGFDKVYEINRNFRNEGISTRHNPEFTMLEIYEAYADYHDMMNLTERLISSVIEQVFTDHIFPYGEHRLDFNIPWPRYSMLEVVREKTGLDF-ENLSPEEAAVAARDAGLEFDSEPS-WAEALNAVFEDKVQPQLVQPTFIYDYPLELSPLAKRHEDAPHLVYRFELFIAGREIANAFSELNDPVDQRERFQAQLEKRKRGDEEAHVFDEDFVTALEYGMPPAGGLGIGIDRLIMLLTDSPSIRDVILFPLLRPRE 489
>gi|156740037|ref|YP_001430166.1| lysyl-tRNA synthetase [Roseiflexus castenholzii DSM 13941] >gi|189082965|sp|A7NFC6|SYK_ROSCS Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|156231365|gb|ABU56148.1| lysyl-tRNA synthetase [Roseiflexus castenholzii DSM 13941] (489 aa)
Score = 1031, Expect = 6.5e-110, Identities = 213/486 (43%), Positives = 308/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGV-----IRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + N+ +  R  KL+ L+ A  DPY   +  RT TIG+  + F +L   +    + +AGR+V  R+  G      I D  G  Q +L++  +     + F   LD  DIVE  G+  RTQ+GE ++ V ++ +++K+L P PEKWHGL D E R R RY+DLIVN +   VF  R  I++ +R+F+D + +LEVETP L PI GGA+ARPFIT HN L+++ YLRIA EL LK+LIVGGF++VYEI ++FRNEG+D THNPEFT ME Y AY +   MMRL E+L++ +A  +     +V  G+  I     +RR+ +   I + TG+D  E+   +  QE  +   +K +  +   G  ++  F  + +   IQPTFV  HP+ +SPL+K+    P   +RFE  +   E  NAF ELNDP+DQ +RF  Q +    G+DEA +MD+DF+ AL YG+PPT GLG+GIDR +MLFT++ SIR+V+LFPH++ ++
  S:     2 ELNELQQQRLAKLERLRAAGIDPYP-PRAQRTHTIGEVLAGFDQLM--DRGEQVTVAGRIVGARRVLGKLAFAHIEDESGRIQLWLSRGDLGDEWFDRFRDDLDTFDIVEASGTLRRTQRGEPSVFVTRMGVLAKSLNPPPEKWHGLSDIEERHRQRYLDLIVNPEVRDVFRTRATIVRTMRRFLDERGFLEVETPTLQPIYGGASARPFITHHNQLKQDLYLRIAVELYLKRLIVGGFERVYEISKVFRNEGVDRTHNPEFTMMECYQAYADYHDMMRLVEDLYRALALEVTGSTTIVFQGQT-IDFGPAWRRVSIPAAIAERTGIDILELTELEPLQEAIRAAGLKVDL-KPGWGRQVDELFSVYVQPALIQPTFVLDHPVALSPLAKRRPDQPLLVERFEPVVAGMEIGNAFTELNDPLDQEQRFLEQGRAYDAGDDEAQQMDVDFLNALMYGMPPTGGLGIGIDRTVMLFTDQPSIREVILFPHLRPRE 489
>gi|154484001|ref|ZP_02026449.1| hypothetical protein EUBVEN_01709 [Eubacterium ventriosum ATCC 27560] >gi|149735043|gb|EDM50929.1| hypothetical protein EUBVEN_01709 [Eubacterium ventriosum ATCC 27560] (513 aa)
Score = 1030, Expect = 8.3e-110, Identities = 226/476 (47%), Positives = 329/476 (69%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---------IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFN--KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RREKL +LQE  +DP++I K   T    +    F K +  +             + +AGR++  R     +F  ++D  G+ Q Y+ + ++     E +   K +D+GDIV + G PF T+ GE ++   ++ ++SK+L+ LPEK HGL + +LR R RY+DLI+N +  + F+ R +I+  IR+++D Q ++EVETP+L    GGA ARPF T  N L+ +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTENL++++A K      ++    E+ L++ F R+ MVD +K+  GVD+ EV++ ++A+ELAK+H+V+FE+H    G I+NLFFEEF E   +QPTF+  HPI++SPL+KK  +NP + +RFE F+N  E ANA++ELNDPIDQ ERF+AQ +  +LG++EA   D DF+ ALE G+PPT G+G GIDRM ML T  ++IRDVLLFP MK
  S:    19 VRREKLADLQERGKDPFQITKYDVTNHTTEIKDNFEKFECEHDEEGKLVKDPAKLVSIAGRIMLKRVMGKASFCNVQDKTGNIQVYVARNELGDEPFEEYKDFKKMDIGDIVGVKGYPFVTKTGEKSIHATEVTLLSKSLQILPEKHHGLTNTDLRYRQRYLDLIMNPEVKETFIKRSKIISEIRKYLDGQGFMEVETPMLVHNAGGAAARPFETHFNALDEDVKLRISLELYLKRLIVGGLERVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYHGMMDLTENLYRHLAEKVCGSAKIEYNGIEMDLSKPFERLTMVDAVKKYAGVDWNEVETVEQARELAKEHHVEFEEHHKK-GDILNLFFEEFVEEHLVQPTFIMDHPIEISPLTKKKPENPEYVERFEFFMNGWEMANAYSELNDPIDQRERFKAQEELLALGDEEANTTDEDFMNALEIGMPPTGGIGFGIDRMCMLLTNAAAIRDVLLFPTMK 509
>gi|163846800|ref|YP_001634844.1| lysyl-tRNA synthetase [Chloroflexus aurantiacus J-10-fl] >gi|187600682|ref|ZP_02986913.1| lysyl-tRNA synthetase [Chloroflexus sp. Y-400-fl] >gi|189082954|sp|A9WK04|SYK_CHLAA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|163668089|gb|ABY34455.1| lysyl-tRNA synthetase [Chloroflexus aurantiacus J-10-fl] >gi|187487151|gb|EDU25121.1| lysyl-tRNA synthetase [Chloroflexus sp. Y-400-fl] (491 aa)
Score = 1029, Expect = 1.0e-109, Identities = 211/485 (43%), Positives = 298/485 (61%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ-----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + ND +  R  KL  L+ A  DPY   +  R+ TI +  + F  L   +T   + L GR++  R+      F  I D  G+ Q +L++  +     E F   LD  DIV+  G    T+ GE +L V+++ I++KA+ P PEKW GL+D E R R RY+DLIVN+D  ++F  R R++  +R+ +D + +LEVETPVL P+ GGA ARPFIT+HN L +N YLRIATEL LK+LIVGGF  VYEIG+ FRNEG+D +HNPEFT ME Y AY +   MM L E +   +  ++     +     E+     + RI M   I   TG+D  ++      QE      ++ E+  S    +  L F EF +    QPTF+  +P+ +SPL+K+    P FT+RFE FI   E  NAF ELNDP DQ ERF  Q++  + G++EA +MD DFI AL YG+PPT GLGVGIDR++M+ T++S+IR+V+LFPH++++
  S:     2 ELNDLQAQRAAKLAELRAAGLDPYP-PRCYRSHTIAEALAAFDDLVAQSTT--LTLTGRIIGARRIMGKIAFAHIEDGTGEIQLWLSRADLGDEWFERFRDQLDTFDIVQASGVLRCTKTGERSLFVRELAILAKAINPPPEKWAGLQDVEERHRQRYLDLIVNRDRREIFRARARVISTMRRVLDERGFLEVETPVLQPLYGGAAARPFITYHNALGQNLYLRIATELYLKRLIVGGFPGVYEIGKNFRNEGVDRSHNPEFTMMECYQAYADYHAMMTLVEEMLSEICLAVHGTTTITYQGRELDFRPPWPRIAMATAIADRTGIDITQITDLDALQEAISARGLRVERKASWAKQVDEL-FSEFVQPHLFQPTFIIDYPVAMSPLAKRIPDRPDFTERFEAFIAGMEIGNAFTELNDPFDQEERFREQLRAFAAGDEEAHQMDEDFINALRYGMPPTGGLGVGIDRLVMVLTDQSNIREVILFPHLRER 488
>gi|166365564|ref|YP_001657837.1| lysyl-tRNA synthetase [Microcystis aeruginosa NIES-843] >gi|166087937|dbj|BAG02645.1| lysyl-tRNA synthetase [Microcystis aeruginosa NIES-843] (573 aa)
Score = 1027, Expect = 1.9e-109, Identities = 218/477 (45%), Positives = 314/477 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFN------KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           R EK+  LQ+A  +PY  +  S T        ++A L      +  + +AGR++A R      F  ++D  G  Q YL+KK++S++M    N      K+ D GDI+   G+  RT++GEL++ V + +I++K+L PLP+KWHGL D E R R RYVDLIVN +  + F  R +I   IR+++D + ++E+ETPVL    GGA+ARPFIT+HNTLE   YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTEN+    A+  L    +   + EI LT  +RR+ M + +++ TGVD    +  + A+  A+   +   +   T+G ++N  FE+  E   IQPTFV   P+++SPL+K         +RFEL++  +E AN+F+EL DPIDQ +R EAQ  +K+ G+ EA  +D DF+ ALEYG+PPT GLG+GIDR+IML T+ +SIRDV+ FP +K +
  S:    23 RLEKVAGLQKAGLNPYAYQWKS-TAHAQQLQEQYADLAPGEEISAEVAIAGRIIARRILGKLAFFNLQDETGTIQLYLDKKRISETMAAVPNAFNTVIKLTDTGDILGAKGTIKRTERGELSIYVNEYEILTKSLLPLPDKWHGLTDVEKRYRQRYVDLIVNPEVRQTFRRRAQITAAIRRYLDQEGFIEIETPVLQSEAGGADARPFITYHNTLEMELYLRIATELHLKRLIVGGFEKVFELGRIFRNEGVSTKHNPEFTSIEIYQAYADYYDMMELTENIIVNAAQDVLGTLKITYQDREIDLTPPWRRVTMHELVQEITGVDLNSFEDFESARIAAENAGIGVPEDCKTIGKLLNEAFEQKVEETLIQPTFVLDFPVEISPLAKPHRSKTDLVERFELYVVGRELANSFSELTDPIDQRQRLEAQALKKAAGDLEAQGVDEDFLTALEYGMPPTGGLGIGIDRLIMLLTDSASIRDVIAFPLLKSQ 510
>gi|152992078|ref|YP_001357799.1| lysyl-tRNA synthetase [Sulfurovum sp. NBC37-1] >gi|151423939|dbj|BAF71442.1| lysyl-tRNA synthetase [Sulfurovum sp. NBC37-1] (547 aa)
Score = 1026, Expect = 2.0e-109, Identities = 225/482 (46%), Positives = 315/482 (65%)
  Q:     5 FNDQELIRR-EKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTN------NNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFN----KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEK-SLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           F++Q +  R +K + L+E   +PY    +++ M   DF   +A +K   T+        + L GR+  +R      F  I D  G  Q Y N+  + +    Y+N    K+ ++GDI+E  G PF TQ GELTL  K +KIVSKA+ PLPEK+HGL D E+R R RY+D+I+N +  + F+ R +I+ +IR+F +  ++LEVETP++HPI GGANA+PF+T HN L  + YLRIA EL LK+L VGG + V+EI R FRNEGMD THNPEFTS+E Y AY N   +MRLTE LF+Y+   L+    +  GE EI  +  F ++  V+ +     V        ++A    K+H V+   +  TLG++    F+EF E K I PTF+  +PID+SPLS++   NP   +RFELF+  KE AN F ELNDPIDQ+ERF+AQ   K + G++E + MD+DFI AL +G+ PTAG G+GIDR++M+ T+  SIRDV+LFP MK
  S:     3 FDNQYIQERIKKTEKLREEGMNPYP-ANITKGMPSSDFFEHYAYVKEQTTDEKKDEGQTVTLTGRIKFIRIMGKAAFAKIEDTDGLVQIYYNRDDLPEG---YYNTVAKKLFEVGDIIEATGYPFVTQTGELTLHCKDLKIVSKAIMPLPEKFHGLTDHEIRYRQRYLDMIMNPEVKETFIMRSKIVSLIRRFFEDHSFLEVETPMMHPIPGGANAKPFVTHHNALGVDRYLRIAPELYLKRLTVGGMEAVFEINRNFRNEGMDQTHNPEFTSIEFYWAYHNYLDLMRLTEELFEYIFAQLQMDKTITYGEYEIDCSTPFAKVPFVEALTSIGEVPAEVATGREKAIAYLKEHGVEVNPNL-TLGYLQAELFDEFVEGKLINPTFITDYPIDISPLSRRSDDNPEIAERFELFMAGKEIANGFNELNDPIDQFERFKAQADAKEATGDEETMHMDLDFIRALGHGMTPTAGEGIGIDRLVMMLTDNHSIRDVILFPAMK 496
>gi|189459667|ref|ZP_03008452.1| hypothetical protein BACCOP_00295 [Bacteroides coprocola DSM 17136] >gi|189433626|gb|EDV02611.1| hypothetical protein BACCOP_00295 [Bacteroides coprocola DSM 17136] (580 aa)
Score = 1024, Expect = 3.6e-109, Identities = 212/486 (43%), Positives = 321/486 (66%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLEY-FNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  L  ++    DPY   +        D  ++F   +       + +AGR+++ R     +F  ++D  G  Q Y+ +  +    +K +    F ++LDLGD + I G  FRTQ GE+++  +K+ ++SK+++PLP         +   +D ELR R RYVDL+VN     +F+ R ++   +R++ +S+ Y+EVETP+L  I GGA ARPFIT HN L+   Y+RIA+EL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y AY++  +MM+ TEN+ + +   +     VK+G+N I     F+R+ M+D IK+ TG D   +   Q  +E+ +K N++ +      G +I+  F EFCE   IQPTF+  +PI++SPL+K+   NP  T+RFEL +N KE  NA++ELNDPIDQ ERFE Q++    G+DEA+ +D DF+ ALEYG+PPT+G+G+G+DR++ML T +S+I++VL FP M+ +K
  S:     9 ELSEQEIIRRNSLNEMRAMGIDPYPAAEYVTNAFSTDIKAEFKDDEAEP--RKVSVAGRIMSRRVMGKASFVELQDSKGRIQIYITRDDICPDENKDLYNVVFKRLLDLGDFIGIEGFVFRTQMGEISIHAQKLTVLSKSIRPLPIVKYKDGVAYDKFDDPELRYRQRYVDLVVNDGVKDIFLKRNKVYNSMREYFNSKGYIEVETPILQSIAGGAAARPFITHHNALDIPLYMRIASELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMEIYVAYKDYNWMMKFTENMIEKICMDVNGTTEVKVGDNIINFKAPFKRVTMLDSIKEFTGYDLTGMNEEQ-IREVCQKLNMEIDDTMGK-GKLIDEIFGEFCEGNYIQPTFITDYPIEMSPLTKRHRNNPDLTERFELMVNGKELCNAYSELNDPIDQLERFEEQMRLSEKGDDEAMIIDKDFVRALEYGMPPTSGMGIGMDRLVMLMTGQSTIQEVLFFPQMRPEK 507
>gi|150021256|ref|YP_001306610.1| lysyl-tRNA synthetase [Thermosipho melanesiensis BI429] >gi|166230598|sp|A6LMS4|SYK_THEM4 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|149793777|gb|ABR31225.1| lysyl-tRNA synthetase [Thermosipho melanesiensis BI429] (502 aa)
Score = 1024, Expect = 3.6e-109, Identities = 218/488 (44%), Positives = 329/488 (67%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI--KLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           M R+F +Q   R ++++ L+  N +PY   +  +T T      +F  L      +++    AGR+++LR+     F  I+DFYG  Q Y+ K  V +   E+F + + +GDIV + G+ F+++ GE+T+ +K+IK+++K L+P+PEKWHG++D+E+  R RYVD+I N D++  F  R  ++K+IR F++S+ ++EVETP+L  + GGA+ARPF+T  N  +   Y+RIATEL LK+ IVGGF+KVYE+G+ FRNEG+   H+PEFTS+E+Y AY + E MM LTE LF Y+ + L     +K    E+  ++ +RRI M DFIK+  GVD  E  S     ++ ++H V+ E      GH+I   + +  E K +QPTF+  HP+++SPL+KK  ++P  T+RFEL I  +E ANAF+ELNDP+DQYERF  QV+ +  G++EA  MD DF+ ALEYG+PPT GLG+GIDR++ML T  ++IRDV+ FP ++ K
  S:     1 MLREFREQ---RIKEIEQLKRKNINPYP-NRFDKTHTSEMIKKEFEGLNPGEVKDDVFVSTAGRIMSLRKHGKSAFFHIKDFYGRIQAYIRKDVVGEEAYEFFKEHIAIGDIVGVKGNVFKSKTGEITILIKEIKLLNKPLRPMPEKWHGIKDKEVLYRQRYVDMIANDDTLNRFKVRFEVIKLIRDFLNSKGFIEVETPILEYVTGGASARPFVTHLNVFDIEMYMRIATELYLKRFIVGGFEKVYELGKNFRNEGLSYKHHPEFTSIEIYQAYADYEDMMNLTEELFVYIVEKLFGTTKIKYQNVELDFSRPWRRIKMRDFIKEHLGVDILE-DSMGRMMDVLEEHGVEVEIRDK--GHMIEKLW-DLVEDKVVQPTFLLEHPVEISPLAKKHREDPRVTERFELIIYGREMANAFSELNDPVDQYERFLKQVELREAGDEEAQMMDRDFVRALEYGMPPTGGLGIGIDRLVMLLTNSATIRDVIAFPLVRLK 487
>gi|167751088|ref|ZP_02423215.1| hypothetical protein EUBSIR_02073 [Eubacterium siraeum DSM 15702] >gi|167656006|gb|EDS00136.1| hypothetical protein EUBSIR_02073 [Eubacterium siraeum DSM 15702] (503 aa)
Score = 1022, Expect = 5.8e-109, Identities = 233/483 (48%), Positives = 318/483 (65%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + ++Q  IR EKL +L+   ++PYEI K   T         F +L+      ++ +AGR+ + R      F  IRD  G  Q Y+    + +   + F K  DLGDIV + G  F+T++GE+++  K IK++SK+L PLPEKWHGL+D+E R R RY+DLI N +    FV R  IL+ IR F+DS+ YLEV+TPVLH +  GA ARPF+T HN L+ + YLRI TEL LK+LIVGGFD+VYE+GRIFRNEGMD+THNPEFTS+E+Y AY +   MM L E +++ VA K      V     EI + + ++R+ M + +K+ TG+D+    S+ +A   AK  + +     +T G ++   FEEF E K IQPT +Y +P++ SPL+K+   +P FT+RFE FIN  E+ NAF+ELNDPIDQ ERF  QV EK      A ++D DF+ ALEYGLPPT GLG+G+DR +ML T+ +SIRDVLLFP MK
  S:    19 QLDEQHRIRIEKLNDLKANGKNPYEITKFDFTHKAQQIRDNFEELE----EKDVMIAGRITSWRDMGKANFIDIRDDSGRMQVYVRIDDIGEDNFKEFKK-WDLGDIVGVSGFVFKTRRGEISVHAKSIKLLSKSLLPLPEKWHGLKDKEERYRKRYLDLIANPEIKDTFVKRSMILREIRSFLDSKGYLEVDTPVLHTLEIGAAARPFVTHHNALDIDMYLRIETELYLKRLIVGGFDRVYEVGRIFRNEGMDATHNPEFTSIEMYQAYTDYYGMMDLIEEMYRTVALKVCGTDTVPYQGKEIEIGKPWKRMTMKEAVKEYTGLDYDSWTSDADAVAQAKTKHAEIAD-TATKGEVLIELFEEFVEEKLIQPTIIYDYPVENSPLAKRKPTDPAFTERFEYFINACEFGNAFSELNDPIDQRERFTKQVMEKRKQGANA-QIDEDFLTALEYGLPPTGGLGMGLDRFVMLLTDSASIRDVLLFPTMK 499
>gi|196188731|gb|EDX83695.1| lysyl-tRNA synthetase [Synechococcus sp. PCC 7335] (524 aa)
Score = 1022, Expect = 7.0e-109, Identities = 216/478 (45%), Positives = 317/478 (66%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLE-------YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           R +K+++L++A   PY   +   T +     +KFA L T    +  + +AGR++A R+ FG      ++D  G  Q YL KK +  +M E       +  ++ D GDI+   G+  RT KGEL++ VK   +++K+L PLP+K+HGL D   R R RYVDLIVN +    F  R +I   IR+ +D   YLEVETPVL    GGA ARPF+T+HNTL+   YLRIATEL LK+++VGGF+KV+E+GR+FRNEG+ + HNPEFT++E+Y AY + E MM LTE + + +   +   K V   GE EI   + ++RI M D ++++TG+DF ++K   +A++ AK+  +   +   ++GH++N  FE+  E   +QPTF+  +P+++SPLSK     PG  +RFELFI  +E AN F+EL DP+DQ ER E Q  +K  GN EA  +D DF+ ALEYG+PPT G+G+GIDR++M+ T+ +SIRD + FP +K +K
  S:    27 RLQKVEDLKQAGLQPYAY-RWEVTHSAAQLQAKFADLATGAEADFEVSVAGRIMA-RRVFGKLAFFTLQDQTGTIQLYLEKKTIQAAMGEADEQAFNHLKQLTDAGDILGARGTIKRTDKGELSVKVKHYAMLTKSLLPLPDKFHGLTDVAKRYRQRYVDLIVNPEVRDTFRKRAKITAAIRRHLDQLGYLEVETPVLQSEPGGAEARPFVTYHNTLDMELYLRIATELHLKRMVVGGFEKVFELGRVFRNEGISTRHNPEFTTIEMYQAYGDYEDMMSLTETMIEQIVVEVTGSKGVTYQGE-EISFARPWQRITMHDAVREKTGIDFVQIKDLAKAKQAAKEAGINEVEACESIGHVLNEAFEQKVETTLVQPTFITDYPVEISPLSKPHRSKPGLVERFELFIVGRETANGFSELTDPVDQRERLELQAAKKEAGNLEAHSVDEDFLTALEYGMPPTVGMGIGIDRLVMVLTDAASIRDAIAFPLLKSEK 516
>gi|60683052|ref|YP_213196.1| lysyl-tRNA synthetase [Bacteroides fragilis NCTC 9343] >gi|81313892|sp|Q5L9E5|SYK_BACFN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|60494486|emb|CAH09283.1| putative lysyl-tRNA synthetase, heat inducible [Bacteroides fragilis NCTC 9343] (575 aa)
Score = 1019, Expect = 1.3e-108, Identities = 215/486 (44%), Positives = 317/486 (65%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  L  L+    +PY   +        D  ++F   K   T   + +AGR+++ R     +F  ++D  G  Q Y+ +  +     K M    F ++LDLGD + I G  FRTQ GE+++  +K+ +++K++KPLP         +   ED ELR R RYVDL VN+    +F+ R ++   +R++ +S+ Y+EVETP+L  I GGA ARPF+T HN L+   Y+RIA+EL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y AY++  +MM  TE + + +   +     VK+G+N I     ++R+ M+  IK+ TG D   +   Q  +E+ KK N++ +      G +I+  F EFCE   IQPTF+  +PI++SPL+KK   NP  T+RFEL +N KE  NA++ELNDPIDQ ERFE Q+K    G+DEA+ +D DF+ ALEYG+PPT+G+G+G+DR+ ML T +S+I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSLNELRAMGIEPYPAAEYVTNAFSTDIKAEF---KDDETPRQVSVAGRMMSRRIMGKASFIELQDSKGRIQVYITRDDICPGEDKEMYNTVFKRLLDLGDFIGIEGFVFRTQMGEISIHAQKLTVLAKSIKPLPIVKYKDGVTYDSFEDPELRYRQRYVDLAVNEGVKDIFIKRSKVYSSMREYFNSKGYMEVETPILQAIAGGAAARPFMTHHNALDIPLYMRIASELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMEIYVAYKDYNWMMEFTEKMIEKICLDVNGTTEVKVGDNIINFKAPYKRVTMLGAIKEHTGYDLTGMNEEQ-IREVCKKLNMEIDDTMGK-GKLIDEIFGEFCEGTYIQPTFITDYPIEMSPLTKKHRDNPELTERFELMVNGKELCNAYSELNDPIDQLERFEDQMKLSEKGDDEAMIIDKDFVRALEYGMPPTSGMGIGMDRLTMLMTGQSTIQEVLFFPQMRPEK 502
>gi|53715094|ref|YP_101086.1| lysyl-tRNA synthetase [Bacteroides fragilis YCH46] >gi|81381368|sp|Q64PM9|SYK_BACFR Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|52217959|dbj|BAD50552.1| lysyl-tRNA synthetase [Bacteroides fragilis YCH46] (575 aa)
Score = 1019, Expect = 1.3e-108, Identities = 215/486 (44%), Positives = 317/486 (65%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  L  L+    +PY   +        D  ++F   K   T   + +AGR+++ R     +F  ++D  G  Q Y+ +  +     K M    F ++LDLGD + I G  FRTQ GE+++  +K+ +++K++KPLP         +   ED ELR R RYVDL VN+    +F+ R ++   +R++ +S+ Y+EVETP+L  I GGA ARPF+T HN L+   Y+RIA+EL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y AY++  +MM  TE + + +   +     VK+G+N I     ++R+ M+  IK+ TG D   +   Q  +E+ KK N++ +      G +I+  F EFCE   IQPTF+  +PI++SPL+KK   NP  T+RFEL +N KE  NA++ELNDPIDQ ERFE Q+K    G+DEA+ +D DF+ ALEYG+PPT+G+G+G+DR+ ML T +S+I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSLNELRAMGIEPYPAAEYVTNAFSTDIKAEF---KDDETPRQVSVAGRMMSRRIMGKASFIELQDSKGRIQVYITRDDICPGEDKEMYNTVFKRLLDLGDFIGIEGFVFRTQMGEISIHAQKLTVLAKSIKPLPIVKYKDGVTYDSFEDPELRYRQRYVDLAVNEGVKDIFIKRSKVYSSMREYFNSKGYMEVETPILQAIAGGAAARPFMTHHNALDIPLYMRIASELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMEIYVAYKDYNWMMEFTEKMIEKICLDVNGTTEVKVGDNIINFKAPYKRVTMLGAIKEHTGYDLTGMNEEQ-IREVCKKLNMEIDDTMGK-GKLIDEIFGEFCEGTYIQPTFITDYPIEMSPLTKKHRDNPELTERFELMVNGKELCNAYSELNDPIDQLERFEDQMKLSEKGDDEAMIIDKDFVRALEYGMPPTSGMGIGMDRLTMLMTGQSTIQEVLFFPQMRPEK 502
>gi|148654264|ref|YP_001274469.1| lysyl-tRNA synthetase [Roseiflexus sp. RS-1] >gi|172048100|sp|A5UPG6|SYK_ROSS1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|148566374|gb|ABQ88519.1| lysyl-tRNA synthetase [Roseiflexus sp. RS-1] (489 aa)
Score = 1018, Expect = 2.1e-108, Identities = 211/485 (43%), Positives = 303/485 (62%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ-----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + N+ +  R  KL+ L+ A  DPY   +  RT TIG   + F +L        + +AGR+V  R+      F  I D  G  Q +L++  +     + F   LD  DIVE  G+  RTQ+GE ++ V+++ +++K+L P PEKWHGL D E R R RY+DLIVN +   VF  R +I+  +R+F+D + +LEVETP L PI GGA+ARPFIT HN L+++ YLRIA EL LK+LIVGGF++VYEI ++FRNEG+D THNPEFT ME Y AY +   MMRL E+L++ +A  +     +    + I     ++R+ +   I   TG+D  E+   +  Q   +   +K +   S  G  ++  F  + + + IQPTFV  HP+ +SPL+K+    P   +RFE  +   E  NAF ELNDP+DQ +RF  Q +    G+DEA +MD+DF+ AL YG+PPT GLG+GIDR +MLFT++ SIR+V+LFPHM+ +
  S:     2 ELNELQQQRLAKLERLRAAGIDPYP-PRTRRTHTIGFVLASFDQLMERG--EQVTVAGRIVGARRILGKLAFAHIEDESGRIQIWLSRGDIGDEWFDRFRDDLDTFDIVEATGTLRRTQRGEPSVFVERLGVLAKSLNPPPEKWHGLSDIEERHRQRYLDLIVNPEVRDVFRTRAKIVSTMRRFLDERGFLEVETPTLQPIYGGASARPFITHHNQLKQDLYLRIAVELYLKRLIVGGFERVYEISKVFRNEGVDRTHNPEFTMMECYQAYADYNDMMRLVEDLYRTLALEVAGSTTIVFQGHTIDFGPAWQRVSIPTAIAARTGIDILELTELEPLQRAIRAVGLKVDLKPS-WGKQVDEIFSVYVQPELIQPTFVIDHPVALSPLAKRRPDQPLLVERFEPIVAGMEVGNAFTELNDPLDQEQRFLEQGRAYDAGDDEAQQMDIDFLNALMYGMPPTGGLGIGIDRTVMLFTDQPSIREVILFPHMRPR 488
>gi|37522925|ref|NP_926302.1| lysyl-tRNA synthetase [Gloeobacter violaceus PCC 7421] >gi|39932049|sp|Q7NG18|SYK_GLOVI Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|35213927|dbj|BAC91297.1| lysyl-tRNA synthetase [Gloeobacter violaceus PCC 7421] (497 aa)
Score = 1017, Expect = 2.4e-108, Identities = 212/479 (44%), Positives = 311/479 (64%)
  Q:     8 QELIRREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSM----LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGE-NEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +E +RR +L+  ++    NQ+PY   +  RT   GD  +K+  L+      + + +AGR+VA R      F  ++D  G  Q Y +KK++ +SM     ++ +K+ D GD +   G+  RT++GEL++ V + +++ K++ PLP +++GL D + R R RY+DLI N    + F  R  I++ IR+F+D + +LE+ETPVL    GGA ARPF T HN L  + +LRIATEL LK+L+VGGF+KVYE+GRIFRNEG+ + HNPEFT++E+Y AY +   +M L E L + VA  +      + E N I L   FRRI M D + Q TGV    ++  ++A  LA+   V+     S +G I+   FEE CEAK  QPTFV  +P+++SPL+K     P   +RFEL+IN +E A+ F+ELNDP+DQ  R EAQ K K+ G+ EA   D DF+ A+E+GLPPT G+G+GIDR++ML T+  SIRDV+ FP ++
  S:     3 EEDLRRTRLEKAEQWRVHNQNPYPY-RYERTHMAGDLQAKYKDLENGQEVEDAVSVAGRIVARRVLGSVAFFGLQDDSGTIQLYFDKKRIRESMGADAFKWLDKLTDTGDFIGAHGTIRRTERGELSVYVHEYELLCKSILPLPSEYYGLTDVQKRYRQRYLDLIANPGVRETFRKRALIVREIRRFLDERGFLEIETPVLQTEAGGAAARPFTTHHNALGLDMFLRIATELHLKRLVVGGFEKVYELGRIFRNEGISTRHNPEFTTVEIYEAYSDYFDIMDLVETLLRAVAHIVLGSTELVCEGNTIDLGAPFRRITMFDLVAQMTGVALAGLRDGEKAARLAEAVGVEVTAGAS-VGQILYQLFEEKCEAKLTQPTFVLDYPVEISPLAKAHRSVPNMVERFELYINGRETADGFSELNDPVDQRARLEAQAKAKAAGDLEAHPFDEDFLTAIEHGLPPTGGVGIGIDRLVMLLTDSPSIRDVIAFPTLR 492
>gi|194476928|ref|YP_002049107.1| lysyl-tRNA synthetase [Paulinella chromatophora] >gi|171191935|gb|ACB42897.1| lysyl-tRNA synthetase [Paulinella chromatophora] (519 aa)
Score = 1016, Expect = 2.8e-108, Identities = 218/475 (45%), Positives = 302/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEI--EKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSM------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEK--HQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK + L    Q PY I  E       + +  S++        N  + +AGRV+A R      F  + D  G  Q Y+ K  ++ SM        +   ++D GD++ I+G+  RT++GEL++ VKK  +++K+L PLP+KWHGL D E R R RY+DLIV+  + +    R +++  IR+++D + +LE+ETPVLH   GGA ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEG+ S HNPEFTS+E+Y AY +   MM LTE L   +A  +     ++  E  I LT  +RR  M + +K+ TG+DF      + A E      +   K   QS++GH++N  FE   E   IQPTFV  +PI++SPL++K     G  +RFELFI  +E ANAF+EL DPIDQ ER EAQ   +  G+ EA  +D DF++ALE G+PPT GLG+GIDR+ ML T   SIRDV+ FP +K
  S:     8 RLEKAQILNSLGQGPYAIRFEPTHHNSILQE--SQYDLFNGEERNLTVAIAGRVMAKRVMGKLAFFTLADETGLIQLYIEKATLAISMSGDSLAFSHLTSLVDTGDLIGIYGTLRRTERGELSVRVKKWHMLTKSLHPLPDKWHGLADVEKRYRQRYLDLIVSPQTRETLRRRAQVVSGIRRWLDEREFLEIETPVLHVEAGGAEARPFITQHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGVSSRHNPEFTSVEIYQAYADYTDMMDLTEQLIDTIANQVCGTSKIEYQEEIIDLTPPWRRATMHELVKEATGLDFTLFSDYETASEAITLSGIMLSKLDAQSSVGHLLNYIFENAVEHTLIQPTFVTDYPIEISPLARKHRNKSGLVERFELFIVGRETANAFSELIDPIDQRERLEAQQLRRQAGDLEANMIDEDFLQALEVGMPPTGGLGIGIDRLTMLLTNSPSIRDVIAFPLLK 495
>gi|126180281|ref|YP_001048246.1| lysyl-tRNA synthetase [Methanoculleus marisnigri JR1] >gi|125863075|gb|ABN58264.1| lysyl-tRNA synthetase [Methanoculleus marisnigri JR1] (508 aa)
Score = 1016, Expect = 3.0e-108, Identities = 213/473 (45%), Positives = 303/473 (64%)
  Q:    14 EKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +KL+ L+E     Y      R  T+ +   +F+ ++   +   +  AGRV  +RQ     F  I D  G  Q YL K  + +   + F + +D GDIV + G  FRT+ GE+T+ V + ++++K++ PLPEK+HGL++ E R R RY+DLI+N++S + F  R RI+ ++RQF+  ++YLE ETP L PI GGANARPF T HN L++  YLRIA EL LK+L+VGGFDKV+EI + FRNE +D+ HNPEFT +EVY AY +   MM LTE +  ++A K L   V     +++  ++ +RR+ M + +++  G+DF    S +E      +H V+  +  +T G  + LFFE F E   IQPTF+Y  PI+ SPL+KK     G T+RFELFI   E AN F+ELNDP+DQ  R E Q  ++  G+ EA  +D DFI AL YG+PPT G+G+GIDR++ML T K SI++VLLFP MK
  S:    15 DKLQELRERGVTVYPY-TFDRRDTVEEIKERFSAIEHDKSEEEVSTAGRVYVVRQHGKTIFADIGDSEGRIQLYLRKNDLGEEQFDLFKQYVDAGDIVGVVGHVFRTKMGEITVWVDRFELLTKSVCPLPEKFHGLKNVETRYRQRYLDLIMNEESRETFRARSRIISLLRQFLFERDYLEFETPTLQPIYGGANARPFTTHHNALDQKLYLRIAPELYLKRLVVGGFDKVFEIAKNFRNEDIDTNHNPEFTMVEVYEAYRDYNDMMNLTEEILSHLAEKVLGTTVCSFAGHDLDFSRPWRRLTMEEAVREYAGIDF-PAMSLEELHAFGLEHCVEGCESAATRGEYLVLFFEHFGEKHLIQPTFIYDFPIENSPLAKKHRSKEGLTERFELFIAGMEMANGFSELNDPLDQKARLEQQDAKRRKGDLEAQMIDYDFINALGYGMPPTGGVGIGIDRLVMLLTGKDSIKEVLLFPQMK 490
>gi|167626876|ref|YP_001677376.1| lysyl-tRNA synthetase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596877|gb|ABZ86875.1| lysyl-tRNA synthetase [Francisella philomiragia subsp. philomiragia ATCC 25017] (560 aa)
Score = 1015, Expect = 4.3e-108, Identities = 217/481 (45%), Positives = 309/481 (64%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAK-----LKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           N Q  +R+EKL+ L E N          R +      +++A+     L+         + GRVV  R     +F  ++D+ G  Q YL K  + +   E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTEN+  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+ LA+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE F+  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    68 NSQITLRKEKLQALAEQNNGISHPNSFRRNVVAHALQNQYAQYSKQELEELEDKKQYNITGRVVLRRVMGKASFITLQDYSGRIQVYLKKSDLPEGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEASHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVSFIRNYFDKLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYMAYADYNDLMDLTENMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLATFESAKALAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFVGAREIANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 558
>gi|118496782|ref|YP_897832.1| lysyl-tRNA synthetase [Francisella tularensis subsp. novicida U112] >gi|194324537|ref|ZP_03058309.1| lysyl-tRNA synthetase [Francisella tularensis subsp. novicida FTE] >gi|118422688|gb|ABK89078.1| lysyl-tRNA synthetase [Francisella tularensis subsp. novicida U112] >gi|194321372|gb|EDX18858.1| lysyl-tRNA synthetase [Francisella tularensis subsp. novicida FTE] (576 aa)
Score = 1013, Expect = 6.5e-108, Identities = 217/485 (44%), Positives = 312/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     + + ++A     +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    80 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELHDRYADKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVSFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 574
>gi|151571350|gb|EDN37004.1| lysine-tRNA ligase [Francisella tularensis subsp. novicida GA99-3548] (576 aa)
Score = 1013, Expect = 6.6e-108, Identities = 217/485 (44%), Positives = 311/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     +  +++A     +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ +  VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    80 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELQARYADKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKARGVFKVRSKVVSFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 574
>gi|150006587|ref|YP_001301331.1| lysyl-tRNA synthetase [Bacteroides vulgatus ATCC 8482] >gi|166229794|sp|A6L7P5|SYK_BACV8 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|149935011|gb|ABR41709.1| lysyl-tRNA synthetase [Bacteroides vulgatus ATCC 8482] (576 aa)
Score = 1012, Expect = 8.5e-108, Identities = 215/486 (44%), Positives = 317/486 (65%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  L  L+    +PY   +        D  ++F   K       + +AGR+++ R     +F  ++D  G  Q Y+ +  +    +K M    F ++LDLGD + I G  FRTQ GE+++  KK+ ++SK++KPLP         +   ED ELR R RYVDL VN++   +F+ R ++   +R++ +S+ Y+EVETP+L  I GGA ARPFIT HN L+   Y+RIA+EL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y AY++  +MM  TE + + +   +     VK+G+N I     ++R+ M+D IK+ TG D   +   Q  +E+ +K N++ +      G +I+  F EFCE   IQPTF+  +P ++SPL+K    NP  T+RFEL +N KE  NA++ELNDPIDQ ERFE Q+K    G+DEA+ +D DF+ ALEYG+PPT+G+G+G+DR+ ML T +S+I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSLNELRAMGIEPYPAAEYVTNAFSTDIKAEF---KDDEEPRKVSVAGRMMSRRVMGKASFIELQDSKGRIQVYITRDDICPDENKEMYNTVFKRLLDLGDFIGIEGFVFRTQMGEISIHAKKLTVLSKSIKPLPIVKYKDGVAYDKFEDPELRYRQRYVDLAVNEEIKDIFIKRSKVYSSMREYFNSKGYMEVETPILQSIAGGAAARPFITHHNALDMPLYMRIASELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMEIYVAYKDYNWMMEFTEKMIEKICLDVNGTTQVKVGDNIIDFKAPYKRVTMLDSIKEHTGYDLTGMNEEQ-IREVCQKLNMEIDDTMGK-GKLIDEIFGEFCEGTYIQPTFITDYPKEMSPLTKIHRSNPDLTERFELMVNGKELCNAYSELNDPIDQLERFEEQMKLSEKGDDEAMIIDKDFVRALEYGMPPTSGMGIGMDRLTMLMTGQSTIQEVLFFPQMRPEK 502
>gi|187932242|ref|YP_001892227.1| lysyl-tRNA synthetase [Francisella tularensis subsp. mediasiatica FSC147] >gi|187713151|gb|ACD31448.1| lysyl-tRNA synthetase [Francisella tularensis subsp. mediasiatica FSC147] (576 aa)
Score = 1012, Expect = 9.3e-108, Identities = 217/485 (44%), Positives = 312/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     +  +++A     +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    80 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELQARYADKTKQELEELDNKQQYNLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVNFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYIAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 574
>gi|77918852|ref|YP_356667.1| lysyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] >gi|77544935|gb|ABA88497.1| lysyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] (494 aa)
Score = 1012, Expect = 9.3e-108, Identities = 218/483 (45%), Positives = 309/483 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAK---LKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGH--IINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + ND  L RR KL   +    +PY       T T GD  +   +       N N++  LAGR++A R      F  I+D +G  Q ++ +  V +   + F K LD+GDIV + G PFRT+  EL+L    +++++K+L+PLPEKWHGL D E+R R RY+DLIVN D  ++F  R +I+ +IR FM   ++LEVETP++ P+ GGA ARPF+T HNTL+ + +LRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY N E +M  TE L  +VA K +       G  E+ LT  + R+ + + I +   V+   ++   +    A+   + F+    T+G+  ++   F+E  E K   PTF+  +P +VSPLS+K+  NP    RFELF+  +E ANAF+ELNDPIDQ +RF  Q+ EK  G+DEA  MD D+I ALEYGLPPTAG G+GIDR++ML T+ +SIR+V+LFP ++
  S:     3 ELNDLLLQRRAKLDEFRGEGVNPYA-NDFCVTATSGDIVAAHGEQDGAALENINHHYALAGRMMARRDFGKAAFIQIQDRHGRLQVFVRRDNVGEEAFQMFRK-LDIGDIVGVTGKPFRTKTNELSLRADSLRLLTKSLQPLPEKWHGLTDVEMRYRQRYLDLIVNPDVQEIFKKRSQIVSLIRNFMVDNDFLEVETPMMQPVAGGATARPFMTHHNTLKMDLFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISIQHNPEFTMMEFYQAYANYEDLMDFTEKLICHVAEKVVGSLTFTYGGREVDLTAPWDRLTVKEAILKYGDVEPEVLEDKDQCLAYARSLGLDFD---DTIGYGKLLTELFDEVAEPKLWNPTFITQYPTEVSPLSRKNEDNPEVVDRFELFVVGRELANAFSELNDPIDQKDRFAKQLLEKEAGDDEAHAMDEDYIRALEYGLPPTAGEGIGIDRLVMLLTDAASIREVILFPQLR 490
>gi|160901648|ref|YP_001567229.1| lysyl-tRNA synthetase [Petrotoga mobilis SJ95] >gi|160359292|gb|ABX30906.1| lysyl-tRNA synthetase [Petrotoga mobilis SJ95] (502 aa)
Score = 1012, Expect = 9.5e-108, Identities = 223/480 (46%), Positives = 319/480 (66%)
  Q:     7 DQELIRREKLKNLQEANQDPYE--IEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKK--HNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           D   IR  +LK ++E   +PY+   +K   +  I D      +      +      GR++ LR+     F  ++D +G  Q Y+   +V +   ++F + +D+GD + I G PF+T+ GELTL    I+++SKA++PLPEKWHGL+D+E+R R RYVD+I N D++K    R  I+K IR++++++ +LEVETPVL  I+GGANARPFIT  N  + + YLRIATEL LK+L+VGG +KVYEIG+IFRNEG+ + HNPEFTS+E+Y A+ +   MM LTE+L   + K +  K  ++  GE EI  T  F+RI M +FI++  G+D  E  S+QE +E  K     V+ E     L  + +L      E K +QPTFV  +PI++SPL+K+   +P  T+RFEL I   E ANAF+ELNDP DQ+ERF+ Q++ K LG++EA  MD+DFI ALEYGLPPT GLG+GIDR+ ML T+  +IRD++ FP +K
  S:     2 DLRNIRMHQLKEMREKGYNPYKYNFQKNYTSQQIKDLFDSKIEAGQQLPDEVFNFGGRLMNLRKHGKSAFADLKDEFGRIQVYIRLDQVGQENYDFFKEYIDIGDWIGIKGYPFKTRTGELTLLALDIELLSKAIRPLPEKWHGLKDKEVRYRQRYVDMIANDDTIKTLRTRFLIIKYIREYLNNKGFLEVETPVLQSIMGGANARPFITHLNVYDIDMYLRIATELHLKRLVVGGMEKVYEIGKIFRNEGVSNKHNPEFTSIELYQAFADYNDMMELTEDLLYNITKKVHNKAKIMYQGE-EIDFTPPFKRIKMREFIQENLGIDIVEA-SDQELKEFLKNKGEEVEIEDRYHYLDKVWDL-----VEDKIVQPTFVMDYPIELSPLAKRKKDDPRLTERFELIIKGNEIANAFSELNDPQDQFERFKKQMELKELGDEEAQMMDLDFIRALEYGLPPTGGLGIGIDRVCMLLTDTPTIRDIIPFPIVK 484
>gi|169836741|ref|ZP_02869929.1| lysyl-tRNA synthetase [candidate division TM7 single-cell isolate TM7a] (494 aa)
Score = 1012, Expect = 1.0e-107, Identities = 221/483 (45%), Positives = 320/483 (66%)
  Q:     6 NDQELIRRE--KLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ND  +I+ +  K+  L+E   +PY  + EKV+    I  ++    K+         K AGR++A R+     FG I+D  G  Q+Y+ K++V +   E + K + LGD + + G  FRT+ GELTL V   +++SK ++PLPEK+HGL + E R R RYVDL++N++ M+    R ++++  R +++ + + EVETP++HPI GGA ARPF+T HN L+   +LRIA EL LK+L+VGGF+KV+EI R FRNEG+   HNPEFT ME+Y AY +   MM LTE+L   +   L  K  ++  +  I L + +RR+ M + +K+ TG DF  + S++EA E AK+  +  EK ++ T   I+NLFFEE  E   I PTF+  +P ++SPLSK       +  RFELFI+ +E+ANA++ELNDP DQ ERFE QVK K  G+DEA  MD+D+I ALEYG+PP  GLG+GIDR++ML T  +SIRDV+LFP ++ +
  S:     7 NDNGIIKEKLKKVAELKEIGIEPYGRKYEKVNDIAEINQYDETCDKV--------FKTAGRIIAFRRMGKNGFGKIQDPTGQIQYYVKKEEVGEDQYEIYKK-MGLGDFIGLEGHLFRTKTGELTLRVDSFEVLSKNVRPLPEKFHGLTNVETRYRQRYVDLVMNREVMETMKKRFQVIRFFRSYLEKKGFTEVETPMMHPIAGGATARPFVTHHNALDMELFLRIAPELYLKRLLVGGFEKVFEINRSFRNEGISVKHNPEFTMMELYQAYADFNDMMDLTEDLISSLTFELHGKYEIEYEDKTINLAKPWRRVTMKEAVKEATGFDFDSISSDEEAIEKAKEFGIPLEKDKTYTKFGILNLFFEEKVEETLINPTFITEYPKEISPLSKNQKGETEWVDRFELFISGREFANAYSELNDPRDQKERFEEQVKLKEAGDDEAQGMDLDYIRALEYGMPPAGGLGIGIDRLVMLQTNSASIRDVILFPTLRKE 490
>gi|153808814|ref|ZP_01961482.1| hypothetical protein BACCAC_03114 [Bacteroides caccae ATCC 43185] >gi|149128640|gb|EDM19858.1| hypothetical protein BACCAC_03114 [Bacteroides caccae ATCC 43185] (576 aa)
Score = 1012, Expect = 1.0e-107, Identities = 213/486 (43%), Positives = 321/486 (66%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL--GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  L  L+    DPY   +        D  ++F   K  +    + +AGR+++ R     +F  ++D  G  Q Y+ +  +     K +    F ++LDLGD + I G  FRTQ GE+++  KK+ +++K++KPLP         +   ED ELR R RYVDL+VN    + F+ R  ++K +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L+ + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y  Y++  +MM  TE L + +  ++      + + + I     +RR+ ++D IK++TG D    KS +E +++ K+  +K E+   T+  G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL +N KE ANA++ELNDPIDQ ERF+ Q++    G+DEA+ +D DF+ +L+YG+PPT+G+G+GIDR++ML T +++I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSLNELRAMGIDPYPAAEYVTNAFSTDIKAEF---KDEDEPRQVSVAGRIMSRRVMGKASFIELQDSKGRIQVYITRDDICPGEDKELYNAVFKRLLDLGDFIGIEGFVFRTQMGEISIHAKKLTVLAKSIKPLPIVKYKDGVAYDSFEDPELRYRQRYVDLVVNDGVKETFLKRATVVKTLRNALDEAGYTEVETPILQSIAGGASARPFITHHNSLDIDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDKTHNPEFTCMELYVQYKDYNWMMNFTEKLLERICIAVNGCTESVVDGKTISFKAPYRRLPILDAIKEKTGYDL-NGKSEEEIRQVCKE--LKMEEIDDTMGKGKLIDEIFGEFCEGTYIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKELANAYSELNDPIDQEERFKEQMRLADKGDDEAMIIDQDFLRSLQYGMPPTSGIGIGIDRLVMLMTGQTTIQEVLFFPQMRPEK 503
>gi|151569875|gb|EDN35529.1| hypothetical protein FTCG_01528 [Francisella tularensis subsp. novicida GA99-3549] (575 aa)
Score = 1011, Expect = 1.1e-107, Identities = 217/485 (44%), Positives = 312/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     + + ++A     +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    79 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELHDRYADKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVSFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 573
>gi|134302700|ref|YP_001122668.1| lysyl-tRNA synthetase [Francisella tularensis subsp. tularensis WY96-3418] >gi|134050477|gb|ABO47548.1| Lysyl-tRNA synthetase [Francisella tularensis subsp. tularensis WY96-3418] (560 aa)
Score = 1011, Expect = 1.1e-107, Identities = 217/485 (44%), Positives = 312/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     +  +++A     +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    64 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELQARYADKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVNFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 558
>gi|83856523|ref|ZP_00950052.1| lysyl-tRNA synthetase [Croceibacter atlanticus HTCC2559] >gi|83850323|gb|EAP88191.1| lysyl-tRNA synthetase [Croceibacter atlanticus HTCC2559] (563 aa)
Score = 1011, Expect = 1.2e-107, Identities = 223/486 (45%), Positives = 307/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRV----VALRQTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE++RREKL  L+E   +PY  +      T  D  + F   K       + +AGR+    +  + +FG ++D  G  Q Y N+ ++     K++    F K+LDLGD + I G  F TQ GE T+ VK   I+SK+L+PLP          +    D ELR R RYVDL+VN    +VFV R ++   +R F +   Y EVETP+L PI GGA A+PFI+ HN L+   Y+RIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y AY++  +MM  TENL ++ A ++  K     GE+ +     + R+ M D IK  TG D    K+ +E  E AK   +  ++     G +I+  F E CE   IQPTF+  +P ++SPL K+   NP  T+RFEL +  KE ANA++ELNDPIDQ ERFEAQ+K    G+DEA+ +D DF+ ALEYG+PPT+GLG+G+DR+IM  T   SI++VL FP MK +K
  S:     2 QLSEQEIVRREKLSQLRELGINPYPADLYPVKQTTADIKNNFEDGK------KVVIAGRLLQKNIQGKASFGQLQDSAGRIQVYFNRDEICEGEDKTLYNTVFKKLLDLGDFIGIEGELFTTQVGEKTVMVKNFSILSKSLRPLPLPKKDKDGNVYDEFNDPELRYRQRYVDLVVNPKVKEVFVKRTKLFNAMRNFFNDAGYFEVETPILQPIPGGAAAKPFISHHNALDIPLYMRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMEFTENLLEHCAVAVNGKTEATFGEHTVNFKAPYARVTMTDSIKHFTGFDI-SGKTEKELYEAAKGMGIDVDETMGK-GKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKEHRDNPELTERFELMVCGKEIANAYSELNDPIDQRERFEAQLKLADRGDDEAMFIDQDFLRALEYGMPPTSGLGIGMDRLIMFLTNNQSIQEVLFFPQMKPEK 497
>gi|86605053|ref|YP_473816.1| lysyl-tRNA synthetase [Synechococcus sp. JA-3-3Ab] >gi|86553595|gb|ABC98553.1| lysyl-tRNA synthetase [Synechococcus sp. JA-3-3Ab] (508 aa)
Score = 1010, Expect = 1.4e-107, Identities = 213/479 (44%), Positives = 313/479 (65%)
  Q:     8 QELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLA--GRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEY----FNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQ---ELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           Q   R EK ++LQE    PY       T    +  ++FA L+      ++++A  GR+ A R      F  ++D  G  Q YL K+++++ M E      +K+LD+GD +   G   RT+KGEL++ V + ++++KAL PLP+KWHGL D E R R RYVDLIVN +  +  +DR +I++ +RQ ++ + ++E+ETPVL  I GGA ARPFIT HN L+ + YLRIATEL LK+L+VGG ++VYEIGR+FRNEG+ + HNPEFTS+E Y A+ +   MM LTE L    A +++  +    + E I LT  +RR+ + + +++ TG+ F +V+    A+    LA++       H S  G ++   FE  CE++  QPTFV  +P++V PL+K     PG  +RFELFI  +E ANA++EL DP+DQ +R EAQ   K+ G++EA  +D DF+ ALEYGLPPT GLG+GIDR+ ML  + +SIRDV+ FP ++
  S:    12 QRAARLEKARHLQEQGILPYAYS-FPVTHLAAELQAQFADLEPGAEREDVQVAVAGRIRARRVMGKLAFFTLQDRSGTIQLYLEKQRLTQHMGELAFKNLDKLLDVGDWLGAKGCLKRTEKGELSVRVDEYQVLTKALLPLPDKWHGLRDVEKRYRQRYVDLIVNPEVKQTLLDRAKIVRSLRQTLEERGFVEIETPVLQVIPGGAEARPFITHHNALDLDLYLRIATELHLKRLVVGGIERVYEIGRVFRNEGISTRHNPEFTSLEAYQAFADYHTMMELTEALVCNAALAVRGSLQITYQGETIDLTPPWRRVTIQELVEEATGI-FIDVEKGSTAELLPALAQQGIPDLSPHDSP-GKLLVKAFEHCCESRLRQPTFVLDYPLEVCPLTKPHRSKPGLAERFELFIVGRETANAYSELTDPVDQRQRLEAQAALKAAGDEEAHFLDEDFLTALEYGLPPTGGLGIGIDRLAMLLCDAASIRDVIAFPLLR 501
>gi|160885236|ref|ZP_02066239.1| hypothetical protein BACOVA_03235 [Bacteroides ovatus ATCC 8483] >gi|156109586|gb|EDO11331.1| hypothetical protein BACOVA_03235 [Bacteroides ovatus ATCC 8483] (575 aa)
Score = 1010, Expect = 1.6e-107, Identities = 213/486 (43%), Positives = 320/486 (65%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL--GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  L  L+    DPY   +        D  ++F   K       + +AGR+++ R     +F  ++D  G  Q Y+ +  +     K +    F ++LDLGD + I G  FRTQ GE+++  KK+ +++K++KPLP         +   ED ELR R RYVDL+VN    + F+ R  ++K +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L+ + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y  Y++  +MM  TE L + +  ++      + + + I     +RR+ ++D IK++TG D    KS +E +++ K+  +K E+   T+  G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL +N KE ANA++ELNDP+DQ ERF+ Q++    G+DEA+ +D DF+ AL+YG+PPT+G+G+GIDR++ML T +++I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSLNELRAMGIDPYPAAEYVTNAFSTDIKAEF---KDDEEPRQVSVAGRIMSRRVMGKASFIELQDSKGRIQVYITRDDICPGEDKELYNAVFKRLLDLGDFIGIEGFVFRTQMGEISIHAKKLTVLAKSIKPLPIVKYKDGVAYDSFEDPELRYRQRYVDLVVNDGIKETFLKRATVVKTLRNVLDEAGYTEVETPILQSIAGGASARPFITHHNSLDIDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDKTHNPEFTCMELYVQYKDYNWMMNFTEKLLERICIAVNGCTESVVDGKTISFKAPYRRLPILDAIKEKTGYDL-NGKSEEEIRQVCKE--LKMEEIDETMGKGKLIDEIFGEFCEGTYIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKELANAYSELNDPLDQEERFKEQMRLADKGDDEAMIIDQDFLRALQYGMPPTSGIGIGIDRLVMLMTGQTTIQEVLFFPQMRPEK 503
>gi|163783340|ref|ZP_02178333.1| lysyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881448|gb|EDP74959.1| lysyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1] (570 aa)
Score = 1010, Expect = 1.7e-107, Identities = 212/430 (49%), Positives = 293/430 (68%)
  Q:    57 IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKY-VAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDF-WEVKSNQEAQELAKKHNVKFEKHQSTLGH--IINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + L GR+VALR      FG I+D  G  Q YL K  V       FN+ +DLGDIV + G  FRTQ GELT++V   ++++K L PLPEKWHGL+D E+R R RY+DLI N D+ K F+ R R++  +R+F D + ++EVETP+L  +  GANA+PF+T+HN LE N YLRIA EL LK+LIVGGF +VYE+G+ FRNEG+D THNPEFT +E YAAY +   +M+ TE LF + + +++    +     E+  +  FRR+   D +K++TG D  + +K  +  ++LA + ++    H   L H  +I+  FE   E   +QPTFV   P  +SPL+K   ++P   +RFEL + T E ANA+ ELNDP DQ ERF  Q+KEK +G++EA++MD DFI ALEYG+PPTAG G+GIDR++ML T   +IRDV+LFPHM+
  S:   134 VSLGGRLVALRTMGKAIFGHIQDLTGRIQIYLRKDIVGDENFSLFNEFIDLGDIVGVEGELFRTQTGELTVEVHSFELLAKCLHPLPEKWHGLKDVEVRYRQRYLDLIANPDARKTFLLRSRLISELRRFFDDRGFVEVETPILQTVASGANAKPFMTYHNYLEMNLYLRIAPELYLKRLIVGGFPRVYELGKNFRNEGVDRTHNPEFTMVEFYAAYWDYNDLMKFTEKLFVHLLERTVGTLKLSYEGVELDFSPPFRRVSYFDLLKEKTGKDKEFFLKDIEGLRKLAGELDI---THHERLTHAKLIDKVFERVAEEDLVQPTFVIDFPKLLSPLAKTHREDPDLVERFELIVATYEVANAYTELNDPADQKERFLEQLKEKEMGDEEAMDMDEDFIRALEYGMPPTAGEGIGIDRLVMLLTNTDTIRDVILFPHMR 568
>gi|113955017|ref|YP_729353.1| lysyl-tRNA synthetase [Synechococcus sp. CC9311] >gi|123132786|sp|Q0IDW9|SYK_SYNS3 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|113882368|gb|ABI47326.1| lysyl-tRNA synthetase [Synechococcus sp. CC9311] (489 aa)
Score = 1010, Expect = 1.7e-107, Identities = 210/475 (44%), Positives = 300/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL-KTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK   L+E  Q+PY + +   T  +    +  A L K    +  + +AGRV+  R      F  + D  G  Q +L K  +  S  +  + ++D GD++ + G   RT +GEL++ V K ++++K+L+PLP+KWHGL D E R R RY+DLIV   S + F  R   +  IR+++D +++LE+ETPVL    GGA ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE L   V + +     +     E+ LT  +RR  M + +++ TG+DF   ++ + A E  +  N+       T+G ++N  FE   E   IQPTFV  +P ++SPL++K    PG  +RFELFI  +E ANAF+EL DP+DQ  R E Q + ++ G+ EA  +D DFI+ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP M+
  S:     8 RLEKANALKEQGQEPYAL-RFDLTDRMARLQADHADLAKGAERDLKVSVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKATLGDSFAQ-LSSLVDAGDLIGVHGILRRTDRGELSVKVSKWEMLTKSLQPLPDKWHGLADVEKRYRQRYLDLIVTPQSRETFRRRAMAVSAIRRWLDERDFLEIETPVLQSEAGGAEARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEVYQAYADYNDMMTLTEQLIASVCEQVCGTTRISYQGVEVDLTPSWRRATMHELVQEATGLDFTSFETREAAVEAMRAANLPAPDKADTVGRLLNEAFEHAVEPNLIQPTFVLDYPQEISPLARKHRSKPGLVERFELFIVGRETANAFSELTDPLDQRGRMELQQERRAAGDVEASGVDEDFIQALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLMR 486
>gi|157121282|gb|EDO65483.1| lysine-tRNA ligase [Francisella tularensis subsp. holarctica FSC022] (576 aa)
Score = 1010, Expect = 1.7e-107, Identities = 216/485 (44%), Positives = 311/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     +  +++      +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    80 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELQARYTDKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVSFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 574
>gi|56707357|ref|YP_169253.1| lysyl-tRNA synthetase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669827|ref|YP_666384.1| lysyl-tRNA synthetase [Francisella tularensis subsp. tularensis FSC198] >gi|56603849|emb|CAG44825.1| Lysyl-tRNA synthetase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320160|emb|CAL08208.1| Lysyl-tRNA synthetase [Francisella tularensis subsp. tularensis FSC 198] >gi|151569182|gb|EDN34836.1| lysyl-tRNA synthetase [Francisella tularensis subsp. tularensis FSC033] (576 aa)
Score = 1009, Expect = 1.8e-107, Identities = 216/485 (44%), Positives = 311/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     +  +++A     +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GG  A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    80 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELQARYADKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVNFIRNYFDRLDFMEVETPMMHVLQGGGAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 574
>gi|115315489|ref|YP_764212.1| lysyl-tRNA synthetase [Francisella tularensis subsp. holarctica OSU18] >gi|156503376|ref|YP_001429441.1| lysyl-tRNA synthetase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|115130388|gb|ABI83575.1| lysine--tRNA ligase [Francisella tularensis subsp. holarctica OSU18] >gi|156253979|gb|ABU62485.1| lysyl-tRNA synthetase [Francisella tularensis subsp. holarctica FTNF002-00] (576 aa)
Score = 1009, Expect = 1.9e-107, Identities = 216/485 (44%), Positives = 311/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     +  +++      +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    80 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELQARYTDKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVSFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 574
>gi|126648193|ref|ZP_01720687.1| lysyl-tRNA synthetase [Algoriphagus sp. PR1] >gi|126575786|gb|EAZ80096.1| lysyl-tRNA synthetase [Algoriphagus sp. PR1] (568 aa)
Score = 1009, Expect = 2.1e-107, Identities = 218/485 (44%), Positives = 314/485 (64%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEA-QELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            ++QEL RR+  + L     +PY  E     +T  D +  +   K  N   +I +AGR+++ R     +F  I+D  G  Q Y+ +  +     K++    F K+L +GD + + G  F TQ GE++L V ++ ++SK++KPLP            G  D ELR R RYVDL VN +    F  R +I+  +R++ D   +LEVETP+L  + GGA ARPF T HNTL+   +LRIA EL LK+LIVGGFD VYE G++FRNEGMD THNPEFTSME+Y AY++  +MM + E L + V +S+  K  +K+G NEI     +RR+ M D IK+  G+D    K ++E  +++  +  +  +      G +++  F E  EA  IQPT++  +PI+++PL+KK    PG  +RFELF+N KE ANA+ ELNDPIDQ ERFE Q+K  + G+DEA+ MD DF+ ALEYG+PPT+GLG+GIDR+ ML T K++I++VL FP M+ +K
  S:     4 LSEQELERRKDREELMRLGINPYPAEAFPINVTAEDIHRNYENRK--NDYKSISIAGRLMSRRIMGSASFAEIQDSTGRLQIYVRRDDICTEEDKTLYNTVFKKLLGIGDFIGVKGYIFTTQTGEISLHVTELTLLSKSVKPLPVVKRDEDGNVHDGFTDPELRYRQRYVDLTVNPEVKATFKTRSKIISTMRRYFDDHGWLEVETPILQAVHGGAAARPFATHHNTLDMPLFLRIANELYLKRLIVGGFDGVYEFGKMFRNEGMDRTHNPEFTSMEIYVAYKDYVWMMEMVEELIEQVTESIHGKTKIKVGANEIEFAGPYRRLTMYDSIKEYAGIDV--SKMDEEGLRKVCSEMGIAVDDSMGK-GKLVDEIFGEKVEANLIQPTYITDYPIEMTPLAKKHRTEPGLVERFELFVNGKEIANAYTELNDPIDQRERFEDQLKLAARGDDEAMAMDTDFLRALEYGMPPTSGLGIGIDRLTMLLTNKTTIQEVLFFPQMRPEK 502
>gi|29347532|ref|NP_811035.1| lysyl-tRNA synthetase [Bacteroides thetaiotaomicron VPI-5482] >gi|39932184|sp|Q8A5W4|SYK_BACTN Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|29339432|gb|AAO77229.1| lysyl-tRNA synthetase [Bacteroides thetaiotaomicron VPI-5482] (576 aa)
Score = 1009, Expect = 2.2e-107, Identities = 213/486 (43%), Positives = 321/486 (66%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL--GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  L  L+    DPY   +        D  ++F   K  +    + +AGR+++ R     +F  ++D  G  Q Y+ +  +     K +    F ++LDLGD V I G  FRTQ GE+++  KK+ +++K++KPLP         +   ED ELR R RYVDL+VN+   + F  R  +++ +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L+ + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y  Y++  +MM  TE L + +  ++      + + + I     +RR+ ++D IK++TG D    KS +E +++ K+  +K E+   T+  G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL +N KE ANA++ELNDP+DQ ERF+ Q++    G+DEA+ +D DF+ AL+YG+PPT+G+G+GIDR++ML T +++I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSLNELRAMGIDPYPAAEYVTNAFSTDIKAEF---KDEDEPRQVSVAGRIMSRRVMGKASFIELQDSKGRIQVYITRDDICPGEDKELYNSVFKRLLDLGDFVGIEGFVFRTQMGEISIHAKKLTVLAKSIKPLPIVKYKDGVAYDSFEDPELRYRQRYVDLVVNEGIKETFEKRATVVRTLRNALDEAGYTEVETPILQSIAGGASARPFITHHNSLDIDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMELYVQYKDYNWMMSFTEKLLERICIAVNGSTETVVDGKTISFKAPYRRLPILDAIKEKTGYDL-NGKSEEEIRQICKE--LKMEEIDDTMGKGKLIDEIFGEFCEGSYIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKELANAYSELNDPLDQEERFKEQMRLADKGDDEAMIIDQDFLRALQYGMPPTSGIGIGIDRLVMLMTGQTTIQEVLFFPQMRPEK 503
>gi|88805036|ref|ZP_01120556.1| lysyl-tRNA synthetase [Robiginitalea biformata HTCC2501] >gi|88785915|gb|EAR17084.1| lysyl-tRNA synthetase [Robiginitalea biformata HTCC2501] (563 aa)
Score = 1008, Expect = 2.4e-107, Identities = 222/486 (45%), Positives = 311/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSK-----SMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQST-LGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRREKL+ L+E   DPY  EK             + + K      ++ +AGR+++ R     +F  ++D  G  Q Y N+ ++ +     +  + + K+LD+GDI+ I G  F+TQ GE T+ VK+  ++SKAL+PLP        + +    D E R R RYVDL+VN +  + FV R +I   IR+F + + YLEVETP+L PI GGA ARPF T HN L    YLRIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT ME+Y AY++  +MM  TE L + VA+       V  G   I     + R+ ++D I++ TG+D   V    EA        +  E  +S  +G +I+  F E CE   +QPTF+  +P ++SPL+K     PG T+RFEL +N KE ANA++ELNDPIDQ ERFE Q+K    G+DEA+ +D DF+ ALE+G+PPT+G+G+GIDR++ML T+ SSI++VL FP MK +K
  S:     2 QLSEQEIIRREKLRQLRELGIDPYPAEKYPVDTLSSSVRENYEEGK------HVVMAGRLMSRRIQGKASFAELQDSAGRIQLYFNRDEICEGEDKSAYNDIYKKLLDIGDIIGIEGELFKTQVGEKTVRVKRFTLLSKALRPLPLPKKDAEGKVFDEFNDPEQRYRMRYVDLVVNPNVRETFVKRTKITNSIRRFFNEKGYLEVETPILQPIPGGAAARPFQTHHNALGIPLYLRIANELYLKRLIVGGFDGVYEFAKDFRNEGMDRTHNPEFTVMELYVAYKDYNWMMETTEQLLERVAREANGSTRVSAGGETIDFKAPYPRVPILDAIREHTGID---VDGMDEAALRDAAAGLGIEVDESMGVGKLIDEIFGECCEHHYVQPTFIIDYPKEMSPLTKAHRSKPGLTERFELLVNGKEIANAYSELNDPIDQRERFEEQLKLSEKGDDEAMFIDRDFLRALEFGMPPTSGIGIGIDRLVMLLTDNSSIQEVLFFPQMKPEK 497
>gi|119357536|ref|YP_912180.1| lysyl-tRNA synthetase [Chlorobium phaeobacteroides DSM 266] >gi|119354885|gb|ABL65756.1| lysyl-tRNA synthetase [Chlorobium phaeobacteroides DSM 266] (509 aa)
Score = 1008, Expect = 2.9e-107, Identities = 218/482 (45%), Positives = 311/482 (64%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---EK--------WHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK--PVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            NDQ   R ++  +L E+  +PY          +  F+         + N  + +AGR++ +R+    +F  ++D  G  Q YL K  V +S  + F K+LD+GDIV + G  F+T+ GE+++  ++  ++SK+L+P+P   EK        +    D+ELR R RYVDLIVN D  + F+ R  I+  +R F   Q +LEVETP+L PI GGA ARPF T HN L+   YLRIA EL LK+LIVGGFD V+E  + FRNEG+D  HNPEFT +E+Y AY++ E+MM+L E LF   A ++     VV +G N+I L   FRR+ + D IK+  G+D  + K   E + +A+   ++ +   S+ G II+  F EF E K IQPTF+  +P+++SPL+K+    PGF +RFEL    KE  N+F+ELNDP+ Q ER EAQ K +  G++EA+ +D DF+ ALEYG+PP AGLGVG+DRM+ML T + SIRDV+ FPH+K
  S:    18 LNDQMKRRLDERLHLAESGVNPYPCH-----FDVTHFSDSILTDFQDDANETVSVAGRIMTIRKMGKASFFHLQDANGRIQIYLKKDDVGESSYQTF-KLLDIGDIVGVKGYTFKTKTGEISVHAQEFSLLSKSLRPIPIAKEKEIDGQKVVYDAFSDKELRYRQRYVDLIVNPDVRQTFIKRSAIVSFMRGFFTGQGWLEVETPILQPIYGGAAARPFTTHHNALDMQLYLRIANELYLKRLIVGGFDGVFEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYEWMMKLVEELFYQTACAVNNSDSVVFLG-NDISLKPPFRRLTITDSIKEYCGIDITD-KDEHELRYMARDLGLELDPKISS-GKIIDEIFGEFVEPKLIQPTFITDYPVEMSPLAKEHRSKPGFVERFELIAGGKELCNSFSELNDPVIQRERLEAQAKLRQRGDEEAMIVDEDFLRALEYGMPPCAGLGVGVDRMVMLLTGQDSIRDVIFFPHLK 507
>gi|89257151|ref|YP_514513.1| lysyl-tRNA synthetase [Francisella tularensis subsp. holarctica] >gi|167011048|ref|ZP_02275979.1| lysyl-tRNA synthetase [Francisella tularensis subsp. holarctica FSC200] >gi|89144982|emb|CAJ80342.1| Lysyl-tRNA synthetase [Francisella tularensis subsp. holarctica LVS] >gi|134254183|gb|EBA53277.1| lysyl-tRNA ligase [Francisella tularensis subsp. holarctica 257] (560 aa)
Score = 1008, Expect = 3.0e-107, Identities = 216/485 (44%), Positives = 311/485 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + + Q  +R+EKLK L + N          R     +  +++      +L+  +      L GRVV  R     +F  ++D+ G  Q YL K  +     E F  + DLGDIV I G+ F+T  GEL+++    +I++KA++PLP+K+HGL D+E+R R RYVDLI N+ + +VF  R +++  IR + D  +++EVETP++H + GGA A+PF T HN L+   YLRIA EL LK+L+VGGF++VYEI R FRNEG+ S HNPEFT +E Y AY +   +M LTE++  K V + +   +++ GE +I    K+ RI MVD  +K    +   ++ + + A+++A+K  +K E +   LGH+IN  FEE  E + IQPTF+  +P  VSPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF  QV+  + G+DEA+  D D+I ALEYG+PPTAG G+GIDR++M  T   SIRDV+LFPHMK
  S:    64 ELQESSQIALRKEKLKTLAQQNNGISHPNSFRRNAVAIELQARYTDKTKQELEELDNKQQYSLTGRVVLRRVMGKASFITLQDYTGRIQVYLKKSDLPDGQYETFKNLCDLGDIVGITGTMFKTNTGELSVEANHFEILTKAIRPLPDKFHGLADQEMRYRQRYVDLITNEKAREVFKVRSKVVSFIRNYFDRLDFMEVETPMMHVLQGGAAAKPFKTHHNALDMPLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISSRHNPEFTMLEFYMAYADYNDLMDLTEDMLSKLVQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKEDLVTFESAKKIAEKLKIKVEAYHE-LGHLINEIFEETVEHQLIQPTFITDYPAVVSPLARRQDGNPEFTDRFEFFIGAREVANGFSELNDAEDQAERFRKQVEAAASGDDEAMPYDKDYIRALEYGMPPTAGQGIGIDRLVMYLTNSQSIRDVILFPHMK 558
>gi|154151870|ref|YP_001405488.1| lysyl-tRNA synthetase [Candidatus Methanoregula boonei 6A8] >gi|154000422|gb|ABS56845.1| lysyl-tRNA synthetase [Candidatus Methanoregula boonei 6A8] (514 aa)
Score = 1007, Expect = 3.3e-107, Identities = 209/475 (44%), Positives = 305/475 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R +K++ L+E   D Y      R  TI +  +KF+++    +   +  AGR+  +R      F  + D  G  Q Y+ K  +     ++FN+ ++ GD V + G  FRT+ GE+T+ V KI++++KA+ PLPEK+HGL D E R R RYVDLI N++  + F +R RIL  IR+++  +++LE ETP+L P+ GGANARPF TFHN L +  +LRIA EL LK+L+VGGF++++EI R FRNE +D+ HNPEFT +E+Y AY ++  MM LTE+    + + +  K  +      I   +  RR+ M D +K+  G+D + + S  E +  A ++ +K  +   T    +  FFE   E K IQPTF+Y  P++ SPL+K+     GFT+RFELFI   E AN F+ELNDP+DQ ERFEAQ K++ LG+ EA  +D DFI AL YG+PPT G+G+GIDR++ML T  +SI++V+LFP MK
  S:    14 RLDKVRALREKGIDLYP-PTFDRKNTIAEIRTKFSEITHEKSAEGVVTAGRLSIIRNHGKTIFADLGDESGKIQLYIRKADLGDEAFDFFNQYIERGDFVGVTGHVFRTKLGEITIWVDKIQLLTKAVCPLPEKFHGLTDVEKRYRQRYVDLIANEEVRQNFRNRSRILSSIRRYLSERDFLEFETPILQPVYGGANARPFTTFHNCLGQKLFLRIAPELYLKRLVVGGFERIFEIARNFRNEDIDTHHNPEFTMVEIYWAYHDVYDMMDLTEDFLATLVQEVHNKTEITFEGTSISFAKPLRRLSMADAVKEYAGIDIFAL-SVDELRAFAIQNKLKEAEKPQTQREFLVYFFENMVEEKLIQPTFIYDFPVENSPLAKRHRTKEGFTERFELFIYGMELANGFSELNDPLDQKERFEAQDKKRQLGDLEAQMIDYDFINALGYGMPPTGGVGIGIDRLVMLLTGNNSIKEVILFPSMK 491
>gi|89890462|ref|ZP_01201972.1| lysine--tRNA ligase, LysRS [Flavobacteria bacterium BBFL7] >gi|89517377|gb|EAS20034.1| lysine--tRNA ligase, LysRS [Flavobacteria bacterium BBFL7] (563 aa)
Score = 1007, Expect = 3.6e-107, Identities = 227/485 (46%), Positives = 302/485 (62%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKV----SKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWH-GLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            ++QE+IRREKL  L+E   DPY         T     + F + K  N     +L  R +A   +F  ++D  G  Q Y N+ ++     KS   + + K+LD+GDI+ I G  F+TQ GE+T+ VKK  +++KALKPLP        K H G  D E+R R RY DL+VN    +VFV R ++   +R F + + Y EVETP+L PI GGA ARPFIT HN+L+   Y+RIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y AY++  +MM  TE L ++ A S+  K   + GE  I     + RI M   I   TG D  + KS  +    AK   +  +      G +I+  F E CE   IQPTF+  +P ++SPL K    NP  T+RFEL +  KE ANA++ELNDPIDQ ERFEAQV     G+DEA+ +D DF+ ALEYG+PPT+GLG+G+DR+IM  T   SI++VL FP MK +K
  S:     4 LSEQEIIRREKLGKLREMGIDPYPAALYPVDNTSTSIKADFKEGKQVNVAG--RLMSRRIAGAASFAELQDSEGRIQVYFNRDEICPGDDKSQYNDVYKKLLDIGDIIGIEGELFKTQVGEMTIMVKKFTLLTKALKPLPLPKVDAEGKVHDGFVDPEMRYRQRYADLVVNPQVKEVFVKRTKLFNAMRNFFNEREYFEVETPILQPIPGGAAARPFITHHNSLDIPLYMRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMDFTERLLEHCAVSVNGKTSSQFGEQTIEWKAPYPRITMRQSIIDFTGFDI-DGKSEADLYAFAKAEGIDVDTTMGK-GKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKAHRDNPELTERFELMVCGKEIANAYSELNDPIDQRERFEAQVALADRGDDEAMFIDQDFLRALEYGMPPTSGLGIGMDRLIMFLTNNPSIQEVLFFPQMKPEK 498
>gi|86608981|ref|YP_477743.1| lysyl-tRNA synthetase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86557523|gb|ABD02480.1| lysyl-tRNA synthetase [Synechococcus sp. JA-2-3B'a(2-13)] (511 aa)
Score = 1007, Expect = 3.6e-107, Identities = 210/479 (43%), Positives = 310/479 (64%)
  Q:     8 QELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLA--GRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEY----FNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSN--QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           Q   R EK ++L+E    PY       T    +   +FA L+      ++++A  GR+ A R      F  ++D  G  Q YL+KK++++ M E      +K++D+GD +   G   RT+KGEL++ V + ++++KAL PLP+KWHGL D E R R RYVDLIVN +  +  +DR +I++ +RQ ++ + ++E+ETPVL  I GGA ARPF+T HN L+ + YLRIATEL LK+L+VGG ++VYEIGR+FRNEG+ + HNPEFTS+E Y A+ +   MM LTE L    A +++  +    + E I LT  +RR+ M + +++ TG+ F +V+    +E         +     Q + G ++   FE  CE++  QPTFV  +P++V PL+K     PG  +RFELFI  +E ANA++EL DP+DQ +R EAQ   K+ G++EA  +D DF+ ALEYGLPPT GLGVGIDR++ML  +  SIRDV+ FP ++
  S:    12 QRAARLEKAQHLREQGIPPYAYS-FPVTHLAAELQEQFADLEPGGEREDVQVAVAGRIRARRVMGKLAFFTLQDRSGTIQLYLDKKRLTEQMGELAFKNLDKLIDVGDWLGAKGCLKRTEKGELSVRVDEYQVLTKALLPLPDKWHGLRDVEKRYRQRYVDLIVNPEVKQTLLDRAQIIRSLRQTLEERGFVEIETPVLQVIPGGAEARPFVTHHNALDLDLYLRIATELHLKRLVVGGIERVYEIGRVFRNEGISTRHNPEFTSLEAYQAFADYHTMMELTETLVCNAALAVRGSLQLTYQGEAIDLTPPWRRVTMQELVEEATGI-FIDVEKGCPEELLPALAAQGIPDLSPQDSPGQLLVKAFEHCCESRLRQPTFVLDYPLEVCPLTKPHRSKPGLAERFELFIVGRETANAYSELTDPVDQRQRLEAQAALKAAGDEEAHFLDEDFLTALEYGLPPTGGLGVGIDRLVMLLCDAPSIRDVIAFPLLR 501
>gi|154493632|ref|ZP_02032952.1| hypothetical protein PARMER_02972 [Parabacteroides merdae ATCC 43184] >gi|154086842|gb|EDN85887.1| hypothetical protein PARMER_02972 [Parabacteroides merdae ATCC 43184] (576 aa)
Score = 1007, Expect = 3.9e-107, Identities = 212/486 (43%), Positives = 319/486 (65%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPE-------KWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  ++ L++   +PY   +        +    F   K       + +AGR+++ R     +F  ++D  G  Q Y+++  +    +K +    F K+LD+GD V I G  FRTQ GE+++  ++I ++SK+LKPLP         + G  D ELR R RYVDL+VN     +F+ R  ++K +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L+ + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y  Y++  +MM  TE L + +  ++      + + + I     +RR+ ++D IK++TG D    KS  E + + K  N++ ++     G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL IN KE ANA++ELNDPIDQ ERF+ Q++    G+DEA+ +D DF+ AL++G+PPT+G+G+GIDR++ML T +++I++VLLFP M+ +K
  S:     5 ELSEQEIIRRNSMEQLRQMGIEPYPAAEYVTNAFSKEIKENF---KDDAEPRPVSIAGRIMSRRIMGKASFMELQDSEGRIQVYISRDDICPEENKDLYNIVFKKLLDIGDFVGIKGFVFRTQMGEISVHAQEITVLSKSLKPLPVVKYKDGVAYDGFNDPELRYRQRYVDLVVNDGVKDIFMKRAAVIKTMRTALDEAGYTEVETPILQSIPGGASARPFITHHNSLDIDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMELYVQYKDYNWMMSFTEQLLERICIAVNGTCESVVDGKTINFKAPYRRLPILDAIKEKTGYDL-NGKSEDEIRTICKDLNLEIDETMGK-GKLIDEIFGEFCEGTFIQPTFIIDYPVEMSPLTKMHRSKPGLTERFELMINGKEVANAYSELNDPIDQEERFKEQLRLSEKGDDEAMFIDQDFLRALQFGMPPTSGIGIGIDRLVMLMTGQTTIQEVLLFPQMRPEK 502
>gi|193213961|ref|YP_001995160.1| lysyl-tRNA synthetase [Chloroherpeton thalassium ATCC 35110] >gi|193087438|gb|ACF12713.1| lysyl-tRNA synthetase [Chloroherpeton thalassium ATCC 35110] (517 aa)
Score = 1004, Expect = 8.8e-107, Identities = 217/485 (44%), Positives = 322/485 (66%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIE-KVSRT--MTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-----------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + + NDQ L RRE+L+ L+E + +PY    +V+ T    I +F          +    + +AGR++++R+    +F  ++D  G  Q Y+ K +V ++  + F K+LD+GDIV + G  FRT+ GE+++  +  +++SK+L+P+P             +    D+ELR R RYVDLIVN +   VF+ R +++  IR F++ + YLEVETP+L PI GGA+ARPF+T HNTL+   YLRIA EL LK+LIVGGFD VYE  + FRNEGMD  HNPEFT +E+Y AY++  +MM L E +    A+++    VV+   ++I L   F+R+ + D IK+ TG D  + KS  E +++AK+  ++ E +  +   II+  F E+ E K I PTF+  +P+++SPL+KK  + PGF +RFEL    KE  N+F+ELNDP+DQ  R E Q   ++ G+DEA+ +D DF+ ALEYG+PP AGLG+GIDR+ M+ T + SIRDVL FP MK
  S:    23 QEELNDQMLRRREELEKLREMDVNPYPYSFEVTHTGKQIIENFKD--------DEKAAVAIAGRIMSIRKMGKASFFHVQDASGRIQVYIKKDEVGETAYQVF-KLLDIGDIVGVKGFSFRTKTGEVSVHAEACELLSKSLRPMPIAKQKEVDGKTVTYDAFSDKELRYRQRYVDLIVNPEVKTVFLKRTKMINSIRNFLNERGYLEVETPILQPIYGGASARPFVTHHNTLDMPLYLRIANELYLKRLIVGGFDGVYEFAKDFRNEGMDRFHNPEFTQIELYVAYKDYAWMMNLVEEMLSKTAEAVNGSTVVEFAGHKIDLKPPFKRMTITDSIKEYTGKDI-DGKSEAELRQIAKELGIEIEANLGS-SKIIDEIFGEYVEPKLIDPTFIMDYPVEMSPLAKKHREKPGFVERFELIAAGKEICNSFSELNDPLDQRARLEEQASLRARGDDEAMAVDEDFLRALEYGMPPCAGLGIGIDRLAMILTGQESIRDVLFFPQMK 515
>gi|158522857|ref|YP_001530727.1| lysyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] >gi|158511683|gb|ABW68650.1| lysyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] (484 aa)
Score = 1003, Expect = 1.1e-106, Identities = 197/428 (46%), Positives = 287/428 (67%)
  Q:    59 LAGRVVAL----RQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           LAGR++A+    +  F   RD  G  Q Y+ K KV       F K +D+GD++ + G  F+T+ GE T+  + I+++ KA +PLPEK+HGL+D E R R RY+DLI+N  +  VF+ R R ++ IR F+  +++LEVETP++ PI GGA ARPF+T HN L+ + +LRIA EL LK+L+VGGF++V+EI R FRNEG+ + HNPEFT +E Y AY + + +M +TE+LF +VA+++   + VV      I  +  + R+ +++ +++  GVD   +   +     A    V+  +  ++ G +I   F+   E   IQPTF+ G+P++VSPLSK   + PGF  RFELFI   E AN F+ELNDP +Q +RF AQV  +  G+DEA  MD D+IEALEYG+PPTAG G+GIDR++ML T+  SIR+V+LFPHM+
  S:    45 LAGRMMAINRFGKAAFVRFRDRTGLMQAYIQKDKVGSDAYALF-KQMDVGDVIGLSGGLFQTKTGEWTVQAETIRLLCKATRPLPEKFHGLKDPEKRYRKRYLDLIMNSATRDVFIRRSRAIQAIRTFLLERDFLEVETPMMQPIPGGAEARPFVTHHNALDMDLFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISTRHNPEFTMLEFYQAYADYQGLMAMTEDLFCHVAEAVTGSRQVVYQAHT-IDFSGPWPRVPLLEALQRIGGVDAGILNDREALLAHAAARGVQIARTDTSTGKVITKLFDALVEPHLIQPTFITGYPVEVSPLSKASAQAPGFVDRFELFIAGNEIANGFSELNDPEEQRQRFAAQVAARKAGDDEAHFMDEDYIEALEYGMPPTAGEGIGIDRLVMLLTDAPSIREVILFPHMR 476
>gi|145352203|ref|XP_001420444.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144580678|gb|ABO98737.1| predicted protein [Ostreococcus lucimarinus CCE9901] (607 aa)
Score = 1002, Expect = 1.3e-106, Identities = 205/430 (47%), Positives = 292/430 (67%)
  Q:    59 LAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKV---SKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQK-FRRIHMVDFIKQETGVDFWEVKSNQEAQELA-----KKHN------VKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEA-----------VEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + GRV+A R      F  + D  G  Q + +KK++   S    E   +++D+GDI+ + GS  R+ KGEL++   K+++++KAL PLP+KWHGL+D E R R RYVDLIV+ +    F  R  I+  IR+ +D   +LE+ETPVLH   GGA+A+PF TFHN L     LRIATEL LK+L+VGGF++VYE+GR+FRNEG+ + HNPEFTS+EVY AY ++  M+ LTE +  +   K+     +  G+  I L+Q+ +RR  M D +K+ TGVD      + E  + A     K H+      +K  K  +++GH++N  FE  CE+  IQPTFV  HP+++SPL+K     PG T+RFELF+  +E AN+F+EL DPIDQ +R EAQ+   +  +              VEMD DF+ ALEYG+PPTAG+G+G+DR++ML T   SIRDV+ FP +K +
  S:   145 VCGRVMAKRSFGKLAFLSLVDERGSVQLFCDKKRLDETSPGAFEMITELVDVGDIIGVHGSVKRSDKGELSIVPAKVQMLTKALLPLPDKWHGLQDVEKRYRQRYVDLIVSPEVRNTFKARSNIISTIRRMLDDDGFLEMETPVLHTQAGGADAKPFNTFHNALGMQLTLRIATELHLKRLVVGGFERVYELGRVFRNEGLSTRHNPEFTSIEVYQAYADVTDMLELTEEMICRCAMKACGTLTIPYGDVTIDLSQRPWRRAPMNDLVKEATGVDVMAFGDDLEGAKAAAIPALKAHSKKAGEGIKGVKLAASVGHVLNEMFEAACESDLIQPTFVLDHPLEISPLAKPHRSKPGVTERFELFVVGRELANSFSELTDPIDQRKRLEAQMVTHAKTSAAQREAAAANEAYDVEMDEDFVAALEYGMPPTAGMGLGVDRLVMLLTNSPSIRDVIAFPLLKKQ 605
>gi|124021897|ref|YP_001016204.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9303] >gi|166229815|sp|A2C629|SYK_PROM3 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|123962183|gb|ABM76939.1| Lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9303] (508 aa)
Score = 1001, Expect = 1.7e-106, Identities = 211/475 (44%), Positives = 301/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEI--EKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNK--------KKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK + L+E    PY +  E   RT  +   ++  AK +    +  + +AGRV+A R      F  + D  G  Q YL+K         +++         ++D GD + + G   RT +GEL++ V++ +I+SK+L+PLP+KWHGL D E R R RY+DLIV+  S + F  R  ++  IR+++D + +LE+ETPVL    GGA ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEGM + HNPEFTS+EVY AY +   MM LTE L   V   +     +     EI LT  +RR  M + +++ TG+DF        A     +  ++      ++G ++N  FE+  E   IQPTFV  +PI++SPL+++    PG  +RFELFI  +E ANAF+EL DP+DQ +R EAQ   +  G+ EA  +D DF++ALE G+PPT GLG+GIDR++MLFT+  SIRDV+ FP ++
  S:    16 RLEKAQALKELGNGPYALRFESSHRTANLQADHADLAKGEERLLS--VSVAGRVMARRVMGKLAFYTLADETGTIQLYLDKATIDAAASNELASGTFVQLTTLVDAGDWIGVTGVLRRTDRGELSVKVQQWQILSKSLQPLPDKWHGLADVEKRYRQRYLDLIVSPQSRETFRRRALMVSAIRRWLDDRAFLEIETPVLQAEAGGAEARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGMSTRHNPEFTSVEVYQAYADYIDMMVLTEQLISSVCTQICGSTRITYQGIEIDLTPPWRRASMHELVQEATGLDFMGFADRAVAASAMARAGLEVPSKADSVGRLLNEAFEQAVEVSLIQPTFVLDYPIEISPLARQHRSKPGLVERFELFIVGRETANAFSELIDPLDQRQRLEAQQARRQAGDLEAHGVDEDFLQALEVGMPPTGGLGIGIDRLVMLFTDSPSIRDVIAFPLLR 503
>gi|188995021|ref|YP_001929273.1| lysyl-tRNA synthetase [Porphyromonas gingivalis ATCC 33277] >gi|188594701|dbj|BAG33676.1| lysyl-tRNA synthetase [Porphyromonas gingivalis ATCC 33277] (578 aa)
Score = 1000, Expect = 2.4e-106, Identities = 217/486 (44%), Positives = 314/486 (64%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTN---NNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSM-LEYFNKVL----DLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFW---EVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE++RR  L+ L+    DPY     +   T+  ++++  +    + N     + +AGR+++ R     TF  ++D  G  Q Y+ +  +      E++N V+    D+GD + + G  FRTQ GE+++ V+++  +SKA++PLP       E + G  D E R R RYVDL+VN     +F+ R  +   +R F + + Y+EV+TPVL  I GGA ARPFIT HN L+   YLRIA EL LK+LIVGGFD VYE  R FRNEGMD THNPEFT+ME+Y AY++  +MM  TE + + +    L    VK+GE  I     +RR+ M++ I + TG+D     E +  Q   +L  +HN    K     G +I+  F E CE   IQPTF+  +P ++SPL+K+   NP  T+RFEL +N KE ANA++ELNDPIDQ ERFE Q+K    G+DEA+ +D DFI ALEYG+PPT+G+G+G+DR++ML T + SI++VLLFP MK +K
  S:     5 ELSEQEVVRRNSLEQLRNLGIDPYP----AAEYTVNAYSTEIKRNFNGDENAAKRQVSIAGRIMSRRIMGKATFMELQDAEGRIQIYITRDDICPGEDKEFYNTVVKKCTDIGDFIGVKGYVFRTQMGEISVHVQEMTFLSKAIRPLPVVKEKDGEVFDGFTDSEQRYRQRYVDLVVNSHVKDIFLKRTMVFNSMRSFFNERGYIEVDTPVLQSIPGGAAARPFITHHNALDIPLYLRIANELYLKRLIVGGFDGVYEFSRNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMNFTEQMLERICMDVLGTTQVKVGEKLIDFKAPYRRVTMIEAIHEHTGIDISGMNEAELRQVCDKLGVEHNETMGK-----GKLIDEIFGEKCEKNYIQPTFITDYPKEMSPLTKEHRTNPELTERFELMVNGKELANAYSELNDPIDQRERFEEQLKLSEKGDDEAMYIDNDFIRALEYGMPPTSGMGIGMDRLVMLLTGQESIQEVLLFPQMKPEK 504
>gi|154249833|ref|YP_001410658.1| lysyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] >gi|171769382|sp|A7HM68|SYK_FERNB Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|154153769|gb|ABS61001.1| lysyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] (509 aa)
Score = 1000, Expect = 2.4e-106, Identities = 219/483 (45%), Positives = 315/483 (65%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHN-TNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFP 483
           M + F +  +   ++L+NL   N  PY   K   T T  D   +F  L     T+  +  AGR++++R+     F  I+D YG  Q Y+ K K      E+F + + +GDIV + G  F++  GE+T+ V+K +++ K L+P+PEKWHG++D+E+  R RYVD+I N +++K F  R  I+++IR+F+  + + EVETP+L  + GGA+ARPFIT  N L+ + YLRIATEL LK+ IVGGFDKVYEIG+IFRNEG+   H+PEFTS+E+Y AY + E MM LTE L  Y+ + L     +     EI  T+ +RR+ M DFIK+  GVD  E      A+ LA+      E   +  GH+I   + +  E K IQPTF+  HP+++SPL+KK  ++P  T+RFEL I  +E ANAF+ELNDP+DQ ERF  Q++ + LG+ EA  +D DF+ ALEYG+PPT GLG+GIDR++ML T+ ++IRDV+ FP
  S:     1 MLKDFREARIKEIDELRNLG-INPYPYSYNK---THTTEDIKKQFEHLSNGEVTDKRVSTAGRIMSIREHGKSAFFHIKDTYGRIQAYIRKDKTEN--YEFFKERVTVGDIVGVEGIVFKSNTGEITILVEKFELLVKPLRPMPEKWHGIKDKEVLYRQRYVDMIANDETIKRFRMRSDIIRMIREFLTKKGFFEVETPILQYLTGGASARPFITHLNALDIDMYLRIATELHLKRFIVGGFDKVYEIGKIFRNEGISYKHHPEFTSIELYQAYADYEDMMNLTEELITYLVEQLYGTTKITYQGQEIDFTRPWRRVKMRDFIKENLGVDIIEDSDETMAKVLAEN---GVEVDINDRGHMIEKLW-DLVEDKVIQPTFLLEHPVEISPLAKKHREDPRVTERFELIIYGREMANAFSELNDPVDQLERFMNQLRLRDLGDQEAQMLDKDFVRALEYGMPPTGGLGIGIDRLVMLLTDSANIRDVIAFP 479
>gi|33862420|ref|NP_893980.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9313] >gi|39932063|sp|Q7U3A4|SYK_PROMM Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|33640533|emb|CAE20322.1| Lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9313] (508 aa)
Score = 999, Expect = 2.8e-106, Identities = 209/475 (44%), Positives = 298/475 (62%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL-KTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNK--------KKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK + L+E    PY + +   + +  +  +  A L K       + +AGRV+  R      F  + D  G  Q YL K         +++         ++D GD + + G   RT +GEL++ V++ +I+SK+L+PLP+KWHGL D E R R RY+DLIV+  S + F  R  ++  IR+++D + +LE+ETPVL    GGA ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEGM + HNPEFTS+EVY AY +   MM LTE L   V   +     +     EI LT  +RR  M + +++ TG+DF   K    A     +  ++      ++G ++N  FE+  E   IQPTFV  +PI++SPL+++    PG  +RFELFI  +E ANAF+EL DP+DQ +R EAQ   +  G+ EA  +D DF++ALE G+PPT GLG+GIDR++MLFT+  SIRDV+ FP ++
  S:    16 RLEKAQALKELGNGPYAL-RFESSHSTANLQADHADLAKGEERLLTVSVAGRVMTRRVMGKLAFYTLADETGTIQLYLEKATIDAAASNELASGTFVQLTTLVDAGDWIGVTGVLRRTDRGELSVKVQQWQILSKSLQPLPDKWHGLADVEKRYRQRYLDLIVSPQSRETFRRRALMVSAIRRWLDDRAFLEIETPVLQAEAGGAEARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGMSTRHNPEFTSVEVYQAYADYIDMMVLTEQLISSVCTQICGSTRITYQGIEIDLTPPWRRASMHELVQEATGLDFMGFKDLAVAASAMARVGLEVPSKADSVGRLLNEAFEQAVEVSLIQPTFVLDYPIEISPLARQHRSKPGLVERFELFIVGRETANAFSELIDPLDQRQRLEAQQARRQAGDLEAHGVDEDFLQALEVGMPPTGGLGIGIDRLVMLFTDSPSIRDVIAFPLLR 503
>gi|170682016|ref|YP_001746526.1| lysyl-tRNA synthetase LysU [Escherichia coli SMS-3-5] >gi|170519734|gb|ACB17912.1| lysyl-tRNA synthetase LysU [Escherichia coli SMS-3-5] (505 aa)
Score = 999, Expect = 3.1e-106, Identities = 218/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + D F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHDEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|78211662|ref|YP_380441.1| lysyl-tRNA synthetase [Synechococcus sp. CC9605] >gi|123770824|sp|Q3ANE6|SYK_SYNSC Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|78196121|gb|ABB33886.1| lysyl-tRNA synthetase [Synechococcus sp. CC9605] (502 aa)
Score = 999, Expect = 3.3e-106, Identities = 204/475 (42%), Positives = 300/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL-KTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKV---LDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK + L+E  Q PY +   S +  + +     A L K    + ++ +AGRV+  R      F  + D  G  Q +L K  +      +F ++   +D GD + + G+  RT +GEL++ V   ++++KAL+PLP+KWHGL D E R R RY+DL+V+ DS + F  R R++  IR+++D +++LE+ETPVL    GGA+ARPF T HN L+    LRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE +   V + +     +     EI L   +RR  M + ++  TG+DF    S +EA        +   +   ++G ++N  FE+  E   IQPTFV  +P+++SPL++     PG  +RFELFI  +E+ANAF+EL DP+DQ +R EAQ   K+ G+ EA  +D DF+ ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP ++
  S:     8 RLEKARTLEELGQGPYAL-TFSPSHRMAELQVTHADLPKGEERDVSVSVAGRVMTRRVMGKLAFFTLADETGSIQLFLEKAGLEAQQEGWFKQITSLVDSGDWLGVSGTLRRTDRGELSVKVSDWRMLTKALQPLPDKWHGLADVEKRYRQRYLDLVVSPDSRETFRRRARLVSGIRRWLDQRDFLEIETPVLQSEPGGADARPFETHHNALDLPLTLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAYSDYVGMMELTEQMVSAVCEEVCGTTTITYQGTEIDLAPPWRRATMHELVQDATGLDFNGFSSREEAAAAMTAKGLHAPELADSVGRLLNEAFEQAVETTLIQPTFVTDYPVEISPLARPHRSKPGLVERFELFIVGREHANAFSELTDPVDQRQRLEAQQARKAAGDLEAQGLDEDFVMALEVGMPPTGGLGIGIDRLVMLLTDCPSIRDVIAFPLLR 490
>gi|85860098|ref|YP_462300.1| lysyl-tRNA synthetase [Syntrophus aciditrophicus SB] >gi|85723189|gb|ABC78132.1| lysyl-tRNA synthetase [Syntrophus aciditrophicus SB] (542 aa)
Score = 998, Expect = 4.0e-106, Identities = 212/435 (48%), Positives = 287/435 (65%)
  Q:    54 NNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           N    LAGR++A+R      F  I+D  G  Q YL++  +  +    F K LD+GDIV I G P RT+ GELT++  +  ++SKA++PLPEKWHGL D E R R R+VDLIVN    +VF+ R RI+  IRQFMD +++LEVETP++ P  GGA ARPF T HN L  + YLRIA EL LK+LI GG ++VYEI R FRNEG+ + HNPEFT ME Y AY   E +M +TE LF  VA K       +    +I LT  + RI + + I +   +D   ++  ++A   A K  ++  K +  LG ++   FEE  E + +QPTFV  +P++VSPLS+++ K+P  T RFEL+I  +E ANAF+ELNDP DQ ERF  Q +E+  GN+E   MD D++  LEY +PPTAG G+GIDR++MLFT+  SIRDV+LFPHM+ +
  S:   100 NERFTLAGRMMAIRNFGKAAFINIQDRKGRIQAYLHRNSIGDASYALF-KRLDVGDIVFIGGRPIRTKTGELTIEADEFMLLSKAIRPLPEKWHGLTDVETRYRQRHVDLIVNPKVREVFITRSRIINAIRQFMDERDFLEVETPMMQPKAGGATARPFETHHNALGMDLYLRIAPELYLKRLITGGMERVYEINRNFRNEGISTFHNPEFTMMEFYQAYATYEDLMDMTEELFASVAMKIFGGLKFQYQGMDIDLTPPWPRISVKESILRHHDIDPDVLEDQEKAYAYACKLGLEVRKTEP-LGKLVTAIFEEVVEKELVQPTFVTLYPVEVSPLSRRNGKDPSLTDRFELYIAGREIANAFSELNDPQDQRERFLMQAREREEGNEETHVMDEDYVRVLEYAMPPTAGEGIGIDRLVMLFTDSPSIRDVILFPHMRKR 537
>gi|123967040|ref|YP_001012121.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515] >gi|166229816|sp|A2BZ03|SYK_PROM5 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|123201406|gb|ABM73014.1| Lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515] (512 aa)
Score = 998, Expect = 4.2e-106, Identities = 217/475 (45%), Positives = 319/475 (67%)
  Q:    12 RREKLKNLQEANQDPY-EIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKK-----KVSKSMLEY--FNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R  K  +L     +PY E  K+S +      N KF  L      + N+ LAGRV+A R      F  I D  G  Q YL K+     +++  +L +    +++D+GD + +FG+  +T KGEL++ V K +++SK+L+PLP+KWHGL D E R R RY+DLIVN  S  VF  R + + +IR+++D +N+LE+ETP+L    GGA ARPFIT HNTL+   YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFTS+E+Y A+ N   MM LTE+L K +  S     V+   +  I  ++ ++RI M + +K+ TG+DF     +  +A++ +++ N++     +TLG ++N  FE+  E++ I+PTFV  +PI++SPL+++  KN    +RFELFI  +E ANAF+EL DP+DQ +R + Q   +  G+ EA  +D DF++ALE G+PPT GLG+GIDR++ML T  SSIRDV+ FP +K
  S:     8 RLLKANSLINKGFEPYAETFKISHSTRF--LNEKFGYLDNGQEFDLNVSLAGRVLAKRVMGKIAFFTITDQEGKIQLYLEKRIIDDYEINAKLLSFEDLKEIVDIGDWIGVFGTIKKTNKGELSIKVSKWEMLSKSLQPLPDKWHGLTDIEKRYRQRYLDLIVNPLSKTVFKTRAKCISLIRRWLDEKNFLEIETPILQSEAGGAEARPFITHHNTLDIPLYLRIATELHLKRMVVGGFEKVYELGRIFRNEGVSTKHNPEFTSVEIYQAFSNYIDMMNLTEDLIKNIVLSCCDSLVINYQDKVIDFSKPWKRISMKNVVKEYTGIDFDSFDGDLNKAKKFSEEINIEISPKINTLGRLLNEVFEQKVESQLIEPTFVTDYPIEISPLARRHPKNKEMVQRFELFIAGRELANAFSELIDPVDQRQRMQLQQSLRDAGDLEAHCIDEDFLQALEIGMPPTGGLGIGIDRLVMLLTNSSSIRDVIPFPLLK 495
>gi|78780096|ref|YP_398208.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9312] >gi|123755041|sp|Q318C3|SYK_PROM9 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|78713595|gb|ABB50772.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9312] (512 aa)
Score = 997, Expect = 4.7e-106, Identities = 207/431 (48%), Positives = 299/431 (69%)
  Q:    56 NIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSM-------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGEN-EIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ++ LAGRV+A R      F  I D  G  Q YL+K+ ++ ++        E   +++D+GD + ++G+  +T KGEL++ V+K +++SK+L+PLP+KWHGL D E R R RY+DLIVN  S  VF  R + +  IRQ++D++N+LE+ETP+L    GGA ARPFIT HNTL+   YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFTS+E+Y A+ N   MM LTE L K +  ++   +V   +N EI  ++ + RI M D +K+ TG+DF     + Q A++  K  NV+F    +++G ++N  FE+  E++ I+PTFV  +P+++SPL++    N    +RFELFI  +E ANAF+EL DP+DQ ER + Q   +  G+ EA  +D DF+ ALE G+PPT GLG+GIDR+IML T   SIRDV+ FP +K
  S:    52 SVSLAGRVMAKRVMGKIAFFTISDQEGQIQLYLDKRMINCNLENQKLLSFEDIKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLQPLPDKWHGLTDIEKRYRQRYLDLIVNPHSKNVFKTRAKCISFIRQWLDNRNFLEIETPILQSEAGGAEARPFITHHNTLDIPLYLRIATELHLKRMVVGGFEKVYELGRIFRNEGISTKHNPEFTSVEIYQAFSNYVDMMNLTEELIKDIVFNVCGSLVINYQNKEIDFSKPWSRISMKDIVKKYTGIDFDSFSGDFQSAKQAVKSINVEFSNKVNSMGRLLNEVFEQKVESELIEPTFVIDYPVEISPLARPHLDNKEMVQRFELFIVGRELANAFSELIDPVDQRERMQLQQSLRDEGDHEAHCIDEDFLNALEIGMPPTGGLGIGIDRLIMLITNSPSIRDVIPFPLLK 495
>gi|159898199|ref|YP_001544446.1| lysyl-tRNA synthetase [Herpetosiphon aurantiacus ATCC 23779] >gi|159891238|gb|ABX04318.1| lysyl-tRNA synthetase [Herpetosiphon aurantiacus ATCC 23779] (492 aa)
Score = 997, Expect = 4.8e-106, Identities = 208/485 (42%), Positives = 308/485 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNI--KLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHG-LEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + ND +  R  KL+ LQ A  +PY      RT T+     +F+ L   N    I  +L  R V  +  F  + D +G  Q +L+K  V     ++F  + DLGDI+ + G+ F T+ GE ++ V    ++SKA+ P P+K  G   D+E R R RYVDL  N +  ++F  R R++  +R+++D + +LEVETPVL  I GGA ARPF T HN L ++ YLRIATEL LK+LIVGGFD VYEIG+ FRNEG+D THNPEFT +EVY AY + E +M+LTE + ++ A+ +     ++   ++I L   ++R+ M D I ++TGVD  E +      E   +  +K E+ + T    ++  F EF E + IQPTF+  +P  +SPL+K+   +P F +RFELF+   E ANAF+ELNDP DQ +RF  Q ++ + G+DEA++MD D++EAL+ G+PPT GLG+GIDR+ +LFT +++IR+V+ FPH++ +
  S:     2 ELNDLQQTRYGKLQALQAAGIEPYPARVPQRTHTLTAVREQFSALVEANATVTIMGRLRQRRVMGKSAFAHLNDDHGAFQIFLSKADVGDEPFKHFVDLTDLGDIIAVTGTLFTTKMGEPSVHVTSWTMLSKAITPPPDKREGQFSDQEARQRQRYVDLSANPEVREIFRIRARLITAMRRYLDERGFLEVETPVLQGIYGGAAARPFTTHHNQLHQDLYLRIATELYLKRLIVGGFDGVYEIGKNFRNEGVDRTHNPEFTMIEVYQAYGDYESIMQLTEGMIRFAAEQIFNSTSIEYQGHQIELGGSWQRLTMRDAIFEKTGVDIRECREFDTLWEAIGEAGLKIER-KPTWAKQVDELFSEFVEPELIQPTFITEYPQPLSPLAKRKADDPQFVERFELFMLGAEIANAFSELNDPFDQEQRFLEQGRDYAAGDDEAMQMDEDYLEALKVGMPPTGGLGIGIDRLCLLFTNQTTIREVIFFPHLRKQ 489
>gi|124514753|gb|EAY56265.1| Lysyl-tRNA synthetase [Leptospirillum sp. Group II UBA] (507 aa)
Score = 997, Expect = 5.7e-106, Identities = 219/483 (45%), Positives = 300/483 (62%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY-----EIEKVSRTMT-IGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHII---NLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +  +QE +RR+K   L EA  DPY       E V+R M  I    S  + L    +    ++AGRVV LR+     F  ++D  G  Q Y+ K  + +       + LD+GD + + G+ FRT+ GE TLD   +  + K++ PLPEKWHGL D E R R RY+DLIVN D+  VFV R +IL  IR+FM+ + ++EVETP++HP  GGA ARPF+T HN L+ + YLRIA EL LK+L+VGGFD V+EI R FRNEG    HNPEFT ME Y AY + E +M LTE+LF  +A+ +        GE+ +     +RR+   D +   TG+D   +       +L ++  ++    ++   +I    NL FEE  E   IQPTFV G+P  +SPL++   ++P  T RFELF+   E AN F ELNDP +Q  RF +Q + ++ G+ EA   DMD+I ALE GLPPTAG G+GIDR++ML T + SIRDVLLFP M+
  S:    13 ELTEQERVRRQKRDRLAEAGIDPYGAPFPNREPVARLMERISSLPSDASVLPPLES----RIAGRVVLLRRFGKAFFATLQDASGRFQIYVRKDHIGEEPYALLAETLDIGDHLGVEGTFFRTKTGEPTLDASHVTFLGKSVHPLPEKWHGLTDIEQRYRQRYIDLIVNPDARDVFVRRGKILGSIRRFMEDRGFMEVETPMMHPSPGGALARPFVTHHNALDVDLYLRIAPELYLKRLMVGGFDLVFEINRNFRNEGFSPRHNPEFTMMEFYMAYHSPEDLMALTESLFDRLAREIHGDSRFAYGEHRLDFAGPYRRLSYFDALTGATGLDRASLFDENRIMDLIRQKGLEIPPRRAGKPYIADLQNLLFEEEIEKTLIQPTFVTGYPRSISPLARSSREDPEITDRFELFVAGVEIANGFMELNDPDEQLRRFLSQQESRNSGDLEAPPPDMDYIRALEIGLPPTAGEGIGIDRLVMLLTNQHSIRDVLLFPQMR 505
>gi|148653258|ref|YP_001280351.1| lysyl-tRNA synthetase [Psychrobacter sp. PRwf-1] >gi|148572342|gb|ABQ94401.1| lysyl-tRNA synthetase [Psychrobacter sp. PRwf-1] (510 aa)
Score = 996, Expect = 6.0e-106, Identities = 216/483 (44%), Positives = 304/483 (62%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN--------IKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ND    R+ KL  +  A +  Y   +  RT    D   +F  +       N        + +AGRV+  R  F VI+D  G  Q Y+ +K++ +  L    K LDLGDI+ + G   R+ KG+L + +++I +++K+L+P+P K+HGL D E R R+R++DL+ N+ S   F+ R +++  IR+FM ++ ++EVETP++HPI GGA ARPFIT HN L+   YLRIA EL LK+L+VGGF++V+EI R FRNEG+ + HNPEFT +E Y AY + + +M LTE LF  +A   L    +   E  I L   F R+ M D I Q   G D  +V       + A+    +  K    +G +  + FEE  E K  QPTF+  +P + SPL++++ +NP  T RFELFI  +E AN F+ELNDP DQ ERF  QV EK  G+DEA+  D D+IEAL YGLPPTAG G+GIDR++MLFT+ +SIRDV+LFPHM+ K
  S:    19 NDLIAQRQAKLDEISAAGKIAYP-NQFKRTDYAEDLQKQFEGITKQEIEENAANGGKTQVSIAGRVMLNRGAFIVIQDMTGRIQLYVARKELDEDSLALI-KSLDLGDIIGVSGYIGRSGKGDLYVHIEQITLLTKSLRPMPNKFHGLADTEARYRNRHLDLMTNESSRNTFMIRSQVISGIRKFMLNERFMEVETPMMHPIPGGAVARPFITHHNALDMPLYLRIAPELYLKRLVVGGFERVFEINRSFRNEGVSTRHNPEFTMIEFYQAYADYKDLMDLTERLFNQLAMDILGTTELTYQEETISLKAPFARLSMTDAIAQYAEGFDMSKVADRDYLADYAQNVLKQQVKEGFGIGKLQTIIFEETAEHKLRQPTFITQYPAETSPLARRNDENPEITDRFELFIGGREIANGFSELNDPADQAERFHNQVAEKDAGDDEAMHFDADYIEALAYGLPPTAGEGIGIDRLVMLFTDAASIRDVILFPHMRIK 509
>gi|153815948|ref|ZP_01968616.1| hypothetical protein RUMTOR_02193 [Ruminococcus torques ATCC 27756] >gi|145846767|gb|EDK23685.1| hypothetical protein RUMTOR_02193 [Ruminococcus torques ATCC 27756] (576 aa)
Score = 995, Expect = 7.8e-106, Identities = 207/422 (49%), Positives = 298/422 (70%)
  Q:    67 RQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + +F  ++D  G+ Q Y+ +  + +   + F K LD+GD++ I G  F+T+ GE+++    + ++SK+L+ LPEK+HGL + ++R R RYVDLI+N ++   F+ R +I+  IR+++D + ++EVETP+L    GGA ARPF T  N L  +  LRI+ EL LK+LIVGG ++VYEIGR+FRNEG+D+ HNPEFT ME+Y AY +   MM LTENL+++VA+  L    +     E+ L + F RI MVD +K+  GVD+ EVK+ +EA++LA +H+V++E+H    G I++LFFEEF E   IQPTFV  HPI++SPL+KK  +NP +T+RFE F+N  E ANA++ELNDPIDQ ERF+AQ +  + G++EA   D DF+ ALE G+PPT G+G GIDRM ML T  ++IRDVLLFP MK +
  S:     9 KASFCNVQDLKGNIQSYVARDSIGEENYKEFKK-LDVGDVIGIEGEVFKTKTGEISIHASHVTLLSKSLQILPEKFHGLTNTDMRYRQRYVDLIMNPEAKDTFIKRSKIISAIRRYLDGEGFMEVETPMLVANAGGAAARPFETHFNALNEDLKLRISLELYLKRLIVGGLERVYEIGRVFRNEGLDTRHNPEFTLMELYQAYTDYNGMMDLTENLYRHVAQEVLGTTKIVYNGVEMDLGKPFERITMVDAVKKYAGVDWNEVKTLEEARKLADEHHVEYEEHHKK-GDILSLFFEEFAEEHLIQPTFVMDHPIEISPLTKKKPENPEYTERFEFFMNGWEMANAYSELNDPIDQRERFKAQEELLAQGDEEANTTDEDFLNALEIGMPPTGGIGFGIDRMCMLLTNSAAIRDVLLFPTMKTQ 429
>gi|116071683|ref|ZP_01468951.1| lysyl-tRNA synthetase [Synechococcus sp. BL107] >gi|116065306|gb|EAU71064.1| lysyl-tRNA synthetase [Synechococcus sp. BL107] (502 aa)
Score = 995, Expect = 8.6e-106, Identities = 208/475 (43%), Positives = 302/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN-NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKV---LDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK   L E  Q PY +     +  + +  +  A L        ++ +AGRV+  R      F  + D  G  Q +L K  +      +F ++   +D GD + + G+  RT +GEL++ V+  +++SK+L+PLP+KWHGL D E R R RY+DLIV+  S + F  R  ++  IR+++D + +LE+ETPVL    GGA+ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEGM + HNPEFTS+EVY AY +   MM LTE++   V + +     +     +I LT  +RR  M + +++ TG++F    +  +A E  +   ++      ++G ++N  FE+  EA  IQPTFV  +PI++SPL++K    PG  +RFELFI  +E ANAF+EL DP+DQ +R EAQ   K+ G+ EA  +D DF+ ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP M+
  S:     8 RLEKATTLGELGQGPYAL-TFEPSHRMAELQADHADLPNGEERELSVAVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKAGLEAQQEGWFKQITSLVDAGDWLGVSGTLRRTDRGELSVKVRDWRMLSKSLQPLPDKWHGLADVEKRYRQRYLDLIVSPQSRETFRRRALLVSGIRRWLDERQFLEIETPVLQSEAGGADARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGMSTRHNPEFTSVEVYQAYSDYIGMMELTESMIAEVCQQVCGGTHIHYQGTDIDLTPPWRRATMHELVEEATGLNFEAFTTRAQAAEAMEAAGLEVPGAADSVGRLLNEAFEQRVEANLIQPTFVTDYPIEISPLARKHRSKPGLVERFELFIVGRETANAFSELIDPVDQRQRLEAQQARKAAGDLEAQGLDEDFVHALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLMR 490
>gi|74314615|ref|YP_313034.1| lysyl-tRNA synthetase [Shigella sonnei Ss046] >gi|73858092|gb|AAZ90799.1| lysine tRNA synthetase, inducible [Shigella sonnei Ss046] (505 aa)
Score = 995, Expect = 8.8e-106, Identities = 218/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG II   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKNNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIITEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|168707439|ref|ZP_02739716.1| lysyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045] (493 aa)
Score = 995, Expect = 9.4e-106, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:     3 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 493
>gi|170766869|ref|ZP_02901322.1| lysyl-tRNA synthetase LysU [Escherichia albertii TW07627] >gi|170124307|gb|EDS93238.1| lysyl-tRNA synthetase LysU [Escherichia albertii TW07627] (505 aa)
Score = 994, Expect = 1.0e-105, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQDVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|1311301|pdb|1LYL|A Chain A, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine >gi|1311303|pdb|1LYL|B Chain B, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine >gi|1311305|pdb|1LYL|C Chain C, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine >gi|9954996|pdb|1E1O|A Chain A, Lysyl-Trna Synthetase (Lysu) Hexagonal For, Complexed With L >gi|9954997|pdb|1E1T|A Chain A, Lysyl-Trna Synthetase (Lysu) Hexagonal Form Complexed With T Lysyl_adenylate Intermediate >gi|9954998|pdb|1E22|A Chain A, Lysyl-Trna Synthetase (Lysu) Hexagonal Form Complexed With Lysine And The Non-Hydrolysable Atp Analogue Amp-Pcp >gi|9954999|pdb|1E24|A Chain A, Lysyl-Trna Synthetase (Lysu) Hexagonal Form Complexed With Lysine And Atp And Mn2+ (504 aa)
Score = 994, Expect = 1.2e-105, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    14 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 504
>gi|194437248|ref|ZP_03069346.1| lysyl-tRNA synthetase LysU [Escherichia coli 101-1] >gi|194423804|gb|EDX39793.1| lysyl-tRNA synthetase LysU [Escherichia coli 101-1] (505 aa)
Score = 994, Expect = 1.2e-105, Identities = 217/485 (44%), Positives = 319/485 (65%)
  Q:     5 FNDQELIRREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L++   A  + +  +  S  +   +F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSEQLH-EEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|160889278|ref|ZP_02070281.1| hypothetical protein BACUNI_01700 [Bacteroides uniformis ATCC 8492] >gi|156861285|gb|EDO54716.1| hypothetical protein BACUNI_01700 [Bacteroides uniformis ATCC 8492] (576 aa)
Score = 994, Expect = 1.2e-105, Identities = 211/486 (43%), Positives = 314/486 (64%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  +  L+    +PY   +        D  ++F           + +AGR+++ R     +F  ++D  G  Q Y+ +  +     K M    F ++LDLGD + I G  FRTQ GE+++  KK+ +++K++KPLP         +   ED ELR R RYVDLIVN    + F+ R  ++K +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L+ + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD  HNPEFT ME+Y  Y++  +MM  TE L + +  ++      ++    I     +RR+ +++ IK++TG D  E KS  E +++ K+ N++ +      G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL +N KE ANA++ELNDPIDQ ERF+ Q++    G+DEA+ +D DF++AL+YG+PPT+G+G+GIDR+ ML T +S I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSMNELRAMGIEPYPAAEYVTNAFSTDIKAEF---NDDAEPRQVSVAGRIMSRRIMGKASFIELQDSKGRIQVYITRDDICPDEDKEMYNTVFKRLLDLGDFIGIEGFVFRTQMGEISIHAKKLTVLAKSIKPLPIVKYKDGVAYDSFEDPELRYRQRYVDLIVNDGVKEKFLKRATVIKTMRAVLDEAGYTEVETPILQSIPGGASARPFITHHNSLDMDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDKNHNPEFTCMELYVQYKDYNWMMSFTEKLLERICIAVNGCTETEIDGKTISFKAPYRRLPILEAIKEKTGYDL-EGKSEDEIRQVCKELNMEIDDTMGK-GKLIDEIFGEFCEGTFIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKELANAYSELNDPIDQEERFKDQLRLSEKGDDEAMFIDQDFLKALQYGMPPTSGIGIGIDRLTMLMTGESFIQEVLFFPQMRPEK 502
>gi|26111378|gb|AAN83560.1|AE016771_71 Lysyl-tRNA synthetase, heat inducible [Escherichia coli CFT073] >gi|91075253|gb|ABE10134.1| lysyl-tRNA synthetase, heat inducible [Escherichia coli UTI89] (514 aa)
Score = 994, Expect = 1.2e-105, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    24 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 514
>gi|157337750|emb|CAO22096.1| unnamed protein product [Vitis vinifera] (571 aa)
Score = 994, Expect = 1.2e-105, Identities = 209/476 (43%), Positives = 321/476 (67%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL----KTHNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKK-----HNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE--MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           IR +K++ L+    +PY   K  RT T       +  L    + ++ ++ + +AGR+VA R+ FG      +RD  G  Q Y  K+++     E    ++D+GDI+ + GS  RT+KGEL++ V    +++K+L PLP+K+HGL D + R R RYVD+I N +   +F  R +I+  IR+ ++S  ++EVETPVL    GGA ARPF+T+HN+L R+ YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFT++E+Y AY + E MM + E +    A ++  K  +     EI L + +RR  M++ +K+ TG+DF E+ ++ + A+E+A +     H+ K +   +  +++GH++N  FE   E + IQPTFV  +PI++SPL+K   ++ G T+RFELFI  +E ANAF+EL DP+DQ +  E +  E     DE+ E  +D DF+ ALEYG+PP +G+G+G+DR++ML T  +SIRDV+ FP +K
  S:    77 IRLKKVEELRNKGLEPYAY-KWDRTHTANQLQDIYRHLGNGEELNSESDYVSIAGRIVA-RRAFGKLAFFTLRDDSGTIQLYCEKERLLNEQFEQLKTLVDIGDILGVSGSIKRTEKGELSVYVNSFAVLTKSLLPLPDKYHGLTDVDKRYRQRYVDMIANPEVADIFRKRAKIVSAIRRTVESSGFVEVETPVLQVPAGGAEARPFVTYHNSLGRDLYLRIATELHLKRMLVGGFEKVYEMGRIFRNEGISTRHNPEFTTIEMYEAYSDYESMMNMAEEIVTQCALAVCGKLTIDYQGTEICLERPWRRETMLNLVKEATGIDFNELDNDIKVAKEVALRALGIGHDSKDKSSIEACTSVGHVLNEVFEIVVEPQLIQPTFVLDYPIEISPLAKPHRRHAGLTERFELFICGRELANAFSELTDPMDQPDHAEVKTTESE---DESYEVTLDDDFLTALEYGMPPASGMGLGVDRLVMLLTNSASIRDVIAFPVLK 568
>gi|117617708|ref|YP_857858.1| lysyl-tRNA synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166229790|sp|A0KNK7|SYK_AERHH Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|117559115|gb|ABK36063.1| lysyl-tRNA synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (511 aa)
Score = 994, Expect = 1.3e-105, Identities = 217/485 (44%), Positives = 316/485 (65%)
  Q:     5 FNDQELIRREKLKNLQ-EANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL----KKPVVKMGEN--EIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            N++   RR KL  L+ + N  P +  + S +   GD +++F              +K+AGR++  R     +F  ++D  G  Q Y+ +  + +       K  DLGDIV + G+ FRT  GEL++ V  I++++KAL+PLPEK  GL D+E R R RY+DLI N++S K FV R +++  IR+F++ + ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++VYEI R FRNEG+   HNPEFT +E Y AY +   +M LTE + + +A+ +    K    K GE    I   Q F+R+ MVD I K    V   ++ + ++A  +AK+ +++  K    LGH+I   FEE  E   +QPTF+  +P  VSPL++++ +NP  T RFE FI  +E AN F+ELND  DQ ERF+AQV +K+ G+DEA+  D DF+ ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP ++ +K
  S:    16 LNNEMQERRSKLAALRAQGNPFPNDFRRDSLS---GDLHAEFGDKSADELAALGKRVKIAGRIMTRRIMGKASFATLQDMAGKIQVYVTRDDLPEGFYNEQFKKWDLGDIVGVEGTLFRTNTGELSVHVSDIRLLTKALRPLPEKHKGLTDQEARCRQRYLDLIANEESRKTFVTRTKVVAGIRKFLNDKRFMEVETPMMQVIPGGASARPFITHHNALDIDMYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISVRHNPEFTMLEFYMAYADYIDLMDLTEEMLRTLAQDILGDTKIRYAKEGEEGLTIDFGQPFQRLSMVDSILKYNPDVTRDDLATLEKATAVAKRLHIELMKSWE-LGHVITAIFEETVEHMLLQPTFITEYPAAVSPLARRNDQNPDVTDRFEFFIGGRELANGFSELNDAEDQAERFQAQVDQKAAGDDEAMFYDADFVTALEHGLPPTAGQGIGIDRLVMLFTNSHTIRDVILFPALRPQK 511
>gi|78183738|ref|YP_376172.1| lysyl-tRNA synthetase [Synechococcus sp. CC9902] >gi|123729968|sp|Q3B0J9|SYK_SYNS9 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|78168032|gb|ABB25129.1| Lysyl-tRNA synthetase, class-2 [Synechococcus sp. CC9902] (502 aa)
Score = 994, Expect = 1.3e-105, Identities = 207/475 (43%), Positives = 302/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNN-NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKV---LDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK   L++  Q PY +     +  + +  +  A L        ++ +AGRV+  R      F  + D  G  Q +L K  +      +F ++   +D GD + + G+  RT +GEL++ V+  +++SK+L+PLP+KWHGL D E R R RY+DLIV+  S + F  R  ++  IR+++D + +LE+ETPVL    GGA+ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEGM + HNPEFTS+EVY AY +   MM LTE +   V + +     +     +I LT  +RR  M + +++ TG++F    +  +A E  +   ++      ++G ++N  FE+  EA  IQPTFV  +PI++SPL++K    PG  +RFELFI  +E ANAF+EL DP+DQ +R EAQ   K+ G+ EA  +D DF+ ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP M+
  S:     8 RLEKANTLEQLGQGPYAL-TFDPSHRMAELQADHADLPNGEERELSVAVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKAGLEAQQEGWFKQITSLVDAGDWLGVSGTLRRTDRGELSVKVRDWRMLSKSLQPLPDKWHGLADVEKRYRQRYLDLIVSPQSRETFRRRALLVSGIRRWLDERQFLEIETPVLQSEAGGADARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGMSTRHNPEFTSVEVYQAYSDYIGMMELTEAMIAEVCQQVCGGTRIHYQGTDIDLTPPWRRATMHELVEEATGLNFEAFTTRAQAAEAMEAAGLEVPGAADSVGRLLNEAFEQRVEASLIQPTFVTDYPIEISPLARKHRSKPGLVERFELFIVGRETANAFSELIDPVDQRQRLEAQQARKAAGDLEAQGLDEDFVHALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLMR 490
>gi|157158511|ref|YP_001465628.1| lysyl-tRNA synthetase [Escherichia coli E24377A] >gi|170021873|ref|YP_001726827.1| lysyl-tRNA synthetase [Escherichia coli ATCC 8739] >gi|157080541|gb|ABV20249.1| lysyl-tRNA synthetase [Escherichia coli E24377A] >gi|169756801|gb|ACA79500.1| lysyl-tRNA synthetase [Escherichia coli ATCC 8739] (505 aa)
Score = 994, Expect = 1.3e-105, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKNNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|117626414|ref|YP_859737.1| lysyl-tRNA synthetase [Escherichia coli APEC O1] >gi|161486020|ref|NP_756986.2| lysyl-tRNA synthetase [Escherichia coli CFT073] >gi|162138308|ref|YP_543665.2| lysyl-tRNA synthetase [Escherichia coli UTI89] >gi|39932415|sp|Q8FAT5|SYK2_ECOL6 Lysyl-tRNA synthetase, heat inducible (Lysine--tRNA ligase) (LysRS) >gi|115515538|gb|ABJ03613.1| lysyl-tRNA synthetase [Escherichia coli APEC O1] (505 aa)
Score = 993, Expect = 1.5e-105, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|15804722|ref|NP_290763.1| lysyl-tRNA synthetase [Escherichia coli O157:H7 EDL933] >gi|15834365|ref|NP_313138.1| lysyl-tRNA synthetase [Escherichia coli O157:H7 str. Sakai] >gi|16131955|ref|NP_418553.1| lysine tRNA synthetase, inducible [Escherichia coli str. K-12 substr. MG1655] >gi|89110851|ref|AP_004631.1| lysine tRNA synthetase, inducible [Escherichia coli W3110] >gi|157163595|ref|YP_001460913.1| lysyl-tRNA synthetase [Escherichia coli HS] >gi|168719619|ref|ZP_02751896.1| lysyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206] >gi|168737193|ref|ZP_02769470.1| lysyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115] >gi|168748011|ref|ZP_02773033.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4113] >gi|168755314|ref|ZP_02780321.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4401] >gi|168760993|ref|ZP_02786000.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4501] >gi|168766403|ref|ZP_02791410.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4486] >gi|168774502|ref|ZP_02799509.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4196] >gi|168780556|ref|ZP_02805563.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4076] >gi|168784761|ref|ZP_02809768.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC869] >gi|168794584|ref|ZP_02819591.1| lysyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042] >gi|168798195|ref|ZP_02823202.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC508] >gi|170083579|ref|YP_001732899.1| lysine tRNA synthetase, inducible [Escherichia coli str. K12 substr. DH10B] >gi|188493779|ref|ZP_03001049.1| lysyl-tRNA synthetase LysU [Escherichia coli 53638] >gi|193063048|ref|ZP_03044140.1| lysyl-tRNA synthetase LysU [Escherichia coli E22] >gi|194426817|ref|ZP_03059370.1| lysyl-tRNA synthetase LysU [Escherichia coli B171] >gi|195935919|ref|ZP_03081301.1| lysyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4024] >gi|67473144|sp|P0A8N5|SYK2_ECOLI Lysyl-tRNA synthetase, heat inducible (Lysine--tRNA ligase) (LysRS) >gi|67473145|sp|P0A8N6|SYK2_ECO57 Lysyl-tRNA synthetase, heat inducible (Lysine--tRNA ligase) (LysRS) >gi|12519106|gb|AAG59329.1|AE005646_8 lysine tRNA synthetase, inducible; heat shock protein [Escherichia coli O157:H7 EDL933] >gi|398703|emb|CAA34542.1| unnamed protein product [Escherichia coli] >gi|536974|gb|AAA97029.1| lysyl-tRNA synthetase [Escherichia coli] >gi|1790571|gb|AAC77090.1| lysine tRNA synthetase, inducible [Escherichia coli str. K-12 substr. MG1655] >gi|13364588|dbj|BAB38534.1| lysine tRNA synthetase [Escherichia coli O157:H7 str. Sakai] >gi|85676882|dbj|BAE78132.1| lysine tRNA synthetase, inducible [Escherichia coli W3110] >gi|157069275|gb|ABV08530.1| lysyl-tRNA synthetase [Escherichia coli HS] >gi|169891414|gb|ACB05121.1| lysine tRNA synthetase, inducible [Escherichia coli str. K12 substr. DH10B] >gi|187769884|gb|EDU33728.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4196] >gi|188017408|gb|EDU55530.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4113] >gi|188488978|gb|EDU64081.1| lysyl-tRNA synthetase LysU [Escherichia coli 53638] >gi|189001831|gb|EDU70817.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4076] >gi|189357458|gb|EDU75877.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4401] >gi|189364021|gb|EDU82440.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4486] >gi|189368520|gb|EDU86936.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC4501] >gi|189375037|gb|EDU93453.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC869] >gi|189379164|gb|EDU97580.1| lysyl-tRNA synthetase LysU [Escherichia coli O157:H7 str. EC508] >gi|192931307|gb|EDV83909.1| lysyl-tRNA synthetase LysU [Escherichia coli E22] >gi|194415153|gb|EDX31422.1| lysyl-tRNA synthetase LysU [Escherichia coli B171] (505 aa)
Score = 993, Expect = 1.5e-105, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|149192199|ref|ZP_01870416.1| lysyl-tRNA synthetase [Vibrio shilonii AK1] >gi|148833957|gb|EDL50977.1| lysyl-tRNA synthetase [Vibrio shilonii AK1] (505 aa)
Score = 992, Expect = 1.9e-105, Identities = 216/478 (45%), Positives = 310/478 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           RR KL+ ++++ +         R    GD   +F   +K +    N+ + +AGR++A R  F VI++  G  Q Y   K V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS + F+ R +++  IR FM S+ YLEVETP++H I GGA ARPFIT HN L+ + YLR+A EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE +   VA   L    +  G+  +    K+ R+ M D IK       Q   +   ++ + +    +AK  +V+ E    T G ++   F E  E K IQPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR+ MLFT   +IRDV+LFP M+ ++
  S:    20 RRAKLEQIRKSCKANGHPNDFRRDALAGDLQKEFGEKSKEELEALNHVVSIAGRIMAKRGPFLVIQETSGRIQAYA-AKDVQKELKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRQAFIVRSKLVSSIRNFMSSKGYLEVETPMMHVIPGGATARPFITHHNALDIDMYLRVAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYQAYADYKDLMDLTEEMLSTVAMDVLGSTSMPYGDETVEFGGKYARMSMFDAIKHYNPEHEQIQALTEEDLTNRELMVSIAKSVHVEVETFW-TCGQLLEEIFGETAEPKLIQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVDAKDAGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLAMLFTNTHTIRDVILFPAMRPQQ 505
>gi|15606442|ref|NP_213822.1| lysyl-tRNA synthetase [Aquifex aeolicus VF5] >gi|6226183|sp|O67258|SYK_AQUAE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|2983651|gb|AAC07218.1| lysyl-tRNA synthetase [Aquifex aeolicus VF5] (597 aa)
Score = 992, Expect = 2.0e-105, Identities = 205/429 (47%), Positives = 299/429 (69%)
  Q:    57 IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKY-VAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDF-WEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHM 485
           + LAGR+V++R      FG I+D  G  Q YL K  + +  L++FN  +D+GDIV + G  FRT  GELT++V++ ++++K+L PLPEKWHGL+D E+R R RY+DLI N ++ ++F+ R +++  +R+F +   ++EVETP+L PI  GANARPF+T+HN LE   YLRIA EL LK+LIVGGF +VYEIG+ FRNE +D THNPEFT +E YAAY +   +++ TE++F Y + K+L    VK GE E+  +  F+++   D +K++TG D  + +K  +  ++LAK+  +  +  + T   +++  FE+  E   IQPTFV   P  +SPL+K   ++P   +RFEL I   E ANA+ ELNDP DQ ERF  Q+KEK +G++EA++MD DFI ALEYG+PPTAG G+GIDR++M+     SIR+V+LFP +
  S:   154 VSLAGRLVSMRSMGKAIFGHIQDLTGKIQIYLKKDVIGEEKLKFFNDYIDVGDIVGVRGKLFRTNTGELTVEVEEYQLLAKSLHPLPEKWHGLKDVEVRYRQRYLDLIANPEARRIFMLRTKLITEMRKFFEMHGFIEVETPILQPIASGANARPFVTYHNFLETELYLRIAPELYLKRLIVGGFPRVYEIGKNFRNESVDRTHNPEFTMVEFYAAYWDYHDLIKFTEDMFVYLLEKTLGTLKVKYGEWELDFSPPFKKVRYFDLLKEKTGKDKDFFLKDLEGLRKLAKELEIP-DVERMTHAKLLDKVFEKVAEEDLIQPTFVIDFPKILSPLAKTHREDPDLVERFELIIARYEVANAYTELNDPFDQKERFLEQLKEKQMGDEEAMDMDEDFIRALEYGMPPTAGEGIGIDRLVMILANTDSIREVILFPQL 587
>gi|126697148|ref|YP_001092034.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9301] >gi|166229814|sp|A3PFA8|SYK_PROM0 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|126544191|gb|ABO18433.1| Lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9301] (512 aa)
Score = 992, Expect = 2.0e-105, Identities = 207/433 (47%), Positives = 296/433 (68%)
  Q:    54 NNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSM-------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYV-AKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           N ++ LAGRV+A R      F  I D  G  Q YL K+ ++ ++        E   +++D+GD + ++G+  +T KGEL++ V+K +++SK+L+PLP+KWHGL D E R R RY+DLIVN  S  VF  R + +  IR+++D++N+LE+ETP+L    GGA ARPFIT HNTL+   YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE L K + A +     +     EI  ++ + RI M D +K+ TG+DF     +   A++  K  NV F    +T+G ++N  FE+  E+K I+PTFV  +P+++SPL++  + N    +RFELFI  +E ANAF+EL DP+DQ ER + Q   +  G+ EA  +D DF+ ALE G+PPT GLG+GIDR+IML T  +SIRDV+ FP +K
  S:    50 NFSVSLAGRVMAKRVMGKIAFFTISDQDGQIQLYLEKRIINLNLEKQKLLSFEDIKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLQPLPDKWHGLTDIEKRYRQRYLDLIVNPHSKNVFKTRAKCISFIRKWLDNRNFLEIETPILQSEAGGAEARPFITHHNTLDIPLYLRIATELHLKRMVVGGFEKVYELGRIFRNEGISTRHNPEFTSVEIYEAYSDYVDMMNLTEELIKDILADACGSLTINYQNKEIDFSKPWLRISMKDIVKKYTGIDFHSFNGDFLAAKKAVKNINVDFSNKVNTIGRLLNEVFEQKVESKLIEPTFVIDYPVEISPLARPHFDNKEIVQRFELFIVGRELANAFSELIDPVDQRERMQLQQSLRDKGDLEAHCIDEDFLNALEIGMPPTGGLGIGIDRLIMLITNSASIRDVIPFPLLK 495
>gi|114320955|ref|YP_742638.1| lysyl-tRNA synthetase [Alkalilimnicola ehrlichei MLHE-1] >gi|114227349|gb|ABI57148.1| lysyl-tRNA synthetase [Alkalilimnicola ehrlichei MLHE-1] (499 aa)
Score = 992, Expect = 2.1e-105, Identities = 217/481 (45%), Positives = 310/481 (64%)
  Q:     6 NDQELI--RREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIY-LTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +D +LI  RREKL  L+EA Q  P +  + S    I    ++         N  +++AGR++A R     +F  ++D  G  Q +L + ++ + + + F K  D+GDI+   G+ FRT+KGEL++ V ++++++K+L+PLPEK+HGL D E R R RYVDLI+N DS +VF+ R R++  IR F++ + +LEVETP++ PI GGA ARPF+T HN L  + YLR+A EL LK+L+VGGF++VYEI R FRNEG+ + HNPEFT +E Y AY +   +M LTE + + +A+          + E +   + FRRI MVD I +    +    +     A  LA   N+    H+  LG +  + FE   E K  +PTFV  +P +VSPL++    +P +T+RFEL +  +E AN F+ELND  DQ ERF AQ  EK+ G+DEA+  D DFI ALEYGLPPTAG G+GIDR++MLF +  SIRDVLLFP M+
  S:     7 DDNKLIAQRREKLAALREAGQAFPNDFRRDSLAADIHARCAELDDEALEAENIRVRVAGRMMAKRVMGKASFTHLQDQSGRIQLFLARDELPEGVYQQF-KGWDVGDIIGAAGTLFRTRKGELSVKVDELRLLTKSLRPLPEKYHGLTDTEARYRQRYVDLIMNDDSRRVFMLRSRLVAGIRDFLNGRGFLEVETPMMQPIPGGATARPFVTHHNALGADLYLRVAPELYLKRLVVGGFEQVYEINRNFRNEGVSTRHNPEFTMLEFYQAYADHNDLMDLTEAMLRRLAEEQLGTTQITYQGETFDFGRPFRRIRMVDAICEFNPDIGPEALTDRDSALNLAGHLNIPLMGHEG-LGKLQMVIFETTTEHKLREPTFVTHYPKEVSPLARPVDDDPFYTERFELIVGGREIANGFSELNDAEDQAERFRAQAAEKAAGDDEAMHYDADFIRALEYGLPPTAGEGIGIDRLVMLFADAPSIRDVLLFPAMR 494
>gi|193067810|ref|ZP_03048776.1| lysyl-tRNA synthetase LysU [Escherichia coli E110019] >gi|192958785|gb|EDV89222.1| lysyl-tRNA synthetase LysU [Escherichia coli E110019] (505 aa)
Score = 992, Expect = 2.1e-105, Identities = 217/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLVALRQQGVAFPNDFRRDHTSDQLHEEFDAKNNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|188991535|ref|YP_001903545.1| lysyl-tRNA synthetase heat inducible [Xanthomonas campestris pv. campestris] >gi|167733295|emb|CAP51494.1| lysyl-tRNA synthetase heat inducible [Xanthomonas campestris pv. campestris] (505 aa)
Score = 992, Expect = 2.2e-105, Identities = 203/453 (44%), Positives = 290/453 (64%)
  Q:    34 RTMTIGDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFE-KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RT   GD  ++FA+ +T         + ++KLAGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ IR ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A+  L    V     +I L   FRR  M + ++     +         A  L     +K + K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+ PT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    41 RTHFAGDLQAEFAEAETWTAEALEAADRSVKLAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKASALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAIRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQVIRDTAQGVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP-EISAADCTDRAALLRHCERLKIKVKPSYGWGKLLLEIFEATVEHTLVQPTFITDHPVEVSPLARASDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHYDADYIRALEYGMAPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 502
>gi|21231301|ref|NP_637218.1| lysyl-tRNA synthetase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66768647|ref|YP_243409.1| lysyl-tRNA synthetase [Xanthomonas campestris pv. campestris str. 8004] >gi|81305381|sp|Q4UU84|SYK_XANC8 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|39932239|sp|Q9L3G6|SYK_XANCP Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|7688055|emb|CAB89697.1| putative lysyl tRNA synthetase [Xanthomonas campestris pv. campestris] >gi|21112955|gb|AAM41142.1| putative lysyl tRNA synthetase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66573979|gb|AAY49389.1| putative lysyl tRNA synthetase [Xanthomonas campestris pv. campestris str. 8004] (505 aa)
Score = 991, Expect = 2.3e-105, Identities = 203/453 (44%), Positives = 290/453 (64%)
  Q:    34 RTMTIGDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFE-KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RT   GD  ++FA+ +T         + ++KLAGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ IR ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A+  L    V     +I L   FRR  M + ++     +         A  L     +K + K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+ PT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    41 RTHFAGDLQAEFAEAETWTAEALEAADRSVKLAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKATALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAIRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQVIRDTAQGVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP-EISAADCTDRAALLRHCERLKIKVKPSYGWGKLLLEIFESTVEHTLVQPTFITDHPVEVSPLARASDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHYDADYIRALEYGMAPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 502
>gi|157165521|ref|YP_001467461.1| lysyl-tRNA synthetase [Campylobacter concisus 13826] >gi|112800973|gb|EAT98317.1| lysyl-tRNA synthetase [Campylobacter concisus 13826] (503 aa)
Score = 991, Expect = 2.4e-105, Identities = 219/484 (45%), Positives = 305/484 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN----IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E+ R E +  L+    +PY    + R M I  F  KF  +K           + LAGR+  +R      F  I D  G+ Q Y + K +     +   K +++GDIV + G  F T+ GE ++ V ++ + +K++ PLPEK+HGL D E R R RY+D+I+N +    F  R  I+  IR+F + + +LEVETP+LHPI GGANA+PF+TFHN L    YLRIA EL LK+L+VGGF+ VYE+ R FRNEGMD THNPEFTS+E Y AY N   +M +TE+LF  + + L  + V+     EI  ++ F+RI     + +  G+   E   + +A+ LAK     FE ++   LGH+    F+ + E+K I PTFV  +PI +SPLS++   NP   +RFELFI  +E AN F ELNDPIDQY RF+AQ+  K+ G+DEA EMD D+++AL YG+PP AG G+GIDR++ML T+K SIRDV+LFP M+  K
  S:     5 NQHEIQRLESIDELRNLGINPYP-HFLRRDMNISKFRLKFNYIKDTEEKKAEGQLVGLAGRIKLIRDAGKAVFANIEDENGNLQIYFSNKTLDPEWFKIVKKYVEIGDIVYVRGYAFITRTGEFSMHVNELSLATKSISPLPEKYHGLVDVETRYRQRYLDMIMNPEVRADFKKRSVIISTIRRFFEEKGFLEVETPMLHPIAGGANAKPFVTFHNALGVERYLRIAPELYLKRLVVGGFEAVYEMNRNFRNEGMDLTHNPEFTSIEFYWAYHNYHDLMGITEDLFNVILEKLGMEKVINFDGMEIDFSKPFKRISYKKALVEIGGLA--EDIVSDKAKILAKLRADGFEANEKLDLGHLQAELFDNYVESKLIHPTFVIDYPISISPLSRRSDTNPDVAERFELFIAGRELANGFNELNDPIDQYNRFKAQIDAKNAGDDEAHEMDEDYVKALGYGMPPVAGEGIGIDRLVMLLTDKKSIRDVVLFPAMRPLK 495
>gi|157414225|ref|YP_001485091.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9215] >gi|166980068|sp|A8G7C4|SYK_PROM2 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|157388800|gb|ABV51505.1| Lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9215] (512 aa)
Score = 991, Expect = 2.7e-105, Identities = 206/431 (47%), Positives = 296/431 (68%)
  Q:    56 NIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSM-------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFK-YVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ++ +AGRV+A R      F  I D  G  Q YL+K+ ++ ++        E   +++D+GD + ++G+  +T KGEL++ V+K +++SK+L+PLP+KWHGL D E R R RY+DLIVN  S  VF  R + +  IR+++D++N+LE+ETP+L    GGA ARPFIT HNTL+   YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE L K  VA S    ++     EI  ++ + RI M D +K+ TG+DF     +   A++  K  NV      +T+G ++N  FE+  E+K I+PTFV  +P+++SPL++  + N    +RFELFI  +E ANAF+EL DP+DQ ER + Q   +  G+ EA  +D DF+ ALE G+PPT GLG+GIDR+IML T  +SIRDV+ FP +K
  S:    52 SVSVAGRVLAKRVMGKIAFFTISDQEGQIQLYLDKRIINLNLEKQKLLSFEDIKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLQPLPDKWHGLTDIEKRYRQRYLDLIVNPHSKNVFKTRAKCISFIRKWLDNRNFLEIETPILQSEAGGAEARPFITHHNTLDIPLYLRIATELHLKRMVVGGFEKVYEMGRIFRNEGISTRHNPEFTSVEIYEAYSDYFDMMNLTEELIKDVVADSCGSLIINYQNKEIDFSKPWLRISMKDIVKKYTGIDFDSFSGDFLAAKQAVKNINVDLSNKVNTMGRLLNEVFEQKVESKLIEPTFVIDYPVEISPLARPHFDNKEIVQRFELFIVGRELANAFSELIDPVDQRERMQLQQSLRDEGDLEAHCIDEDFLNALEIGMPPTGGLGIGIDRLIMLITNSASIRDVIPFPLLK 495
>gi|15231261|ref|NP_187958.1| OVA5 (OVULE ABORTION 5); ATP binding / aminoacyl-tRNA ligase [Arabidopsis thaliana] >gi|9280301|dbj|BAB01756.1| lysyl-tRNA synthetase [Arabidopsis thaliana] >gi|26983796|gb|AAN86150.1| putative lysyl-tRNA synthetase [Arabidopsis thaliana] (602 aa)
Score = 991, Expect = 2.8e-105, Identities = 219/480 (45%), Positives = 314/480 (65%)
  Q:     7 DQELIRREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN----IKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN------------QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE--------------------MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           D+E IR  +LK ++E      +PY   K  ++ +       +  L     ++N    + +AGRVVA R+ FG      +RD  G  Q Y  K+++S    E   + +D+GDI+   GS  RT+KGEL++ V    I++K+L PLP+K+HGL D + R R RYVD+I N +   VF  R +I+  IR+ ++S  YLEVETPVL    GGA ARPF+TFHN+L R+ YLRIATEL LK+++VGGF+KVYEIGRIFRNEG+ + HNPEFT++E+Y AY +   MM + E +    + ++  K  +     EI L + +RR  M + +K+ TG++F E+  +            Q+  E   K  +   +  S+LGH++N  FE   E K +QPTFV  +PI++SPL+K    N G T+RFELFI  +E ANAF+EL DP+DQ  R E QV++ +    EAV                     +D DF+ ALEYG+PP +G+G+GIDR++ML T  +SIRDV+ FP +K
  S:    80 DREAIRSIRLKKVEELRGQGLEPYAY-KWEKSHSANQLQEIYKHLANGEESDNEIDCVSIAGRVVA-RRAFGKLAFLTLRDDSGTIQLYCEKERLSDDQFEQLKQFIDIGDILGASGSMKRTEKGELSICVNSFSILTKSLLPLPDKYHGLTDIDKRYRQRYVDMIANPEVADVFRRRAKIVSEIRKTVESFGYLEVETPVLQGAAGGAEARPFVTFHNSLGRDLYLRIATELHLKRMLVGGFEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDYHSMMDMAELIVTQCSMAVNGKLTIDYQGTEICLERPWRRETMHNLVKEITGINFSELGEDLGNAKDTVLLALQDVLEPKDKSGI---RACSSLGHLLNEIFEVVVEPKLVQPTFVLDYPIEISPLAKPHRGNAGLTERFELFICGREMANAFSELTDPVDQRTRLEEQVRQHNAKRAEAVRESPEPNAKKDDDDDESYEVTLDEDFLTALEYGMPPASGMGLGIDRLVMLLTNSASIRDVIAFPVLK 599
>gi|33864663|ref|NP_896222.1| lysyl-tRNA synthetase [Synechococcus sp. WH 8102] >gi|39932070|sp|Q7U9X5|SYK_SYNPX Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|33632186|emb|CAE06642.1| lysyl-tRNA synthetase [Synechococcus sp. WH 8102] (502 aa)
Score = 990, Expect = 3.1e-105, Identities = 201/475 (42%), Positives = 299/475 (62%)
  Q:    12 RREKLKNLQEANQDPYEI--EKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKV---LDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK + L +  Q PY +  E   R   + + ++     +       + +AGRV+  R      F  + D  G  Q +L K  +      +F ++   +D GD + + G+  RT +GEL++ V   ++++KAL+PLP+KWHGL D E R R RY+DLIV+ DS + F  R R++  IR+++D +++LE+ETPVL    GGA+ARPF T HN L+    LRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE +   V + +     +   + EI L+  +RR  M + +++ TG+DF    S + A        +   +   ++G ++N  FE+  E   IQPTFV  +P+++SPL++     PG  +RFELFI  +E+ANAF+EL DP+DQ +R EAQ   K+ G+ EA  +D DF+ ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP ++
  S:     8 RLEKCQALSDLGQGPYALNFEPTHRMAALHEAHADLPNGEEREVT--VSVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKAGLEAQQEGWFKQITGLVDGGDWLGVSGTLRRTDRGELSVKVSDWRMLTKALQPLPDKWHGLADVEKRYRQRYLDLIVSPDSRETFRRRARLVSGIRRWLDQRDFLEIETPVLQSEPGGADARPFETHHNALDLPLTLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAYSDYIGMMELTEQMVSAVCQEVCGSCQITYQDTEIDLSPPWRRATMHELVEEATGLDFNSFSSREAAAVAMTGKGLHAPELADSVGRLLNEAFEQAVETTLIQPTFVTDYPVEISPLARPHRSKPGLVERFELFIVGREHANAFSELTDPVDQRQRLEAQQARKAAGDLEAQGLDEDFVTALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLR 490
>gi|110644488|ref|YP_672218.1| lysyl-tRNA synthetase [Escherichia coli 536] >gi|191173390|ref|ZP_03034919.1| lysyl-tRNA synthetase LysU [Escherichia coli F11] >gi|110346080|gb|ABG72317.1| lysyl-tRNA synthetase, heat inducible [Escherichia coli 536] >gi|190906366|gb|EDV65976.1| lysyl-tRNA synthetase LysU [Escherichia coli F11] (505 aa)
Score = 990, Expect = 3.1e-105, Identities = 217/485 (44%), Positives = 317/485 (65%)
  Q:     5 FNDQELIRREKLKNL-QEANQDPYEIEKVSRTMTIGD-FNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L Q+    P +  +   +  + + F++K  + +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+  K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPLK 505
>gi|154174894|ref|YP_001407789.1| lysyl-tRNA synthetase [Campylobacter curvus 525.92] >gi|153793144|gb|EAT99544.2| lysyl-tRNA synthetase [Campylobacter curvus 525.92] (503 aa)
Score = 989, Expect = 4.0e-105, Identities = 220/484 (45%), Positives = 306/484 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN------IKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E+ R E  +NL++   +PY    + R M I  F  KFA +   NT +       + LAGR+  +R      F  I D  G+ Q Y + K +     +   K +++GDI+ + G  F T+ GE ++ V ++ + SKA+ PLPEK+HGL D E R R RY+DLI+N +    F  R  I+  IR+F++ + +LEVETP++HPI GGANA+PF+TFHN L  N YLRIA EL LK+LIVGGF+ VY++ R FRNEGMD THNPEFTS+E Y AY     +M LTE LF  +   L  P V++    ++  ++ F R++    + +  G+D   ++   +   LAK     FE +    LGH+    F+ + E K I PTF+  +PI +SPLS++  KNP   +RFELFI  +E AN F ELNDP+DQY RF AQ++ K+ G+DEA EMD D++ AL Y +PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     5 NQLEIQRLETAENLRKMGVNPYP-HFLRRDMDIAKFRLKFAHII--NTEDKKAEGQYVSLAGRIKLIRDAGKAIFANIEDENGNLQIYFSNKTLDSEWFKVVKKNIEVGDIIYVRGYAFVTRTGEFSMHVSELNLASKAISPLPEKFHGLVDIETRYRQRYLDLIMNPEVRSDFKKRSIIISTIRRFIEEKGFLEVETPMMHPIAGGANAKPFVTFHNALGVNRYLRIAPELYLKRLIVGGFEAVYDMNRNFRNEGMDLTHNPEFTSIEFYWAYHTYHDLMGLTEELFNVLIDKLDLPKVIEFDGMQVDFSKPFARLNYKKALVEVGGLDPQIIEDKDKI--LAKLKADGFEANAKLDLGHLQAELFDNYVEEKLIDPTFIIDYPISISPLSRRSDKNPEIAERFELFIAGRELANGFNELNDPVDQYNRFAAQIEAKNAGDDEAHEMDEDYVRALGYAMPPTAGEGIGIDRLVMLLTNKKSIRDVVLFPAMRPLK 495
>gi|118581419|ref|YP_902669.1| lysyl-tRNA synthetase [Pelobacter propionicus DSM 2379] >gi|118504129|gb|ABL00612.1| lysyl-tRNA synthetase [Pelobacter propionicus DSM 2379] (503 aa)
Score = 989, Expect = 4.4e-105, Identities = 220/480 (45%), Positives = 310/480 (64%)
  Q:    10 LIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGV-----IRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV--VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGH--IINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           L RR K+  L EA  +PY  +      +   F +   K +    ++   +AGR++A R++FG      I+D  G  Q Y+ K ++ +     F +  D+GDIV + G PFRT+  EL+L  KKI+++ K+L PLPEK+HGL D E R R RYVDLIVN +S ++F+ R RI+ +IR FM ++++LEVETP++  I GGA A+PFIT HN L+   +LRIA EL LK+L+VGG ++V+EI R FRNEG+   HNPEFT ME Y AY   E +M  TE LF +VA+ +   +  V  G  EI   + ++R+ + D I +   +D  ++     A   A+   +        +GH  ++   FEE  E K IQPTFV  +P +VSPLS+K+  NP    RFEL +  +E ANAF+ELNDP+DQ ERF +QV EK+ G++EA  MD D+I ALEYGLPPTAG G+GIDR++ML T+ +SIRDV+LFP ++ +K
  S:    19 LQRRRKVDTLWEAGINPYPNDFRPEHTSADVFAAYGDKEQVDAEHDIFVVAGRILA-RRSFGKAAFIKIQDRKGRLQLYIKKDEIGEQAFADF-ETFDIGDIVGVEGFPFRTKTNELSLHAKKIRLLVKSLHPLPEKFHGLTDVETRYRQRYVDLIVNPESREIFIKRSRIINLIRAFMTARDFLEVETPMMQRIPGGATAKPFITHHNALDMQLFLRIAPELYLKRLVVGGMERVFEINRNFRNEGISVRHNPEFTMMEFYQAYATYEDLMNFTEELFCHVAQEVLGTLDFVNQGR-EISFQRPWKRLTVRDAILEYGDIDAKKLDDRDLALIYARSIGLDLP---DDIGHGKLMMEIFEEVAEHKLIQPTFVTAYPTEVSPLSRKNDHNPDIVDRFELIVGGREIANAFSELNDPVDQKERFLSQVAEKAKGDEEAHYMDEDYIRALEYGLPPTAGEGIGIDRLVMLLTDSASIRDVILFPQLRKEK 501
>gi|163748443|ref|ZP_02155697.1| lysyl-tRNA synthetase [Shewanella benthica KT99] >gi|161332021|gb|EDQ02698.1| lysyl-tRNA synthetase [Shewanella benthica KT99] (502 aa)
Score = 988, Expect = 5.9e-105, Identities = 214/475 (45%), Positives = 309/475 (65%)
  Q:    12 RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQ-----ET--GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL +++    AN  P   ++  +   I     ++ K+          +AGR++A R  F VI+D  G  Q Y +K  V K + E F   LD+GDI+ + G    + KG+L +++++ ++++KAL+PLPEK+HGL D+E R R RYVDLIVN++S   F+ R +++  IR FM  + ++EVETP++H I GGA ARPFIT HN L+   YLR+A EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE +   +A  L   P +  GE+ +     + R+ M+D IK+     ET   + + EVK  +  ++LAK   +  EK   T G ++   F E  E + IQPTF+ G+P+D+SPL++++ +N   T RFE FI  +E AN F+ELND  DQ +RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP M+
  S:    15 RRAKLDHIRANCPANGHPNNFDRKHKAADIQAEYGQYTKVDLEGMAIQCSIAGRIMAKRGPFLVIQDVSGRIQAYASKD-VQKDLKEKFLG-LDIGDIIGVTGQLHLSGKGDLYVNMEEYQLLTKALRPLPEKFHGLTDQETRYRQRYVDLIVNEESRNAFIMRSKVVAAIRNFMIKKEFMEVETPMMHTIPGGATARPFITHHNALDIEMYLRVAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEMLSSIATELCGSPKLPYGEHTVDFGGPYVRLSMLDAIKKYNPDNETIQSMTYEEVKDVEFMRDLAKSIGMTIEKFW-TCGQLLEEIFGETAEPQLIQPTFITGYPVDISPLARRNDENHFITDRFEFFIGGREVANGFSELNDAEDQDQRFKAQVAAKDAGDDEAMFYDADYIRALEHGLPPTAGQGIGIDRLVMLFTNTHTIRDVILFPAMR 497
>gi|150006819|ref|YP_001301562.1| lysyl-tRNA synthetase [Parabacteroides distasonis ATCC 8503] >gi|166229813|sp|A6L8C6|SYK_PARD8 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|149935243|gb|ABR41940.1| lysyl-tRNA synthetase [Parabacteroides distasonis ATCC 8503] (576 aa)
Score = 988, Expect = 6.1e-105, Identities = 208/486 (42%), Positives = 317/486 (65%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV-----SKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPE-------KWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENE-IYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  ++ L++   +PY   +        +    F   K       + +AGR+++ R     +F  ++D  G  Q Y+++  +       +    F K+LD+GD V I G  FRTQ GE+++  +++ ++SK+L+PLP         + G  D ELR R RYVDL+VN+    +F+ R  I+K +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L+ + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD THNPEFT ME+Y  Y++  +MM  TE L + +  ++        + + I     FRR+ +++ IK++TG D  E K+  E + + K+  ++ +      G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL +N KE ANA++ELNDPIDQ ERF+ Q++    G+DEA+ +D DF+ AL++G+PPT+G+G+GIDR++ML T +++I++VLLFP M+ +K
  S:     5 ELSEQEIIRRNSMEQLRQMGIEPYPAAEYVTNAFSKEIKETF---KDDAEPRPVSIAGRIMSRRIMGKASFMELQDSEGRIQVYISRDDICPDENKDTYNVVFKKLLDIGDFVGIKGFVFRTQMGEISVHAQELTVLSKSLRPLPVVKYKDGVAYDGFNDPELRYRQRYVDLVVNEGVKDIFMKRAAIIKTMRTALDEAGYTEVETPILQSIAGGASARPFITHHNSLDIDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMELYVQYKDYNWMMSFTEKLLERICIAVNGTSESTIDGKTISFKAPFRRLPILEAIKEKTGYDL-EGKTEDEIRAICKELKMEIDDTMGK-GKLIDEIFGEFCEGTFIQPTFIIDYPVEMSPLTKMHRSKPGLTERFELMVNGKELANAYSELNDPIDQEERFKEQLRLSEKGDDEAMFIDQDFLRALQFGMPPTSGIGIGIDRLVMLMTGQTTIQEVLLFPQMRPEK 502
>gi|119505212|ref|ZP_01627287.1| Protein-L-isoaspartate(D-aspartate) O-methyltransferase [marine gamma proteobacterium HTCC2080] >gi|119458903|gb|EAW40003.1| Protein-L-isoaspartate(D-aspartate) O-methyltransferase [marine gamma proteobacterium HTCC2080] (503 aa)
Score = 987, Expect = 6.9e-105, Identities = 212/475 (44%), Positives = 302/475 (63%)
  Q:    12 RREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL +L+EA   P+  +  + +    +       +K      +    +AGR++  R  F +I+D     Q Y+N+K +  + LE   K  DLGDIV   G   R+ KG+L ++++  ++++KAL+PLP+K+HGL D+E+R R RYVDLIVN DS  VF  R   +  IR+F+D + ++EVETP+LHPI GGA A+PF T HN L+   YLRIA EL LK+L VGGF+KVYEI R FRNEG+ + HNPEFT +E Y AY +    M LTE L + + ++L   + V  GE ++  +Q F R+ ++D I K    +   ++ S + A  +A +  ++  K    LG I    FE   E +  QPTF+  +P +VSPL++++  NP  T RFE F+  +E AN F+ELNDP DQ ERF AQ  EK  G++EA+  D D++ ALEYG+PPTAG G+GIDR++ML T+ +SIRDVLLFPHM+
  S:    24 RRSKLASLREAGVQPFPNDFRRTAEAEALQQDFEAISKEDLEEKHEVFAVAGRLIRNRGAFLLIQDGTSTIQLYINRKVLDATTLEAI-KTWDLGDIVAASGPINRSGKGDLYINMESARLLTKALRPLPDKYHGLSDQEMRYRQRYVDLIVNPDSRAVFRMRSAAVSFIRRFLDDRGFMEVETPMLHPIPGGAAAKPFETHHNALDMPMYLRIAPELYLKRLTVGGFEKVYEINRNFRNEGLSTRHNPEFTMLEFYWAYADYNDAMDLTEALLRELTQNLLGTMTVPYGELQLDFSQPFARLSVLDAIYKYNPDITPEQIASREAAAAVAHELGIEV-KPSWGLGKIQIEIFEATAEHRLEQPTFITAYPTEVSPLARRNDDNPFITDRFEFFVGGREIANGFSELNDPEDQAERFRAQAAEKDSGDEEAMHFDHDYVRALEYGMPPTAGEGIGIDRLVMLLTDAASIRDVLLFPHMR 500
>gi|167764830|ref|ZP_02436951.1| hypothetical protein BACSTE_03221 [Bacteroides stercoris ATCC 43183] >gi|167697499|gb|EDS14078.1| hypothetical protein BACSTE_03221 [Bacteroides stercoris ATCC 43183] (574 aa)
Score = 987, Expect = 7.1e-105, Identities = 209/486 (43%), Positives = 313/486 (64%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  +  L+    +PY   +        D   +F   K      ++ +AGR+++ R     +F  ++D  G  Q Y+ +  +     K M    F ++LDLGD + I G  FRTQ GE+++  +K+ +++K++KPLP         +   +D ELR R RYVDLIVN    + F+ R  I+K +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L+ + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD  HNPEFT ME+Y  Y++  +MM  TE L + +  ++       +    I     +RR+ ++D IK++TG D    KS +E +++ ++  ++ +      G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL +N KE ANA++ELNDPIDQ ERF+ Q+K    G+DEA+ +D DF++AL+YG+PPT+G+G+GIDR+ ML T ++ I++VL FP M+ +K
  S:     5 ELSEQEIIRRNSMNELRAMGIEPYPAAEYVTNAFSTDIKKEF---KDDAEPRHVSVAGRIMSRRVMGKASFIELQDSKGRIQVYITRDDICPGEDKEMYNTVFKRLLDLGDFIGIEGFVFRTQMGEISIHAQKLTVLAKSIKPLPIVKYKDGVAYDSFDDPELRYRQRYVDLIVNDGVKETFLKRATIIKTMRAVLDEAGYTEVETPILQSIPGGASARPFITHHNSLDMDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDKNHNPEFTCMELYVQYKDYNWMMGFTEKLLERICIAVNGSTETTIDGKTISFKAPYRRLPILDAIKEKTGYDL-NGKSEEEIRQVCRELKMEIDDTMGK-GKLIDEIFGEFCEGTFIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKELANAYSELNDPIDQEERFKEQLKLSEKGDDEAMFIDQDFLKALQYGMPPTSGIGIGIDRLTMLMTGQAFIQEVLFFPQMRPEK 502
>gi|86134315|ref|ZP_01052897.1| lysyl-tRNA synthetase [Tenacibaculum sp. MED152] >gi|85821178|gb|EAQ42325.1| lysyl-tRNA synthetase [Polaribacter dokdonensis MED152] (565 aa)
Score = 987, Expect = 7.2e-105, Identities = 216/486 (44%), Positives = 311/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE-MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE++RREKL  L+E   +PY  +         +  S FA+      +  + +AGR+++ R     +F  ++D  G  Q Y N+ ++     K++  + + K+LD+GD + I G+ F T+ GE T+ VK  K++SKALKPLP          +    D E+R R RY DL+VN +  +VF+ R ++   +R F +   Y EVETPVL PI GGA ARPFIT HN+L+   Y+RIA EL LK++IVGGFD VYE  + FRNEGMD THNPEFT+ME+Y +Y++  +MM   E L ++ A ++        GE+ I     + R+ M D IK  TG D    K+  E +E AK  N++ ++     G +I+  F E CE   IQPTF+  +P ++SPL K+   NP  T+RFEL +  KE ANA++ELNDPIDQ ERFE Q+K  + G+DEA E +D DF+ ALEYG+PPT+G+G+G+DR+IM  T   SI++VL FP M+ +K
  S:     2 QLSEQEVVRREKLAKLREMGINPYPADLFPIDSNSKEIKSDFAE------DKKVVIAGRLMSRRIQGKASFAELQDGEGRIQVYFNRDEICTGEDKTLYNDVYKKLLDIGDFIGIEGTLFTTKVGEKTVMVKDFKLLSKALKPLPLPKVDAEGNTYDAFNDPEMRYRQRYADLVVNPNVKEVFIKRTKLFNAMRSFFNDAGYFEVETPVLQPIPGGAAARPFITHHNSLDIPLYMRIANELYLKRIIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVSYKDYNWMMDFCEQLLEHCAIAVNGTSKATFGEHNIDFKAPYARVTMADSIKHFTGFDI-TGKTEDEIREAAKGMNIEVDETMGK-GKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKEHRDNPELTERFELMVCGKEIANAYSELNDPIDQRERFEHQLKLAAKGDDEATEFIDHDFLRALEYGMPPTSGMGIGMDRLIMFLTNNQSIQEVLFFPQMRPEK 498
>gi|123969360|ref|YP_001010218.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. AS9601] >gi|123199470|gb|ABM71111.1| Lysyl-tRNA synthetase [Prochlorococcus marinus str. AS9601] (488 aa)
Score = 986, Expect = 1.0e-104, Identities = 210/456 (46%), Positives = 305/456 (66%)
  Q:    31 KVSRTMTIGDFNSKFAKLKTHNTNN-NIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSM-------LEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFK-YVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           KVS T +      KF  L+     + ++ +AGRV+A R      F  I D  G  Q YL+K+ ++ ++        E   +++D+GD + ++G+  +T KGEL++ V+K +++SK+L+PLP+KWHGL D E R R RY+DLIVN  S  VF  R + +  IR+++D++N+LE+ETP+L    GGA ARPFIT HNTL+   YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE L K  VA +    ++     EI  ++ + RI M   +K+ TG+DF     +   A++  K  NV      +T+G ++N  FE+  E+K ++PTFV  +P+++SPL++  + N    +RFELFI  +E ANAF+EL DP+DQ ER + Q   +  G+ EA  +D DF+ ALE G+PPT GLG+GIDR+IML T  +SIRDV+ FP +K
  S:    13 KVSHTTSF--LIQKFDHLENGQEEDFSVSIAGRVLAKRVMGKIAFFTISDQEGQIQLYLDKRIINFNLEKQKLLSFEDLKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLQPLPDKWHGLTDIEKRYRQRYLDLIVNPHSKNVFKTRAKCISFIRKWLDNRNFLEIETPILQSEAGGAEARPFITHHNTLDIPLYLRIATELHLKRMVVGGFEKVYELGRIFRNEGISTRHNPEFTSVEIYEAYSDYVDMMNLTEELIKDIVADACGSLIINYQNKEIDFSKPWSRISMKAIVKKYTGIDFDSFSGDFLAAKQAVKNINVDCSNKVNTMGRLLNEVFEQKVESKLVEPTFVIDYPVEISPLARPHHDNKQIVQRFELFIVGRELANAFSELIDPVDQRERMQLQQSLRDEGDLEAHCIDEDFLNALEIGMPPTGGLGIGIDRLIMLITNSASIRDVIPFPLLK 480
>gi|149910166|ref|ZP_01898812.1| lysyl-tRNA synthetase [Moritella sp. PE36] >gi|149806752|gb|EDM66716.1| lysyl-tRNA synthetase [Moritella sp. PE36] (502 aa)
Score = 986, Expect = 1.0e-104, Identities = 219/475 (46%), Positives = 311/475 (65%)
  Q:    12 RREKLKNLQ---EANQDPYEIEKVSRTMTI-GDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNK--KKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQE------LAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL +++   +AN  P +     ++  +  +F  K +K +     + + +AGR++A R  F  I+D  G  Q Y +K  +K  K+ L      LD+GDIV I G+  ++ KG+L +++    +++KAL+PLPEK+HGL D+E+R R RYVDLIVN++S   F+ R +++  IR FM S++Y+EVETP++H I GGA ARPFIT HN L++  YLR+A EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY +   +M  TE +   VA + L    +  G++ +    K+ RI M+D IKQ     +  +  +N+  Q+      +AK  N+K EK   T G ++   F E  E + IQPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR+ MLFT   +IRDV+LFP M+
  S:    15 RRAKLDHIRTNCKANGHPNDFRVKHKSADLQAEFGEK-SKEELVEMQHLVSIAGRIMAKRGPFLAIQDTAGRIQAYASKDVQKAQKADL----GGLDIGDIVGITGALNKSGKGDLYVEMTDYVLLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEESRNAFIVRSKLVTAIRNFMVSKDYMEVETPMMHVIPGGATARPFITHHNALDQAMYLRVAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYQAYADYNDLMDFTEEMLSTVAVEVLGATAMPYGDHMVEFGGKYTRISMLDAIKQYNPEHEVIQALTNEGVQDRELMVSIAKSLNMKIEKFW-TCGQLLEEIFGETAEPQLIQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVNAKDAGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLAMLFTNTHTIRDVILFPAMR 497
>gi|84393963|ref|ZP_00992703.1| lysyl-tRNA synthetase [Vibrio splendidus 12B01] >gi|84375407|gb|EAP92314.1| lysyl-tRNA synthetase [Vibrio splendidus 12B01] (510 aa)
Score = 985, Expect = 1.1e-104, Identities = 215/475 (45%), Positives = 308/475 (64%)
  Q:    12 RREKLKNLQ---EANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL +++   +AN  P +     R    GD  ++F +         N+ + +AGRV+A R  F  I++  G  Q Y   K V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS   F+ R +++  IR FM S+ YLEVETP++H I GGA ARPFIT HN L+ + YLR+A EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE +    A   L    +  G+  +     + R+ M D IK  T        +   ++++ +   ++A++  +  EK   T G ++   F E  E + IQPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR+ MLFT   +IRDV+LFP M+
  S:    25 RRSKLDHIRLNCKANGHPNDFR---REHLAGDLQAEFGEKTKEELEELNHIVAIAGRVMAKRGPFLAIQETSGRIQAYA-AKDVQKVLKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEFELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRNTFIVRSKLVSSIRNFMSSKGYLEVETPMMHVIPGGATARPFITHHNALDIDMYLRVAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYQAYSDYKDLMDLTEEMLSTAAMDVLGSTSMPYGDETVEFGGTYARMSMFDAIKHYTPENANIQALTEDDLQNRELMVKIAEEVGLYVEKFW-TCGQLLEEIFGETAEPQLIQPTFITGYPADISPLARRSDSNPFFTDRFEFFIGGREVANGFSELNDAQDQDERFKAQVNAKDAGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLAMLFTNTHTIRDVILFPAMR 507
>gi|34541056|ref|NP_905535.1| lysyl-tRNA synthetase [Porphyromonas gingivalis W83] >gi|39932028|sp|Q7MUV7|SYK_PORGI Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|34397371|gb|AAQ66434.1| lysyl-tRNA synthetase [Porphyromonas gingivalis W83] (578 aa)
Score = 985, Expect = 1.1e-104, Identities = 213/486 (43%), Positives = 307/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSM-LEYFNKVL----DLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFW---EVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE++RR  L+ L+    DPY   + +      +    F     +     + +AGR+++ R     TF  ++D  G  Q Y+ +  +      E++N V+    D+GD + + G  FRTQ GE+++ V+++  +SKA++PLP       E + G  D E R R RYVDL+VN     +F+ R  +   +R F +   Y+EV+TPVL  I GGA ARPFIT HN L+   YLRIA EL LK+LIVGGFD VYE  R FRNEGMD THNPEFT+ME+Y AY++  +MM  TE + + +    L    +K+G   I     ++R+ M++ I + TG+D     E +  Q   +L  +HN    K     G +I+  F E CE   IQPTF+  +P ++SPL+K+   NP  T+RFEL +N KE ANA++ELNDPIDQ ERFE Q+K    G+DEA+ +D DFI ALEYG+PPT+G+G+G+DR++ML T + SI++VLLFP MK +K
  S:     5 ELSEQEVVRRNSLEQLRNLGIDPYPAAEYTVNAYSAEIKRNFNG-DENVAKRQVSIAGRIMSRRIMGKATFMELQDAEGRIQIYITRDDICPGEDKEFYNTVVKKCTDIGDFIGVKGYVFRTQMGEISVHVQEMTFLSKAIRPLPVVKEKDGEVFDGFTDPEQRYRQRYVDLVVNSHVKDIFLKRTMVFNSMRSFFNECGYIEVDTPVLQSIPGGAAARPFITHHNALDIPLYLRIANELYLKRLIVGGFDGVYEFSRNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMNFTEQMLERICMDVLGTTQMKVGGKLIDFKAPYKRVTMIEAIHEHTGIDISGMNEAELRQVCDKLGVEHNETMGK-----GKLIDEIFGEKCEKNYIQPTFITDYPKEMSPLTKEHRTNPELTERFELMVNGKELANAYSELNDPIDQRERFEEQLKLSEKGDDEAMYIDNDFIRALEYGMPPTSGMGIGMDRLVMLLTGQESIQEVLLFPQMKPEK 504
>gi|31340515|sp|Q9KU60|SYK_VIBCH Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) (510 aa)
Score = 985, Expect = 1.2e-104, Identities = 214/478 (44%), Positives = 312/478 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           RR KL ++++  +         R    GD   KF   +K +    N+ + +AGRV+A R  F VI++  G  Q Y +K+ V + + + +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN++S   F+ R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE L   VA + L    +  GE+ +    K+ R+ M D IK       Q   +   ++++      +AK  +V  E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+ ++
  S:    25 RRSKLDHIRKNCKANGHPNSFRRDSLAGDLQKKFGEKSKEELEALNHVVSIAGRVMAKRGPFLVIQETSGRIQAYASKE-VQQELKDKYQG-LDIGDIIGVQGALHKSGKGDLYVNMEQFQLLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNENSRNAFIVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEELLSSVALEVLGSTSMPYGEHTVEFGGKYARMSMFDAIKHYNPNHAQIQALTEEDIQNRDLMVSIAKSVHVDVEPFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMRPQQ 510
>gi|58582495|ref|YP_201511.1| lysyl-tRNA synthetase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427089|gb|AAW76126.1| lysyl-tRNA synthetase heat inducible [Xanthomonas oryzae pv. oryzae KACC10331] (528 aa)
Score = 985, Expect = 1.2e-104, Identities = 200/448 (44%), Positives = 291/448 (64%)
  Q:    39 GDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVK-SNQEAQELAKKHNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           GD  ++FA   T        +   +K+AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A+S L    V     +I L   FRR  M + ++        E+  ++   ++   +H  + +   K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+PPT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    69 GDLQAEFADADTWTPDALEASGRTVKMAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKASALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAMRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQVIRDTAQSVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP----EISAADCTDRDALLRHCERLKIRVKPSYGWGKLLLEIFEATVEHTLVQPTFITDHPVEVSPLARSSDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHFDADYIRALEYGMPPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 525
>gi|116074402|ref|ZP_01471664.1| lysyl-tRNA synthetase [Synechococcus sp. RS9916] >gi|116069707|gb|EAU75459.1| lysyl-tRNA synthetase [Synechococcus sp. RS9916] (497 aa)
Score = 985, Expect = 1.2e-104, Identities = 201/475 (42%), Positives = 300/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEI--EKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKV---LDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK + LQ+  Q PY +  E   R   + + ++     +  +    + +AGRV+  R      F  + D  G  Q +L K  +      +F ++   +D GD + + G+  RT +GEL++ V   +++SK+L+PLP+KWHGL D E R R RY+DL+V+ D+ + F  R R++  IR+++D +++LE+ETPVL    GGA+ARPF T HN L+    LRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFTS+E+Y AY +   MM LTE +   V + +     +     E+ LT  +RR  M + ++  TG+DF    S  EA        +   +   ++G ++N  FE+  E+  IQPTFV  +P+++SPL++     PG  +RFELFI  +E+ANAF+EL DP+DQ +R EAQ   K+ G+ EA  +D DF+ ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP ++
  S:     8 RLEKAQALQDLGQGPYALGFEPSHRMAALQEAHADLPNGEERDVP--VAVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKAGLEAQQEGWFKQITSLVDSGDWLGVSGTLRRTDRGELSVKVSDWRMLSKSLQPLPDKWHGLADVEKRYRQRYLDLVVSPDTRETFRRRARLVSGIRRWLDERDFLEIETPVLQSEPGGADARPFETHHNALDLPLTLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAYSDYIGMMELTEQMVAAVCQEVCGSTKITYQGTEVDLTPPWRRATMHELVEDATGLDFNGFSSRDEAAAAMTAKGLHVPELADSVGRLLNEAFEQAVESTLIQPTFVTDYPVEISPLARPHRSKPGLVERFELFIVGREHANAFSELIDPVDQRQRLEAQQARKAAGDLEAQGLDEDFVNALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLR 490
>gi|191165676|ref|ZP_03027516.1| lysyl-tRNA synthetase LysU [Escherichia coli B7A] >gi|190904371|gb|EDV64080.1| lysyl-tRNA synthetase LysU [Escherichia coli B7A] (505 aa)
Score = 985, Expect = 1.2e-104, Identities = 216/485 (44%), Positives = 318/485 (65%)
  Q:     5 FNDQELIRREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           FND+   RREKL  L++   A  + +  +  S  +   +F++K  + +  + N  + +AGR++  R     +F  ++D     Q Y+ +  + + +     K  DLGDI+   G+ F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N  S + FV R +IL  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE+LF+ +A+  L    V  GE+     + F ++ M + IK+     D  ++ +   A+ LA+   +  EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRMIMLFT   +IRDV+LFP M+ +K
  S:    15 FNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLH-EEFDAKDNQ-ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGDRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 505
>gi|86147406|ref|ZP_01065719.1| lysyl-tRNA synthetase [Vibrio sp. MED222] >gi|85834834|gb|EAQ52979.1| lysyl-tRNA synthetase [Vibrio sp. MED222] (510 aa)
Score = 985, Expect = 1.3e-104, Identities = 214/475 (45%), Positives = 308/475 (64%)
  Q:    12 RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL ++++   AN  P +     R    GD  ++F +         N+ + +AGR++A R  F  I++  G  Q Y   K V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS   F+ R +++  IR FM S+ YLEVETP++H I GGA ARPFIT HN L+ + YLR+A EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE +    A   L    +  G+  +     + R+ M D IK  T        +   ++++ +   ++A++  +  EK   T G ++   F E  E + IQPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR+ MLFT   +IRDV+LFP M+
  S:    25 RRSKLDHIRQNCKANGHPNDFR---REHLAGDLQAEFGEKTKEELEELNHIVAIAGRIMAKRGPFLAIQETSGRIQAYA-AKDVQKVLKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEFELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRNTFIVRSKLVSSIRNFMSSKGYLEVETPMMHVIPGGATARPFITHHNALDIDMYLRVAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYQAYSDYKDLMDLTEEMLSTAAMDVLGSTSMPYGDETVEFGGTYARMSMFDAIKHYTPENANIQALTEDDLQNRELMVKIAEEVGLYVEKFW-TCGQLLEEIFGETAEPQLIQPTFITGYPADISPLARRSDSNPFFTDRFEFFIGGREVANGFSELNDAQDQDERFKAQVNAKDAGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLAMLFTNTHTIRDVILFPAMR 507
>gi|189423826|ref|YP_001951003.1| lysyl-tRNA synthetase [Geobacter lovleyi SZ] >gi|189420085|gb|ACD94483.1| lysyl-tRNA synthetase [Geobacter lovleyi SZ] (492 aa)
Score = 985, Expect = 1.4e-104, Identities = 214/479 (44%), Positives = 305/479 (63%)
  Q:    10 LIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGEN-EIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           L RR K+ +L  A  +PY  +   +  ++    +  +  +    +    LAGR++A R++FG      ++D  G  Q Y+ K  + + +   F    D+GDI+ I G PFRT+ GEL++  + I+++ K+L PLPEK+HGL D E R R RYVDLIVN +  ++F+ R RI+ +IR FM S+++LEVETP++H I GGA ARPF+T HN L+   YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY   E +M  TE LF +VA+ +   +    +   I   + +RR+ + + I +   +D  ++     A   A+   +      S  G ++   FEE  E K IQPTFV  +P +VSPLS+K+  +P    RFEL I  +E ANAF+ELNDP+DQ ERF AQV EK  G++EA  MD D++ ALEYGLPPTAG G+GIDR++ML T+ +SIRDV+LFP ++ +
  S:     9 LQRRRKVNDLWAAGINPYPNDFKPQHTSVDVVAAYGSVEQIDAPDVEFVLAGRIIA-RRSFGKAAFMQLQDRKGRIQVYVRKDDLGEEVFAQFES-FDIGDIIGIVGFPFRTKTGELSVHARSIRLLVKSLLPLPEKFHGLTDVETRYRQRYVDLIVNPEVRELFIKRSRIVNLIRSFMTSRDFLEVETPMMHQIPGGATARPFVTHHNALDMELYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMEFYQAYATFEDLMDFTEELFCHVAEQVLGTLGFSYQGLAISFQRPWRRLTVKEAILEYGDIDAKKLDDRDLALAYARSIGLDLPDDIS-YGKLVMEIFEEVAEHKLIQPTFVTAYPTEVSPLSRKNDLDPYIVDRFELMIGGREIANAFSELNDPVDQKERFLAQVAEKDKGDEEAHYMDEDYVRALEYGLPPTAGEGIGIDRLVMLLTDSASIRDVILFPQLRKE 490
>gi|189463939|ref|ZP_03012724.1| hypothetical protein BACINT_00273 [Bacteroides intestinalis DSM 17393] >gi|189438512|gb|EDV07497.1| hypothetical protein BACINT_00273 [Bacteroides intestinalis DSM 17393] (580 aa)
Score = 984, Expect = 1.5e-104, Identities = 210/486 (43%), Positives = 309/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR  +  L+    DPY   +        D  ++F   K       + +AGR++  R     +F  ++D  G  Q Y+ +  +     K +    F ++LDLGD + I G  FRTQ GE+++  +K+ +++K++KPLP         +   ED ELR R RYVDLIVN      F+ R  ++K +R  +D   Y EVETP+L  I GGA+ARPFIT HN+L  + YLRIATEL LK+LIVGGF+ VYEIG+ FRNEGMD  HNPEFT ME+Y  Y++  +MM  TE L + +  ++       +    I     +RR+ ++D IK++TG D    KS +E +++ K+  ++ +      G +I+  F EFCE   IQPTF+  +P+++SPL+K     PG T+RFEL +N KE ANA++ELNDPIDQ ERF+ Q++    G+DEA+ +D DF+ AL++G+PPT+G+G+GIDR+ ML T KS I++VL FP M+ +K
  S:     9 ELSEQEIIRRNSMNELRAMGIDPYPAAEYVTNAFSTDIKAEF---KDDAEPRKVSVAGRMMTRRVMGKASFVELQDSKGRIQVYITRDDICPGEDKELYNTVFKRLLDLGDFIGIEGFVFRTQMGEISIHAQKLTVLAKSIKPLPIVKYKDGVAYDSFEDPELRYRQRYVDLIVNDGVKDTFLKRATVIKTMRAVLDEAGYTEVETPILQSIAGGASARPFITHHNSLNIDLYLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDKNHNPEFTCMELYVQYKDYNWMMSFTEKLLERICIAVNGSEETTIDGKTISFKAPYRRLPILDAIKEKTGYDL-NGKSEEEIRQICKELKMEIDDTMGK-GKLIDEIFGEFCEGTFIQPTFITDYPVEMSPLTKMHRSKPGLTERFELMVNGKELANAYSELNDPIDQEERFKDQLRLSEKGDDEAMFIDQDFLRALQFGMPPTSGIGIGIDRLTMLMTGKSYIQEVLFFPQMRPEK 506
>gi|84624383|ref|YP_451755.1| lysyl-tRNA synthetase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|123752737|sp|Q2P1U6|SYK_XANOM Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|84368323|dbj|BAE69481.1| lysyl-tRNA synthetase heat inducible [Xanthomonas oryzae pv. oryzae MAFF 311018] (505 aa)
Score = 984, Expect = 1.5e-104, Identities = 200/448 (44%), Positives = 291/448 (64%)
  Q:    39 GDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVK-SNQEAQELAKKHNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           GD  ++FA   T        +   +K+AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A+S L    V     +I L   FRR  M + ++        E+  ++   ++   +H  + +   K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+PPT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    46 GDLQAEFADADTWTPDALEASGRTVKMAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKASALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAMRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQVIRDTAQSVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP----EISAADCTDRDALLRHCERLKIRVKPSYGWGKLLLEIFEATVEHTLVQPTFITDHPVEVSPLARSSDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHFDADYIRALEYGMPPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 502
>gi|88803560|ref|ZP_01119085.1| lysyl-tRNA synthetase [Polaribacter irgensii 23-P] >gi|88780572|gb|EAR11752.1| lysyl-tRNA synthetase [Polaribacter irgensii 23-P] (564 aa)
Score = 984, Expect = 1.6e-104, Identities = 220/486 (45%), Positives = 310/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVAL----RQTFGVIRDFYGDTQFYLNKKKV----SKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPE-------KWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE-MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE++RR KL  L++   +PY  +     +   D NSK  K ++      + +AGR++A+    + +F  ++D  G  Q Y N+ ++     KS+  E F K+LDLGD + I G+ F TQ GE T+ VK+ K++SKALKPLP         +    D E+R R RY DL+VN    +VF+ R ++   +R F +   Y EVETPVL PI GGA ARPFIT HN+L+   Y+RIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y +Y++  +MM   E L ++ A ++        GE++I     + RI M D IK  TG D    K+  E +  A+  +++        G +I+  F E CE   IQPTF+  +P ++SPL K+   NP  T+RFEL +  KE ANA++ELNDPIDQ ERFE Q+K    G+DEA E +D DF+ ALEYG+PPT+G+G+G+DR+IM  T   SI++VL FP M+ +K
  S:     2 QLSEQEVVRRGKLSKLRDLGINPYPAD-----LFPVDANSKGIK-ESFAEGKQVTIAGRLMAINIQGKASFAQLQDGEGRIQVYFNRDEICLGEDKSLYNEVFKKLLDLGDFLGITGTLFTTQVGEKTVMVKEFKLLSKALKPLPMPKIKDGVTFDAFTDPEMRYRQRYADLVVNPHVKEVFIKRTKLFNAMRSFFNDAGYFEVETPVLQPIPGGAAARPFITHHNSLDIPLYMRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVSYKDYNWMMDFAEQLLEHCAIAVNGTSEATFGEHKIDFKAPYARITMADSIKHFTGFDI-TGKTEDEIRAAAQSMHIEVNATMGK-GKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKEHRDNPELTERFELMVCGKEIANAYSELNDPIDQRERFEQQLKLAQKGDDEATEFIDEDFLRALEYGMPPTSGMGIGMDRLIMFLTNNQSIQEVLFFPQMRPEK 497
>gi|15640683|ref|NP_230313.1| lysyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587863|ref|ZP_01677620.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae 2740-80] >gi|121728407|ref|ZP_01681435.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae V52] >gi|147674731|ref|YP_001216158.1| lysyl-tRNA synthetase [Vibrio cholerae O395] >gi|153216961|ref|ZP_01950725.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae 1587] >gi|153223101|ref|ZP_01953656.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MAK 757] >gi|153801992|ref|ZP_01956578.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MZO-3] >gi|153818684|ref|ZP_01971351.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae NCTC 8457] >gi|153826526|ref|ZP_01979193.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MZO-2] >gi|153829165|ref|ZP_01981832.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae 623-39] >gi|194532637|ref|YP_002068061.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MO10] >gi|194535070|ref|YP_002070258.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae RC385] >gi|9655101|gb|AAF93829.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547899|gb|EAX57983.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae 2740-80] >gi|121629341|gb|EAX61773.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae V52] >gi|124114026|gb|EAY32846.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae 1587] >gi|124118437|gb|EAY37180.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MAK 757] >gi|124122451|gb|EAY41194.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MZO-3] >gi|125618689|gb|EAZ47224.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MO10] >gi|125620932|gb|EAZ49283.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae V51] >gi|126510764|gb|EAZ73358.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae NCTC 8457] >gi|146316614|gb|ABQ21153.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae O395] >gi|148875354|gb|EDL73489.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae 623-39] >gi|149739706|gb|EDM53913.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae MZO-2] >gi|150419864|gb|EDN12176.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae RC385] >gi|150422189|gb|EDN14154.1| lysyl-tRNA synthetase, heat inducible [Vibrio cholerae AM-19226] (512 aa)
Score = 984, Expect = 1.6e-104, Identities = 214/478 (44%), Positives = 312/478 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           RR KL ++++  +         R    GD   KF   +K +    N+ + +AGRV+A R  F VI++  G  Q Y +K+ V + + + +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN++S   F+ R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE L   VA + L    +  GE+ +    K+ R+ M D IK       Q   +   ++++      +AK  +V  E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+ ++
  S:    27 RRSKLDHIRKNCKANGHPNSFRRDSLAGDLQKKFGEKSKEELEALNHVVSIAGRVMAKRGPFLVIQETSGRIQAYASKE-VQQELKDKYQG-LDIGDIIGVQGALHKSGKGDLYVNMEQFQLLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNENSRNAFIVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEELLSSVALEVLGSTSMPYGEHTVEFGGKYARMSMFDAIKHYNPNHAQIQALTEEDIQNRDLMVSIAKSVHVDVEPFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMRPQQ 512
>gi|148981823|ref|ZP_01816540.1| lysyl-tRNA synthetase [Vibrionales bacterium SWAT-3] >gi|145960731|gb|EDK26071.1| lysyl-tRNA synthetase [Vibrionales bacterium SWAT-3] (505 aa)
Score = 984, Expect = 1.8e-104, Identities = 212/475 (44%), Positives = 305/475 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL +++++ +         R    GD  ++F +         N+ + +AGRV+A R  F  I++  G  Q Y   K V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS   F+ R +++  IR FM S+ YLEVETP++H I GGA ARPFIT HN L+ + YLR+A EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE +    A   L    +  G+  +    K+ R+ M + IK           +   +++  ++   +AK  +V+ E    T G ++   F E  E + IQPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ ERF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR+ MLFT   +IRDV+LFP M+
  S:    20 RRAKLDHIRKSCKANGHPNDFRREHLAGDLQAEFGEKTKEELEELNHVVAIAGRVMAKRGPFLAIQETSGRIQAYA-AKDVQKVLKEQYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEFELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRNAFIVRSKLVSSIRNFMSSKGYLEVETPMMHVIPGGATARPFITHHNALDIDMYLRVAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYQAYSDYKDLMDLTEEMLSTAAMDVLGSTSMPYGDETVEFGGKYARMSMFEAIKHYNPEHAEIQALTEEDLQDREKMVAIAKSVHVEVETFW-TCGQLLEEIFGETAEPQLIQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDERFKAQVNAKDAGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLAMLFTNTHTIRDVILFPAMR 502
>gi|78223563|ref|YP_385310.1| lysyl-tRNA synthetase, class-2 [Geobacter metallireducens GS-15] >gi|78194818|gb|ABB32585.1| Lysyl-tRNA synthetase, class-2 [Geobacter metallireducens GS-15] (491 aa)
Score = 983, Expect = 2.0e-104, Identities = 212/480 (44%), Positives = 302/480 (62%)
  Q:    10 LIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGEN-EIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           L RR K+  L EA  +PY  +   R  T  D  + + K +      +   +AGR++A R++FG      ++D  G  Q Y+ K  +     E F    D+GDI+   G+PFRT+ GEL+L+  ++++++K+  PLPEK+HGL D E R R RYVDLIVN +  +VF+ R RI+ +IR+FM   ++LEVETP++ PI GGA ARPF+T HN L+   +LRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY   E +M  TE L  +V + +   +    +  EI   + ++R+ + + I +   +D   ++    A   A+   +         G +I   FEE  E K IQPTF+  +P +VSPLS+K  K+P    RFE F   +E ANAF+ELNDP+DQ ERF  QV +K+ G++EA  MD D+I ALEYG+PPTAG G+GIDR++ML T+  SIRDV+LFP ++ +K
  S:     9 LQRRRKVDALWEAGINPYPNDYKPR-HTSADVVAAYGKCEIIEEGADPFVVAGRIIA-RRSFGKAAFVQLQDRKGRIQLYVRKDTLGDEAYEAFES-FDIGDIIGATGTPFRTKTGELSLNASEVRLLTKSFLPLPEKFHGLTDVETRYRQRYVDLIVNPEVREVFIKRSRIVNLIREFMVRHDFLEVETPMMQPIPGGATARPFVTHHNALDMELFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMEFYQAYATFEDLMDFTEELLCHVTQEVLGTLDFTYQGVEISFQRPWKRLTVKEAILEYGDIDAKSLEDRDLAYAYARSIGLDLPT-DVGYGKLITEIFEEVAEVKLIQPTFITAYPTEVSPLSRKSDKDPDIVDRFEFFCAGREMANAFSELNDPVDQKERFLGQVAQKAKGDEEAHYMDEDYIRALEYGMPPTAGEGIGIDRLVMLLTDSPSIRDVILFPQLRKEK 491
>gi|118475508|ref|YP_892300.1| lysyl-tRNA synthetase [Campylobacter fetus subsp. fetus 82-40] >gi|118414734|gb|ABK83154.1| lysyl-tRNA synthetase [Campylobacter fetus subsp. fetus 82-40] (504 aa)
Score = 983, Expect = 2.0e-104, Identities = 218/484 (45%), Positives = 310/484 (64%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHN-----TNNNIKLAGRV----VALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N+ EL R  K   L+    +PY    + R M+I +F +KFA +K  N      +  + ++GR+    VA + TF  + D   + Q Y +   + +     F K L++GDIV + G  F T+ GE ++   KI + SKA+ PLPEK+HGL D E+R R RY+D+I++KD    FV R  I+  IR+F + + +LEVETP++HPI GGANA+PFIT HN L+ + YL+IA EL LK+LIVGG + V+E+ R FRNEGMD THNPEFTS+E Y A+ N    M LTE LF  +   L  P V++     I  ++ F R+  +D I +  G+   ++ +N++ + L+K    KFE +    LGH+    F+ + E K I PTF+   PI +SPLS++   +    +RFELFI  +E ANAF ELNDP+DQYERF++Q++ K+ G+DEA EMD D+ +AL YG+ PT G G+G+DR++ML   K SIRDV+LFP MK  K
  S:     5 NELELTRLAKADELRSLGVNPYP-HFLKRDMSISEFKTKFAYIKDLNGDEKKADEEVTISGRLKLKRVAGKSTFANMEDENDNIQIYYSLGSIGEEDYTKFKKNLEVGDIVLVTGYAFVTKTGEFSIHASKIVLASKAISPLPEKFHGLTDIEMRYRQRYLDMIMDKDVRADFVKRSLIISTIRRFFEDKGFLEVETPMMHPIAGGANAKPFITHHNALDVDRYLKIAPELYLKRLIVGGMEAVFEMNRCFRNEGMDLTHNPEFTSIEFYWAWHNYFEAMDLTEELFAVLLDRLNLPQVIEFDGKSIDFSKPFARVKYIDAIVEIGGIS-RDIVTNKD-KILSKLKADKFEANDKLDLGHLQAELFDNYVEDKLINPTFIVDFPISISPLSRRSDADKNVAERFELFIAGRELANAFNELNDPVDQYERFKSQIEAKNAGDDEAHEMDEDYCQALGYGMSPTVGWGLGVDRLVMLLLNKKSIRDVILFPAMKPLK 496
>gi|163766301|ref|ZP_02173327.1| lysyl-tRNA synthetase [Anaeromyxobacter sp. K] >gi|167455407|ref|ZP_02321629.1| lysyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-1] >gi|167418092|gb|EDR84791.1| lysyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-1] >gi|196171397|gb|ACG72370.1| lysyl-tRNA synthetase [Anaeromyxobacter sp. K] (513 aa)
Score = 983, Expect = 2.1e-104, Identities = 214/430 (49%), Positives = 282/430 (65%)
  Q:    59 LAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPI--LGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK-PVVKMGENEIYLTQKFRRIHMVDFIKQETGVD---------FWEVKSNQEAQELAKKHNVKFEKH-QSTLGHIINLFFEEFCEAKCIQ--PTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           LAGRV+A+R      F  +RD   + Q ++ K +V +   E F K+LD+GDIV   G   RT+ GELTL+ +   I++KA +PLPEKWHGL D E R R RYVDL+V     + FV R RI+  IR+F+D++ YLEVETP LH     GGA ARPF T HN L+ +  LRIATEL LK+L+VGG D+VYEIGRI+RNEG+D  HNPEFTS+E Y AY   E +MRLTE L   +A  +   PVV      I LT  F R+ M++   +  G+            E  S   A+E   +   K E+  + T G  + L FE F E +  +  P FV   P++ SPLS++   +P    RFELF    E ANAF+ELNDP DQ  RFEAQ++ K+ G++EA+  D DF+ ALE+G+PPTAG G+GIDR+ MLFT+ +SIRDV+LFP +K +
  S:    65 LAGRVLAVRSFGKAAFLRVRDRSAELQVWVKKDRVGEQAFEVF-KLLDIGDIVGAEGPATRTKTGELTLEARTFTILTKATRPLPEKWHGLTDVEQRYRQRYVDLVVTPGVREAFVKRARIVSGIRRFLDARGYLEVETPTLHKPEEAGGAAARPFETHHNALDLDLKLRIATELHLKRLVVGGLDRVYEIGRIWRNEGIDRRHNPEFTSIEFYQAYATHEDLMRLTEELMHRLAVEVTGGPVVTFQGQAIDLTPPFPRVSMLEVGARALGLSPDDALAGRGLAEALSRAAARENDSEDAWKLEQAAKKTPGEAVALAFEIFGEPQLPKDRPAFVVDFPLETSPLSRRRDADPRLVDRFELFAAGMELANAFSELNDPADQRARFEAQMRAKAAGDEEAMPYDEDFVRALEHGMPPTAGEGIGIDRLAMLFTDSASIRDVILFPLLKSR 512
>gi|74316911|ref|YP_314651.1| lysyl-tRNA synthetase, class-2 [Thiobacillus denitrificans ATCC 25259] >gi|74056406|gb|AAZ96846.1| lysyl-tRNA synthetase, class-2 [Thiobacillus denitrificans ATCC 25259] (501 aa)
Score = 982, Expect = 2.7e-104, Identities = 212/475 (44%), Positives = 298/475 (62%)
  Q:    12 RREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQ---ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++EA    P + E+      +   +   +K        +++LAGR++  R     +F  ++D  G  Q Y++         E F K  DLGD V + G+ F+T KGELT+  K ++++SKAL+PLPEK+HGL D+E + R RY+DLI N D+   FV R +I++ IR+FM    +LEVETP++HPI GGA A+PF+T HN L+   +LRIA EL LK+L+VGGF+KV+EI R FRNEG+ + HNPEFT ME Y AY    Y+M  TE L ++ A  +     +    + I L   F R+ +V+ +++   E  V+    +    AQ  A K   K+ +H   LG +   FFEE  EA  +QPTF+  +P +VSPL+++    P  T+RFELFI  +E AN F+ELND  DQ ERF  QV+ K  G++EA+  D DFI ALE+GLPPT G G+GIDR++ML T+  SIRDV+LFP M+
  S:    19 RRAKLAAIREAGVAFPNDFERRDYAGRLAHEHGDKSKEALEAEAVDVQLAGRMMLKRVMGKASFATLQDMSGRIQVYVSNDLTGLDAHEAF-KRWDLGDFVGVSGTLFKTNKGELTIQAKSVRLLSKALRPLPEKFHGLADQEQKYRQRYLDLITNDDARSTFVRRSKIIQAIREFMTGHGFLEVETPMMHPIPGGAAAKPFVTHHNALDMELFLRIAPELYLKRLVVGGFEKVFEINRNFRNEGLSTRHNPEFTMMEFYEAYREYRYLMDFTEALIRHTAVAATGSTTISYQGSTIELGTPFDRLTIVEAVRKYHPEYTVEQLNDRDWLTAQFTAMK--AKYREHDG-LGGLQLTFFEETTEALLVQPTFIVDYPAEVSPLARRSDTQPEITERFELFITGREMANGFSELNDAEDQAERFMEQVRAKEAGDEEAMHYDADFIRALEHGLPPTGGCGIGIDRLVMLLTDSPSIRDVILFPQMR 498
>gi|107028702|ref|YP_625797.1| lysyl-tRNA synthetase [Burkholderia cenocepacia AU 1054] >gi|116690139|ref|YP_835762.1| lysyl-tRNA synthetase [Burkholderia cenocepacia HI2424] >gi|170733472|ref|YP_001765419.1| lysyl-tRNA synthetase [Burkholderia cenocepacia MC0-3] >gi|194558775|ref|YP_002093801.1| Lysyl-tRNA synthetase (class II) [Burkholderia cenocepacia PC184] >gi|122977748|sp|Q1BHT1|SYK_BURCA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|166229795|sp|A0K8P2|SYK_BURCH Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|105897866|gb|ABF80824.1| lysyl-tRNA synthetase [Burkholderia cenocepacia AU 1054] >gi|116648228|gb|ABK08869.1| lysyl-tRNA synthetase [Burkholderia cenocepacia HI2424] >gi|124872566|gb|EAY64282.1| Lysyl-tRNA synthetase (class II) [Burkholderia cenocepacia PC184] >gi|169816714|gb|ACA91297.1| lysyl-tRNA synthetase [Burkholderia cenocepacia MC0-3] (508 aa)
Score = 982, Expect = 2.7e-104, Identities = 210/475 (44%), Positives = 307/475 (64%)
  Q:    12 RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEA--QELAKKHNVKFEKH---QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L+E   A  + +  E  +      D  +KFA         N   + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++  K+++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R + +  IR+FMD+ +++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L + F R+ +   I Q+   D+ + + + +A  +   K+  V   +     + +G +    FEE  EA+  +PTF+  +P++VSPL++     PG T+RFELF+  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALEYG+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    22 RREKLRALREQGVAYPNDFRPEHHA-----ADLQAKFADSDKAALEANPVEVSVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGADTYDAFKK-WDLGDIVAARGVLFRTNKGELSVQCKELRLLSKALRPLPDKFHGLSDQEMRYRQRYVDLIVTPETRDTFRARTKTIASIRKFMDNADFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTATIQYQGRELDLAKPFHRLTITQAI-QKYAPDYTDGQLSDDAFLRTELKRFGVDVSQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPVEVSPLARASDTVPGITERFELFMTGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 505
>gi|57506076|ref|ZP_00371999.1| lysyl-tRNA synthetase [Campylobacter upsaliensis RM3195] >gi|57015684|gb|EAL52475.1| lysyl-tRNA synthetase [Campylobacter upsaliensis RM3195] (502 aa)
Score = 982, Expect = 2.8e-104, Identities = 221/484 (45%), Positives = 310/484 (64%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN----IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R  K+  L+ A  +PY    + + ++I +F +KFA +   +   +    + +AGRV  LR      F  I D   + Q Y +K  + +     F K L++GDI+   G PF T+ GE +L + K+ + +K++ PLPEK+HGL D E R R RYVD+I+N D  K F  R +I+ +IR F +++ +LEVETP++HPI GGANA+PF+TFHN L    +LRIA EL LK+LIVGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N   +M LTE LF  + K L  +  +   +  I  ++ F RI   + +++   +   E+  N+E Q L K  +  FE ++   LGH+    F+ + E K I PTF+   PI +SPLS++  K+    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML TEK SIRDV+LFP M+  K
  S:     4 NILEQQRIAKMAELKTAGINPYP-HFLQKELSIKEFKNKFAYITQKDEKRDEKVLVSIAGRVKLLRIAGKSIFANIEDESENVQIYFSKDSIGEEQFNLFKKNLEVGDIILAKGYPFLTKMGEFSLHISKLTLATKSIVPLPEKFHGLTDIEQRYRKRYVDMIMNADVRKDFFTRSKIVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNALGVERFLRIAPELHLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYNDLMDLTEELFALLLKELNLETKITFDDKIIDFSRPFERISYKEALEKYGNLS-KEIIENKE-QILNKLKSDGFEANEKLDLGHLQAELFDNYVEDKLINPTFIIDFPISISPLSRRSEKDENIAERFELFIAGREIANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGEGIGIDRLVMLLTEKKSIRDVILFPAMRPLK 494
>gi|163803525|ref|ZP_02197394.1| lysyl-tRNA synthetase [Vibrio campbellii AND4] >gi|159172660|gb|EDP57513.1| lysyl-tRNA synthetase [Vibrio campbellii AND4] (510 aa)
Score = 982, Expect = 3.0e-104, Identities = 215/475 (45%), Positives = 312/475 (65%)
  Q:    12 RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  +++   AN  P +     R    GD   +F    K +    N+ + +AGR++A R  F VI++  G  Q Y +K  V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS + FV R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE L   +A+  L    +  G++ +     + R+ M + IK       Q   +   ++++      +AK  +V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T+  +IRDV+LFP M+
  S:    25 RRAKLDAIRKSCTANGHPNDFR---RDALAGDLQKEFGEKTKEELEALNHVVSIAGRIMAKRGPFLVIQETSGRIQAYADKA-VQKVLKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEFELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRQAFVVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEELLSSIAQEVLGSTSMPYGDDTVEFGGTYTRMSMFEAIKHYNPDHAQIQALTEEDIQNRDLMVSIAKSVHVEVEPFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTDTHTIRDVILFPAMR 507
>gi|86142116|ref|ZP_01060640.1| lysyl-tRNA synthetase [Flavobacterium sp. MED217] >gi|85831679|gb|EAQ50135.1| lysyl-tRNA synthetase [Leeuwenhoekiella blandensis MED217] (564 aa)
Score = 981, Expect = 3.3e-104, Identities = 219/486 (45%), Positives = 306/486 (62%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV-----SKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE-MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRREKL  L++ N +PY  +      T       F   K       + +AGR+++ R     +F  ++D  G  Q Y N+ ++          + + K+LD+GD + I G  F TQ GE T+ VKK  ++SKALKPLP         ++    D E+R R RY DL+VN     VFV R ++   +R F + + Y EVETP+L  I GGA ARPF+T HN L+   YLRIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y AY++  +MM  TE L ++ A ++        GE+++     ++R+ M D IKQ TG D    KS  E +E A    ++ ++     G +I+  F E CE   IQPTF+  +P ++SPL K+  +NP  T+RFEL +  KE ANA++ELNDPIDQ ERFE Q+K  + G+DEA E +D DF+ ALEYG+PPT+GLG+G+DR+IM  T   SI++VL FP MK ++
  S:     2 QLSEQEIIRREKLAGLRKLNINPYPADLYPVDHTSAKIKQDFEDGK------KVVIAGRLMSRRIQGKASFAELQDSTGRIQVYFNRDEICPGDDKTQYNDVYKKLLDIGDFIGIEGELFTTQVGEKTVMVKKFTLLSKALKPLPLPKVDKDGNEFDKFNDPEMRYRQRYADLVVNPKVKDVFVKRTKLFAAMRNFFNDKGYFEVETPILQSIPGGAAARPFVTHHNALDIPLYLRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMAFTEKLLEHCATAVNGTTEATFGEHKVDFKAPYKRVTMTDAIKQFTGFDI-TGKSEAELREAALGMGLEVDETMGK-GKLIDEIFGEKCEGNFIQPTFITDYPKEMSPLCKEHRENPELTERFELMVCGKEIANAYSELNDPIDQRERFEEQLKLAAKGDDEATEFIDQDFLRALEYGMPPTSGLGIGMDRLIMFLTNNQSIQEVLFFPQMKPER 498
>gi|194683346|emb|CAR44053.1| lysyl-tRNA synthetase [Proteus mirabilis HI4320] (504 aa)
Score = 981, Expect = 3.4e-104, Identities = 209/485 (43%), Positives = 309/485 (63%)
  Q:     5 FNDQELIRREKLKNLQE-ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            N++   RREKL  L++  N  P +  + + +  +       +  +    N  + +AGR++  R     +F  ++D  G  Q Y+++  + + +     K  DLGDI+   G  F+T+ GEL++   ++++++KAL+PLP+K+HGL D+E R R RY+DLI N++S   F  R +I+  IRQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME+Y AY +   ++ LTE LF+ + +  L   +VK G+ E    + F ++ M + I K     +  ++    +A  +A+   +K EK    LG +    FEE  E+  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ ERFE QV++K  G+DEA+  D D+I ALE+GLPPTAGLG+GIDRM+MLFT   +IRDV+LFP M+  K
  S:    14 LNNELQTRREKLSALRDNGNAFPNDFRRDAMSDELHQKYDAMSAEELDAANVEVAIAGRMMTRRIMGKASFATLQDMGGRIQLYVSRDDLPEGVYNEQFKKWDLGDILGGRGRVFKTKTGELSIHCTELRLLTKALRPLPDKFHGLADQETRYRQRYLDLISNENSRNTFKIRSKIMSAIRQFMVNKGFMEVETPMMQTIPGGASARPFITHHNALDIDMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYRDLIELTEELFRTLTQDVLGSTIVKYGDEEFDFGKPFEKLTMKEAICKYRPETNMADLDDMDKAVAIAQSIGIKIEKSWG-LGRVQCEIFEEVAESHLIQPTFIIEYPAEVSPLARRNDDNPFITDRFEFFIGGREIGNGFSELNDAQDQAERFEEQVRQKEAGDDEAMFFDHDYITALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPGK 504
>gi|117924339|ref|YP_864956.1| lysyl-tRNA synthetase [Magnetococcus sp. MC-1] >gi|117608095|gb|ABK43550.1| lysyl-tRNA synthetase [Magnetococcus sp. MC-1] (501 aa)
Score = 981, Expect = 3.6e-104, Identities = 215/485 (44%), Positives = 308/485 (63%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPY------EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP--VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +++ N Q   R+ KL+ L+EA  +PY      +I+  S +   G+     A L+      ++K+AGR++ LR     TF  ++D  G  Q    +  V   +     + +++GDI+ + G  FRT+ GELT+ V++ +++SKA++PLPEK+HGLED E R R RYVDLIVN +  ++F  R R++  IRQFM+ + +LEVETP++HPI GGA ARPF+T HN L+ + YLRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M  TE L + V K + +    V     E+  +  + R+   + I +    D   +      + LA+   +K E      G ++   FEE  E K + PTF+  +PI VSPLS++   NP   +RFELFI  +E ANAF+ELNDP DQ  RF+ QV+ K  GN+EA+  D D+I ALEYG+PPT G G+GIDR++ML T+ ++IR+VLLFP MK
  S:     8 QQEENQQIAARKVKLEALREAGVNPYPSGFKPDIDLASVSRANGN-EMDPATLE----RVSVKVAGRIMLLRNFGKLTFATLQDESGRLQISAQRDVVGAELYSTVFRKIEVGDILGVEGHLFRTKVGELTVQVERFELLSKAVRPLPEKFHGLEDVETRYRQRYVDLIVNTEVREIFKTRSRVISRIRQFMEHRGFLEVETPMMHPIPGGATARPFVTHHNALDTDLYLRIAPELYLKRLIVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYQAYTDYRELMDFTEALVQDVVKDVNEGELTVAYQGQELDFSGPWARLTPAEAIVRYMEADAARITERGYLESLAESLGIKAETSWDD-GMLLLTIFEEGVEHKLMAPTFIIDYPISVSPLSRRSDDNPDIAERFELFIAGREIANAFSELNDPADQASRFQKQVEAKDAGNEEAMHFDADYIRALEYGMPPTGGEGIGIDRLVMLLTDAANIREVLLFPQMK 498
>gi|167586750|ref|ZP_02379138.1| lysyl-tRNA synthetase [Burkholderia ubonensis Bu] (508 aa)
Score = 981, Expect = 3.8e-104, Identities = 207/475 (43%), Positives = 303/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQ-----STLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L+E  Q          T    D  +KFA         N   + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++  K+++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R + +  IR+FMD+ +++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L + F R+ +   I Q+    + + + + +A   ++   +  +  Q     + +G +    FEE  EA+  +PT++  +P++VSPL++     PG T+RFELF+  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALEYG+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    22 RREKLRALRE--QGVAYPNDFQPTHHAADLQAKFADSDKAALEANPVEVAVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGAETYDAFKK-WDLGDIVAARGVLFRTNKGELSVQCKELRLLSKALRPLPDKFHGLADQEMRYRQRYVDLIVTPETRDTFRARTKTIASIRKFMDTADFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTATIQYQGRELDLAKPFHRLTITQAI-QKYAPQYTDGQLSDDAFLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQLWEPTYIIDYPVEVSPLARASDTVPGITERFELFMTGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 505
>gi|78187216|ref|YP_375259.1| lysyl-tRNA synthetase [Pelodictyon luteolum DSM 273] >gi|78167118|gb|ABB24216.1| Lysyl-tRNA synthetase, class-2 [Pelodictyon luteolum DSM 273] (501 aa)
Score = 981, Expect = 3.9e-104, Identities = 214/482 (44%), Positives = 305/482 (63%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---------EK--WHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            NDQ   R ++ ++LQE+  +PY       +  +   + +  +    +    + +AGR++A+R+    +F  I+D  G  Q YL K +V       F K+LD+GDIV + G  FRT+ GE+++  +  +++ K+L+P+P         EK  +    D ELR R RYVDLIVN +    F+ R  I+  IR F  SQ +LEVETP+L PI GGA ARPF T HN L+   YLRIA EL LK+LIVGGFD V+E  + FRNEG+D  HNPEFT +E+Y AY++ ++MMRL E LF+  A ++    +     +EI L   FRR+ + D I++ TG +  E K+  E + LAK   ++ +    + G II+  F EF E K IQPTF+  +P ++SPL+K     PG  +RFEL    KE  N+F+ELNDP+ Q +R E Q   +  G+DEA+ +D DF+ ALEYG+PPTAGLG+GIDR++ML T + SIRDV+ FPH+K
  S:    10 LNDQMQRRFDERRHLQESGINPYPC-----SFEVTGHSRQIIEHFKEDAEEKVSVAGRIMAIRRMGKASFFHIQDSDGRMQIYLKKDEVGDDAYATF-KLLDIGDIVGVNGYTFRTRTGEISVHAESFELLCKSLRPIPVAKEKEVEGEKVVFDAFADRELRYRQRYVDLIVNPEVRSTFIKRSAIVSHIRSFFTSQGWLEVETPILQPIYGGAAARPFTTHHNALDMQLYLRIANELYLKRLIVGGFDGVFEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYDWMMRLVEELFQQTAIAVNGTAMTTFLGHEISLEAPFRRLTIADSIREYTGAEI-EGKTETELRNLAKDLGLELDPKIGS-GKIIDEIFGEFVEPKLIQPTFITDYPTEMSPLAKPHRSKPGLVERFELIAGGKEICNSFSELNDPVIQRQRLEEQASLRQRGDDEAMVVDEDFLRALEYGMPPTAGLGIGIDRLVMLITGEESIRDVIFFPHLK 499
>gi|15602054|ref|NP_245126.1| lysyl-tRNA synthetase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431878|sp|P57822|SYK_PASMU Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|12720410|gb|AAK02273.1| LysU [Pasteurella multocida subsp. multocida str. Pm70] (501 aa)
Score = 981, Expect = 4.1e-104, Identities = 214/487 (43%), Positives = 311/487 (63%)
  Q:     2 ERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ---ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E   N + L+RREKL  L+ A  +P+      R     D ++ +  L+          +K+AGR++  R     TF  ++D  G  Q Y+ +  + + +        DLGDI+ + G+ F+T+  ELT+   ++++++KAL+PLP+K+HGL D+E R R RY+DLI N+DS + F+ R +++  IR++  S+ ++EVETP+L  I GGA+ARPF+T HN L+ + YLRIA EL LK+L+VGGF++V+E+ R FRNEG+   HNPEFT +E Y AY +   +M  TE L + +A   L   +V  GE E    + F RI M D I +   E G+   ++     A  +AKK  ++ +K    LG ++N+ FEE  E   IQPTF+  HP ++SPL++++ +NP  T RFELFI  +E  N F+ELND  DQ ERF+AQV  K  G+DEA+  D DF+ ALE+GLPPTAG G+GIDR+ MLF   +SIRDV+LFP MK K
  S:     7 ELDLNGEMLVRREKLAALR-AKGNPFP-NTFRRDALAQDLHANYDALEGEALKAQEVEVKVAGRIMTRRAMGKATFITLQDMSGRIQLYVARDNLPEGIYADDVGQWDLGDIIGVKGTLFKTKTNELTVRCTEVQLLTKALRPLPDKFHGLSDQETRYRQRYLDLIANEDSRRTFIIRSKVIAGIREYFLSKGFMEVETPMLQIIPGGASARPFVTHHNALDVDMYLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMLEYYQAYADYHDLMDNTEELLRKLAMDILGTTIVPYGELEFDFGKPFERITMHDAILKYGAEKGIVKEDLYDFDRAVAVAKKLGIEVQKSWG-LGSLVNVIFEEVAEHHLIQPTFLMAHPAEISPLARRNDENPEVTDRFELFIGGREIGNGFSELNDAEDQNERFDAQVAAKEAGDDEAMFKDEDFVTALEHGLPPTAGEGLGIDRLAMLFANAASIRDVILFPAMKQK 501
>gi|78066893|ref|YP_369662.1| lysyl-tRNA synthetase [Burkholderia sp. 383] >gi|77967638|gb|ABB09018.1| Lysyl-tRNA synthetase, class-2 [Burkholderia sp. 383] (524 aa)
Score = 980, Expect = 4.3e-104, Identities = 209/475 (44%), Positives = 301/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEA--QELAKKHNVKFEKH---QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L+E  Q          T    D  + FA         N   + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++  K+++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R + +  IR+FMD+  ++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L + F R+ +   I Q+   D+   + + +A  +   K+  V   +     + +G +    FEE  EA+  +PTF+  +P++VSPL++     PG T+RFELF+  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALEYG+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    38 RREKLRALRE--QGVAYPNDFRPTHHAADLQTTFADSDKAALEANPVEVSVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGAETYDAFKK-WDLGDIVAARGVLFRTNKGELSVQCKELRLLSKALRPLPDKFHGLSDQEMRYRQRYVDLIVTPETRDTFRARTKTIASIRKFMDNAEFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTATIQYQGRELDLAKPFHRLTITQAI-QKYAPDYTAGQLSDDAFLRTELKRFGVDVSQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPVEVSPLARASDTVPGITERFELFMTGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 521
>gi|28897287|ref|NP_796892.1| lysyl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633] >gi|153839370|ref|ZP_01992037.1| lysyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810] >gi|31340436|sp|Q87SB1|SYK_VIBPA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|28805496|dbj|BAC58776.1| lysyl-tRNA synthetase, heat inducible [Vibrio parahaemolyticus RIMD 2210633] >gi|149747118|gb|EDM58106.1| lysyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810] (505 aa)
Score = 980, Expect = 4.6e-104, Identities = 213/475 (44%), Positives = 309/475 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++++ +         R    GD   +F +         N+ + +AGR++A R  F VI++  G  Q Y +K+ V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS   FV R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M  TE L   VA + L    +  GE+ +    K+ R+ M + IK       Q   +   ++++ +    +AK  +V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:    20 RRAKLDEIRKSCKANGHPNDFRRDALAGDLQKEFGEKTKEELEELNHVVAIAGRIMAKRGPFLVIQETSGRIQAYADKE-VQKELKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRNAFVVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDFTEELLSSVALEVLGSTSMPYGEDTVEFGGKYARMSMFEAIKHYNPDHAQIQALTEEDLQNRELMVSIAKSVHVEVEPFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMR 502
>gi|88808214|ref|ZP_01123725.1| lysyl-tRNA synthetase [Synechococcus sp. WH 7805] >gi|88788253|gb|EAR19409.1| lysyl-tRNA synthetase [Synechococcus sp. WH 7805] (497 aa)
Score = 980, Expect = 4.6e-104, Identities = 203/481 (42%), Positives = 301/481 (62%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL-KTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +D    R EK+  L++  ++PY +     T  +    +  A L K    +  + +AGRV+  R      F  + D  G  Q +L K  + ++  +    ++D GD++ + G+  RT +GEL++ V +  +++K+L+PLP+KWHGL D E R R RY+DLIV   S + F  R   +  IR+++D + +LE+ETPVL    GGA+ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEGM + HNPEFTS+EVY AY +   M+ LTE++   + + +     +     EI LT  +RR  M + +++ TG+DF      + A E      +   +   ++G ++N  FE   EA   QPTFV  +P ++SPL++K    PG  +RFELFI  +E ANAF+EL DP+DQ  R EAQ   ++ G++EA  +D DF++ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP ++
  S:    10 SDLRETRLEKVSALRDQGREPYAL-TFDPTDRMARLQTDHADLPKGEEKDCAVAVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKAALGEAFAQ-ITSLVDAGDLIGVRGTLRRTDRGELSVKVAEWTMLTKSLQPLPDKWHGLADVEKRYRQRYLDLIVTPQSRETFRRRALTVSAIRRWLDEREFLEIETPVLQAEAGGADARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGMSTRHNPEFTSVEVYQAYTDYLGMIDLTESMIASICQQVCGSTRLAYQGTEIDLTPPWRRATMHELVEEATGLDFTTFSDREAAAEAMAAKGLPVPEKADSVGRLLNEAFEHAVEANLTQPTFVLDYPEEISPLARKHRSKPGLVERFELFIVGRETANAFSELIDPVDQRGRLEAQQARRAAGDEEAQGVDEDFLQALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLR 494
>gi|88713473|ref|ZP_01107556.1| lysyl-tRNA synthetase [Flavobacteriales bacterium HTCC2170] >gi|88708383|gb|EAR00620.1| lysyl-tRNA synthetase [Flavobacteriales bacterium HTCC2170] (564 aa)
Score = 980, Expect = 4.7e-104, Identities = 220/486 (45%), Positives = 310/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV-----SKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQ--ELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE-MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRREKL  L+E   +PY         T       + + K       + ++GR+++ R     +F  ++D  G  Q Y N+ ++          E + K+LD+GDI+ I G  F TQ GE T+ VK   ++SKAL+PLP          +    D ELR R RY+DL+VN    + F+ R +I   IR+F++++ YLEVETP+L PI GGA ARPF+T HN L    YLRIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT +E+Y AY++  +MM +TE L + VAK       V +G+ EI     + R+ ++D IK  TG D   V +  EAQ  E+ KK +++ ++     G +I+  F E CE   +QPTF+  +P ++SPL+K     PG T+RFEL +N  E ANA++ELNDPIDQ ERFE Q+     G+DEA + +D DF+ ALEYG+PPT+G+G+GIDR++M  T  SSI++VL FP M+ +K
  S:     2 QLSEQEVIRREKLTKLRELGINPYPAALYPVDATSNSIKQNYEEGK------KVIISGRLMSRRIQGKASFAELQDSEGRIQVYFNRDEICVGEDKTKYNEVYKKLLDIGDIIGIEGELFTTQVGEKTVMVKDFSMLSKALRPLPLPKKDGEGNVYDEFNDPELRYRQRYIDLVVNPSVRETFIKRTKITNSIREFLNNKGYLEVETPILQPIPGGAAARPFLTHHNALNIPLYLRIANELYLKRLIVGGFDGVYEFAKDFRNEGMDRTHNPEFTMIELYVAYKDYNWMMGMTEQLLEKVAKDATGSTKVTVGDKEIDFKAPYPRVPILDAIKTHTGFD---VSAMNEAQLREVCKKLHLEVDESFGR-GKLIDEIFGEKCEHLYVQPTFITDYPKEMSPLTKAHRSKPGLTERFELMVNGSELANAYSELNDPIDQRERFEHQLALAQKGDDEATQFIDYDFLRALEYGMPPTSGIGIGIDRLVMFMTNNSSIQEVLFFPQMRPEK 498
>gi|148241213|ref|YP_001226370.1| lysyl-tRNA synthetase [Synechococcus sp. RCC307] >gi|166230597|sp|A5GQ58|SYK_SYNR3 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|147849523|emb|CAK27017.1| Lysyl-tRNA synthetase [Synechococcus sp. RCC307] (502 aa)
Score = 980, Expect = 4.9e-104, Identities = 199/475 (41%), Positives = 300/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEI--EKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK + L E  Q PY +  E   RT  +   ++     +  + +  + +AGRV+  R      F  + D  G  Q +L K  +  +  +    ++D GD + + G+  RT +GEL++   + +++SK+L+PLP+KWHGL D E R R RY+DLIV+ D+   F  R +++  IR+++D +++LE+ETPVL    GGA+ARPF T HN L+    LRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFTS+E+Y A+ +   MM LTE L   V + +    ++     EI L   +RR  M + +K+ TG+DF    S ++A    +   ++      ++G ++N  FE+  E   IQPTFV  +P+++SPL++     PG  +RFELFI  +E+ NAF+EL DP+DQ +R EAQ + ++ G+ EA  +D DF+ ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP +K
  S:     8 RLEKAQALIECGQVPYALRFEPSHRTAELQQAHADLPNGEERDVS--VAIAGRVMTRRVMGKLAFFTLADETGPIQLFLEKAALGDA-FKQITSLVDAGDWIGVKGTLRRTDRGELSVKAAQWQMLSKSLQPLPDKWHGLADVEKRYRQRYLDLIVSPDTRDTFRRRAQLVSGIRRWLDERDFLEIETPVLQSEPGGADARPFETHHNALDLPLTLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAFADYNDMMDLTEELISSVTQQVCGSTLINYQGTEINLAPGWRRATMHELVKEATGLDFAGFSSREDAAAAMEAKGLQTPALADSVGRLLNEAFEQAVEETLIQPTFVTDYPVEISPLARSHRSKPGLVERFELFIVGREHGNAFSELTDPVDQRQRLEAQQERRAAGDLEAQRVDEDFLNALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLK 486
>gi|156973279|ref|YP_001444186.1| lysyl-tRNA synthetase [Vibrio harveyi ATCC BAA-1116] >gi|166230600|sp|A7MXL2|SYK_VIBHB Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|156524873|gb|ABU69959.1| hypothetical protein VIBHAR_00960 [Vibrio harveyi ATCC BAA-1116] (510 aa)
Score = 980, Expect = 5.0e-104, Identities = 211/475 (44%), Positives = 308/475 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++++ +         R    GD   +F +         N+ + +AGR++A R  F VI++  G  Q Y +K  V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS + FV R +++  IR FM ++ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE L   VA + L    +  G++ +     + R+ M + IK       Q   +   ++++      +AK  +V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:    25 RRAKLDAIRKSCKANGHPNDFRRDALAGDLQKEFGEKTKEELEELNHVVAIAGRIMAKRGPFLVIQETSGRIQAYADKA-VQKVLKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEFELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRQAFVVRSKVMSAIRNFMITKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKELMDLTEELLSSVALEVLGSTSMPYGDDTVEFGGTYTRMSMFEAIKHYNPDHAQIQALTEEDIQNRDLMVSIAKSVHVEVESFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMR 507
>gi|161870293|ref|YP_001599463.1| lysyl-tRNA synthetase [Neisseria meningitidis 053442] >gi|161595846|gb|ABX73506.1| lysyl-tRNA synthetase [Neisseria meningitidis 053442] (491 aa)
Score = 980, Expect = 5.1e-104, Identities = 208/476 (43%), Positives = 310/476 (65%)
  Q:    11 IRREKLKNL-QEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL------GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +RREKL N+ Q+ N  P + ++ S      D ++++ ++     +     +K+AGR++  RQ    +F  I+D  G  Q YLN K VS+ +L+ FN   DLGDIV   G+ F+T  GELT+ V  I+++SK+L+PLP+K  GL D+E + R RYVDLI N++S   F+ R +I++ +R FM  ++YLEVETP++HPI GGA A+PF+T HN L+   YLRIA EL LK+L+VGG ++V+EI R FRNEGM   HNPEFT +E Y A+ + E MM++ E++ +  + ++     +     E+ L   F R+ +++ IK+      +  +   +A+ L K    +  KH  +L      G +    FE   E K   PTF+  +P++VSPL++      G T+RFELF+  +E AN ++ELNDP DQ ERF+AQV +K  G+DEA+  D D+I A+E+GLPPT G G+GIDR++ML T+  +IRDV+LFP M+
  S:     9 LRREKLHNIRQQRNAYPNDFKRDSFA---ADLHAQYGEIGKEELDPQGIPVKVAGRMMLKRQMGKASFATIQDVSGQIQLYLNNKGVSQEVLDDFNH-WDLGDIVGAEGTLFKTNHGELTVRVSGIRLLSKSLRPLPDKHKGLSDQETKYRQRYVDLIANEESRNTFIKRSQIIQSVRNFMVGEHYLEVETPMMHPIPGGATAKPFVTHHNALDIPLYLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIRNASHTVNGTANITYNGKEVDLESPFERLTILEAIKKYN--PHYTDEQLNDAEWLKK----EIVKHGESLPPSPGIGSLQLALFEGCAEGKLWNPTFIVDYPVEVSPLARASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKAQVAQKDAGDDEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDSQTIRDVILFPQMR 489
>gi|95929407|ref|ZP_01312150.1| lysyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] >gi|95134523|gb|EAT16179.1| lysyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] (494 aa)
Score = 980, Expect = 5.1e-104, Identities = 200/430 (46%), Positives = 285/430 (66%)
  Q:    59 LAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGH--IINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           +AGR++A R      F  ++D  G  Q Y+ K K+       F K LD+GDIV I G PFRT+  EL+L  + + +++K+L+PLPEKWHGL D E R R RY+DLIVN +   VF  R +I+ ++R FM  ++YLEVETP++ P+ GGA A+PF+T HNTL+ + +LRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY     +M +TE +   +A K     V+  G  ++ LT  + R+ + + I +   +   +++   +A   A    ++FE    T+G+  ++   F+E  E K   PTFV  +P +VSPLS+++ + P    RFELF+  +E ANAF+ELNDP+DQ  RFE Q+ EK  G+DEA  MD D+I ALEYGLPPTAG G+GIDR++ML T+ +SIRDV+LFP ++ +
  S:    60 IAGRIMARRDFGKAAFIQVQDRTGRLQIYVGKNKIGDEQFAVFGK-LDVGDIVGISGKPFRTKTDELSLRAESLTLLTKSLQPLPEKWHGLTDVETRYRQRYLDLIVNPEVGDVFKKRSQIISLMRAFMQERDYLEVETPMMQPVAGGATAKPFVTHHNTLKMDLFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISIQHNPEFTMMEFYQAYATYHDLMDMTEEMIGSIAEKVCGSRVISYGGKDVDLTAPWDRLTVKEAIVKYGDISLEDLEDPDKALAYANSIGLEFE---GTIGYGKLLTELFDEVAEPKLWNPTFVTEYPTEVSPLSRRNDERPEVVDRFELFVVGRELANAFSELNDPVDQKGRFEQQLVEKEAGDDEAHAMDEDYIRALEYGLPPTAGEGIGIDRLVMLLTDSASIRDVILFPQLRKE 492
>gi|37678853|ref|NP_933462.1| lysyl-tRNA synthetase [Vibrio vulnificus YJ016] >gi|39932022|sp|Q7MNP6|SYK_VIBVY Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|37197594|dbj|BAC93433.1| lysyl-tRNA synthetase, class II [Vibrio vulnificus YJ016] (510 aa)
Score = 979, Expect = 5.5e-104, Identities = 214/475 (45%), Positives = 309/475 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++++ +         R    GD   +F   +K +    N+ + +AGRV+A R  F VI++  G  Q Y +K  V K + + +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS   FV R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE L   VA + L    +  GE+ +     + R+ M + IK       Q   +   ++++      +AK  +V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:    25 RRAKLDQIRKSCKANGHPNDFRRDSLAGDLQKEFGEKSKEELEALNHVVAIAGRVMAKRGPFLVIQETSGRIQAYADKD-VQKVLKDKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRNAFVVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEELLSSVALEVLGSTSMPYGEHTVEFGGTYTRMSMFEAIKHYNPDHAQIQALTEEDIQNRDLMVSIAKSVHVEVEPFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMR 507
>gi|50084268|ref|YP_045778.1| lysyl-tRNA synthetase [Acinetobacter sp. ADP1] >gi|2501016|sp|Q43990|SYK_ACIAD Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|1359473|emb|CAA86924.1| lysyl-tRNA-synthase [Acinetobacter sp. ADP1] >gi|49530244|emb|CAG67956.1| lysyl-tRNA synthetase [Acinetobacter sp. ADP1] (509 aa)
Score = 979, Expect = 5.7e-104, Identities = 218/483 (45%), Positives = 305/483 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEI---EKVSRTMTIGDFNSKFAKLKTHNTNNN----IKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQST----LGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           ND    R  KLK +Q+  ++  +        R     D   +F  +       +    +K+AGRV+  R +F VI+D  G  Q Y+++K +    LE   K LDLGDI+   G   R+ KG+L + ++  ++++K+L+PLP+K+HGL D E + R RY+DLIVN+++ K F  R +++  IR F+ +Q ++EVETP++H I GGA+A+PF+T HN L+   YLRIA EL LK+L+VGGF++V+EI R FRNEG+ + HNPEFT +E Y AY + + +M+LTEN+ + +A   L    V  G+        F++I M D I  E   DF     N   +E   K      K Q      LG +  + FEE  E K  QPTF+  +P + SPL++++  NP  T RFE FI  +E AN F+ELNDPIDQ ERF+AQV EK  G+DEA+  D DFIEALEYGLPPTAG G+GIDR++M+F    SIRDVLLFPHM+ K
  S:    17 NDLIAQRHAKLKQIQDKAKETGKSVWPNTFKREHYAADLQEQFKDIDKAQIEGSDKTYVKVAGRVMLNRGSFMVIQDMTGRIQLYVDRKGLPADTLETI-KSLDLGDIIAAEGYIGRSGKGDLYVHLEGFELLTKSLRPLPDKFHGLTDTEAKYRKRYLDLIVNEETRKTFEIRAQVVAGIRAFLTNQRFMEVETPMMHVIPGGASAQPFVTHHNALDMELYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSTRHNPEFTMIEFYQAYADYKDLMQLTENMLEKLALDILGTTDVPYGDEVYSFKGPFKKISMFDAI-LEHNPDF--TPENVNDREFLAKFTQDVLKEQVKPGFGLGKLQTIVFEETVETKLRQPTFITEYPAETSPLARRNDDNPHITDRFEFFIGGRELANGFSELNDPIDQAERFQAQVAEKDAGDDEAMHYDADFIEALEYGLPPTAGQGIGIDRLVMIFANAPSIRDVLLFPHMRRK 507
>gi|86157505|ref|YP_464290.1| lysyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85774016|gb|ABC80853.1| lysyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-C] (513 aa)
Score = 979, Expect = 6.0e-104, Identities = 213/430 (49%), Positives = 281/430 (65%)
  Q:    59 LAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPI--LGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKK-PVVKMGENEIYLTQKFRRIHMVDFIKQETGV---------DFWEVKSNQEAQELAKKHNVKFEKH-QSTLGHIINLFFEEFCEAKCIQ--PTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           LAGRV+A+R      F  +RD   + Q ++ K +V     E F K+LD+GDIV   G   RT+ GELTL+ +   I++KA +PLPEKWHGL D E R R RYVDL+V     + FV R RI+  IR+F+D++ YLEVETP LH     GGA ARPF T HN L+ +  LRIATEL LK+L+VGG D+VYEIGRI+RNEG+D  HNPEFTS+E Y AY   E +MRLTE L   +A  +   PVV      I LT  + R+ M++   +  G+            E  S   A+E   +   K E+  + T G  + L FE F E +  +  P FV   P++ SPLS++   +P    RFELF    E ANAF+ELNDP DQ  RFEAQ++ K+ G++EA+  D DF+ ALE+G+PPTAG G+GIDR+ MLFT+ +SIRDV+LFP +K +
  S:    65 LAGRVLAVRSFGKAAFLRVRDRSAELQVWVKKDRVGDQAFEVF-KLLDIGDIVGAEGPATRTKTGELTLEARTFTILTKATRPLPEKWHGLTDVEQRYRQRYVDLVVTPGVREAFVKRARIVSGIRRFLDARGYLEVETPTLHKPEEAGGAAARPFETHHNALDLDLKLRIATELHLKRLVVGGLDRVYEIGRIWRNEGIDRRHNPEFTSIEFYQAYATHEDLMRLTEELMHQLAVEVTGGPVVTFQGQAIDLTPPYPRVSMLEVGARALGLAPDDALAGRGLAEALSRAAARENDSEDAWKLEQAAKKTPGEAVALAFEIFGEPQLPKDRPAFVVDFPLETSPLSRRRDADPRLVDRFELFAAGMELANAFSELNDPADQRARFEAQMRAKAAGDEEAMPYDEDFVRALEHGMPPTAGEGIGIDRLAMLFTDSASIRDVILFPLLKSR 512
>gi|21674209|ref|NP_662274.1| lysyl-tRNA synthetase [Chlorobium tepidum TLS] >gi|39932217|sp|Q8KCM7|SYK_CHLTE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|21647373|gb|AAM72616.1| lysyl-tRNA synthetase [Chlorobium tepidum TLS] (511 aa)
Score = 979, Expect = 6.1e-104, Identities = 219/482 (45%), Positives = 310/482 (64%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---EK--------WHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQ--ELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            NDQ   R E+  +L EA  +PY   K   T T       F+         ++ +AGR++A+R+    +F  I+D  G  Q YL K  V ++    F K+LD+GDIV + G  F+T+ GE+++  ++ ++++K+L+P+P   EK        +    D ELR R RYVDLIVN +    F+ R +I+ ++R +  S  +LEVETP+L PI GGA ARPF T HN L+   YLRIA EL LK+LIVGGFD V+E  + FRNEG+D  HNPEFT +E+Y AY++  +MM L E+L       +  K   + +G NEI L   FRR+ + D I++ TG+   E++   EAQ  ++AK   ++ +   S+ G II+  F EF E K IQPTF+  +P ++SPL+KK    PG  +RFEL +  KE  N+F+ELNDP+ Q ER E Q + +  G+DEA+ +D DF+ ALEYG+PP AGLG+GIDRM+ML T + SIRDV+ FPHMK
  S:    20 LNDQMKRRFEERTHLAEAGINPYPY-KFDVTTTSKAIIDSFSD----ENPADVSVAGRIMAIRRMGKASFLHIQDSEGRIQIYLKKDDVGEASYNTF-KLLDIGDIVGVSGFTFKTKTGEISVHARQFELLAKSLRPIPIAKEKEVDGQKVIYDAFSDRELRYRQRYVDLIVNPEVRGTFIKRTKIVALMRNYFASNGWLEVETPILQPIYGGAAARPFTTHHNALDMQLYLRIANELYLKRLIVGGFDGVFEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYIWMMELVEDLLHKACVEVNGKDSTMFLG-NEINLKPPFRRLTIADSIREYTGM---EIRGKSEAQLRDIAKDLGLELDPKISS-GKIIDEIFGEFVEPKLIQPTFITDYPEEMSPLAKKHRSEPGLVERFELIVGGKEVCNSFSELNDPVIQRERLEEQARLRQRGDDEAMIVDEDFLRALEYGMPPCAGLGIGIDRMVMLLTGQDSIRDVIFFPHMK 509
>gi|163754082|ref|ZP_02161205.1| lysyl-tRNA synthetase [Kordia algicida OT-1] >gi|161326296|gb|EDP97622.1| lysyl-tRNA synthetase [Kordia algicida OT-1] (561 aa)
Score = 979, Expect = 6.1e-104, Identities = 220/486 (45%), Positives = 310/486 (63%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSMLE-YFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---EK----WHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE++RREKL  L+E   +PY         T       FA+ K       + +AGR+++ R     +F  ++D  G  Q Y N+ ++     KS     + K+LD+GD + I G  F T+ GE T+ VK   ++SKALKPLP   EK    +   +D E R R RY DL+VN +  +VFV R ++   +R F +   Y EVETP+L PI GGA ARPF+T HN+L    Y+RIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y AY++  +MM  TE+L ++ A ++        GE++I     ++R+ M   I   TG D    KS +E +E AK   ++ ++     G +I+  F E CE   I+PTF+  +P ++SPL K+  +NP  T+RFEL +  KE ANA++ELNDPIDQ ERFEAQ+K    G+DEA+ +D DFI ALEYG+PPT+GLG+G+DR+IM  T  +SI++VL FP MK ++
  S:     2 QLSEQEIVRREKLSKLRELGINPYPANLYPVNHTSKQVKETFAEGK------QVIIAGRLMSRRIQGSASFAELQDADGKIQVYFNRDEICPGEDKSHYNNVYKKLLDIGDFIGIEGELFTTKVGEKTVMVKNFTLLSKALKPLPLPKEKDGVVYDKFDDPEQRYRQRYADLVVNPEVKEVFVKRTKLFNAMRNFFNDAGYFEVETPILQPIPGGAAARPFVTHHNSLNIPLYMRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMEFTESLLEHCAIAVNGTTEATFGEHKIDFKAPYKRVTMTQSIIDFTGFDI-TGKSEEELREAAKSMGIEVDETMGK-GKLIDEIFGEKCEGNYIEPTFITDYPKEMSPLCKEHRENPELTERFELMVCGKEIANAYSELNDPIDQRERFEAQLKLSEKGDDEAMFIDNDFIRALEYGMPPTSGLGIGMDRLIMYLTNNASIQEVLFFPQMKPER 496
>gi|147669196|ref|YP_001214014.1| lysyl-tRNA synthetase [Dehalococcoides sp. BAV1] >gi|189082959|sp|A5FRN5|SYK_DEHSB Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|146270144|gb|ABQ17136.1| lysyl-tRNA synthetase [Dehalococcoides sp. BAV1] (498 aa)
Score = 979, Expect = 7.0e-104, Identities = 200/433 (46%), Positives = 286/433 (66%)
  Q:    57 IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKS-LGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +KLAGR++  R     +F  IRD  G  Q +  +  + ++ +E   K LDLGD + + GS  RT+ GE +L   K+ ++SK+L PLPEKWHGL+D E R R RY+DLI N D+ + F+ R R++ +IR FM+++ +LEVETPVL P  GGA ARPFIT H  L  +FY+RIA EL LK+LIVGGFD+VYEIGRIFRNEG+ + HNPEFT ME Y AY N + +M   E +   V K +     +  G+  +  T  + R+ M D +KQ  G+DF++  + +       +  +K +  +   G +++    EF E   +QPTF+  HP+ +SPL+K+  ++P  T+RFE      E ANAF+ELNDP++Q  RF+ Q++++S L  DE+  +D DF+ AL YG+PPT GLGVGIDR++MLFT   SIR+V+LFP +KD++
  S:    56 LKLAGRIMTRRDMGKISFMDIRDGSGKMQIFFRQNDLDEASIELL-KDLDLGDFIGVEGSLMRTRTGEPSLAATKVSMLSKSLLPLPEKWHGLQDVEKRYRQRYLDLISNADARQTFLTRSRVISVIRAFMNAKGFLEVETPVLQPEAGGALARPFITHHQALNCDFYMRIALELHLKRLIVGGFDRVYEIGRIFRNEGISTRHNPEFTMMESYQAYANYKDVMDFLEEMVSSVVKEISGGYTLPFGDITLDFTPPWPRLTMRDAVKQYAGIDFFDFPTKETLAAEMTRRKLKVDPAKD-WGKLVDELVGEFVEPHLVQPTFLTDHPVAMSPLAKQKPEDPRLTERFEAICANMEIANAFSELNDPVEQRARFKEQLEKRSQLRTDESESVDEDFLAALAYGMPPTGGLGVGIDRLVMLFTNHDSIREVILFPALKDRE 492
>gi|27363989|ref|NP_759517.1| lysyl-tRNA synthetase [Vibrio vulnificus CMCP6] >gi|31340442|sp|Q8DEQ9|SYK_VIBVU Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|27360106|gb|AAO09044.1|AE016798_204 Lysyl-tRNA synthetase [Vibrio vulnificus CMCP6] (510 aa)
Score = 978, Expect = 7.4e-104, Identities = 213/475 (44%), Positives = 309/475 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++++ +         R    GD   +F   +K +    N+ + +AGRV+A R  F VI++  G  Q Y +K  V K + + +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS   FV R +++  IR FM S+ ++EVETP++H I GGA+ARPF+T HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE L   VA + L    +  GE+ +     + R+ M + IK       Q   +   ++++      +AK  +V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:    25 RRAKLDQIRKSCKANGHPNDFRRDSLAGDLQKEFGEKSKEELEALNHVVAIAGRVMAKRGPFLVIQETSGRIQAYADKD-VQKVLKDKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRNAFVVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFVTHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEELLSSVALEVLGSTSMPYGEHTVEFGGTYTRMSMFEAIKHYNPDHAQIQALTEEDIQNRDLMVSIAKSVHVEVEPFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMR 507
>gi|193212439|ref|YP_001998392.1| lysyl-tRNA synthetase [Chlorobaculum parvum NCIB 8327] >gi|193085916|gb|ACF11192.1| lysyl-tRNA synthetase [Chlorobaculum parvum NCIB 8327] (511 aa)
Score = 978, Expect = 7.7e-104, Identities = 220/482 (45%), Positives = 310/482 (64%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---------EK--WHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL--KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            NDQ   R E+  +L E+  +PY   K   T T      +F +        ++ +AGR++A+R+    +F  I+D  G  Q YL + +V       F K+LD+GDIV + G  FRT+ GE+++  K+ +++SK+L+P+P         EK  +    D ELR R RYVDLIVN +    F+ R +I+ ++R +  S  +LEVETP+L PI GGA ARPF T HN L+   YLRIA EL LK+LIVGGFD VYE  + FRNEG+D  HNPEFT +E+Y AY++  +MM L E+L       +  K   + +G NEI L   FRR+ + D IK+ TG++  + KS  + +++AK   ++ +   S+ G II+  F EF E K IQPTF+  +P ++SPL+KK    PG  +RFEL +  KE  N+F+ELNDP+ Q ER E Q + +  G+DEA+ +D DF+ ALEYG+PP AGLG+GIDRM+ML T + SIRDV+ FPHMK
  S:    20 LNDQMKRRFEERAHLAESGIEPYPY-KFDVTATSKGIIERFDE----ENPEDVSVAGRIMAIRKMGKASFFHIQDSVGRIQIYLKRDEVGVDSYNTF-KLLDIGDIVGVKGFSFRTKTGEISVHAKEFELLSKSLRPIPIAKEKEVDGEKVVYDAFADRELRYRQRYVDLIVNPEVRDTFIKRTKIVALMRNYFASNGWLEVETPILQPIYGGAAARPFTTHHNALDMQLYLRIANELYLKRLIVGGFDGVYEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYVWMMELVEDLLHKACVEVNGKDSTMFLG-NEINLKPPFRRLTIADSIKEYTGMEIRD-KSEAQLRDIAKDLGLELDPKISS-GKIIDEIFGEFVEPKLIQPTFITDYPEEMSPLAKKHRSEPGLVERFELIVGGKEVCNSFSELNDPVIQRERLEEQARLRQRGDDEAMIVDEDFLRALEYGMPPCAGLGIGIDRMVMLLTGEDSIRDVIFFPHMK 509
>gi|121635115|ref|YP_975360.1| lysyl-tRNA synthetase [Neisseria meningitidis FAM18] >gi|166229812|sp|A1KUN1|SYK_NEIMF Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|120866821|emb|CAM10579.1| lysyl-tRNA synthetase [Neisseria meningitidis FAM18] (503 aa)
Score = 978, Expect = 8.2e-104, Identities = 210/485 (43%), Positives = 317/485 (65%)
  Q:     2 ERKFNDQELI--RREKLKNL-QEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL------GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + ++ ++I  RREKL N+ Q+ N  P + ++ S      D ++++ ++     +     +K+AGR++  RQ    +F  I+D  G  Q YLN K VS+ +L+ FN   DLGDIV   G+ F+T  GELT+ V  I+++SK+L+PLP+K  GL D+E + R RYVDLI N++S   F+ R +I++ +R FM  ++YLEVETP++HPI GGA A+PF+T HN L+   YLRIA EL LK+L+VGG ++V+EI R FRNEGM   HNPEFT +E Y A+ + E MM++ E++ +  ++++     +     E+ L   F R+ +++ IK+      +  +   +A+ L K    +  KH  +L      G +    FE   E K   PTF+  +P++VSPL++      G T+RFELF+  +E AN ++ELNDP DQ ERF+AQV +K  G+DEA+  D D+I A+E+GLPPT G G+GIDR++ML T+  +IRDV+LFP M+
  S:    10 EPQLDENQIIALRREKLHNIRQQRNAYPNDFKRDSFA---ADLHAQYGEIGKEELDPQGIPVKVAGRMMLKRQMGKASFATIQDVSGQIQLYLNNKGVSQEVLDDFNH-WDLGDIVGAEGTLFKTNHGELTVRVSDIRLLSKSLRPLPDKHKGLSDQETKYRQRYVDLIANEESRNTFIKRSQIIQSVRNFMVGEHYLEVETPMMHPIPGGATAKPFVTHHNALDIPLYLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIRNASRTVNGTANITYNGKEVDLESPFERLTILEAIKKYN--PHYTDEQLNDAEWLKK----EIVKHGESLPPSPGIGSLQLALFEGCAEGKLWNPTFIIDYPVEVSPLARASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKAQVAQKDAGDDEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDSQTIRDVILFPQMR 501
>gi|119511071|ref|ZP_01630191.1| lysyl-tRNA synthetase [Nodularia spumigena CCY9414] >gi|119464322|gb|EAW45239.1| lysyl-tRNA synthetase [Nodularia spumigena CCY9414] (467 aa)
Score = 978, Expect = 8.5e-104, Identities = 193/398 (48%), Positives = 270/398 (67%)
  Q:    89 VSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           V      +  ++ D GDI+ + G+  RT+KGEL++ VK+  I++K+L PLP+KWHGL D   R R RYVDLIVN +  + F  R +I   IR+++  +++LE+ETPVL    GGA+ARPF+T+HNTL+   YLRIATEL LK+LIVGGF+KV+E+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE +   VA+  L    +      I L+  +RR+ M D +K+ TG+DF    + +EA+  +K   +   +   ++G ++N  FE+  E   IQPTFV  +P+++SPL+K     PG  +RFELFI  +E AN+F+EL DP+DQ ER EAQ   K+ G+ EA  +D DFI ALEYG+PPT GLG+GIDR++ML T+ +SIRD + FP +K
  S:     4 VDADAFSHLKQLTDAGDILGVKGTIKRTEKGELSVYVKEYSILTKSLLPLPDKWHGLTDVAKRYRQRYVDLIVNPEVRQTFRRRAQITAGIRRYLTERDFLEIETPVLQSEAGGADARPFVTYHNTLDMQLYLRIATELHLKRLIVGGFEKVFELGRIFRNEGVSTRHNPEFTSIEVYQAYADYHDMMALTEGIITTVAQEVLGTLQITYQGTPIDLSAPWRRVTMHDLVKEYTGLDFNSFSTLEEAKAASKNAGLHGIEDVPSMGKLLNAAFEQKIEENLIQPTFVIDYPVEISPLAKPHRSQPGLVERFELFIVGRETANSFSELTDPVDQRERLEAQAALKAAGDLEAQGVDEDFITALEYGMPPTGGLGIGIDRLVMLLTDCASIRDAIAFPLLK 402
>gi|153951744|ref|YP_001398557.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. doylei 269.97] >gi|166229803|sp|A7H4X7|SYK_CAMJD Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|152939190|gb|ABS43931.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. doylei 269.97] (501 aa)
Score = 978, Expect = 9.1e-104, Identities = 219/484 (45%), Positives = 309/484 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R EK K L+    +PY    + + M++  F  KF+    +++  + + N  +AGR+  LR      F  I D   + Q Y +K  V + +     K L+ GDIV + G PF T+ GE +L   ++K+ +KA+ PLPEK+HGL D E R R RYVD+I+N +  K F+ R +++ +IR F +++ +LEVETP++HPI GGANA+PF+TFHN+L    +LRIA EL LK+L+VGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N + +M LTE LF  +   L     ++     I  ++ F RI   D + +  G+D   ++  ++   LAK     FE ++   LGH+    F+ + E K I PTFV   PI +SPLS++  +N    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     4 NILEQQRIEKAKELKNLGINPYP-HFLEKEMSLKTFKDKFSYILEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKKNLEAGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVDMIMNAEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGVERFLRIAPELYLKRLVVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEELFALLLDKLNLGKTIEFDGKMIDFSKPFERITYKDALCKYGGLDRDLIEDKEKI--LAKLKTDGFEANEKLELGHLQAELFDNYVEEKLINPTFVSDFPISISPLSRRSDENSQIAERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLK 494
>gi|127511746|ref|YP_001092943.1| lysyl-tRNA synthetase [Shewanella loihica PV-4] >gi|166229827|sp|A3QB36|SYK_SHELP Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|126637041|gb|ABO22684.1| lysyl-tRNA synthetase [Shewanella loihica PV-4] (500 aa)
Score = 977, Expect = 9.4e-104, Identities = 219/485 (45%), Positives = 316/485 (65%)
  Q:     2 ERKFNDQELI--RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQ-----ET--GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  ++ +LI  RR KL +++    AN  P   ++  +   I     +++K +    N    +AGR++A R  F VI+D  G  Q Y  K  V K +   +   LD+GDI+ + G    + KG+L +++++ ++++KAL+PLPEK+HGL D+E R R RYVDLIVN++S   F+ R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE +   +AK L     +  GE+ I     + R+ M+D IK+     ET   + + EVK  +  + LAK   +  EK   T G ++   F E  E K +QPTF+ G+P D+SPL++++ +N   T RFE FI  +E AN F+ELND  DQ +RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP M+
  S:     3 EQTQDENKLIAERRAKLDHVRASCPANGHPNNFDRKHKAADIQAEYGQYSKEELEEMNVQRSIAGRIMAKRGPFLVIQDVSGRIQAYAGKD-VQKDLKAKYQG-LDIGDIIGVTGQLHLSGKGDLYVNMEEYQLLTKALRPLPEKFHGLTDQETRYRQRYVDLIVNEESRAAFIMRSKVVTAIRNFMVSKEFMEVETPMMHSIPGGASARPFITHHNALDIEMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEMLSSIAKDLLGDTKLPYGEHTIDFGGPYERLSMLDAIKKYNPDNETIQSMTYEEVKDVEFMRNLAKSLGMTIEKFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRNDENHFITDRFEFFIGGREVANGFSELNDAEDQDKRFKAQVDAKDAGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLFTNTHTIRDVILFPAMR 497
>gi|21242620|ref|NP_642202.1| lysyl-tRNA synthetase [Xanthomonas axonopodis pv. citri str. 306] >gi|39932221|sp|Q8PLC6|SYK_XANAC Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|21108084|gb|AAM36738.1| lysyl-tRNA synthetase heat inducible [Xanthomonas axonopodis pv. citri str. 306] (505 aa)
Score = 977, Expect = 1.0e-103, Identities = 199/448 (44%), Positives = 290/448 (64%)
  Q:    39 GDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVK-SNQEAQELAKKHNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           GD  ++FA   T        +   +++AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A+S L    V     +I L   FRR  M + ++        E+  ++   +E   +H  + +   K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+ PT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    46 GDLQAEFADADTWTPEALEASGRTVRMAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKASALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAMRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHQIMDLTEQVIRDTAQSVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP----EISAADCTDREALLRHCERLKIRVKPSYGWGKLLLEIFEATVEHTLVQPTFITDHPVEVSPLARSSDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHFDADYIRALEYGMAPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 502
>gi|73748416|ref|YP_307655.1| lysyl-tRNA synthetase [Dehalococcoides sp. CBDB1] >gi|123759759|sp|Q3ZWX9|SYK_DEHSC Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|73660132|emb|CAI82739.1| lysyl-tRNA synthetase [Dehalococcoides sp. CBDB1] (498 aa)
Score = 977, Expect = 1.1e-103, Identities = 200/433 (46%), Positives = 286/433 (66%)
  Q:    57 IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKS-LGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +KLAGR++  R     +F  IRD  G  Q +  +  + ++ +E   K LDLGD + + GS  RT+ GE +L   K+ ++SK+L PLPEKWHGL+D E R R RY+DLI N D+ + F+ R R++ +IR FM+++ +LEVETPVL P  GGA ARPFIT H  L  +FY+RIA EL LK+LIVGGFD+VYEIGRIFRNEG+ + HNPEFT ME Y AY N + +M   E +   V K +     +  G+  +  T  + R+ M D +KQ  G+DF++  + +       +  +K +  +   G +++    EF E   +QPTF+  HP+ +SPL+K+  ++P  T+RFE      E ANAF+ELNDP++Q  RF+ Q++++S L  DE+  +D DF+ AL YG+PPT GLGVGIDR++MLFT   SIR+V+LFP +KD++
  S:    56 LKLAGRIMNRRDMGKISFMDIRDGSGKMQIFFRQNDLDEASIELL-KDLDLGDFIGVEGSLMRTRTGEPSLAATKVSMLSKSLLPLPEKWHGLQDVEKRYRQRYLDLISNADARQTFLTRSRVISVIRAFMNAKGFLEVETPVLQPEAGGALARPFITHHQALNCDFYMRIALELHLKRLIVGGFDRVYEIGRIFRNEGISTRHNPEFTMMESYQAYANYKDVMDFLEEMVSSVVKEISGGYTLPFGDITLDFTPPWPRLTMRDAVKQYAGIDFFDFPTKETLAAEMTRRKLKVDPAKD-WGKLVDELVGEFVEPHLVQPTFLTDHPVAMSPLAKQKPEDPRLTERFEAICANMEIANAFSELNDPVEQRARFKEQLEKRSQLRTDESESVDEDFLAALAYGMPPTGGLGVGIDRLVMLFTNHDSIREVILFPALKDRE 492
>gi|94309979|ref|YP_583189.1| lysyl-tRNA synthetase [Ralstonia metallidurans CH34] >gi|123081366|sp|Q1LPK6|SYK_RALME Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|93353831|gb|ABF07920.1| lysyl-tRNA synthetase [Ralstonia metallidurans CH34] (515 aa)
Score = 977, Expect = 1.2e-103, Identities = 204/475 (42%), Positives = 301/475 (63%)
  Q:    12 RREKLKNL-QEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETG--VDFWEVKSNQEAQELAKKHNVKFEKHQ---STLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L Q+    P + +   +   +     +  +     +   + +AGR++  R     +F  ++D  G  QFY+ + KV + +   F K  DLGDI+   G  FRT KGEL++ V++++++SKAL+PLP+K+HGL D+E + R RYVDLIV+ ++   F  R + +  IR+ M    ++EVETP+LHPI GGA A+PFIT HN L+   ++RIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TENL +  A   +    V     E+ L++ F R+ +   I++      D     ++    EL  K  +     Q   + LG +  + FEE  EA+  +PT++  +P++VSPL++     PG T+RFELFI  +E AN F+ELNDP DQ ERF  QV++K  G++EA+  D D+I ALEYG+PPT G G+GIDR++ML T+  +IRDV+LFPH++
  S:    28 RREKLQALRQQGVAFPNDFQPTHQAGALHAQYGETDQATLEASPVEVSIAGRMMLKRVMGKASFATVQDGSGQIQFYITRDKVGEDVYAAF-KHWDLGDIISARGELFRTNKGELSVQVRELRLLSKALRPLPDKFHGLADQETKYRQRYVDLIVSPETRSTFRARTQAISSIRRHMADAGFMEVETPMLHPIPGGAAAKPFITHHNALDMQMFMRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTENLIRQAAIDARGSATVTYQGRELDLSKPFHRLTICGAIQKYAPEYTDAQLADADFLRAELKNKFKINTSAPQFLNAGLGTLQLVLFEETAEAQLWEPTYIVDYPVEVSPLARGSDTQPGITERFELFITGREIANGFSELNDPEDQAERFRKQVEQKDAGDEEAMYFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPNIRDVILFPHLR 512
>gi|91226782|ref|ZP_01261435.1| lysyl-tRNA synthetase [Vibrio alginolyticus 12G01] >gi|91188913|gb|EAS75197.1| lysyl-tRNA synthetase [Vibrio alginolyticus 12G01] (505 aa)
Score = 977, Expect = 1.2e-103, Identities = 212/475 (44%), Positives = 307/475 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIK-------QETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++++ +         R    GD   +F +         N+ + +AGR++A R  F VI++  G  Q Y +K  V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS + FV R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M LTE L   VA+  L    +  G+  +     + R+ M + IK       Q   +   ++++      +AK  +V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:    20 RRAKLDAIRKSCKANGHPNDFRRDALAGDLQKEFGEKTKEELEELNHVVAIAGRIMAKRGPFLVIQETSGRIQAYADKA-VQKVLKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRQAFVVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEELLSSVAQEVLGSTSMPYGDETVEFGGTYTRMSMFEAIKHYNPDHSQIQALTEEDLQNRDLMVSIAKSVHVEVEPFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMR 502
>gi|15677284|ref|NP_274437.1| lysyl-tRNA synthetase [Neisseria meningitidis MC58] >gi|32130177|sp|Q9JYU6|SYK_NEIMB Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|7226664|gb|AAF41786.1| lysyl-tRNA synthetase, heat inducible [Neisseria meningitidis MC58] (503 aa)
Score = 977, Expect = 1.2e-103, Identities = 210/485 (43%), Positives = 317/485 (65%)
  Q:     2 ERKFNDQELI--RREKLKNL-QEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL------GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + ++ ++I  RREKL N+ Q+ N  P + ++ S      D ++++ ++     +     +K+AGR++  RQ    +F  I+D  G  Q YLN K VS+ +L+ FN   DLGDIV   G+ F+T  GELT+ V  I+++SK+L+PLP+K  GL D+E + R RYVDLI N++S   F+ R +I++ +R FM  ++YLEVETP++HPI GGA A+PF+T HN L+   YLRIA EL LK+L+VGG ++V+EI R FRNEGM   HNPEFT +E Y A+ + E MM++ E++ +  ++++     +     E+ L   F R+ +++ IK+      +  +   +A+ L K    +  KH  +L      G +    FE   E K   PTF+  +P++VSPL++      G T+RFELF+  +E AN ++ELNDP DQ ERF+AQV +K  G+DEA+  D D+I A+E+GLPPT G G+GIDR++ML T+  +IRDV+LFP M+
  S:    10 EPQLDENQIIALRREKLHNIRQQRNAYPNDFKRDSFA---ADLHAQYGEIGKEELDPQGIPVKVAGRMMLKRQMGKASFATIQDVSGQIQLYLNNKGVSQEVLDDFNH-WDLGDIVGAEGTLFKTNHGELTVRVSGIRLLSKSLRPLPDKHKGLSDQETKYRQRYVDLIANEESRNTFIKRSQIIQSVRNFMVGEHYLEVETPMMHPIPGGATAKPFVTHHNALDIPLYLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIRNASRTVNGTANITYNGKEVDLESPFERLTILEAIKKYN--PHYTDEQLNDAEWLKK----EIVKHGESLPPSPGIGSLQLALFEGCAEGKLWNPTFIVDYPVEVSPLARASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKAQVVQKDAGDDEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDSQTIRDVILFPQMR 501
>gi|171322227|ref|ZP_02911073.1| lysyl-tRNA synthetase [Burkholderia ambifaria MEX-5] >gi|171092452|gb|EDT37798.1| lysyl-tRNA synthetase [Burkholderia ambifaria MEX-5] (508 aa)
Score = 976, Expect = 1.2e-103, Identities = 207/475 (43%), Positives = 302/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEA--QELAKKHNVKFEKH---QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L+E  Q          T    D  + FA         N   + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++  K+++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R R +  IR+FMD+ +++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L Q F R+ +   I Q+    + + + + +A  +   K+  V   +     + +G +    FEE  E++  +PT++  +P++VSPL++     PG T+RFELF+  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALE+G+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    22 RREKLRALRE--QGVAYPNDFRPTHHAADLQATFADSDKAALEANPVEVSVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGAETYDAFKK-WDLGDIVAARGVLFRTNKGELSVQCKELRLLSKALRPLPDKFHGLADQEMRYRQRYVDLIVTPETRDTFRARTRTIASIRKFMDNADFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTATIQYQGRELDLAQPFHRLTITQAI-QKYAPQYTDGQLSDDAFLRTELKRFGVDVSQPAFLNAGIGALQLALFEETAESQLWEPTYIIDYPVEVSPLARASDTAPGITERFELFMTGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEHGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 505
>gi|152969073|ref|YP_001334182.1| lysyl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150953922|gb|ABR75952.1| lysyl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (505 aa)
Score = 976, Expect = 1.3e-103, Identities = 211/485 (43%), Positives = 319/485 (65%)
  Q:     5 FNDQELIRREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            N++   RREKL  L+E   A  + +  +  S  +   +F++K    +  + N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G  F+TQ GEL++   ++++++KAL+PLP+K+HGL+D+E+R R RY+DLI N++S   F  R +IL  +RQFM ++ ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY + + ++ LTE+LF+ +A++ L K  V  G+      + F ++ M + IK+     +  ++ +   A+ LA+   ++ EK    LG I+   F+E  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ +RF+ QV  K+ G+DEA+  D D++ ALEYGLPPTAGLG+GIDRM+MLFT   +IRDV+LFP M+ +K
  S:    15 LNNELKARREKLAALREQGVAFPNDFRRDHTSDQLH-AEFDAK-DNDELASLNVEVAVAGRMMTRRVMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDIIAARGKLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANEESRHTFRIRSQILATMRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQTVLGKTEVPYGDQVFDFGKPFEKLTMREAIKKHRPETNMADLDNFDAAKALAESIGIQVEKSWG-LGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPQK 505
>gi|15794532|ref|NP_284354.1| lysyl-tRNA synthetase [Neisseria meningitidis Z2491] >gi|32130176|sp|Q9JTT7|SYK_NEIMA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|121052437|emb|CAM08773.1| lysyl-tRNA synthetase [Neisseria meningitidis Z2491] (503 aa)
Score = 976, Expect = 1.3e-103, Identities = 210/485 (43%), Positives = 316/485 (65%)
  Q:     2 ERKFNDQELI--RREKLKNL-QEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL------GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + ++ ++I  RREKL N+ Q+ N  P + ++ S      D ++++ ++     +     +K+AGR++  RQ    +F  I+D  G  Q YLN K VS+ +L+ FN   DLGDIV   G+ F+T  GELT+ V  I+++SK+L+PLP+K  GL D+E + R RYVDLI N++S   F+ R +I++ +R FM  ++YLEVETP++HPI GGA A+PF+T HN L+   YLRIA EL LK+L+VGG ++V+EI R FRNEGM   HNPEFT +E Y A+ + E MM++ E++ +  + ++     +     E+ L   F R+ +++ IK+      +  +   +A+ L K    +  KH  +L      G +    FE   E K   PTF+  +P++VSPL++      G T+RFELF+  +E AN ++ELNDP DQ ERF+AQV +K  G+DEA+  D D+I A+E+GLPPT G G+GIDR++ML T+  +IRDV+LFP M+
  S:    10 EPQLDENQIIALRREKLHNIRQQRNAYPNDFKRDSFA---ADLHAQYGEIGKEELDPQGIPVKVAGRMMLKRQMGKASFATIQDVSGQIQLYLNNKGVSQEVLDDFNH-WDLGDIVGAEGTLFKTNHGELTVRVSGIRLLSKSLRPLPDKHKGLSDQETKYRQRYVDLIANEESRNTFIKRSQIIQSVRNFMVGEHYLEVETPMMHPIPGGATAKPFVTHHNALDIPLYLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIRNASHTVNGTANITYNGKEVDLESPFERLTILEAIKKYN--PHYTDEQLNDAEWLKK----EIVKHGESLPPSPGIGSLQLALFEGCAEGKLWNPTFIVDYPVEVSPLARASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKAQVAQKDAGDDEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDSQTIRDVILFPQMR 501
>gi|194539229|ref|YP_002074284.1| lysyl-tRNA synthetase [Vibrio sp. Ex25] >gi|151937784|gb|EDN56632.1| lysyl-tRNA synthetase [Vibrio sp. Ex25] (505 aa)
Score = 976, Expect = 1.4e-103, Identities = 213/475 (44%), Positives = 306/475 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQ--------ELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++++ +         R    GD   +F +         N+ + +AGR++A R  F VI++  G  Q Y   K V K + E +   LD+GDI+ + G+  ++ KG+L +++++ ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN+DS K F+ R +++  IR FM S+ ++EVETP++H I GGA+ARPFIT HN L+   YLRIA EL LK+L+VGGFD+V+EI R FRNEG+   HNPEFT ME Y AY + + +M  TE L   VA+  L    +  G+  +     + R+ M + IKQ    D  ++++  E           +AK  +V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++   NP FT RFE FI  +E AN F+ELND  DQ  RF+AQV+ K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:    20 RRAKLDEIRKSCKANGHPNDFRRDALAGDLQKEFGEKTKEELEELNHVVAIAGRIMAKRGPFLVIQETSGRIQAYA-AKDVQKELKEKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNEDSRKAFIVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPFITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDFTEELLSSVAQEVLGSTSMPYGDETVEFGGTYTRMSMFEAIKQYNP-DHAQIQALTEEDLQNRELMVSIAKSVHVEVEDFW-TCGQLLEEIFGETAEPKLMQPTFITGYPADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMR 502
>gi|33862174|ref|NP_893735.1| lysyl-tRNA synthetase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|39932077|sp|Q7UZP0|SYK_PROMP Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|33634392|emb|CAE20077.1| Lysyl-tRNA synthetase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (512 aa)
Score = 976, Expect = 1.4e-103, Identities = 212/475 (44%), Positives = 313/475 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-HNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKK-----KVSKSMLEY--FNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R  K  +L +   +PY  E    T +      KF  L+   + N ++ +AGRV+A R      F  I D  G  Q YL KK     ++   +L +    +++D+GD + ++G+  +T KGEL++ V K +++SK+L+PLP+KWHGL D E R R RY+DLIVN  S  VF  R + + +IR+++D +N+LE+ETP+L    GGA ARPFIT HNTL+   YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFTS+E+Y A+ N   MM LTE+L + +  S     ++   E  I  ++ ++RI M D + + TG+DF     +  +A +  ++ N++     +TLG ++N  FEE  E++ ++PTFV  +PI++SPL++   +N    +RFELFI  +E ANAF+EL DP+DQ +R + Q   +  G+ EA  +D DF++ALE G+PPT GLG+GIDR+IML T   SIRDV+ FP +K
  S:     8 RLLKANSLVKKGFEPYA-ETFKITHSTKFLTEKFGYLENGQDFNLDVAIAGRVLAKRVMGKIAFYTIADQEGKIQLYLEKKILDDFEIHAKLLSFEDLKEIVDIGDWIGVYGTIKKTNKGELSIKVSKWEMLSKSLQPLPDKWHGLTDIEKRYRQRYLDLIVNPLSKNVFKTRAKCISLIRRWLDEKNFLEIETPILQSEAGGAEARPFITHHNTLDIPLYLRIATELHLKRMVVGGFEKVYELGRIFRNEGISTKHNPEFTSVEIYQAFSNYIDMMNLTEDLIRDIVLSCCDSLIINYQEKVIDFSKPWKRISMKDVVMEYTGIDFDSFNGDLNKAMKDLEESNIEISPKINTLGRLLNEVFEEKVESQLVEPTFVIDYPIEISPLARPHPENKEMVQRFELFIAGRELANAFSELIDPVDQRKRMQLQQSLRDAGDLEAHCIDEDFLQALEIGMPPTGGLGIGIDRLIMLLTNSPSIRDVITFPLLK 495
>gi|166711948|ref|ZP_02243155.1| lysyl-tRNA synthetase [Xanthomonas oryzae pv. oryzicola BLS256] (505 aa)
Score = 975, Expect = 1.6e-103, Identities = 199/448 (44%), Positives = 290/448 (64%)
  Q:    39 GDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVK-SNQEAQELAKKHNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           GD  ++FA   T        +   +K+AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A+S L    V     +I L   FRR  M + ++        E+  ++   ++   +H  + +   K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+ PT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    46 GDLQAEFADADTWTPDALEASGRTVKMAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKASALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAMRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQVIRDTAQSVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP----EISAADCTDRDALLRHCERLKIRVKPSYGWGKLLLEIFEATVEHTLVQPTFITDHPVEVSPLARSSDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHFDADYIRALEYGMAPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 502
>gi|194562959|ref|YP_002097982.1| Lysyl-tRNA synthetase (class II) [Burkholderia dolosa AUO158] >gi|124894583|gb|EAY68463.1| Lysyl-tRNA synthetase (class II) [Burkholderia dolosa AUO158] (508 aa)
Score = 975, Expect = 1.6e-103, Identities = 208/475 (43%), Positives = 300/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQ-----STLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L+E  Q          T    D  +KFA   K         + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++  K+++++SK+L+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R + +  IR+FM   +++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L Q F R+ +   I Q+    + + + + +A    +   +  +  Q     + +G +    FEE  EA+  +PTF+  +P++VSPL++     PG T+RFELFI  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALEYG+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    22 RREKLRALRE--QGVAYPNDFRPTHHAADLQAKFAESDKAALEADPVEVAVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGADTYDAFKK-WDLGDIVAARGVLFRTNKGELSVQCKELRLLSKSLRPLPDKFHGLADQEMRYRQRYVDLIVTPETRDTFRARTKTIASIRKFMSDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTATIQYQGRELDLAQPFHRLTITQAI-QKYAPQYTDRQLSDDAYLRNELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPVEVSPLARASDTVPGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 505
>gi|188575994|ref|YP_001912923.1| lysyl-tRNA synthetase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188520446|gb|ACD58391.1| lysyl-tRNA synthetase [Xanthomonas oryzae pv. oryzae PXO99A] (505 aa)
Score = 975, Expect = 1.8e-103, Identities = 199/448 (44%), Positives = 284/448 (63%)
  Q:    39 GDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFE-KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           GD  ++FA   T        +   +K+AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A+S L    V     +I L   FRR  M + ++     +            L     +K   K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+ PT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    46 GDLQAEFADADTWTPDALEASGRTVKMAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKASALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAMRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQVIRDTAQSVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP-EISAADCTDRDALLRHCERLKIRVKPSYDWGKLLLEIFEATVEHTLVQPTFITDHPVEVSPLARSSDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHFDADYIRALEYGMAPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 502
>gi|190574184|ref|YP_001972029.1| putative lysyl-tRNA synthetase [Stenotrophomonas maltophilia K279a] >gi|190012106|emb|CAQ45729.1| putative lysyl-tRNA synthetase [Stenotrophomonas maltophilia K279a] (503 aa)
Score = 975, Expect = 1.9e-103, Identities = 209/478 (43%), Positives = 298/478 (62%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFE-KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           RREKLK L+   Q         R    G    +FA  +T            +K+AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDI+ + G   RT+ GEL++  + I++++K+L+PLP+KWHGL D E R R RYVDLIV  +S  VF+ R +I++ +R ++D++++LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L VGG ++VYEI R FRNEG+ + HNPEFT ME+Y AY     +M LTE + + VAK++     V+    +I L   FRR  M + ++     +            L     +K   K     G ++   FE   E   IQPTF+  HP++VSPL++ +  +PG+T RFELF+N KE AN F+ELNDP DQ +RF+AQV  K  G+DEA+  D D+I ALEYG+ PT GLG+G+DR++ML T  SSIRDVLLFP+M+ ++
  S:    19 RREKLKALR--GQGIAYPNDFRREDFAGRLQEEFADAETWTAEALEGNGRQVKMAGRLMAKRIMGKASFAQIQDESGRIQLFLQGAVLGDAYTAF--KGWDVGDIIAVEGGLTRTKTGELSVKAESIRLLTKSLRPLPDKWHGLADVEQRYRQRYVDLIVTPESRAVFIKRSKIIRAMRAWLDNRDFLEVETPMMHYIPGGAAAKPFTTHHNALDLDLYLRVAPELYLKRLTVGGLERVYEINRNFRNEGVSTRHNPEFTMMELYEAYATYNEIMDLTEGVIRDVAKAVNGGTEVEWDGAKIDLGPAFRRWRMDEAVRHHNP-EISAADCTDRDALLRHCERLKIRVKPSYGWGKLLLEIFEATVEHTLIQPTFITDHPVEVSPLARANDNDPGYTDRFELFVNGKELANGFSELNDPEDQAQRFQAQVAAKEGGDDEAMHYDADYIRALEYGMAPTGGLGIGVDRLVMLLTGSSSIRDVLLFPYMRPEQ 503
>gi|163730604|ref|ZP_02138077.1| lysyl-tRNA synthetase [Vibrio fischeri MJ11] >gi|161396238|gb|EDQ20534.1| lysyl-tRNA synthetase [Vibrio fischeri MJ11] (501 aa)
Score = 975, Expect = 1.9e-103, Identities = 213/483 (44%), Positives = 311/483 (64%)
  Q:     4 KFNDQELI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + ++ +LI  RR KL ++++A +         R    GD  ++F +         N+ + +AGRV+A R  F +I++  G  Q Y   K+V K + + +   LD+GDI+ + G+  ++ KG+L +++++  +++KAL+PLPEK+HGL D+E+R R RYVDLIVN DS   F+ R +++  IR FM  + ++EVETP++H I GGA+ARPF+T HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M LTE +   VA S L    +  GE+ +    K+ R+ M+D IKQ          + +  VK       +AK  +V+ E    T G ++   F E  E K +QPTF+  +P D+SPL++++  N   T RFE FI  +E AN F+ELND  DQ ERF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:     6 QLDENKLIAERRGKLDHIRQACKANGHPNDFRRDSLAGDLQAEFGEKTKEELEELNHVVAIAGRVMAKRGPFLLIQEVSGKIQAYA-AKEVQKELKDKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYVLLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNDDSRHAFIVRSKVVAAIRNFMVDKGFMEVETPMMHVIPGGASARPFVTHHNALDVDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEEMLSTVATSVLGSDKMPYGEHTVDFGGKYARMSMLDAIKQYNPDHSEIQALTYEGVKDRDLMVSIAKSVHVEVESFW-TCGQLLEEIFGETAEPKLMQPTFITEYPADISPLARRNDDNDFITDRFEFFIGGREVANGFSELNDAQDQDERFKAQVNAKESGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPSMR 498
>gi|157736905|ref|YP_001489588.1| lysyl-tRNA synthetase [Arcobacter butzleri RM4018] >gi|166980066|sp|A8ESJ5|SYK_ARCB4 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|157698759|gb|ABV66919.1| lysyl-tRNA synthetase [Arcobacter butzleri RM4018] (504 aa)
Score = 975, Expect = 2.0e-103, Identities = 221/478 (46%), Positives = 314/478 (65%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDF---NSKFAKLK-THNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           R EK   L+E   +PY  E  SR  TI  +   NS   +L+   + N N  +AGR+   R     +F  I D  G  Q Y+ +  + ++   E F K +++GDI+EI G PF T  GEL+L    +KI++KA+ PLPEK+HG++D+ELR R RY+DLI+N +  K F  R +++ + R+F +++ +LEVETP++HPI GGANA+PF+T  N L  + +LRIA EL LK+LIVGGF+ V+EI R FRNEGMD+THNPEFTS+E Y AY+  + ++ LT+  F+Y+ ++L  P ++  GE +I    KF  I ++  + +  GV   ++  +++      K N         LG +    F+EF EAK I PTF+  +P+++SPL+++  + P  T RFELFI  KE ANAF+ELNDPIDQ +RFE Q+  K  G+DEA EMD DF+ AL YG+ PTAG G+GIDR++M+ T + SIRDVLLFP MK  K
  S:    10 RIEKANKLREDGINPYSNES-SRNCTISKYLNVNSDIFQLEEKRDENRNYTVAGRIKFFRLMGKASFLKIEDESGMLQIYVARDNLPENFYNEVFKKNIEVGDIIEISGYPFVTGHGELSLHADSLKILTKAISPLPEKFHGIQDKELRYRQRYLDLIMNSEVRKTFHIRSKVISLTRRFFENKGFLEVETPMMHPIAGGANAKPFVTHFNALGVDRFLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDATHNPEFTSIEFYWAYKTYKDLIVLTKEYFEYLFENLNLPTILPYGEFKIDF-NKFSEIPLIQSLYEIGGVP-QDIVEDKDKILAFLKANNLEANANLNLGQLQGELFDEFVEAKLINPTFITEYPVEISPLARRSDEKPHLTDRFELFIAGKEIANAFSELNDPIDQLQRFEGQIAAKEAGDDEAHEMDEDFVNALSYGMAPTAGQGIGIDRLVMMLTNEHSIRDVLLFPAMKPIK 494
>gi|170702007|ref|ZP_02892927.1| lysyl-tRNA synthetase [Burkholderia ambifaria IOP40-10] >gi|170133097|gb|EDT01505.1| lysyl-tRNA synthetase [Burkholderia ambifaria IOP40-10] (508 aa)
Score = 974, Expect = 2.1e-103, Identities = 206/475 (43%), Positives = 302/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEA--QELAKKHNVKFEKH---QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L+E  Q          T    D  + FA         N   + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++  K+++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R R +  IR+FMD+ +++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L + F R+ +   I Q+    + + + + +A  +   K+  V   +     + +G +    FEE  E++  +PT++  +P++VSPL++     PG T+RFELF+  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALE+G+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    22 RREKLRALRE--QGVAYPNDFRPTHHAADLQATFADSDKATLEANPVEVSVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGAETYDAFKK-WDLGDIVAARGVLFRTNKGELSVQCKELRLLSKALRPLPDKFHGLADQEMRYRQRYVDLIVTPETRDTFRARTRTIASIRKFMDNADFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTAAIQYQGRELDLAKPFHRLTITQAI-QKYAPQYTDGQLSDDAFLRTELKRFGVDVSQPAFLNAGIGALQLALFEETAESQLWEPTYIIDYPVEVSPLARASDTTPGITERFELFMTGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEHGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 505
>gi|148238513|ref|YP_001223900.1| lysyl-tRNA synthetase [Synechococcus sp. WH 7803] >gi|166230596|sp|A5GI38|SYK_SYNPW Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|147847052|emb|CAK22603.1| Lysyl-tRNA synthetase [Synechococcus sp. WH 7803] (489 aa)
Score = 974, Expect = 2.2e-103, Identities = 204/481 (42%), Positives = 300/481 (62%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL-KTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +D    R EK+  L++  ++PY +     +  +    S  A L K    +  + +AGRV+  R      F  + D  G  Q +L K  + ++  +    ++D GD++ + G+  RT +GEL++ V +  +++K+L+PLP+KWHGL D E R R RY+DLIV   S + F  R   +  IR+++D + +LE+ETPVL    GGA+ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFTS+EVY AY +   M+ LTE++   V + +     +     EI LT  +RR  M + +++ TG+DF        A E      +       ++G ++N  FE   EA  IQPTFV  +P ++SPL++K    PG  +RFELFI  +E ANAF+EL DP+DQ  R EAQ   ++ G++EA  +D DF++ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP ++
  S:     2 SDLRETRLEKVSALRDQGREPYAL-TFDPSDRMARLQSDHADLPKGEERDCAVAVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKAALGEAFAQ-ITSLVDAGDLIGVRGTLRRTDRGELSVKVAEWTMLTKSLQPLPDKWHGLADVEKRYRQRYLDLIVTPQSRETFRRRALTVSAIRRWLDEREFLEIETPVLQSEAGGADARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEVYQAYADYLGMIELTESMIASVCEQVCGGTRLTYQGTEIDLTPPWRRATMHELVEEATGLDFTAFADRAAAAEAMTAKGLPVPDKADSVGRLLNEAFEHAVEANLIQPTFVLDYPEEISPLARKHRSKPGLVERFELFIVGRETANAFSELIDPVDQRGRLEAQQARRAAGDEEAQGVDEDFLQALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLR 486
>gi|90580578|ref|ZP_01236383.1| lysyl-tRNA synthetase [Vibrio angustum S14] >gi|90438236|gb|EAS63422.1| lysyl-tRNA synthetase [Vibrio angustum S14] (501 aa)
Score = 974, Expect = 2.4e-103, Identities = 213/475 (44%), Positives = 308/475 (64%)
  Q:    12 RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKL---KTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++E   AN  P +  + S      D N+K+ ++   +     +   +AGR++A R  F  I+D  G  Q Y +K  V K + E ++  LD+GDI+ I G+  ++ KG+L +++ + ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN DS   FV R +++  IR FM ++ ++EVETP++H I GGA ARPFIT HN L+ + YLR+A EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M LTE +   +A   L    +  GE E+     + R+ M+D IKQ          + +  V   +   ++AK  +V  E    T G ++   F E  E + +QPTF+  +P D+SPL++++ +NP  T RFE FI  +E AN F+ELND  DQ +RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP M+
  S:    15 RRAKLDMIRENCKANGHPNDFRRDSLA---ADLNAKYGEMTKEELEEAGHVFAIAGRIMAKRGPFLAIQDVSGRIQAYASKD-VQKELKEKYSG-LDIGDIIGIKGALHKSGKGDLYVNMDEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNDDSRHAFVVRSKVVSAIRSFMVTKGFMEVETPMMHVIPGGATARPFITHHNALDIDMYLRVAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEEMLSSIAIDVLGSSKMPYGEFEVEFAGPYTRMSMLDAIKQYNPEHAEIQALTYEGVADRELMVKIAKSVHVDVEDFW-TCGQLLEEIFGETAEPQLMQPTFITEYPADISPLARRNDENPFITDRFEFFIGGREVANGFSELNDAQDQDQRFKAQVDAKDAGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLVMLFTNTHTIRDVILFPAMR 497
>gi|147798996|emb|CAN72569.1| hypothetical protein [Vitis vinifera] (601 aa)
Score = 974, Expect = 2.5e-103, Identities = 208/472 (44%), Positives = 319/472 (67%)
  Q:    15 KLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL----KTHNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKK-----HNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKE------------------KSLGNDEAVE--MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +++ L+    +PY   K  RT T       +  L    + ++ ++ + +AGR+VA R+ FG      +RD  G  Q Y  K+++     E    ++D+GDI+ + GS  RT+KGEL++ V     ++K+L PLP+K+HGL D + R R RYVD+I N +   +F  R +I+  IR+ ++S  ++EVETPVL    GGA ARPF+T+HN+L R+ YLRIATEL LK+++VGGF+KVYE+GRIFRNEG+ + HNPEFT++E+Y AY + E MM + E +    A ++  K  +     EI L + +RR  M++ +K+ TG+DF E+  + + A+E+A +     H+ K +   +  +++GH++N  FE   E + IQPTFV  +PI++SPL+K   ++ G T+RFELFI  +E ANAF+EL DP+DQ  R E QV++                   +   DE+ E  +D DF+ ALEYG+PP +G+G+G+DR++ML T  +SIRDV+ FP +K
  S:    90 QVEELRNKGLEPYAY-KWDRTHTANQLQDIYRHLGNGEELNSESDYVSIAGRIVA-RRAFGKLAFFTLRDDSGTIQLYCEKERLLNEQFEQLKTLVDIGDILGVSGSIKRTEKGELSVYVNSFAXLTKSLLPLPDKYHGLTDVDKRYRQRYVDMIANPEVADIFRKRAKIVSAIRRTVESSGFVEVETPVLQGAAGGAEARPFVTYHNSLGRDLYLRIATELHLKRMLVGGFEKVYEMGRIFRNEGISTRHNPEFTTIEMYEAYSDYESMMNMAEEIVTQCALAVCGKLTIDYQGTEICLERPWRRETMLNLVKEATGIDFNELXXDIKVAKEVALRALGIGHDSKDKSSIEACTSVGHVLNEVFEIVVEPQLIQPTFVLDYPIEISPLAKPHRRHAGLTERFELFICGRELANAFSELTDPMDQRGRLEEQVRQHNEKRAAVVSEPDHAEVKTTESEDESYEVTLDDDFLTALEYGMPPASGMGLGVDRLVMLLTNSASIRDVIAFPVLK 598
>gi|89072537|ref|ZP_01159109.1| lysyl-tRNA synthetase [Photobacterium sp. SKA34] >gi|89051641|gb|EAR57094.1| lysyl-tRNA synthetase [Photobacterium sp. SKA34] (501 aa)
Score = 974, Expect = 2.6e-103, Identities = 213/475 (44%), Positives = 308/475 (64%)
  Q:    12 RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKL---KTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  ++E   AN  P +  + S      D N+K+ ++   +     +   +AGR++A R  F  I+D  G  Q Y +K  V K + E ++  LD+GDI+ I G+  ++ KG+L +++ + ++++KAL+PLPEK+HGL D+E+R R RYVDLIVN DS   FV R +++  IR FM ++ ++EVETP++H I GGA ARPFIT HN L+ + YLR+A EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M LTE +   +A   L    +  GE E+     + R+ M+D IKQ          + +  V   +   ++AK  +V  E    T G ++   F E  E + +QPTF+  +P D+SPL++++ +NP  T RFE FI  +E AN F+ELND  DQ +RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP M+
  S:    15 RRAKLDMIRENCKANGHPNDFRRDSLA---ADLNAKYGEMTKEELEEAGHVFAIAGRIMAKRGPFLAIQDVSGRIQAYASKD-VQKELKEKYSG-LDIGDIIGIKGTLHKSGKGDLYVNMDEYELLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNDDSRHAFVVRSKVVSAIRSFMVTKGFMEVETPMMHVIPGGATARPFITHHNALDIDMYLRVAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEEMLSSIAIDVLGSSKMPYGEFEVEFAGPYTRMSMLDAIKQYNPEHEEIQALTYEGVADRELMVKIAKSVHVDVEDFW-TCGQLLEEIFGETAEPQLMQPTFITEYPADISPLARRNDENPFITDRFEFFIGGREVANGFSELNDAQDQDQRFKAQVDAKDAGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLVMLFTNTHTIRDVILFPAMR 497
>gi|194099248|ref|YP_002002342.1| lysyl-tRNA synthetase [Neisseria gonorrhoeae NCCP11945] >gi|193934538|gb|ACF30362.1| lysyl-tRNA synthetase [Neisseria gonorrhoeae NCCP11945] (503 aa)
Score = 974, Expect = 2.7e-103, Identities = 209/485 (43%), Positives = 316/485 (65%)
  Q:     2 ERKFNDQELI--RREKLKNL-QEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL------GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + ++ ++I  RREKL N+ Q+ N  P + ++ S      D  +++ ++     +     +K+AGR++  RQ    +F  I+D  G  Q YLN K VS+ +L+ FN   DLGDIV   G+ F+T  GELT+ V  I+++SK+L+PLP+K  GL D+E + R RYVDLI N++S   F+ R +I++ +R FM  ++YLEVETP++HPI GGA A+PF+T HN L+   YLRIA EL LK+L+VGG ++V+EI R FRNEGM   HNPEFT +E Y A+ + E MM++ E++ +  ++++     +     E+ L   F R+ +++ IK+      +  +   +A+ L K    +  KH  +L      G +    FE   E K   PTF+  +P++VSPL++      G T+RFELF+  +E AN ++ELNDP DQ ERF++QV +K  G+DEA+  D D+I A+E+GLPPT G G+GIDR++ML T+  +IRDV+LFP M+
  S:    10 EPQLDENQIIALRREKLNNIRQQRNAYPNDFKRDSFA---ADLQAQYGEIGKEELDPQAVPVKIAGRMMLKRQMGKASFATIQDVTGQIQLYLNNKGVSQEVLDGFNH-WDLGDIVGAEGTLFKTNHGELTVRVSDIRLLSKSLRPLPDKHKGLSDQETKYRQRYVDLIANEESRNTFIKRSQIIQSVRNFMVGEHYLEVETPMMHPIPGGATAKPFVTHHNALDIPLYLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIRNASRTVNGTANITYNGKEVDLESPFERLTILEAIKKYN--PHYTDEQLNDAEWLKK----EIVKHGESLPPSPGIGSLQLALFEGCAEGKLWNPTFIVDYPVEVSPLARASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKSQVAQKDAGDDEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDLQTIRDVILFPQMR 501
>gi|163786312|ref|ZP_02180760.1| lysyl-tRNA synthetase [Flavobacteriales bacterium ALC-1] >gi|159878172|gb|EDP72228.1| lysyl-tRNA synthetase [Flavobacteriales bacterium ALC-1] (562 aa)
Score = 973, Expect = 2.8e-103, Identities = 221/486 (45%), Positives = 315/486 (64%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPY--EIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVAL----RQTFGVIRDFYGDTQFYLNKKKV----SKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE-MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QEL+RREKL+ L+    +PY  ++  V+RT       SK  KL        + +AGR++A+    + +F  ++D  G  Q Y N+ ++     KS+  + F K++DLGD V I G  F T+ GE T+ V++ K++SKALKPLP         +    D E R R RY DL VN    +VF+ R ++   +RQF +   Y EVETP+L PI GGA ARPFIT HN+L+   Y+RIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y +Y++  +MM   E L ++ A ++        GE++I     ++RI M D I + TG D +  KS  E +  A+  +++ ++     G +I+  F E CE   IQPTF+  +P ++SPL K+  +NP  T+RFEL +  KE ANA++ELNDPIDQ ERFE Q+K    G+DEA E +D DF+ ALEYG+PPT+G+G+G+DR+IM  T   SI++VL FP M+ +K
  S:     2 QLSEQELVRREKLEKLRALGINPYPADLFPVNRT-------SKQIKLD-FKEGKQVIVAGRLMAINVQGKASFAQLQDSEGRIQVYFNRDEICTGEDKSLYNDVFKKLIDLGDFVGIEGELFTTKVGEKTIMVREFKLLSKALKPLPIPKQKDGVTYDAFTDPEQRYRQRYADLAVNPHVKEVFIKRTKLFNAMRQFFNDAGYFEVETPILQPIPGGAAARPFITHHNSLDIPLYMRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVSYKDYNWMMDFCEQLLEHCAIAVNGTSEATFGEHKINFKAPYKRITMRDSILEFTGFDIYN-KSEDEIRAAARGMHIEVDETMGK-GKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKEHRENPELTERFELMVCGKEIANAYSELNDPIDQRERFEHQLKLAQKGDDEATEFIDHDFLRALEYGMPPTSGMGIGMDRLIMFLTNNQSIQEVLFFPQMRPEK 497
>gi|59711060|ref|YP_203836.1| lysyl-tRNA synthetase [Vibrio fischeri ES114] >gi|75354565|sp|Q5E7P8|SYK_VIBF1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|59479161|gb|AAW84948.1| lysine tRNA synthetase, inducible [Vibrio fischeri ES114] (501 aa)
Score = 973, Expect = 2.9e-103, Identities = 213/483 (44%), Positives = 310/483 (64%)
  Q:     4 KFNDQELI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + ++ +LI  RR KL ++++A +         R    GD  ++F +         N+ + +AGRV+A R  F +I++  G  Q Y   K+V K + + +   LD+GDI+ + G+  ++ KG+L +++++  +++KAL+PLPEK+HGL D+E+R R RYVDLIVN DS   F+ R +++  IR FM  + ++EVETP++H I GGA+ARPF+T HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M LTE +   VA S L    +  GE+ +    K+ R+ M+D IKQ          + +  VK       +AK  +V  E    T G ++   F E  E K +QPTF+  +P D+SPL++++  N   T RFE FI  +E AN F+ELND  DQ ERF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++ML T   +IRDV+LFP M+
  S:     6 QLDENKLIAERRGKLDHIRQACKANGHPNDFRRDSLAGDLQAEFGEKTKEELEELNHVVAIAGRVMAKRGPFLLIQEVSGKIQAYA-AKEVQKELKDKYQG-LDIGDIIGVKGALHKSGKGDLYVNMEEYVLLTKALRPLPEKFHGLTDQEMRYRQRYVDLIVNDDSRHAFIVRSKVVAAIRNFMVDKGFMEVETPMMHVIPGGASARPFVTHHNALDVDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEEMLSTVATSVLGSDKMPYGEHTVDFGGKYARMSMLDAIKQYNPDHAEIQALTYEGVKDRDLMVSIAKSVHVDVESFW-TCGQLLEEIFGETAEPKLMQPTFITEYPADISPLARRNDDNDFITDRFEFFIGGREVANGFSELNDAQDQDERFKAQVNAKESGDDEAMYYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPSMR 498
>gi|115352206|ref|YP_774045.1| lysyl-tRNA synthetase [Burkholderia ambifaria AMMD] >gi|172061073|ref|YP_001808725.1| lysyl-tRNA synthetase [Burkholderia ambifaria MC40-6] >gi|122322758|sp|Q0BDR2|SYK_BURCM Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|115282194|gb|ABI87711.1| lysyl-tRNA synthetase [Burkholderia ambifaria AMMD] >gi|171993590|gb|ACB64509.1| lysyl-tRNA synthetase [Burkholderia ambifaria MC40-6] (508 aa)
Score = 973, Expect = 3.1e-103, Identities = 206/475 (43%), Positives = 302/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEA--QELAKKHNVKFEKH---QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL+ L+E  Q          T    D  + FA         N   + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++  K+++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R R +  IR+FMD+ +++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L + F R+ +   I Q+    + + + + +A  +   K+  V   +     + +G +    FEE  E++  +PT++  +P++VSPL++     PG T+RFELF+  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALE+G+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    22 RREKLRALRE--QGVAYPNDFRPTHHAADLQATFADSDKAALEANPVEVSVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGAETYDAFKK-WDLGDIVAARGVLFRTNKGELSVQCKELRLLSKALRPLPDKFHGLADQEMRYRQRYVDLIVTPETRDTFRARTRTIASIRKFMDNADFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTATIQYQGRELDLAKPFHRLTITQAI-QKYAPQYTDGQLSDDAFLRTELKRFGVDVSQPAFLNAGIGALQLALFEETAESQLWEPTYIIDYPVEVSPLARASDTTPGITERFELFMTGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEHGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 505
>gi|59801795|ref|YP_208507.1| lysyl-tRNA synthetase [Neisseria gonorrhoeae FA 1090] >gi|75355660|sp|Q5F6U2|SYK_NEIG1 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|59718690|gb|AAW90095.1| putative lysyl-tRNA synthetase [Neisseria gonorrhoeae FA 1090] (503 aa)
Score = 973, Expect = 3.2e-103, Identities = 209/485 (43%), Positives = 316/485 (65%)
  Q:     2 ERKFNDQELI--RREKLKNL-QEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTL------GHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E + ++ ++I  RREKL N+ Q+ N  P + ++ S      D  +++ ++     +     +K+AGR++  RQ    +F  I+D  G  Q YLN K VS+ +L+ FN   DLGDIV   G+ F+T  GELT+ V  I+++SK+L+PLP+K  GL D+E + R RYVDLI N++S   F+ R +I++ +R FM  ++YLEVETP++HPI GGA A+PF+T HN L+   YLRIA EL LK+L+VGG ++V+EI R FRNEGM   HNPEFT +E Y A+ + E MM++ E++ +  ++++     +     E+ L   F R+ +++ IK+      +  +   +A+ L K    +  KH  +L      G +    FE   E K   PTF+  +P++VSPL++      G T+RFELF+  +E AN ++ELNDP DQ ERF++QV +K  G+DEA+  D D+I A+E+GLPPT G G+GIDR++ML T+  +IRDV+LFP M+
  S:    10 EPQLDENQIIALRREKLNNIRQQRNAYPNDFKRDSFA---ADLQAQYGEIGKEELDPQAVPVKIAGRMMLKRQMGKASFATIQDVTGQIQLYLNNKGVSQEVLDDFNH-WDLGDIVGAEGTLFKTNHGELTVRVSDIRLLSKSLRPLPDKHKGLSDQETKYRQRYVDLIANEESRNTFIKRSQIIQSVRNFMVGEHYLEVETPMMHPIPGGATAKPFVTHHNALDIPLYLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIRNASRTVNGTANITYNGKEVDLESPFERLTILEAIKKYN--PHYTDEQLNDAEWLKK----EIVKHGESLPPSPGIGSLQLALFEGCAEGKLWNPTFIVDYPVEVSPLARASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKSQVAQKDAGDDEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDLQTIRDVILFPQMR 501
>gi|120437254|ref|YP_862940.1| lysyl-tRNA synthetase [Gramella forsetii KT0803] >gi|117579404|emb|CAL67873.1| lysyl-tRNA synthetase [Gramella forsetii KT0803] (569 aa)
Score = 973, Expect = 3.2e-103, Identities = 216/487 (44%), Positives = 308/487 (63%)
  Q:     3 RKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV-----SKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP--------EKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           ++ ++QE IRR+KL  +++A  +PY  +      T       F + K      N+ +AGR+++ R     +F  ++D  G  Q Y N+ ++          + + K+LD+GD + I G  F+TQ GE+T+ VK   ++SKAL+PLP            G  D E R R RY DL VN    ++FV R ++   +R F + + Y EVETP+L  I GGA ARPF+T HN L+   YLRIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y AY++  +MM  TE L ++ A+++        GE++I     ++R+ M D I + TG D    KS +E  E AK  +++ +      G +I+  F E CE K IQPTF+  +P ++SPL K+   NP  T+RFEL +  KE ANA++ELNDP+DQ ERFE Q+K    G+DEA+ +D DF+ +LEYG+PPT+GLG+G+DR+IM  T K SI++VL FP MK +K
  S:     8 QQLSEQEQIRRDKLTAIRKAGINPYPADLFPVDHTTTGIKENFEEGK------NVVIAGRLMSRRIQGKASFAELQDSKGRIQVYFNRDEICTGEDKSKYNDLYKKLLDIGDFIGIEGELFKTQVGEMTVMVKDFHLLSKALRPLPLPKTDKEGNTHDGFNDPEQRYRQRYADLAVNPKVKEIFVKRTKLFNAMRNFFNEREYFEVETPILQSIPGGAAARPFVTHHNALDIPLYLRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMEFTEQLLEHCAEAVNGTTDATFGEHKINFKAPYKRLSMTDAIIEYTGFDI-TGKSEKELYEAAKGMDIEVDDTMGK-GKLIDEIFGEKCEGKFIQPTFITDYPKEMSPLCKEHRDNPELTERFELMVCGKEIANAYSELNDPLDQRERFEEQLKLSEKGDDEAMFIDNDFLRSLEYGMPPTSGLGIGMDRLIMFLTNKQSIQEVLFFPQMKPEK 504
>gi|86151307|ref|ZP_01069522.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153627|ref|ZP_01071830.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|157414696|ref|YP_001481952.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81116] >gi|172047060|sp|A8FKI8|SYK_CAMJ8 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|85841654|gb|EAQ58901.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842588|gb|EAQ59800.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|157385660|gb|ABV51975.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81116] (501 aa)
Score = 973, Expect = 3.4e-103, Identities = 218/484 (45%), Positives = 309/484 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R EK K L+    +PY    + + M++  F  KF+    +++  + + N  +AGR+  LR      F  I D   + Q Y NK  V + +     K L++GDIV + G PF T+ GE +L   ++K+ +KA+ PLPEK+HGL D E R R RYVD+I+N +  K F+ R +++ +IR F +++ +LEVETP++HPI GGANA+PF+TFHN+L    +LRIA EL LK+L+VGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N + +M LTE LF  +   L     ++     I  ++ F RI   D + +  G+D   ++  ++   L K     FE ++   LGH+    F+ + E K I PTFV   PI +SPLS++  ++    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     4 NILEQQRIEKAKELKNLGINPYP-HFLEKEMSLKTFKDKFSYILEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFNKDSVGEELYAILKKNLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVDMIMNAEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGVERFLRIAPELYLKRLVVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEELFALLLDKLNLGKTIEFDGKMIDFSKPFERITYKDALCKYGGLDRDLIEDKEKI--LTKLKVDGFEANEKLELGHLQAELFDNYVEEKLINPTFVIDFPISISPLSRRSDEDSQIAERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLK 494
>gi|113461151|ref|YP_719219.1| lysyl-tRNA synthetase [Haemophilus somnus 129PT] >gi|112823194|gb|ABI25283.1| lysyl-tRNA synthetase [Haemophilus somnus 129PT] (496 aa)
Score = 973, Expect = 3.4e-103, Identities = 212/481 (44%), Positives = 312/481 (64%)
  Q:     6 NDQELIRREKLKNLQEANQD--PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           N+ E +RR KL  ++E      P +  +    + + +   +  K++      N+ + GR++  R      F  ++D     Q Y+++  VS +  E F K  D+GDIV + G+ F+T   EL+++ KK ++++KAL+PLP+K+HGL D+E+R R RYVDLIVN+ S   F  R +IL  IR +M S  ++EVETP++  I GGA+ARPFIT HN L  + YLRI+ EL LK+LIVGGFD+V+EI R FRNEG+   HNPEFT ME+Y A+ +   +++LTENLF+ VA  +L  P+VK G  E   ++ F ++ M +  I     +   ++ S + A ++A+K  ++ EK    LG + +  FEE  E   IQPTF+  +P ++SPL++++  +P +T RFE FI  +E  N F+ELND  DQ ERF  QVK K  G+DEA+  D D++ ALEYG+PPTAGLG+GIDRM+ML T+  +IRDV+LFP +K
  S:     8 NEHE-VRRNKLAYIRETENFAFPNDFRRSHYAVELHNKYDQTTKIELEMLKVNVAVTGRIMTKRFMGKIAFITLKDGDSSIQLYISQDIVSNAEFEKFKK-WDIGDIVGVEGAVFKTNTDELSINTKKARLLTKALRPLPDKFHGLSDQEMRYRQRYVDLIVNEKSYNTFKLRSKILAEIRNYMVSNGFMEVETPMMQVIPGGASARPFITHHNALNSDLYLRISPELFLKRLIVGGFDRVFEINRNFRNEGISPRHNPEFTMMELYMAHADYRDLIKLTENLFRTVAINTLGSPIVKYGNIEFDFSKPFVQMTMREAIIHYGNDIQLDDIMSYESAVKIAQKLGIQVEKSWG-LGRLQSEIFEEVAEKHLIQPTFITEYPAEISPLARRNDIDPEYTDRFEFFIGAREIGNGFSELNDAEDQAERFRDQVKAKEAGDDEAMFYDDDYVIALEYGMPPTAGLGIGIDRMVMLLTDSHTIRDVILFPTLK 493
>gi|78047472|ref|YP_363647.1| lysyl-tRNA synthetase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|123771380|sp|Q3BUB6|SYK_XANC5 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|78035902|emb|CAJ23593.1| lysyl-tRNA synthetase heat inducible [Xanthomonas campestris pv. vesicatoria str. 85-10] (505 aa)
Score = 973, Expect = 3.4e-103, Identities = 198/448 (44%), Positives = 290/448 (64%)
  Q:    39 GDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVK-SNQEAQELAKKHNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           GD  ++FA   T        +   +++AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDIV + G   RT+ GEL++    +++++K+L+PLP+KWHGL D E R R RYVDLIV  ++ +VF+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M LTE + +  A++ L    V     +I L   FRR  M + ++        E+  ++   +E   +H  + +   K     G ++   FE   E   +QPTF+  HP++VSPL++     PG+T RFELFIN KE AN F+ELNDP DQ  RF+AQV+ K  G+DEA+  D D+I ALEYG+ PT GLG+GIDR++ML T  +SIRDVLLFP+M+
  S:    46 GDLQAEFADADTWTPEALEASGRTVRMAGRLMAKRVMGKASFAQIQDESGRVQLFLQGNVLGDAYTAF--KGWDVGDIVAVEGGLTRTKTGELSVKAGALRLLTKSLRPLPDKWHGLSDVEQRYRQRYVDLIVTPEAREVFIKRSKIIRAMRAWLDARRFLEVETPMMHYIPGGATAKPFTTHHNALDLDLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHQIMDLTEQVIRDTAQTVLGTTQVSWDGADIDLAPAFRRWRMDEAVRHHNP----EISAADCTDREALLRHCERLKIRVKPSYDWGKLLLEIFEATVEHTLVQPTFITDHPVEVSPLARSSDTEPGYTDRFELFINGKELANGFSELNDPEDQAARFQAQVQAKDGGDDEAMHFDADYIRALEYGMAPTGGLGIGIDRLVMLLTGSTSIRDVLLFPYMR 502
>gi|157960585|ref|YP_001500619.1| lysyl-tRNA synthetase [Shewanella pealeana ATCC 700345] >gi|189082970|sp|A8H0J7|SYK_SHEPA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|157845585|gb|ABV86084.1| lysyl-tRNA synthetase [Shewanella pealeana ATCC 700345] (501 aa)
Score = 972, Expect = 3.8e-103, Identities = 220/485 (45%), Positives = 314/485 (64%)
  Q:     2 ERKFNDQELI--RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIK-------LAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  ++ +LI  RR KL++++    AN  P   +   R     D  ++F     HNT   ++       +AGRV+A R  F VI+D  G  Q Y  K  V K + E F   LD+GDI+ + G    + KG+L +++++ ++++KAL+PLPEK+HGL D+E R R RYVDLIVN+DS + F+ R +++  IR FM  + ++EVETP++H I GGA+ARPF T HN L+   YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M LTE +   +A  L   P +  GE+ +     + R+ M+D IK+          + + EVK  +  ++LAK   +  EK   T G ++   F E  E + +QPTF+ G+P D+SPL++++  N   T RFE FI  +E AN F+ELND  DQ  RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP M+
  S:     3 EQTQDENKLIAERRAKLEHIRTNCPANGHPNNFD---RKHKAADIQAEFG----HNTKEELEGMGIERSIAGRVMAKRGPFLVIQDVSGRIQAYAGKD-VQKDLKEKFLG-LDIGDIIGVTGQLHLSGKGDLYVNMEEYQLLTKALRPLPEKFHGLTDQETRYRQRYVDLIVNEDSREAFIMRSKVVSAIRNFMVKKEFMEVETPMMHSIPGGASARPFETHHNALDIAMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADFNDLMDLTEEMLSSIATELCGSPQLPYGEHTVDFGGPYARLSMLDAIKKYNPDNATIQSMTYEEVKDVEFMRDLAKSLGMTVEKFW-TCGQLLEEIFGETAETQLMQPTFITGYPADISPLARRNDDNHFITDRFEFFIGGREVANGFSELNDAEDQDSRFKAQVDAKDAGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLFTNTHTIRDVILFPAMR 497
>gi|17545747|ref|NP_519149.1| lysyl-tRNA synthetase [Ralstonia solanacearum GMI1000] >gi|39932228|sp|Q8Y0L5|SYK_RALSO Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|17428041|emb|CAD14730.1| putative lysyl-trna synthetase (lysine--trna ligase) (lysrs) protein [Ralstonia solanacearum] (510 aa)
Score = 972, Expect = 4.2e-103, Identities = 207/475 (43%), Positives = 303/475 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT---HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETG--VDFWEVKSNQEAQELAKKHNVKFEKHQ---STLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RREKL  L++  Q          T    D ++++++         N  + LAGR++  R     +F  ++D  G  QFY+ + +V + +   F K  DLGDIV   G  FRT KGEL++ V++++++SK+L+PLP+K+HGL D+E++ R RYVDLIV+ ++   F  R + +  +R  M    ++EVETP+LHPI GGA A+PFIT HN L+   +LRIA EL LK+LIVGGF++VYEI R FRNEG+   HNPEFT ME YAAY +  ++M  TENL +  A  +     +     E+ L++ F R+ +   I++      D     +N    EL KK  +     Q   + +G +  + FEE  E++  +PTF+  +P++VSPL++     PG T+RFELFI  +E AN F+ELNDP DQ ERF  QV++K  G++EA+  D D+I ALEYG+PPT G G+GIDR++ML T+  +IRDV+LFPH++
  S:    24 RREKLAALRQ--QGVAYPNDFCPTHHAADLHTRYSETDQPALEAANVEVALAGRMMLKRVMGKASFATVQDGSGQIQFYITRDRVGEDVYAAF-KHWDLGDIVAARGVLFRTNKGELSVQVQELRLLSKSLRPLPDKFHGLADQEMKYRQRYVDLIVSPETRNTFRARTKAIASLRHHMSDAGFMEVETPMLHPIPGGAAAKPFITHHNALDMQMFLRIAPELYLKRLIVGGFERVYEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDYTENLIRQAAIDATGSAALNYQGRELDLSKPFHRLTICQAIQKYAPQYTDAQLADANFLRAEL-KKFKIDTNAPQFLNAGVGTLQLVLFEETAESQLWEPTFIVDYPVEVSPLARGSDTLPGITERFELFITGREIANGFSELNDPEDQAERFRKQVEQKDAGDEEAMFYDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPNIRDVILFPHLR 507
>gi|186476208|ref|YP_001857678.1| lysyl-tRNA synthetase [Burkholderia phymatum STM815] >gi|184192667|gb|ACC70632.1| lysyl-tRNA synthetase [Burkholderia phymatum STM815] (512 aa)
Score = 972, Expect = 4.5e-103, Identities = 211/483 (43%), Positives = 307/483 (63%)
  Q:     4 KFNDQELI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA---KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEA--QELAKKHNVKFEKH---QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + +D ++I  RREKL+ L+E  Q          T    D  +++A   K        ++ LAGR++  R     +F  +RD  G  QF++    V ++  E F K  DLGDIV   G  FRT KGEL++   +++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++ K FV R + +  IR+FM   +++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME YAAY + +++M  TE L +  A  +L    +     E+ L++ F R+ +   I Q+    + + +    A  +   KK  V   +     + +G +    FEE  E++  +PTF+  +PI+VSPL++      G T+RFELFI  +E AN F+ELNDP DQ  RF+ QV +K  G++EA+  D D+I ALEYG+PP  G G+GIDR++ML T+  SIRDV+LFPH++
  S:    16 ELDDNQIIAERREKLRALRE--QGVAYPNDFRPTHHAADLQTEYADADKDALETKALHVALAGRMMLKRVMGKASFATVRDGSGQIQFFITPADVGEATYEAFKK-WDLGDIVAAKGVLFRTNKGELSVRCTELRLLSKALRPLPDKFHGLADQEMRYRQRYVDLIVTDEARKTFVARTKAVSSIRKFMAEADFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYKWLMDFTEQLIRQAAVDALGNAAITYQGRELDLSKPFHRLTITQAI-QKYAPQYSDAQLADGAFLRTELKKFGVDATQPAFLNAGIGALQLALFEETAESQLWEPTFIIDYPIEVSPLARASDSVDGITERFELFITGREIANGFSELNDPEDQAARFKKQVDQKDAGDEEAMYYDADYIRALEYGMPPAGGCGIGIDRLVMLLTDSPSIRDVILFPHLR 509
>gi|145618518|ref|ZP_01774576.1| lysyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|144945152|gb|EDJ80219.1| lysyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|197086588|gb|ACH37859.1| lysyl-tRNA synthetase [Geobacter bemidjiensis Bem] (492 aa)
Score = 972, Expect = 4.5e-103, Identities = 214/479 (44%), Positives = 300/479 (62%)
  Q:    10 LIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-KLKTHNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           L RR K+  L EA  +PY         T  D  + +  K        +  +AGR++ +R++FG      ++D  G  Q Y+ K  + + +   F    D+GDI+   G+PFRT+ GEL+L V ++++++K+L PLPEK+HGL D E R R RYVDLIV+ D  +VF  R R++++IR FM   ++LEVETP++HPI GGA A+PF T HN L+   +LRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY   E +M  TE L  +VA+ L   +    G   I   + +RR  + + I +   +D   ++    A   A+K  ++  +     G +I   FEE  E K IQPTF+  +P +VSPLS+K  ++P +  RFE F   +E ANAF+ELNDP DQ ERF AQV  K  G++EA  MD D+I ALEYGLPPTAG G+GIDR++ML T+  SIRDV+LFP ++ +
  S:     9 LQRRRKVDALWEAGINPYP-NDYRPQHTSADVRAAYGDKEVIEEEPQSFVVAGRIL-MRRSFGKAAFVQVQDRKGRMQLYMKKDTLGEELFAEFEN-YDIGDIIGATGTPFRTKTGELSLAVSELRLLTKSLLPLPEKFHGLTDVETRYRQRYVDLIVSPDVREVFYKRSRVIQLIRDFMTKNDFLEVETPMMHPIPGGATAKPFATHHNALDMELFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMEFYQAYATFEDLMNYTEELLCHVAQELLGTLDFSYGGEPISFQRPWRRFTVKEAILEYGDIDAKSLEDRDLAYAYAQKIGLELPE-DVGYGKLITEIFEEVAEIKLIQPTFITNYPTEVSPLSRKSDQDPEYVDRFEFFCAGREMANAFSELNDPRDQKERFLAQVAAKDKGDEEAHYMDEDYIRALEYGLPPTAGEGIGIDRLVMLLTDSPSIRDVILFPQLRKE 490
>gi|87123221|ref|ZP_01079072.1| Lysyl-tRNA synthetase, class-2:tRNA synthetases, class II [Synechococcus sp. RS9917] >gi|86168941|gb|EAQ70197.1| Lysyl-tRNA synthetase, class-2:tRNA synthetases, class II [Synechococcus sp. RS9917] (501 aa)
Score = 971, Expect = 4.7e-103, Identities = 205/475 (43%), Positives = 299/475 (62%)
  Q:    12 RREKLKNLQEANQDPYEI--EKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDF-----WEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK   L+E  ++PY +  E   RT  +   ++  A  +       + +AGRV+  R      F  + D  G  Q +L K  +  +  +    ++D GD + + G   RT +GEL++ V + ++++KAL+PLP+KWHGL D E R R RY+DLIV+  S + F  R  ++  IR+++D +++LE+ETPVL    GGA ARPFIT HNTL+   YLRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFTS+EVY AY +   MM LTE L   V + +     +      + LT  +RR  M + +++ TG+DF             A        ++      ++G ++N  FE+  EA  IQPTFV  +PI++SPL++K    PG  +RFELFI  +E ANAF+EL DP+DQ +R E Q   ++ G+DEA  +D DF++ALE G+PPT GLG+GIDR++ML T+ +SIRDV+ FP ++
  S:     8 RLEKANALRELGREPYALRFEPSHRTAQLQADHADLANGEERQLE--VAVAGRVMTRRVMGKLAFFTLADASGPIQLFLEKASLGDAFAQ-LTSLVDAGDWIGVRGILRRTDRGELSVKVAEWQMLTKALQPLPDKWHGLADVEKRYRQRYLDLIVSPQSRETFRRRALMVSAIRRWLDDRDFLEIETPVLQAEAGGAEARPFITHHNTLDLPLYLRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEVYQAYADYVDMMNLTEQLIASVTEQICGTTRITYQGTAVDLTPPWRRATMHELVQEATGLDFTAFTGPGAAGRDAAAAAMAAAGLEVPDAADSVGRLLNEAFEQRVEATLIQPTFVIDYPIEISPLARKHRSKPGLVERFELFIVGRETANAFSELIDPLDQRQRLEDQQARRAAGDDEAHGVDEDFLQALEVGMPPTGGLGIGIDRLVMLLTDSASIRDVIAFPLLR 491
>gi|192359674|ref|YP_001982939.1| lysyl-tRNA synthetase [Cellvibrio japonicus Ueda107] >gi|190685839|gb|ACE83517.1| lysyl-tRNA synthetase [Cellvibrio japonicus Ueda107] (532 aa)
Score = 971, Expect = 4.8e-103, Identities = 206/475 (43%), Positives = 306/475 (64%)
  Q:    12 RREKLKNLQE-ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR+KL  ++E  N  P +  +  +++ +     +  K +    ++ + +AGR++A R  F V++D  G  Q Y +K   ++ +++    V DLGDIV + G+  ++ KG+L +++++ ++++K+L+PLP+K+HGL D+E+R R RYVDLIVN +    F  R + +  IR +M  + ++EVETP+LH I GGA+ARPF+T HN L+ + +LRIA EL LK+L+VGGF++V+EI R FRNEG+ + HNPEFT ME Y AY + + +M LTE+L + +   +     +K  ++E    + F R+ + D I      V   ++ S   A ++A++  +K  K  + LG I    FEE  E K  QPTF+  +P +VSPL+++   NP  T RFE FI  +E AN F+ELND  DQ ERF  QVK K  G+DEA+  D DF+ ALEYGLPPTAG G+GIDR+IMLF    SIRDVLLFPHM+
  S:    56 RRQKLAAIREKGNAFPNDFRRTDKSVDLQAAFGEKTKEELEALDHKVSVAGRLMAKRGPFMVLQDGDGTIQLYADK--AAQEVIKENWGVWDLGDIVGVTGALHKSGKGDLYVNLEQFQLLTKSLRPLPDKYHGLSDQEIRYRQRYVDLIVNPEVRDTFRLRSQCISFIRNYMSGRGFMEVETPMLHVIPGGASARPFVTHHNALDMDMFLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSTRHNPEFTMMEFYQAYADYKDLMDLTEDLLRKLCIDVTGGTTLKYQDSEYDFGKPFVRLSVFDSILHYNPDVTAEQISSVAGATQVAERLGLKV-KPGTPLGKIQTEIFEETVEHKLDQPTFITEYPTEVSPLARRSDTNPAVTDRFEFFIGGRELANGFSELNDAEDQAERFLEQVKAKDAGDDEAMYYDADFVRALEYGLPPTAGEGIGIDRLIMLFANAPSIRDVLLFPHMR 530
>gi|167622750|ref|YP_001673044.1| lysyl-tRNA synthetase [Shewanella halifaxensis HAW-EB4] >gi|189082969|sp|B0TTP2|SYK_SHEHH Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|167352772|gb|ABZ75385.1| lysyl-tRNA synthetase [Shewanella halifaxensis HAW-EB4] (501 aa)
Score = 971, Expect = 4.8e-103, Identities = 219/485 (45%), Positives = 313/485 (64%)
  Q:     2 ERKFNDQELI--RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIK-------LAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           E+  ++ +LI  RR KL++++    AN  P   +   R     D  ++F     HNT   ++       +AGRV+A R  F VI+D  G  Q Y  K  V K + E F   LD+GDI+ + G    + KG+L +++++ ++++KAL+PLPEK+HGL D+E R R RYVDLIVN+ S + F+ R +++  IR FM  + ++EVETP++H I GGA+ARPF T HN L+   YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M LTE +   +A  L   P +  GE+ +     + R+ M+D IK+          + + EVK  +  ++LAK   +  EK   T G ++   F E  E + +QPTF+ G+P D+SPL++++  N   T RFE FI  +E AN F+ELND  DQ  RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP M+
  S:     3 EQTQDENKLIAERRAKLEHIRTNCPANGHPNNFD---RKHKAADIQAEFG----HNTKEELEGMGIERSIAGRVMAKRGPFLVIQDVSGRIQAYAGKD-VQKDLKEKFQG-LDIGDIIGVTGQLHLSGKGDLYVNMEEYQLLTKALRPLPEKFHGLTDQETRYRQRYVDLIVNEQSREAFIMRSKVVSAIRNFMVKKEFMEVETPMMHSIPGGASARPFATHHNALDIAMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADFNDLMDLTEEMLSSIATELCGSPQLPYGEHTVDFGGPYARLSMLDAIKKYNPDNATIQSMTYEEVKDVEFMRDLAKSLGMTVEKFW-TCGQLLEEIFGETAETQLMQPTFITGYPADISPLARRNDDNHFITDRFEFFIGGREVANGFSELNDAEDQDRRFKAQVDAKDAGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLFTNTHTIRDVILFPAMR 497
>gi|191163892|ref|ZP_03025763.1| lysyl-tRNA synthetase [Geobacter sp. M21] >gi|190995057|gb|EDV70514.1| lysyl-tRNA synthetase [Geobacter sp. M21] (492 aa)
Score = 971, Expect = 6.0e-103, Identities = 213/479 (44%), Positives = 300/479 (62%)
  Q:    10 LIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA-KLKTHNTNNNIKLAGRVVALRQTFG-----VIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           L RR K+  L EA  +PY         T  D  + +  K        +  +AGR++ +R++FG      ++D  G  Q Y+ K  + + +   F    D+GDI+   G+PFRT+ GEL+L V ++++++K+L PLPEK+HGL D E R R RYVDLIV+ D  +VF  R R++++IR FM   ++LEVETP++HPI GGA A+PF T HN L+   +LRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY   E +M  TE L  +VA+ L   +    G   I   + +RR  + + I +   +D   ++    A   ++K  ++  +     G +I   FEE  E K IQPTF+  +P +VSPLS+K  ++P +  RFE F   +E ANAF+ELNDP DQ ERF AQV  K  G++EA  MD D+I ALEYGLPPTAG G+GIDR++ML T+  SIRDV+LFP ++ +
  S:     9 LQRRRKVDALWEAGINPYP-NDYRPQHTSADLRAAYGDKEVIEAEPQSFVVAGRIL-MRRSFGKAAFVQVQDRKGRMQLYMKKDTLGEELFAEFEN-YDIGDIIGATGTPFRTKTGELSLAVTELRLLTKSLLPLPEKFHGLTDVETRYRQRYVDLIVSPDVREVFYKRSRVIQLIRDFMTKNDFLEVETPMMHPIPGGATAKPFATHHNALDMELFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMEFYQAYATFEDLMNYTEELLCHVAQELLGTLDFSYGGEPISFQRPWRRFTVKEAILEYGDIDAKSLEDRDLAYAYSQKIGLELPE-DVGYGKLITEIFEEVAEVKLIQPTFITNYPTEVSPLSRKSDQDPEYVDRFEFFCAGREMANAFSELNDPRDQKERFLAQVAAKDKGDEEAHYMDEDYIRALEYGLPPTAGEGIGIDRLVMLLTDSPSIRDVILFPQLRKE 490
>gi|152995161|ref|YP_001339996.1| lysyl-tRNA synthetase [Marinomonas sp. MWYL1] >gi|150836085|gb|ABR70061.1| lysyl-tRNA synthetase [Marinomonas sp. MWYL1] (500 aa)
Score = 970, Expect = 6.3e-103, Identities = 205/433 (47%), Positives = 290/433 (66%)
  Q:    54 NNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFI----KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ++ + +AGR++  R  F +++D  G  Q Y+N+K +S  +L    K  DLGDI+ I G   ++ KG+L +D+ + ++++K+L+PLP+K HGL D E+R R RYVDLIVN++S + F  R +I+  IR+F++ + ++EVETP+L  I GGA+ARPFIT HN ++ + YLRIA EL LK+L+VGGF++V+EI R FRNEG  + HNPEFT +E Y AY + + +M LTE++ + VA K L    V    +E      F R+ M+D I     + T  D   +++ + A  +AKK  +   K    LG +    FEE  E K  QPTF+  +P +VSPL++++  N   T RFE F+  +E AN F+ELNDP DQ ERF  QV EK  G+DEA+  D D+I ALEYGLPPTAG G+GIDR++MLFT+  SIRDVLLFPHMK
  S:    65 DHKVSIAGRIIRNRGAFMLLQDMTGQIQAYVNRKVLSPELLAD-QKTWDLGDIIGISGPVHKSGKGDLYIDMHEAQLLTKSLRPLPDKHHGLSDMEMRYRQRYVDLIVNEESRETFQMRSKIISTIRRFLEDRRFMEVETPMLQTIPGGASARPFITHHNAMDMSMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGTSTRHNPEFTMIEFYQAYADYKDLMDLTEDMLRTVAEKVLGTTTVTYQGSEYDFGAPFVRMSMLDSILHYNPELTAAD---LETLEGATAVAKKLKIDV-KPIWGLGKLWTEIFEETAEHKLDQPTFITEYPAEVSPLARRNDDNDFITDRFEFFVGGREIANGFSELNDPEDQAERFMRQVAEKDAGDDEAMHYDADYINALEYGLPPTAGEGIGIDRLVMLFTDAPSIRDVLLFPHMK 497
>gi|40063229|gb|AAR38056.1| lysyl-tRNA synthetase [uncultured marine bacterium 577] (501 aa)
Score = 970, Expect = 7.1e-103, Identities = 213/475 (44%), Positives = 304/475 (64%)
  Q:    12 RREKLKNLQEANQD-PYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFE-KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL  L+EA    P +     R     D + K+          +   +++AGR++  R     +F  I+D  G  Q Y++     +S    F K  DLGDI+ + G+ F T+ GELT+ VK +++++K+L+PLPEK+HGL D+E + R RY+DLI N+D+ KVF+ R RI++ IR F + + YLEVETP++HPI GGA ARPFIT HN L  +FYLRIA EL LK+L+V G +KV+EI R FRNEG+ + HNPEFT +E Y AY++  Y+M LTE L + +A K L    +     +I L+  F R+ +   I Q+   +  + + N  A  + K   +    K +  +G +    F+E  E   + PTF+  +P +VSPL++++ KNPG T RFEL+I  +E AN F+ELNDP DQ  RF+ QV+ K  G+ EA+  D D+I ALE+GLPPTAG G+GIDR+IML T+  SIRDV+LFPH++
  S:    19 RRAKLATLREAGAAFPNDFR---RNHLASDLHKKYGDQSNDTLEKDPISVEVAGRMILKRVMGKASFATIQDMSGHIQLYISNDITGESAHAAF-KHFDLGDILGVHGTLFITKSGELTIRVKSLRLLTKSLRPLPEKFHGLTDQEQKYRQRYLDLISNEDTRKVFLTRSRIIQSIRTFFEERGYLEVETPMMHPIPGGAAARPFITHHNALNMDFYLRIAPELYLKRLVVSGMEKVFEINRSFRNEGISTRHNPEFTMLEFYEAYQDHIYLMNLTETLIRELAIKVLGTTEISYQGYKINLSNPFLRLSITQAI-QKFHPEHTDAQLNDRAYLIKKLEALNISYKPEDGIGKLQLSLFDETTEHLLMDPTFIVDYPSEVSPLARRNDKNPGVTDRFELYITGREMANGFSELNDPEDQAARFQEQVRAKESGDKEAMHYDGDYIRALEHGLPPTAGEGIGIDRLIMLLTDSPSIRDVILFPHLR 498
>gi|15791768|ref|NP_281591.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|88597300|ref|ZP_01100535.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612659|ref|YP_001000112.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005070|ref|ZP_02270828.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|166229804|sp|A1VYC1|SYK_CAMJJ Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|8928543|sp|P41258|SYK_CAMJE Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|87250122|gb|EAQ73080.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190361|gb|EAQ94335.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359765|emb|CAL34551.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] (501 aa)
Score = 970, Expect = 7.2e-103, Identities = 218/484 (45%), Positives = 309/484 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R EK K L+    +PY    + + M++  F  KF+    +++  + + N  +AGR+  LR      F  I D   + Q Y +K  V + +     K L++GDIV + G PF T+ GE +L   ++K+ +KA+ PLPEK+HGL D E R R RYVD+I+N +  K F+ R +++ +IR F +++ +LEVETP++HPI GGANA+PF+TFHN+L    +LRIA EL LK+LIVGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N + +M LTE LF  +   L     ++     I  ++ F RI   D + +  G+D   ++  ++   L K     FE ++   LGH+    F+ + E K I PTFV   PI +SPLS++  ++    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     4 NILEQQRIEKAKELKNLGINPYP-HFLEKEMSLKTFKDKFSYILEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKKNLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVDMIMNVEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGVERFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEELFALLLDKLNLGKTIEFDGKMINFSKPFERITYKDALCKYGGLDRDLIEDKEKI--LTKLKADGFEANEKLELGHLQAELFDNYVEEKLINPTFVIDFPISISPLSRRSDEDSQIAERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLK 494
>gi|86132072|ref|ZP_01050668.1| lysyl-tRNA synthetase [Cellulophaga sp. MED134] >gi|85817406|gb|EAQ38586.1| lysyl-tRNA synthetase [Dokdonia donghaensis MED134] (564 aa)
Score = 970, Expect = 7.4e-103, Identities = 216/486 (44%), Positives = 303/486 (62%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV----SKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPE-------KWH-GLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAV-EMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE +RR+KL  L+E   +PY   +   T       + + +         + +AGR+++ R     +F  I+D  G  Q Y N+ ++     KS   E + K+LD+GD + I G  F T+ GE+T+ VK   ++SKALKPLP+       K H    D E+R R RYVDL VN    +VFV R ++   +R F +   Y EVETPVL PI GGA ARPFIT HN+L+   Y+RIA EL LK+LIVGGF+ VYE  + FRNEGMD THNPEFT+ME+Y AY++  +MM   E L +  A ++        GE+E+     + R+ M D IK  TG D    K+  E +  A+   ++ +      G +I+  F E CE   IQPTF+  +P ++SPL K+   NP  T+RFEL +  KE ANA++ELNDPIDQ ERFEAQ++    G+DEA   +D DF+ +LEYG+PPT+G+G+G+DR+IM  T   SI++VL FP MK +K
  S:     2 QLSEQEQVRRQKLSRLREIGINPYPAAQYHVTHASAKAKNDYTE------GEKVVMAGRLMSRRIQGNASFAEIQDGEGRIQVYFNRDEICTGEDKSKYNEVYKKLLDIGDFIGIEGEMFTTKVGEITVLVKDFTLLSKALKPLPQPRTDDEGKVHDAFTDPEMRYRQRYVDLTVNPHVKEVFVKRTKLFNAMRNFFNDAGYFEVETPVLQPIAGGAAARPFITHHNSLDMPLYMRIANELYLKRLIVGGFEGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMDFCEQLLETCAIAVNGTTEATFGEHEVDFKAPYARVTMADSIKHFTGFDI-NGKTEDEIRAAAEGMGIEVDDTMGK-GKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKEHRDNPELTERFELMVCGKEIANAYSELNDPIDQRERFEAQLELAKRGDDEATASIDYDFLRSLEYGMPPTSGMGIGMDRLIMFLTNNQSIQEVLFFPQMKPEK 498
>gi|144208|gb|AAA23029.1| transfer RNA-Lys synthetase (501 aa)
Score = 970, Expect = 7.5e-103, Identities = 218/484 (45%), Positives = 310/484 (64%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R EK K L++   +PY    + + M++  F  KF+    +++  + + N  +AGR+  LR      F  I D   + Q Y +K  V + +     K L++GDIV + G PF T+ GE +L   ++K+ +KA+ PLPEK+HGL D E R R RYVD+I+N +  K F+ R +++ +IR F +++ +LEVETP++HPI GGANA+PF+TFHN+L    +LRIA EL LK+LIVGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N + +M LTE LF  +   L     ++     I  ++ F RI   D + +  G+D   ++  ++   L K     FE ++   LGH+    F+ + E K I PTFV   PI +SPLS++  ++    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     4 NILEQQRIEKAKELKKLGINPYP-HFLEKEMSLKTFKDKFSYILEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKKNLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVDMIMNVEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGVERFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEELFALLLDKLNLGKTIEFDGKMINFSKPFERITYKDALCKYGGLDRDLIEDKEKI--LTKLKADGFEANEKLELGHLQAELFDNYVEEKLINPTFVIDFPISISPLSRRSDEDSQIAERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLK 494
>gi|163726670|ref|ZP_02134179.1| lysyl-tRNA synthetase [Desulfatibacillum alkenivorans AK-01] >gi|161400019|gb|EDQ24278.1| lysyl-tRNA synthetase [Desulfatibacillum alkenivorans AK-01] (504 aa)
Score = 970, Expect = 7.7e-103, Identities = 208/476 (43%), Positives = 308/476 (64%)
  Q:    11 IRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN--IKLAGRVVAL----RQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGE-NEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           IRREK++ L+E   +PY    V    TI +  +   +     T+      +AGR++A+    +  F   +D  G  Q Y+ K +V +   + F K L +GD V + G+ F+T+ GE TL  +++ ++ K+L+PLPEK++ L+D E R R RY+DLI+N+++ + F+ R +I++ +R+F D +++LEVETP++ PI GGA A PF+T HN L+   YLRIA EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E Y AY     +M LTE +F++VAK +      M +  EI     ++RI M + ++   G D   ++   +    A+  NV  +K   T G I+   F+   E + +QPTF++ +P++VSPLS++  K P  T+RFELFI  KE AN F+ELNDP DQ  RF  QV +K  G++EA  MD D++EALEYG+PPTAG GVGIDR+ ML T+ +SIR+V+LFPHM+
  S:     8 IRREKMEALREEGIEPYPSGYVVEN-TISEILAVTEEAPDSLTDEGPVFGVAGRLMAINKFGKSAFVRFKDRTGQMQAYIRKDQVDEQAFKVF-KALHVGDFVGLKGTIFKTKTGEWTLAARELTLLCKSLRPLPEKYNKLKDPEKRYRQRYLDLIMNEETRETFIRRSKIVRAMRRFFDQRDFLEVETPMMQPIPGGAEACPFVTHHNALDMALYLRIAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLEFYWAYATYHDLMELTEEMFQHVAKEVLGSTTFMYQGQEISFEGPWKRISMFNALQTIGGADKEVLEDRDKLIAFAESKNVPIDKKART-GKIMTKLFDALVEPELVQPTFIHSYPVEVSPLSRRSQKEPDLTERFELFIAGKEIANGFSELNDPDDQRGRFLQQVADKEAGDEEAHWMDEDYVEALEYGMPPTAGQGVGIDRLAMLLTDAASIREVILFPHMR 487
>gi|86149179|ref|ZP_01067411.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85840537|gb|EAQ57794.1| lysyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni CF93-6] (501 aa)
Score = 969, Expect = 8.2e-103, Identities = 218/484 (45%), Positives = 309/484 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R EK K L+    +PY    + + M++  F  KF+    +++  + + N  +AGR+  LR      F  I D   + Q Y +K  V + +     K L++GDIV + G PF T+ GE +L   ++K+ +KA+ PLPEK+HGL D E R R RYVD+I+N +  K F+ R +++ +IR F +++ +LEVETP++HPI GGANA+PF+TFHN+L    +LRIA EL LK+LIVGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N + +M LTE LF  +   L     ++     I  ++ F RI   D + +  G+D   ++  ++   L K     FE ++   LGH+    F+ + E K I PTFV   PI +SPLS++  ++    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     4 NILEQQRIEKAKELKNLGINPYP-HFLEKEMSLKTFKDKFSYILEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKKNLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVDMIMNVEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGIERFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEELFALLLDKLNLGKTIEFDGKMINFSKPFERITYKDALCKYGGLDRDLIEDKEKI--LTKLKADGFEANEKLELGHLQAELFDNYVEEKLINPTFVIDFPISISPLSRRSDEDSQIAERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLK 494
>gi|57241808|ref|ZP_00369752.1| lysyl-tRNA synthetase [Campylobacter lari RM2100] >gi|57017448|gb|EAL54226.1| lysyl-tRNA synthetase [Campylobacter lari RM2100] (500 aa)
Score = 969, Expect = 8.5e-103, Identities = 218/476 (45%), Positives = 303/476 (63%)
  Q:    14 EKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLK----THNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +K + L+E   +PY    + + M+I ++ +KF  +K      + N +  LAGR+  LR      F  I D   + Q Y N+  + +       K L++GDIV + G PF T+ GE +L V++I+I +KA+ PLPEK+HGL D E R R RY+D+I+N +  K F+ R +I+  IR F D++ +LEVETP++HPI GGANA+PF+T+HN L    +LRIA EL LK+LIVGGF+ VYEI R FRNEGMD THNPEFT++E Y AY N   +M LTE LF  +   L     ++  E  I  ++ F RI   D +K+  G+D  E+ +N+E      K +      +  LGH+    F+ + E K I PTFV   PI +SPLS++  K+    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL Y + PTAG G+GIDR++ML   K SIRDV+LFP M+  K
  S:    12 QKAQELKELGINPYP-HFLKKEMSISEYKAKFTYIKDMENQRDENAHGVLAGRLKLLRIAGKSVFANIEDEQDNLQIYFNQNILGEEYFAILKKYLEVGDIVLVKGFPFMTKTGEFSLHVEQIQIATKAIVPLPEKYHGLTDIEQRYRKRYLDMIMNSEVRKDFILRSKIVSYIRSFFDNKGFLEVETPMMHPIAGGANAKPFVTYHNALGVERFLRIAPELYLKRLIVGGFEAVYEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYHDLMDLTEELFAMLLDKLNLDKKLEFDEKIIDFSKSFERITYKDALKKYGGLDD-ELINNKELILKKLKKDGFEANEKLELGHLQAELFDNYVEDKLINPTFVIDFPISISPLSRRSDKDADIAERFELFIAGREIANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYAMAPTAGQGIGIDRLVMLLINKKSIRDVVLFPAMRPLK 494
>gi|156932659|ref|YP_001436575.1| lysyl-tRNA synthetase [Enterobacter sakazakii ATCC BAA-894] >gi|166229806|sp|A7MR65|SYK_ENTS8 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|156530913|gb|ABU75739.1| hypothetical protein ESA_00442 [Enterobacter sakazakii ATCC BAA-894] (505 aa)
Score = 969, Expect = 8.8e-103, Identities = 212/485 (43%), Positives = 314/485 (64%)
  Q:     5 FNDQELIRREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            N++   RREKL  L+E   A  + +  +  S  +   DF+ K  + +    N  + +AGR++  R     +F  ++D  G  Q Y+ +  + + +     K  DLGDI+   G  F+T+ GEL++   ++++++KAL+PLP+K+HGL+D+E R R RY+DLI N +S K F  R +IL  IRQFM  + ++EVETP++  I GGA+ARPF+T HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY + + ++ LTE+LF+ +A+  L    V  GE      + F ++ M + IK+     D  ++   ++A+ +A+   +K EK    LG ++   FEE  EA  IQPTF+  +P +VSPL++++ +NP  T RFE FI  +E  N F+ELND  DQ +RF+ QV  K  G+DEA+  D D++ ALE+GLPPTAGLG+GIDRM+MLFT   +IRDV+LFP M+  K
  S:    15 LNNELKTRREKLAALREHGVAFPNDFRRDHTSDQLH-ADFDGKENE-ELEALNIEVCVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGARGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLIANDESRKTFKVRSQILAGIRQFMVGRGFMEVETPMMQVIPGGASARPFVTHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDVLGTTQVPYGEETFDFGKPFEKLTMREAIKKYRPETDLADLDDFEKAKGIAQAVGIKVEKSWG-LGRVVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDENPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK 505
>gi|167730612|emb|CAO81524.1| lysyl-tRNA synthetase [Candidatus Cloacamonas acidaminovorans] (498 aa)
Score = 969, Expect = 9.2e-103, Identities = 220/486 (45%), Positives = 303/486 (62%)
  Q:     1 MERKFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQT----FGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPE-----------KWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           M  K N    +R+EKL  ++    DPY I K  RT  I D      K +       + + GR+ A+R+     FG + D  G  Q Y+ +  + +   E F K+ D GD ++  G  F TQ GE +L    IK++SK ++PLP            ++    D ELR R RY+DL++N +  KVF  R +I+  IR FMDS+ Y+EVETP+L P+ GGANARPFIT HNTL+ + YLRIATEL LK+LIVGGF+KVYE+G+ FRNEGMD THNPEFT +E Y AY ++E MM + E L K++A   + K       +++ L+ +++R  + D + +  G +   + S +E   + K   +      S  G +I L FE F E   IQPTFV   P +VSPL+K   +NP    RFELFI   E+ANAF+ELNDP++Q  R E Q K ++LG D+A  +D DF+EALEYG+PP  G G+GIDR++ML TE  SI++V+LFP MK
  S:     1 MSSKPNQFIQLRKEKLAKIKALGIDPYPI-KSYRTHYISDLLKD--KEEQLQKAEEVTITGRLTAMRRQGKIGFGDLEDISGKIQLYVAQNLIGEENYELF-KLCDPGDFIQATGKTFFTQTGEYSLKCNNIKLLSKNIRPLPAVKEKIVDGKKIRYDEFSDIELRYRKRYLDLLLNPEHRKVFETRAKIITAIRNFMDSRGYVEVETPILQPLYGGANARPFITHHNTLDMDLYLRIATELYLKRLIVGGFEKVYELGKDFRNEGMDRTHNPEFTMIEFYEAYSDLEGMMDIAEELIKHLALDIIGKDTFFYHNHQVCLSGEWKRASLPDLVSEFVGQNVMNI-SFEELSTICKNKELVIPP-GSEKGKLIALLFENFVEETLIQPTFVRDFPKEVSPLAKAKPENPFVADRFELFIAGGEFANAFSELNDPLEQRVRLEEQAKLRALGIDDANVVDEDFLEALEYGMPPMGGQGIGIDRLVMLLTENDSIKEVILFPQMK 496
>gi|90579832|ref|ZP_01235640.1| lysyl-tRNA synthetase [Vibrio angustum S14] >gi|90438717|gb|EAS63900.1| lysyl-tRNA synthetase [Vibrio angustum S14] (501 aa)
Score = 969, Expect = 1.0e-102, Identities = 208/475 (43%), Positives = 314/475 (66%)
  Q:    12 RREKLKNLQE---ANQDP--YEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL+++++   AN  P  +   K+++ + I DF +K       NT     +AGR++A R  F V++D  G  Q Y NK+   +   +Y +  LD+GDI+ + G   R+ +GEL +++ + ++ +KAL+PLPEK+HGL D+E R R RYVDLI+N++S    + R +++  IRQFM    ++EVETP++HPI GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   ++  TE+L   VAK L     +  GE+ I  +  + R+ M++ I+           + + ++K+ +   ++A +  V+ E    T G ++   F E  E K +QPTF+ G+P D+SPL+++  ++P  T RFE F+  +E AN F+ELND  DQ  RF+AQ+  K  G+DEA++ D D+I ALE+GLPPTAG G+GIDR++MLFT+  +IRDV+LFP ++
  S:    16 RRAKLEHIRKESKANGHPNTFRRLKLAKELII-DFENKSKDDLICNTYTT-SVAGRIMAKRGPFMVLQDVSGRIQVYANKQVQEELKAKYHS--LDIGDIIGVKGQVHRSDRGELYVNMDEYELQTKALRPLPEKFHGLTDQEQRYRQRYVDLIINEESRNTMIMRSKVVAAIRQFMLKHQFMEVETPMMHPIAGGASARPFITHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISPRHNPEFTMMEFYMAYADYNDLIDFTEDLLSSVAKELCGTTALPYGEHVIEFSGPYTRVTMLEAIQHYNPDNRRIQDLSYEQIKNKELMVDIASEVGVEVESFW-TCGQLLEEIFGETAEPKLLQPTFITGYPADISPLARRSDEDPFITDRFEFFVGGREVANGFSELNDAQDQDSRFKAQMAAKDAGDDEAMQYDEDYIRALEFGLPPTAGQGIGIDRLVMLFTDSHTIRDVILFPSLR 498
>gi|57237456|ref|YP_178469.1| lysyl-tRNA synthetase [Campylobacter jejuni RM1221] >gi|81354013|sp|Q5HW66|SYK_CAMJR Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|57166260|gb|AAW35039.1| lysyl-tRNA synthetase [Campylobacter jejuni RM1221] (501 aa)
Score = 968, Expect = 1.0e-102, Identities = 216/484 (44%), Positives = 309/484 (63%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFA----KLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R EK K L+    +PY    + + M++  F  +F+    +++  + + N  +AGR+  LR      F  I D   + Q Y +K  V + +     K L++GDIV + G PF T+ GE +L   ++K+ +KA+ PLPEK+HGL D E R R RYVD+I+N +  K F+ R +++ +IR F +++ +LEVETP++HPI GGANA+PF+TFHN+L    +LRIA EL LK+L+VGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N + +M LTE LF  +   L     ++     I  ++ F RI   D + +  G+D   ++  ++   L K     FE ++   LGH+    F+ + E K I PTFV   PI +SPLS++  ++    +RFELFI  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     4 NILEQQRIEKAKELKNLGINPYP-HFLEKEMSLKTFKDRFSYILEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKKNLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVDMIMNAEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGVERFLRIAPELYLKRLVVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEELFALLLDKLNLGKTIEFDGKMIDFSKPFERITYKDALCKYGGLDRDLIEDKEKI--LTKLKADGFEANEKLELGHLQAELFDNYVEEKLINPTFVIDFPISISPLSRRSDEDSQIAERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLK 494
>gi|126663329|ref|ZP_01734327.1| lysyl-tRNA synthetase [Flavobacteria bacterium BAL38] >gi|126624987|gb|EAZ95677.1| lysyl-tRNA synthetase [Flavobacteria bacterium BAL38] (565 aa)
Score = 968, Expect = 1.2e-102, Identities = 222/486 (45%), Positives = 304/486 (62%)
  Q:     4 KFNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKV----SKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP-----EKWH---GLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVE-MDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + ++QE+IRR+KL  L+E   +PY  +      T       F + K       + LAGR+++ R     +F  ++D  G  Q Y N+  +     K++  + F K+ DLGD + I G  F T+ G + + V   K++SK LKPLP     E+ H      D ELR R RYVDL+VN    +VF+ R ++   +R F +   Y+EVETPVL  I GGA ARPFIT HN+L+   Y+RIA EL LK+LIVGGFD VYE  + FRNEGMD THNPEFT+ME+Y AY++  +MM +TENL +Y A  +        GE+++     + R+ M D IKQ TG D    K+  E  E AK   ++        G +I+  F E CE   IQPTF+  +P ++SPLSK    NP  T+RFEL +  KE ANA++ELNDPIDQ ERFEAQ+     G+DEA   +D DF+ ALEYG+PPT+GLG+G+DR+IM  T  +SI++VL FP M+ +K
  S:     2 QLSEQEIIRRDKLNALRELGINPYPADLFPVNHTSKQVKENFEEGK------KVILAGRMMSDRDMGKASFVELQDSEGRIQLYFNRDVLCPGDDKTLYNQVFRKLTDLGDFIGIEGELFMTKVGAMCIRVDDFKMLSKTLKPLPLPKTDEEGHVFDAFTDPELRYRMRYVDLVVNPQVKEVFMKRTKLFTAMRTFFNEAGYMEVETPVLQSIPGGAAARPFITHHNSLDIPLYMRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMEMTENLLEYCANQVNGTTEATFGEHKVNFKAPYARVTMTDAIKQFTGFDI-TGKTESELFEAAKYMGIEVNDTMGK-GKLIDEIFGEKCEGNFIQPTFITDYPKEMSPLSKSHRDNPELTERFELMVCGKEIANAYSELNDPIDQRERFEAQMALAEKGDDEANGIIDEDFLRALEYGMPPTSGLGIGMDRLIMFLTNNASIQEVLFFPQMRPEK 498
>gi|159904285|ref|YP_001551629.1| lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9211] >gi|159889461|gb|ABX09675.1| Lysyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9211] (503 aa)
Score = 968, Expect = 1.2e-102, Identities = 195/428 (45%), Positives = 277/428 (64%)
  Q:    59 LAGRVVALR----QTFGVIRDFYGDTQFYLNKKKV---------SKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSN-QEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           +AGRV++ R      F  + D  G  Q +L K  +         S         ++D GD + + G   RT +GEL++ V    ++ K+L+PLP+KWHGL D E R R RYVDLIVN  S K F  R  ++  IR+++D +++LE+ETPVL    GGA ARPFIT HNTL+ + YLRIATEL LK+L+VGGF++VYE+GRIFRNEG+ + HNPEFT++E+Y A+ +   MM LTE +  +V   +     ++    E+ LT  +RRI M + + + TG+DF+E   +  +A    +   +    H  ++G ++N  FE+  E    QPTFV  +PI++SPL++K    PG  +RFELFI  +E ANAF+EL DP+DQ ER   Q   +  G+ EA  +D DF+ ALE G+PPT GLG+GIDR++ML T+  SIRDV+ FP +K
  S:    55 VAGRVISRRVMGKLAFFTLSDESGSIQLFLEKATLEEHSDLDQESPGSFSQLTDLVDSGDWIGVNGILRRTDRGELSIKVFSWTMLCKSLQPLPDKWHGLSDVEKRYRQRYVDLIVNPQSRKTFRSRALMVSAIRRWLDERDFLEIETPVLQSEAGGAEARPFITHHNTLDLSLYLRIATELHLKRLVVGGFERVYELGRIFRNEGISTRHNPEFTTVEIYQAFADYTDMMDLTEEMISFVCSQICGSTTIQYQGKEVDLTPPWRRITMHELVLESTGLDFYEFGQDISKASTAMQSVGLNVPDHADSVGRLMNEAFEQAVEGDLFQPTFVMDYPIEISPLARKHRSKPGIVERFELFIAGRETANAFSELIDPVDQKERLLLQQSRRQAGDLEAHVIDEDFVNALEVGMPPTGGLGIGIDRLVMLLTDSPSIRDVIAFPLLK 497
>gi|152971836|ref|YP_001336945.1| lysyl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956685|gb|ABR78715.1| lysyl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (505 aa)
Score = 968, Expect = 1.2e-102, Identities = 212/485 (43%), Positives = 314/485 (64%)
  Q:     5 FNDQELIRREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ-ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
            N++   RREKL  L+E   A  + +  +  S  +   DF+ K    +    N  + +AGR++  R     +F  ++D  G  Q Y+ +  +++ +     K  DLGDI+   G  F+T+ GEL++   ++++++KAL+PLP+K+HGL+D+E R R RY+DLI N +S K F  R +IL  IRQFM  + ++EVETP++  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME+Y AY + + ++ LTE+LF+ +A+  L    V  G+      + F ++ M + IK+     +  ++ +   A+ +A+   +K EK    LG I+   FEE  EA  IQPTF+  +P +VSPL++++  NP  T RFE FI  +E  N F+ELND  DQ +RF+ QV  K+ G+DEA+  D D++ ALE+GLPPTAGLG+GIDRM+MLFT   +IRDV+LFP M+ +K
  S:    15 LNNELKTRREKLAALREQGVAFPNDFRRDHTSDQLH-ADFDGK-ENEELEALNVEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLAEGVYNDQFKKWDLGDIIAARGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRKTFKVRSQILAGIRQFMVGRGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGNTEVTYGDQVFDFGKPFEKLTMREAIKKYRPETEMADLDNFDSAKAIAESIGIKVEKSWG-LGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVDAKAAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPQK 505
>gi|110598631|ref|ZP_01386897.1| lysyl-tRNA synthetase [Chlorobium ferrooxidans DSM 13031] >gi|110339743|gb|EAT58252.1| lysyl-tRNA synthetase [Chlorobium ferrooxidans DSM 13031] (514 aa)
Score = 968, Expect = 1.2e-102, Identities = 215/482 (44%), Positives = 309/482 (64%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---------EK--WHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMG-ENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
            NDQ   R E+ ++L +A  +PY       + ++ D  + F +         + +AGR++ +R+    +F  I+D  G  Q YL K +V  +  + F K+LD+GDIV + G  F+T+ GE+++  +  +++SK+L+P+P         EK  +    D E R R RYVDLIVN +  + F+ R  ++  +RQF  SQ +LEVETP+L PI GGA ARPF T HN L+   YLRIA EL LK+LIVGGFD V+E  + FRNEG+D  HNPEFT +E+Y AY++  +MM L E LF   A  + K  V +   NEI L   F+R+ ++D I++  G +    KS  E + +AK   ++ +   S+ G II+  F EF E K IQPTF+  +P ++SPL+K+    PG  +RFEL +  KE  N+F+ELNDP+ Q ER E+Q K +  G++EA+ +D DF+ ALEYG+PP AGLG+GIDRM+ML T + SIRDV+ FPHMK
  S:    23 LNDQMQRRLEERQHLLDAGINPYPCHFDVTSFSL-DIIANFRE----EAKEPVAVAGRIMTIRKMGKASFFHIQDSKGKIQIYLKKDEVGDTAYDTF-KLLDIGDIVGVKGYTFKTRTGEISVHAESFELLSKSLRPIPVPKEKEVDGEKVVFDAFSDREQRYRQRYVDLIVNPEVRQTFIKRSAVVSFMRQFFSSQGWLEVETPILQPIYGGAAARPFTTHHNALDMELYLRIANELYLKRLIVGGFDGVFEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYNWMMELVEELFYRTALEVNKSEVTLFLGNEISLKPPFKRLSIIDAIEEYCGKNI-RGKSEVELRNVAKDLGLELDPKISS-GKIIDEIFGEFVEPKLIQPTFITDYPTEMSPLAKEHRSQPGIVERFELIVGGKEVCNSFSELNDPVVQRERLESQAKLRQRGDEEAMIVDEDFLRALEYGMPPCAGLGIGIDRMVMLITGQDSIRDVIFFPHMK 512
>gi|153091361|gb|EDN73335.1| lysine--tRNA ligase [Mannheimia haemolytica PHL213] (500 aa)
Score = 967, Expect = 1.4e-102, Identities = 213/487 (43%), Positives = 312/487 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQE-ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHN---TNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E   N + L RREKL  ++E  N  P       R     D ++++  ++       N  +K+AGR++  R     +F  I+D  G  Q Y+ +  +S S+ E    + DLGDIV + G+ F+T+ GELT+   ++++++K+L+PLP+K HGL D E R R RY+DLI N++S + F+ R +++  IR+F   ++++EVETP+L  I GGA A+PFIT HN L+ + YLRIA EL LK+L+VGGF++V+E+ R FRNEG+   HNPEFT +E Y AY +   +M  TE L + +A   L    V  G+      + F RI M D  +K   G+   ++ S +++ E+AK   ++ +K    LG ++N  FEE  E + IQPTF+  HP ++SPL++++ +NP  T RFELFI  +E  N F+ELND  DQ ERF+AQV  K  G+DEA+  D DFI ALE+GLPPTAG G+GIDR++M+F    SIRDV+LFP M+ K
  S:     8 ELDLNGEMLARREKLNKIREQGNAFP---NTFRRDALAKDLHAQYDAVEGETLKEQNIQVKVAGRIMLKRVMGKASFFTIQDVSGAIQLYVARDNLSDSVYEEKVSLWDLGDIVGVEGALFKTKTGELTVRCSEVQLLTKSLRPLPDKHHGLTDLETRYRQRYLDLISNEESRRTFMIRSQVVSGIRKFFLERDFIEVETPMLQVIPGGAAAKPFITHHNALDVDMYLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEELLRQLALDILGTTDVPYGDYVFDFGKPFERITMHDAIVKYGNGIQREDLDSFEKSVEIAKGLGIEIQKSWG-LGSVVNAIFEEVAEHQLIQPTFLMAHPAEISPLARRNDENPEVTDRFELFIGGREIGNGFSELNDAEDQAERFDAQVAAKDAGDDEAMFKDEDFIVALEHGLPPTAGEGLGIDRLVMIFANAPSIRDVILFPAMRQK 500
>gi|170725302|ref|YP_001759328.1| lysyl-tRNA synthetase [Shewanella woodyi ATCC 51908] >gi|169810649|gb|ACA85233.1| lysyl-tRNA synthetase [Shewanella woodyi ATCC 51908] (501 aa)
Score = 967, Expect = 1.5e-102, Identities = 211/475 (44%), Positives = 300/475 (63%)
  Q:    12 RREKLKNLQE---ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL-KKPVVKMGENEIYLTQKFRRIHMVDFIKQET-------GVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR KL++++    AN  P   ++  +   I        K +         +AGR++A R  F VI+D  G  Q Y  K  V K +   F   LD+GDI+ + G    + KG+L +++++ ++++KAL+PLPEK+HGL D+E R R RYVDLIVN+DS   F+ R +++  IR FM  + ++EVETP++H I GGA+ARPF T HN L+   YLRIA EL LK+L+VGGF++V+EI R FRNEG+   HNPEFT ME Y AY +   +M LTE +   +A  L   P +  GE+ +     + R+ M+D IK+          + + EVK  +  ++LAK   +  EK   T G ++   F E  E + +QPTF+ G+P D+SPL++++  N   T RFE FI  +E AN F+ELND  DQ  RF+AQV  K  G+DEA+  D D+I ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP M+
  S:    16 RRAKLEHIRANCPANGHPNNFDRKHKAADIQAEFGNNTKEELEGMGIQRSIAGRIMAKRGPFLVIQDVSGRIQAYAGKD-VQKDLKATFQG-LDIGDIIGVTGQLHLSGKGDLYVNMEEYQLLTKALRPLPEKFHGLTDQETRYRQRYVDLIVNEDSRNAFIMRSKVVSAIRNFMVKKEFMEVETPMMHSIPGGASARPFETHHNALDIAMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADFNDLMDLTEEMLSSIATELCGSPQLPYGEHTVDFGGPYARLSMLDAIKKYNPDNATIQSMTYEEVKDVEFMRDLAKSLGMTIEKFW-TCGQLLEEIFGETAETQLMQPTFITGYPADISPLARRNDDNHFITDRFEFFIGGREVANGFSELNDAEDQDNRFKAQVDAKDAGDDEAMFYDADYITALEHGLPPTAGQGIGIDRLVMLFTNTHTIRDVILFPAMR 498
>gi|78777471|ref|YP_393786.1| lysyl-tRNA synthetase [Sulfurimonas denitrificans DSM 1251] >gi|78498011|gb|ABB44551.1| Lysyl-tRNA synthetase, class-2 [Sulfurimonas denitrificans DSM 1251] (504 aa)
Score = 967, Expect = 1.6e-102, Identities = 215/475 (45%), Positives = 308/475 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDF----NSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSML-EYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           R EK++ L++A  +PY  E   R  TI  F    +    K    +      L+GR+   R     +F  I D     Q Y+ +  + +    E F K ++ GDIVE+ G PF T +GEL+L    +K+++KA+ PLPEK+HG+ D+E R R RY+DLI+N D  K F  R +++ + R+F + + +LEVETP++HPI GGANA+PF+T HN L  + YLRIA EL LK+LIVGGF+ V+EI R FRNEGMD+THNPEFTS+E Y AY+  + ++ +T+  F+Y+   L  P  +  G+ E+    KF  + +++ +     V    V    +     K+ N++  K+  +LG +    F+EF E K I PTF+  +P+++SPL+++  KNP  T+RFELFI  +E ANAF+ELNDP+DQY RF+ QV+ K  G+DEA  MD+DF+EAL YG+ PTAG G+GIDR++ML T + SIRDVLLFP MK
  S:    11 RIEKVEILKKAGINPYANES-KRNATIEKFLNVNSDVINKENKRDEKRRYTLSGRIKLFRIMGKASFIQIEDESNVLQVYVARDHIGEEFYNETFKKNIETGDIVEVSGYPFVTGQGELSLHADNLKLLTKAISPLPEKFHGITDKETRYRKRYLDLIMNADVRKTFKVRSKVISLTRRFFEDKGFLEVETPMMHPIAGGANAKPFVTHHNALGIDRYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDATHNPEFTSIEFYWAYKTYKDLIEITKEYFRYLFDHLNLPTSLPYGDMEVDF-NKFSEVPLIESLYTIGAVPKEIVNDKDKIILFLKEKNIQV-KNNLSLGQLQGELFDEFVEDKLINPTFITEYPVEISPLARRSDKNPEVTERFELFIAGREIANAFSELNDPVDQYNRFKTQVESKESGDDEAHAMDLDFVEALSYGMAPTAGQGIGIDRLVMLLTNEHSIRDVLLFPAMK 492
>gi|149193730|ref|ZP_01870828.1| lysyl-tRNA synthetase [Caminibacter mediatlanticus TB-2] >gi|149135683|gb|EDM24161.1| lysyl-tRNA synthetase [Caminibacter mediatlanticus TB-2] (498 aa)
Score = 967, Expect = 1.6e-102, Identities = 213/478 (44%), Positives = 308/478 (64%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSK----FAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           R  K + L+E N +PY+     R   I DF  K    F      + +    +AGRV  LR      F  I D  G  Q Y++K  +         K L++GDIVE+ G PF T+ GEL++    ++I++KA+ PLPEK+HGL+D E + R RY+D+I+NKD+   F  R +I+ ++R+F   + +LEVETP+LH ++GGANARPF+T HN L+ +  LRIA EL LK+LIVGGF+ V+E+ R FRNEG+D THNPEFT +E Y AY  ME +M+LT+ LF ++ + L  P      + +     +R I   D + +   +    ++  +  ++  K   ++ E+H  + G +    F+EF E K I PTF+   PI++SPL+++  KNP F +RFELFI  +E AN F ELNDPIDQYERF+AQ++ K+ G++E ++MD D+I+AL+YG+PPTAG G+GIDR++ML T   SI+DV+LFP MK KK
  S:    10 RISKAEKLKENNLNPYD-HNSKRDTKISDFLEKNKDIFELENKRDESRKFIVAGRVKFLRLMGKAAFFKIEDESGILQVYMSKNDLGDK-FNLLKKTLEVGDIVEVIGYPFVTKTGELSIHADDVRILTKAIHPLPEKFHGLQDVETKYRQRYLDMIMNKDTRDRFKLRSQIVSLVREFFLKKGFLEVETPMLHTVVGGANARPFMTHHNALDIDMNLRIAPELFLKRLIVGGFEAVFELNRNFRNEGIDHTHNPEFTMIEFYWAYHTMEDLMKLTKELFDFLFEKLNLPKKLEYGDMVIDFDDWRTITYKDALIKIGNIPEEILEDVEAMKKYLKDAGIEIEEHIDSKGKLWAELFDEFVEDKLINPTFITEFPIEISPLARRSDKNPEFAERFELFIAGREIANGFNELNDPIDQYERFKAQLEAKAKGDEEGMDMDYDYIKALQYGMPPTAGEGIGIDRLVMLLTNSHSIKDVILFPTMKPKK 493
>gi|145297979|ref|YP_001140820.1| lysyl-tRNA synthetase [Aeromonas salmonicida subsp. salmonicida A449] >gi|166229791|sp|A4SJK0|SYK_AERS4 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|142850751|gb|ABO89072.1| lysyl tRNA synthetase [Aeromonas salmonicida subsp. salmonicida A449] (512 aa)
Score = 967, Expect = 1.6e-102, Identities = 213/486 (43%), Positives = 312/486 (64%)
  Q:     4 KFNDQELIRREKLKNLQ-EANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNT---NNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSL----KKPVVKMGEN--EIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           + N++   RR KL  L+ + N  P +  + S +   GD +++F              +K+AGR++  R     +F  ++D  G  Q Y+ +  + +       K  DLGDIV + G+ FRT  GEL++ V  I++++KAL+PLPEK  GL D+E R R RY+DLI N++S K F+ R +++  IR+F + + ++EVETP++  I GGA+ARPF+T HN L+ + YLRIA EL LK+L+VGGF++VYEI R FRNEG+   HNPEFT +E Y AY +   +M LTE L + +A+ +    K    K GE    I   Q F+R+ MVD I K    V   ++ + + A+ +AK  +++  K    LGH+I   FEE  E   +QPTF+  +P  VSPL++++  NP  T RFE FI  +E AN F+ELND  DQ +RF+ QV +K  G+DEA+  D DF+ ALE+GLPPTAG G+GIDR++MLFT   +IRDV+LFP ++ ++
  S:    15 ELNNEMTERRSKLAALRAQGNPFPNDFRRDSLS---GDLHAEFGDKSAEELVALGKQVKIAGRIMTRRIMGKASFATLQDMAGKIQIYVTRDDLPEGFYNEQFKKWDLGDIVGVEGTLFRTNTGELSVHVSTIRLLTKALRPLPEKHKGLTDQEARCRQRYLDLIANEESRKTFMIRTKVVAGIRKFFNDKRFMEVETPMMQVIPGGASARPFVTHHNALDIDMYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISVRHNPEFTMIEFYMAYADYIDLMDLTEELLRTLAQDILGDTKIRYAKEGEEGLTIDFGQPFQRLTMVDSILKFNPDVTPADLATLESAKAVAKHLHIELMKGWE-LGHVITAIFEETVEHMLLQPTFITEYPAAVSPLARRNDVNPDVTDRFEFFIGGRELANGFSELNDAEDQAKRFQDQVNQKEAGDDEAMFYDADFVTALEHGLPPTAGQGIGIDRLVMLFTNSHTIRDVILFPALRPQQ 511
>gi|33152397|ref|NP_873750.1| lysyl-tRNA synthetase [Haemophilus ducreyi 35000HP] >gi|39932104|sp|Q7VLU5|SYK_HAEDU Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|33148620|gb|AAP96139.1| lysyl-tRNA synthetase [Haemophilus ducreyi 35000HP] (498 aa)
Score = 966, Expect = 2.0e-102, Identities = 207/487 (42%), Positives = 305/487 (62%)
  Q:     2 ERKFNDQELIRREKLKNLQE-ANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVD-FIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E   N + L RREKL  ++   N  P    + +    +    ++ A     + +  +K+ GR++  R     +F  I+D  G  Q Y+ +  +++ +      + DLGDIV + G+ F+T+ GELT+    +++++K+L+PLP K  GL D+E+R R RY+DLI N+ S + FV R +++  IRQF   + ++EVETP+L  I GGA A+PF+T HN L+ + YLRIA EL LK+L+VGGF++V+E+ R FRNEG+   HNPEFT +E Y AY +   +M  TE L + +A   L    V  GE +    Q F RI M D  +K   G+   ++   ++A E+AKK  ++ +K    LG ++N  FEE  E + IQPTF+  HP ++SPL++++ +NP  T RFELFI  +E  N F+ELND  DQ  RF+AQV  K  G+DEA+  D DF+ ALE+GLPPTAG G+GIDR++M+F    SIRDV+LFP M+ K
  S:     6 ELDLNGEMLARREKLAKIRAMGNPFPNRFRRDAYAYALQAEYAEMAGDALKDADVQVKVVGRIMLKRVMGKASFFTIQDVSGQIQLYVARDNLAEGVYVDNVGLWDLGDIVGVCGTLFKTKTGELTVRCADVELLTKSLRPLPNKHQGLVDQEMRYRQRYLDLIANEQSRRTFVIRSQVVSGIRQFFLERGFMEVETPMLQVIPGGAAAKPFVTHHNALDVDMYLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEQLLRKLALDILGTTAVPYGEYQFDFGQPFERITMHDAIVKYGNGIAREDLDDIEKAVEIAKKLGIEVQKSWG-LGAVVNAIFEEVAEHQLIQPTFLMAHPAEISPLARRNDENPEVTDRFELFIGGREIGNGFSELNDAEDQAARFDAQVAAKDAGDDEAMFKDDDFVVALEHGLPPTAGEGLGIDRLVMIFANAPSIRDVILFPAMRHK 498
>gi|188997502|ref|YP_001931753.1| lysyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932569|gb|ACD67199.1| lysyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1] (577 aa)
Score = 966, Expect = 2.1e-102, Identities = 203/430 (47%), Positives = 294/430 (68%)
  Q:    57 IKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLF-KYVAKSLKKPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGH--IINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           + +AGR++ALR      FG I+D  G  Q Y N   + +   +    ++D+GDI+ + G  FRT  GELT++V   +I++K+L+PLPEKWHGL+D E R R+RY+DLI N+ + ++F  R + +K +R+F++S+ ++EVETP+L P+  GA A+PFIT+HN L+ N YLRIA EL LK L+VGGF++V+EIGR FRNEG+D+THNPEFT +E YAAY +   +M LTE LF K +  ++    +     E+   + FR++   D +KQ+TG D       ++A+  AK+  +       TL H  I++  FE F E   IQPTFV   P  +SPL+K    +P   +RFEL IN KE ANA+ ELNDP+DQ ERF  Q++EK +G++EA+++D  F+ ALEYGLPPTAG G+GIDR++M+ T+  SIR+V+LFP ++
  S:   140 VAVAGRLIALRDQGKAAFGHIQDSDGKLQVYFNADILGEENYKKAMDLIDIGDIIGVEGHLFRTMTGELTVEVHNYEILAKSLRPLPEKWHGLKDTEYRYRYRYLDLIANQRTREIFKIRSKAIKSLREFLESKGFIEVETPILQPVASGAMAKPFITYHNALDMNLYLRIAPELYLKMLVVGGFNRVFEIGRNFRNEGIDTTHNPEFTMVEFYAAYLDYNDLMALTEELFRKILLDTVGTLKITWEGQELDFEKPFRKVAFFDALKQKTGKDKEFFLDFEKARNFAKEVGI---PKADTLTHVKILDKLFEHFVEEDLIQPTFVIDFPKILSPLAKTHRNDPDLVERFELIINKKELANAYTELNDPMDQRERFIQQIREKEMGDEEAMDIDETFLTALEYGLPPTAGEGIGIDRLVMMLTDNYSIREVILFPTLR 573
>gi|170718674|ref|YP_001783868.1| lysyl-tRNA synthetase [Haemophilus somnus 2336] >gi|189082960|sp|B0URW9|SYK_HAES2 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|168826803|gb|ACA32174.1| lysyl-tRNA synthetase [Haemophilus somnus 2336] (502 aa)
Score = 966, Expect = 2.2e-102, Identities = 211/487 (43%), Positives = 312/487 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQ-EANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ---ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E   N + L+RREKL  L+ + N  P       R     D ++++ ++++ +       +K+AGR++  R     TF  ++D  G  Q Y+ +  +++ +        DLGDIV + G+ F+T+  ELT+   ++ +++KAL+PLP K+HGL D+E R R RY+DLI N+DS + F+ R +++  IR++  S+ ++EVETP+L  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+E+ R FRNEG+   HNPEFT +E Y AY +   +M  TE L + +A   L   +V  G+ +    + F RI M + I +   E G+   ++     A  +A+K  ++ +K    LG ++N  FEE  E   IQPTF+  HP ++SPL++++ +NP  T RFELFI  +E  N F+ELND  DQ ERF+AQV  K  G+DEA+  D DF+ ALE+GLPPTAG G+GIDR+ MLF   +SIRDV+LFP MK K
  S:     7 ELDLNGEMLVRREKLAALRAKGNAFP---NTFRRNALAQDLHTQYDEIESESLKTQGIEVKVAGRIMTRRVMGKATFITLQDMSGKIQLYVARDNLAEGVYTDDVGNWDLGDIVGVKGTLFKTKTNELTIRATEVHLLTKALRPLPNKFHGLSDQETRYRQRYLDLIANEDSRRTFIIRSKVIAGIREYFISKGFMEVETPMLQIIPGGASARPFITHHNALDVDMYLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSIRHNPEFTMLEYYQAYADYHDLMDNTEELLRKLALDILGTTIVPYGDLKFDFGKPFERITMHEAILKYGAEQGIVKEDLYDFDRAVAVAQKLGIEVQKSWG-LGSLVNAIFEEVAEHHLIQPTFLMAHPAEISPLARRNDENPDVTDRFELFIGGREIGNGFSELNDAEDQNERFDAQVAAKEAGDDEAMFKDEDFVTALEHGLPPTAGEGLGIDRLAMLFANANSIRDVILFPAMKTK 501
>gi|113461618|ref|YP_719687.1| lysyl-tRNA synthetase [Haemophilus somnus 129PT] >gi|112823661|gb|ABI25750.1| lysyl-tRNA synthetase [Haemophilus somnus 129PT] (502 aa)
Score = 966, Expect = 2.2e-102, Identities = 211/487 (43%), Positives = 312/487 (64%)
  Q:     2 ERKFNDQELIRREKLKNLQ-EANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFIKQ---ETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           E   N + L+RREKL  L+ + N  P       R     D ++++ ++++ +       +K+AGR++  R     TF  ++D  G  Q Y+ +  +++ +        DLGDIV + G+ F+T+  ELT+   ++ +++KAL+PLP K+HGL D+E R R RY+DLI N+DS + F+ R +++  IR++  S+ ++EVETP+L  I GGA+ARPFIT HN L+ + YLRIA EL LK+L+VGGF++V+E+ R FRNEG+   HNPEFT +E Y AY +   +M  TE L + +A   L   +V  G+ +    + F RI M + I +   E G+   ++     A  +A+K  ++ +K    LG ++N  FEE  E   IQPTF+  HP ++SPL++++ +NP  T RFELFI  +E  N F+ELND  DQ ERF+AQV  K  G+DEA+  D DF+ ALE+GLPPTAG G+GIDR+ MLF   +SIRDV+LFP MK K
  S:     7 ELDLNGEMLVRREKLAALRAKGNAFP---NTFRRNALAQDLHTQYDEIESESLKTQGIEVKVAGRIMTRRVMGKATFITLQDMSGKIQLYVARDNLAEGVYTDDVGNWDLGDIVGVKGTLFKTKTNELTIRATEVHLLTKALRPLPNKFHGLSDQETRYRQRYLDLIANEDSRRTFIIRSKVIAGIREYFISKGFMEVETPMLQIIPGGASARPFITHHNALDVDMYLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSIRHNPEFTMLEYYQAYADYHDLMDNTEELLRKLALDILGTTIVPYGDLKFDFGKPFERITMHEAILKYGAEQGIVKEDLYDFDRAVAIAQKLGIEVQKSWG-LGSLVNAIFEEVAEHHLIQPTFLMAHPAEISPLARRNDENPDVTDRFELFIGGREIGNGFSELNDAEDQNERFDAQVAAKEAGDDEAMFKDEDFVTALEHGLPPTAGEGLGIDRLAMLFANANSIRDVILFPAMKTK 501
>gi|194365604|ref|YP_002028214.1| lysyl-tRNA synthetase [Stenotrophomonas maltophilia R551-3] >gi|194348408|gb|ACF51531.1| lysyl-tRNA synthetase [Stenotrophomonas maltophilia R551-3] (503 aa)
Score = 966, Expect = 2.2e-102, Identities = 208/478 (43%), Positives = 302/478 (63%)
  Q:    12 RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVK-SNQEAQELAKKHNVKFE---KHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           RREKLK L+   Q         R    G    +FA  +             +K+AGR++A R     +F  I+D  G  Q +L    +  +   +  K  D+GDI+ + G   RT+ GEL++  + I++++K+L+PLP+KWHGL D E R R RYVDLIV  +S  VF+ R +I++ +R ++D++++LEVETP++H I GGA A+PF T HN L+ + YLR+A EL LK+L VGG ++VYEI R FRNEG+ + HNPEFT ME+Y AY     +M LTE + + VA ++     V+    +I L   FRR  M + ++        E+  ++   +E   +H  + +   K     G ++   FE   E   IQPTF+  HP++VSPL++ +  +PG+T RFELF+N KE AN F+ELNDP DQ +RF+AQV  K  G+DEA+  D D+I ALEYG+ PT GLG+G+DR++ML T  SSIRDVLLFP+M+ ++
  S:    19 RREKLKTLR--GQGIAYPNDFRREDFAGRLQEEFADAEQWTAEALEGNGRQVKMAGRLMAKRIMGKASFAQIQDESGRIQLFLQGTVLGDAYTAF--KGWDVGDIIAVEGGLTRTKTGELSVKAESIRLLTKSLRPLPDKWHGLADVEQRYRQRYVDLIVTPESRAVFIKRSKIIRAMRAWLDNRDFLEVETPMMHYIPGGAAAKPFTTHHNALDLDLYLRVAPELYLKRLTVGGLERVYEINRNFRNEGVSTRHNPEFTMMELYEAYATYNEIMDLTEGVIRDVATTVNGGTEVEWDGAKIDLGPAFRRWRMDEAVRHHNP----EISAADCTDREALLRHCERLKIRVKPSYGWGKLLLEIFEATVEHTLIQPTFITDHPVEVSPLARANDNDPGYTDRFELFVNGKELANGFSELNDPEDQAQRFQAQVAAKEGGDDEAMHYDADYIRALEYGMAPTGGLGIGVDRLVMLLTGSSSIRDVLLFPYMRPEQ 503
>gi|34556537|ref|NP_906352.1| lysyl-tRNA synthetase [Wolinella succinogenes DSM 1740] >gi|39932014|sp|Q7MAR1|SYK_WOLSU Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|34482251|emb|CAE09252.1| LYSYL-TRNA SYNTHETASE [Wolinella succinogenes] (507 aa)
Score = 966, Expect = 2.3e-102, Identities = 215/485 (44%), Positives = 316/485 (65%)
  Q:     5 FNDQELIRR-EKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT------HNTNNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKP-VVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           F++Q + +R +K + L+E  ++PY+  ++ RT+T   F  KF  LK+       + +    +AGR+  LR      F  I D  G  Q Y ++ ++ +   +   K+ ++GDIV + G PF T+ GEL+L   ++KI++KA+ PLPEK+HGL D ELR R RY+DLI+N +  + F  R +++  +R+F + + +LEVETP++HPI GGANA+PFIT HN L  + YLRIA EL LK+L+VGGF+ V+EI R FRNEGMD +HNPEFT +E Y AY+    +M LTE LF Y+ + L  P ++  GE  I  +  FRRI     + +  GV    ++  ++ +    +  V+ E     +G +    F+ F E K I PTF+   PI++SPL+++  +NP    RFELFI  KE +N F+ELNDP+DQ ERF+AQV  K+ G++EA  MD D++ AL +GLPPTAG G+GIDR++ML T   SI+DV+LFP +K +K
  S:     3 FSNQYIKQRIQKGEELRELGRNPYD-NQLMRTLTHAQFLQKFEALKSLESEEKRDESAKESIAGRIKFLRHMGKAAFAKIEDESGILQIYFSQNELGED-FKMLKKLAEVGDIVAVSGFPFVTKTGELSLHALEMKILTKAIVPLPEKYHGLVDVELRYRQRYLDLIMNPEVKETFKLRSQVVSSVRRFFEERGFLEVETPMMHPIPGGANAKPFITHHNALGVDRYLRIAPELYLKRLVVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYKTYHELMSLTEELFGYLFERLGLPKILPHGEEMIDFSLPFRRIPYKKALHEIGGVPLEVIEEKEKLRAYLIEKGVRLEGEMG-IGKLQAEAFDAFVEEKLINPTFITEFPIEISPLARRSDENPQIADRFELFIGKKEISNGFSELNDPLDQLERFKAQVAAKNAGDEEAQHMDEDYVWALGHGLPPTAGEGIGIDRLVMLLTNNRSIKDVILFPALKVQK 496
>gi|153003984|ref|YP_001378309.1| lysyl-tRNA synthetase [Anaeromyxobacter sp. Fw109-5] >gi|152027557|gb|ABS25325.1| lysyl-tRNA synthetase [Anaeromyxobacter sp. Fw109-5] (520 aa)
Score = 965, Expect = 2.5e-102, Identities = 208/431 (48%), Positives = 280/431 (64%)
  Q:    59 LAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPI--LGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNV---------KFEKH-QSTLGHIINLFFEEFCEAKCIQ--PTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +AGRV+A+R      F  +RD  G+ Q +L K ++ +   E + K LD+GDIV   G   RT+ GELTL+     I++K+++PLPEKWHGL D E R R RY+DL+        FV R RI+  IR+F+D + YLEVETP LH     GGA ARPF T HN L+ +  LRIATEL LK+L+VGGFD+VYEIGRI+RNEG+D  HNPEFTS+E Y AY   E +MRLTE LF  +A  +   PVV      I LT  + R+ +V    +E G+   +  S +   E   +            K E+  + + G  +   FE F E +  +  P+FV   PI+ SPLS++   +P    RFELF    E ANAF+ELNDP+DQ  RFEAQV  ++ G++EA+  D DF+ ALE+G+PPTAG G+GIDR+ ML T+ +SIRDV+LFP +K ++
  S:    72 IAGRVLAVRPFGKAAFLKVRDAAGELQVWLKKDRLPERDFEIY-KQLDIGDIVAAQGGATRTKTGELTLEASGFTILTKSMRPLPEKWHGLTDVEQRYRQRYLDLVATPGVRDTFVKRARIVSTIRRFLDGRGYLEVETPTLHKPEEAGGAAARPFETHHNALDLDLKLRIATELHLKRLVVGGFDRVYEIGRIWRNEGIDRRHNPEFTSIEFYQAYATAEDLMRLTEELFHALAVEVTGAPVVTFQGQAIDLTPPYPRVSLVQEAARELGLSVEDALSGRGLAEALARAAARENESEDAWKLEQAAKRSPGEALAAVFEVFGEPRLAKDRPSFVVDWPIETSPLSRRRDSDPRLVDRFELFAGGMECANAFSELNDPVDQRARFEAQVNARAAGDEEAMPYDEDFVRALEHGMPPTAGEGIGIDRVAMLLTDSASIRDVILFPLLKTRE 520
>gi|57168540|ref|ZP_00367673.1| lysyl-tRNA synthetase [Campylobacter coli RM2228] >gi|57020045|gb|EAL56722.1| lysyl-tRNA synthetase [Campylobacter coli RM2228] (502 aa)
Score = 965, Expect = 2.8e-102, Identities = 214/484 (44%), Positives = 310/484 (64%)
  Q:     6 NDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKL-KTHNTNN---NIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLK-KPVVKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQS-TLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           N  E  R +K   L+ A  +PY    + + +++ DF  KF+ +  T N  +   +  ++GR+  LR      F  I D   + Q Y +K  + +     F K L++GDI+   G PF T+ GE +L   +I + +K++ PLPEK+HGL D E R R RYVD+I+N +  K F+ R +++ +IR F + + +LEVETP++HPI GGANA+PF+TFHN+L    +LRIA EL LK+L+VGGF+ V+EI R FRNEGMD THNPEFT++E Y AY N + +M LTE LF  + + L+   +++    +I  ++ F RI   D +K+   +    +++  +  E  KK    FE +    LGH+    F+ + E+K I PTF+   PI +SPLS++  KN    +RFELF+  +E AN F ELNDP+DQYERF  Q++ K+ G++EA EMD DF+ AL YG+PPTAG G+GIDR++ML T K SIRDV+LFP M+  K
  S:     4 NILEQQRIQKANELKNAGVNPYP-HFLVKELSLADFKKKFSYIFDTENKRDESISSVISGRLKLLRIAGKSIFANIEDENENLQIYFSKDSLGEEKFNLFKKNLEVGDIILAKGFPFVTKTGEFSLHASEITLATKSIVPLPEKYHGLTDIEQRYRKRYVDMIMNAEVRKDFLTRSKVVSLIRHFFEEKGFLEVETPMMHPIAGGANAKPFVTFHNSLGVERFLRIAPELYLKRLVVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEELFALLLEKLQLGKIIEFDGQKIDFSKPFERITYKDALKKYGALSDEIIENKDKILEKLKKDG--FEANDKLDLGHLQAELFDNYVESKLIDPTFITDFPISISPLSRRSDKNSEIAERFELFVCGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLK 494
>gi|146308389|ref|YP_001188854.1| lysyl-tRNA synthetase [Pseudomonas mendocina ymp] >gi|166229818|sp|A4XXQ6|SYK_PSEMY Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|145576590|gb|ABP86122.1| lysyl-tRNA synthetase [Pseudomonas mendocina ymp] (505 aa)
Score = 965, Expect = 2.9e-102, Identities = 213/485 (43%), Positives = 310/485 (63%)
  Q:     2 ERKFNDQELI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKF---AKLKTHNTNNNIKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ER+  + +LI  R+EKL  ++E  Q         R    G+   ++   +K +       +K+AGR++  R  F V++D  G  Q Y+++K +    LE   K  DLGDI+   G+  R+ KG+L +++  +++++K+L+PLP+K HGL D E R R RYVDLIVN+++   F  R +++  IR+F++ + +LEVETP+L  I GGA A+PF T HN L+   +LRIA EL LK+L+VGGF+KV+EI R FRNEG+ + HNPEFT +E Y AY +    M LTE LF+ +A + L    V  G+   +  + F R+ + D I K    +   ++    +A+ +AKK   K   H+  LG +  + FEE  E+K  QP F+  +P +VSPL++++ +NP  T RFELFI  +E ANA++ELND  DQ ERF AQV EK  G+DEA+  D DF+ ALEYG+PPTAG G+GIDR++ML T   SIRDV+LFPHM+
  S:    15 ERQHEENKLIAQRKEKLAAVRE--QGIAFPNDFRRDSLCGELQKQYEGKSKEELEAAAIPVKIAGRIMLNRGAFMVLQDTSGRLQVYVDRKGLPAETLEAI-KTWDLGDIIAAEGTLARSGKGDLYVNMTSVRLLTKSLRPLPDKHHGLTDTEQRYRQRYVDLIVNEETRHTFRVRSQVIAHIRRFLNERGFLEVETPMLQTIPGGAAAKPFETHHNALDMQMFLRIAPELYLKRLVVGGFEKVFEINRNFRNEGVSTRHNPEFTMLEFYQAYADYRDNMDLTEELFRELALAVLGTTDVPYGDKVFHFGEPFVRLSVYDSILKYNPDITEADLNDVDKARAIAKKAGAKVLGHEG-LGKLQVMIFEELVESKLEQPHFITEYPFEVSPLARRNDQNPAVTDRFELFIGGREIANAYSELNDAEDQAERFHAQVAEKDAGDDEAMHFDADFVRALEYGMPPTAGEGIGIDRLVMLLTNSPSIRDVILFPHMR 502
>gi|124003298|ref|ZP_01688148.1| lysyl-tRNA synthetase [Microscilla marina ATCC 23134] >gi|123991396|gb|EAY30827.1| lysyl-tRNA synthetase [Microscilla marina ATCC 23134] (582 aa)
Score = 964, Expect = 3.5e-102, Identities = 212/483 (43%), Positives = 308/483 (63%)
  Q:     7 DQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT-----HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSM-LEYFN----KVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPE-------KWH-GLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           +QE +R EKL+ L++   +PY  +      +  D  +    L             + +AGR+++ R      F  ++D  G  Q Y+N+ ++       Y+N    K++DLGDI+ + G  F+TQ GEL++ V +  +++KA+KPLP+       K H    D ELR R RYVDL+VN      F+ R +++  +R +++ + YLEVETP+L P+ GGA ARPF T HNTL+   YLRIA EL LK+LIVGGFD VYE  + FRNEGM   HNPEFT +E+Y AY++ E+MM L E + + VA +L     V++G N I   + ++R  M + I+  TG+D  E+  +Q  +E  KK +V+ +      G +I+  F E CE   IQPTF+  +P+++SPL+K     PG  +RFE   N KE  NAF+ELNDP+DQ +RFE QV     G+DEA+ +D DF+ ALEYG+PPTAGLG+GIDR+ M+ T  S+I++VL FP M+ +K
  S:     8 EQERVRIEKLEELRKLGINPYPADLYEINASSADIKTDCDHLAAGDKVEEGKYKQVSVAGRLMSRRIQGKAGFAELQDSQGRVQIYMNRDEICPGEDKSYYNNVYKKLVDLGDILGVKGYVFKTQTGELSIWVTEYILLTKAIKPLPQPKTDEDGKVHDAFTDPELRYRQRYVDLVVNPQVRDTFIKRTKLVNTMRDYLNDKGYLEVETPILQPLYGGAAARPFKTHHNTLDMTLYLRIANELYLKRLIVGGFDGVYEFSKDFRNEGMSRFHNPEFTQVELYVAYKDYEWMMNLVEEMVEKVAIALHGTTEVQVGANTINFQRPWKRYTMFEAIEHFTGIDISEMNEDQ-LRETCKKLDVETDPSMGK-GKLIDEIFGEKCEGSLIQPTFITNYPVEMSPLAKSHRDKPGLVERFEAIANGKEICNAFSELNDPLDQRQRFEDQVNLGKRGDDEAMTLDEDFLRALEYGMPPTAGLGIGIDRLSMIMTNSSTIQEVLFFPQMRPEK 511
>gi|71065613|ref|YP_264340.1| lysyl-tRNA synthetase [Psychrobacter arcticus 273-4] >gi|123761770|sp|Q4FSV2|SYK_PSYA2 Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|71038598|gb|AAZ18906.1| lysyl-tRNA synthetase [Psychrobacter arcticus 273-4] (514 aa)
Score = 964, Expect = 3.6e-102, Identities = 207/476 (43%), Positives = 299/476 (62%)
  Q:    13 REKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN--------IKLAGRVVALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK 488
           + KL+++  + + PY      RT    D  + F  +      +N        + +AGRV+  R  F VI+D  G  Q Y+ +K++ +  L    K LDLGDIV + G   R+ KG+L + ++++++++KAL+P+P K+HGL D E R R+R++DL+ N+ +   F+ R +++  IR+FM ++ ++EVETP++HPI GGA ARPF+T HN L+   YLRIA EL LK+L+VGGF+KV+EI R FRNEG+ + HNPEFT +E Y AY +   +M LTE LF  +A   L    +   E +I L   F R+ M + I K     D   +       E A     +  K    +G +  + FEE  E +  QPTF+  +P + SPL+++   NP  T RFELF+  +E AN F+ELNDP DQ ERF  QV EK  G+DEA+  D ++IEAL YGLPPTAG G+GIDR++ML T+ +SIRDV+LFPHM+ K
  S:    28 QAKLEDIVASGKQPYP-NTFKRTDYAQDLQTAFEGISKQEIADNDAKGEKTQVNVAGRVMLNRGAFIVIQDMTGRIQLYVARKELDEETLADI-KSLDLGDIVGVSGYIGRSGKGDLYVHIEEMQLLTKALRPMPNKFHGLADVEARYRNRHLDLMTNETTRDTFMVRSQVISGIRKFMLNERFMEVETPMMHPIPGGAVARPFVTHHNALDMPLYLRIAPELYLKRLVVGGFEKVFEINRSFRNEGVSTRHNPEFTMIEFYQAYADYHDLMDLTERLFNELATDILGTTEITYQEEDISLKAPFERLSMSNAIAKYAENFDMARINDRDYLAEYASTTLKQQVKDVFGVGKLQTIIFEETAEHQLRQPTFITEYPAETSPLARRSDDNPEITDRFELFVGGRELANGFSELNDPADQAERFLGQVAEKDAGDDEAMHFDAEYIEALSYGLPPTAGEGIGIDRLVMLLTDSASIRDVILFPHMRRK 511
>gi|45657773|ref|YP_001859.1| lysyl-tRNA synthetase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|59798559|sp|Q72R38|SYK_LEPIC Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|45601013|gb|AAS70496.1| lysyl-tRNA synthetase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (495 aa)
Score = 964, Expect = 3.7e-102, Identities = 214/478 (44%), Positives = 307/478 (64%)
  Q:     9 ELI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRV----VALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---EK----WHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKSLKKPV-VKMGENEIYLTQKFRRIHMVDFIKQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           ELI  R +K++ L++   +PY +     + +  D   KF K  T       KL GR+    V  + +F  ++D  G  Q Y  K  + ++    F K LDLGDI+ + G  F+TQKGE+TL V  ++++SK ++PLP   EK    +    D E R R RYVDLIVN      F+ R +I+  IR F+  + +LEVETP++ PI GGA ARPF+T HNTL+   +LRIA EL LK+LIVGG D+V+E+ R FRNEG+ + HNPEFT ME Y A+ +M  M+ LTE L  ++A+ +   + ++ G++ I L+  ++R   VD IK+ +G+DF ++ S +EA++ A +  V   K Q T+  + +  F E  E   IQP F+  +P ++SPL+K +   PG+ +RFE ++  +E  NAF ELNDP DQ ERFE QVK++  G+DEA  MD D+I ALEYG+PPT GLG+GIDR++ML T   SIRD +LFP M+
  S:     6 ELIEQRIQKIEELKKQGINPYPVRFFPDSKS-KDIAEKFEKNPT-GPETKFKLGGRLHSKRVMGKASFAHLKDNSGIIQLYATKDDLGETQYSIF-KSLDLGDIIGLEGYLFKTQKGEITLHVTSVELLSKCIRPLPVVKEKDGVVYDAFADVEQRYRMRYVDLIVNDHVRDTFITRSKIVSEIRSFLTQEGFLEVETPMMQPIAGGAAARPFVTHHNTLDMQLFLRIAPELYLKRLIVGGMDRVFELNRNFRNEGISTKHNPEFTMMEAYMAFGDMSTMLDLTERLITHLAQKICGTLKIQYGKDLIDLSPPWKRTTYVDIIKEYSGIDFSQIISLEEAKKKASELKVDVSKCQ-TIWKVADEVFSEKAEPNLIQPIFITDYPKELSPLAKSNPDKPGYVERFEPYVAGREIGNAFTELNDPFDQKERFEDQVKQREAGDDEAFMMDEDYIRALEYGMPPTGGLGIGIDRLVMLLTNSHSIRDTILFPLMR 493
>gi|15837714|ref|NP_298402.1| lysyl-tRNA synthetase [Xylella fastidiosa 9a5c] >gi|11387145|sp|Q9PEB6|SYK_XYLFA Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|9106069|gb|AAF83922.1|AE003947_2 lysyl-tRNA synthetase [Xylella fastidiosa 9a5c] (506 aa)
Score = 964, Expect = 3.8e-102, Identities = 204/485 (42%), Positives = 300/485 (61%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           F++  LI   + K L    Q       V R     D    FA ++T        + + +++AGR++A R     +F  I+D  G  Q  +    + +     F KVLD+GDI+ + G   RT+ GEL++ V  +++++KAL+PLP+KWHGL D E R R RYVDLIV  +S ++F+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF+T+HN L+   YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M L E + +  A+S L    V     +I L   FRR  M + +      +   E           ++  +K  K     G ++   FE   E   IQPTF+  HP+++SPL+++    PG+T RFELFIN KE AN F+ELNDP +Q  RF+ QV+ K  G+DEA+  D D+I ALEYG+ PT GLG+G+DR++ML T  +SIRDVLLFP+M+ ++
  S:    12 FDENALIAERRAKLLALRAQGVAYPNDVKREHYAADVQVAFANVETWTAEALEASGDRVRMAGRLMAKRLMGKASFAQIQDESGRIQLLIQSNVLGEDSYAAF-KVLDVGDIIAVEGGLTRTRTGELSVKVNVLRLLTKALRPLPDKWHGLTDVEQRYRQRYVDLIVTPESREIFIKRSKIIRALRTWLDARLFLEVETPMMHYIPGGAAAKPFVTYHNALDLELYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYSTYHEVMDLAETMIRDTAQSVLGTTQVIWDGAQIDLGPIFRRWRMDEAVCHHNPEISVAECTDRDALLLHCERLKIKV-KSSYGWGRLLLSIFEATVEHTLIQPTFITDHPVEISPLARESDIEPGYTDRFELFINGKEIANGFSELNDPEEQAMRFQKQVEAKEGGDDEAMYYDADYIRALEYGMAPTGGLGIGVDRLVMLLTGSTSIRDVLLFPYMRPER 506
>gi|161524327|ref|YP_001579339.1| lysyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] >gi|189350917|ref|YP_001946545.1| class II lysyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] >gi|160341756|gb|ABX14842.1| lysyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] >gi|189334939|dbj|BAG44009.1| class II lysyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] (508 aa)
Score = 964, Expect = 3.8e-102, Identities = 205/475 (43%), Positives = 297/475 (62%)
  Q:    12 RREKLKNLQEAN-QDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNN---IKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVA-KSLKKPVVKMGENEIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKH---QSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMK 486
           RR+KL+ L+E     P +     R     +  +KFA+        N   + +AGR++  R     +F  ++D  G  QF++    V     + F K  DLGDIV   G  FRT KGEL++   +++++SKAL+PLP+K+HGL D+E+R R RYVDLIV  ++   F  R + +  IR+FM    ++EVETP+LHPI GGA A+PF+T HN L+   +LRIA EL LK+LIVGGF++V+EI R FRNEG+   HNPEFT ME YAAY +  ++M  TE L +  A  +L    ++    E+ L + F R+ +   I K        ++  N   +   K+  V   +     + +G +    FEE  E++  +PTF+  +P++VSPL++     PG T+RFELFI  +E AN F+ELNDP DQ  RF+ QV++K  G++EA+  D D+I ALEYG+PPT G G+GIDR++ML T+  +IRDVLLFPH++
  S:    22 RRDKLRALREQGVAYPNDFRPTHRA---AELQAKFAESDKEALEANPFEVAVAGRMMLKRVMGKASFATVQDGSGQIQFFVTPNDVGAETYDAFKK-WDLGDIVAARGVLFRTNKGELSVKCTELRLLSKALRPLPDKFHGLSDQEMRYRQRYVDLIVTPETRDTFRARTKTIASIRKFMSDAEFMEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTEQLIRQAAIDALGTATIQYQGRELDLAKPFHRLTITQAIQKYAPQYTDGQLSDNAYLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAESQLWEPTFIIDYPVEVSPLARASDTVPGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMYFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLR 505
>gi|71897687|ref|ZP_00679932.1| Lysyl-tRNA synthetase, class-2 [Xylella fastidiosa Ann-1] >gi|71732590|gb|EAO34643.1| Lysyl-tRNA synthetase, class-2 [Xylella fastidiosa Ann-1] (506 aa)
Score = 963, Expect = 4.0e-102, Identities = 204/485 (42%), Positives = 301/485 (62%)
  Q:     5 FNDQELIRREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKT------HNTNNNIKLAGRVVALR----QTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLPEKWHGLEDEELRARHRYVDLIVNKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNTLERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDSTHNPEFTSMEVYAAYENMEYMMRLTENLFKYVAKS-LKKPVVKMGENEIYLTQKFRRIHMVDFI-KQETGVDFWEVKSNQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSKKDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQVKEKSLGNDEAVEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDKK 489
           F++  LI   + K L    Q       V R     D  + FA ++T        +++ +++AGR++A R     +F  I+D  G  Q  +    + +     F KVLD+GDI+ + G   RT+ GEL++ V  +++++KAL+PLP+KWHGL D E R R RYVDLIV  +S ++F+ R +I++ +R ++D++ +LEVETP++H I GGA A+PF+T+HN L+   YLR+A EL LK+L+VGG ++VYEI R FRNEG+ + HNPEFT +E+Y AY     +M L E + +  A+S L    V     +I L   FRR  M D +      +   E           ++  +K  K     G ++   FE   E   IQPTF+  HP+++SPL+++     G+T RFELFIN KE AN F+ELNDP +Q  RF+ QV+ K  G+DEA+  D D+I ALEYG+ PT GLG+G+DR++ML T  +SIRDVLLFP+M+ ++
  S:    12 FDENALIAERRAKLLALRAQGVAYPNDVKREHYAADVQAAFANVETWTAETLEASSHRVRMAGRLMAKRLMGKASFAQIQDESGRIQLLIQSNVLGEDSYAAF-KVLDVGDIIAVEGGLTRTRTGELSVKVNVLRLLTKALRPLPDKWHGLTDVEQRYRQRYVDLIVTPESREIFIKRSKIIRALRTWLDARLFLEVETPMMHYIPGGAAAKPFVTYHNALDLELYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYSTYHEVMDLAETMIRDTAQSVLGTTQVIWDGAQIDLGPIFRRWRMDDAVCHHNPEISVAECTDRDALLLHCERLKIKV-KSSYGWGRLLLSIFEATVEHTLIQPTFITDHPVEISPLARESDIESGYTDRFELFINGKEIANGFSELNDPEEQAMRFQKQVEAKEGGDDEAMYYDADYIRALEYGMAPTGGLGIGVDRLVMLLTGSTSIRDVLLFPYMRPER 506
>gi|116328407|ref|YP_798127.1| lysine--tRNA ligase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331136|ref|YP_800854.1| lysine--tRNA ligase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281115|sp|Q04SM4|SYK_LEPBJ Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|122283805|sp|Q050Q1|SYK_LEPBL Lysyl-tRNA synthetase (Lysine--tRNA ligase) (LysRS) >gi|116121151|gb|ABJ79194.1| Lysine--tRNA ligase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124825|gb|ABJ76096.1| Lysine--tRNA ligase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (495 aa)
Score = 963, Expect = 4.0e-102, Identities = 211/482 (43%), Positives = 309/482 (64%)
  Q:     5 FNDQELI--RREKLKNLQEANQDPYEIEKVSRTMTIGDFNSKFAKLKTHNTNNNIKLAGRV----VALRQTFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKVLDLGDIVEIFGSPFRTQKGELTLDVKKIKIVSKALKPLP---EK----W