>gi|26553538|ref|NP_757472.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma penetrans HF-2] >gi|26453544|dbj|BAC43876.1| ribonucleoside diphosphate reductase subunit alpha [Mycoplasma penetrans HF-2] (725 aa)
Score = 3619, Expect = 0.0e+00, Identities = 713/713 (100%), Positives = 713/713 (100%)
  Q:    13 IIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           IIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI
  S:    13 IIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
>gi|50365345|ref|YP_053770.1| ribonucleotide-diphosphate reductase subunit alpha [Mesoplasma florum L1] >gi|50363901|gb|AAT75886.1| ribonucleoside-diphosphate reductase alpha chain [Mesoplasma florum L1] (721 aa)
Score = 2456, Expect = 0.0e+00, Identities = 463/710 (65%), Positives = 574/710 (80%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + D Y++LNA  K+    G+  F+ D+ A + YL+  ++P   KF S+KE++EYL    YY+  +  KY+   +  I + A  ++  F SFMGAMKFY +Y LK+FD + Y E+FEDR V NAL  G GN + A   L ++M GR+Q ATPTFLNAGKKQRGEYVSCYLLRVEDNMESI RA TT LQLSKRGGGVA CLTNLRE GAPIK I NQATG+IPVMKILED FSYANQLGQRQGAGAVYLNA HPD++ FLD+KRENADEKIRIKSLSLG+V+PDI F LA++N++MALFSPYD++REYGK MSDISIT+EY+NL+ NPNI K YI+ARK F  +AE+ FESGYP+ILFDD  N  N+ A   RI+MSNLC+EI Q++TPS  N DL+++ +G+D+CCNLGSLNIAKVME GA F + ++++I ALD ++  +DLSSAP+I+ GN KN AVGLGAMNLHGFLATN I+Y+S EAVDFTNMFFY MAY+A+KAS++ A + G  F+ F+ +++ADGS+F+KYT+C E+ WTP+T+RV+EL  +Y + IPT++DWI+L E IKK G+ANSHLMAVAPTGSISYLSSCTPSLQP+V+PIE+RKEGK+GR+YVPAY I+ +N  YYA GAYE+G  PIIDI +AAQQHVDQAIS+TLF+T+  TTRDLNKAYI+AF KKC SIYY+R+RQEVL+DSE  +EC  CVI
  S:    14 ESDEYVTLNARAKIL-AAGSDNFKLDVDAAKAYLKHHVEPRLVKFGSVKERIEYLVSNGYYEEELINKYTIEQIEEITDIAYGFHREFPSFMGAMKFYNSYGLKTFDGQKYLENFEDRAVMNALFLGNGNFESATKTLRQLMLGRFQPATPTFLNAGKKQRGEYVSCYLLRVEDNMESICRAVTTSLQLSKRGGGVALCLTNLRELGAPIKQIANQATGVIPVMKILEDSFSYANQLGQRQGAGAVYLNAHHPDVMSFLDTKRENADEKIRIKSLSLGLVIPDITFELAQKNEEMALFSPYDVEREYGKAMSDISITQEYQNLVKNPNIKKTYINARKFFLTVAELHFESGYPYILFDDTVNNNNAHAATGRIVMSNLCSEIAQVSTPSTFNDDLSFKSMGDDICCNLGSLNIAKVMESGAEFAEVIEHSINALDLVSRTSDLSSAPSIQQGNKKNHAVGLGAMNLHGFLATNFIWYNSIEAVDFTNMFFYAMAYNAFKASHKLALQYG-TFDGFETSQFADGSWFNKYTKCAEDKWTPETQRVRELFAQYNVTIPTQKDWIELVELIKKDGIANSHLMAVAPTGSISYLSSCTPSLQPVVAPIEVRKEGKLGRIYVPAYNINFDNMAYYALGAYEVGPMPIIDIVAAAQQHVDQAISLTLFMTDQVTTRDLNKAYIHAFKKKCASIYYVRVRQEVLEDSEN-YECDACVI 721
>gi|76788702|ref|YP_329138.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus agalactiae A909] >gi|77406063|ref|ZP_00783139.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae H36B] >gi|76563759|gb|ABA46343.1| ribonucleoside-diphosphate reductase, alpha chain [Streptococcus agalactiae A909] >gi|77175343|gb|EAO78136.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae H36B] (722 aa)
Score = 2379, Expect = 0.0e+00, Identities = 461/712 (64%), Positives = 571/712 (80%)
  Q:    14 IVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEK-------------LFECTTCVI 725
           +   D+Y+SLNA  +  D  GN+ F +D  AVE+Y+   ++PN   F S+ EKL+YL   NYY+ ++ K+Y+  F+  IFE A    F F +FMGA+KFY  YALK+ DN+ Y EH+EDR+V NAL    G+E+ A   +D+M+  R+Q ATPTFLNAGKK+RGEY+SCYLLR+EDNMESI RA +T LQLSKRGGGVA CLTNLREFGAPIKGIKNQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ NKDMALFSPYDI+R YGKPMSDISITEEYE LL N +I K +ISARKLFQ IAE+ FESGYP+ILF+D  N KN      RI+MSNLC+EI Q+NT S  + DLT+ ++G DVCCNLGS+NIA+ M+  A+F K +  +I+ALD ++  +DL SAP+I+ GN+ N AVGLGAMNLHGFLATN IYYDS+EA+DFT+ FFY MAY+A+KASN  AKE G  FE F  + YADGSYF +YT  E+N+  PKT+RVK LL EY L +P+++DW +L + IK+ GLAN+HL+AVAPTGSISYLSSCTPSLQP+VSP+E+RKEG +GRVYVPAYKID +NY+YY KGAYE+G   II+I +AAQ+HVDQAIS+TLF+T+ ATTRDLNKAYI AF +KC SIYY+R+RQ++L+ SE              L +C +C+I
  S:     1 MTQSDAYLSLNAKTRFRDRTGNYHFASDKEAVEQYMIEHVEPNTMAFTSLIEKLDYLVSNNYYESDLLKQYNLEFICQIFEHAYAKKFTFLNFMGALKFYNAYALKTEDNRYYLEHYEDRVVMNALFLAAGDEKAAYDLVDDMLANRFQPATPTFLNAGKKRRGEYISCYLLRIEDNMESISRAISTSLQLSKRGGGVALCLTNLREFGAPIKGIKNQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLSLGLVIPDITFELAKANKDMALFSPYDIERVYGKPMSDISITEEYETLLANADIRKTFISARKLFQTIAELHFESGYPYILFEDTVNAKNPHKKEGRIVMSNLCSEIAQVNTASQFSEDLTFTKVGHDVCCNLGSINIARAMDQAADFEKLIANSIRALDRVSRTSDLDSAPSIKKGNAANHAVGLGAMNLHGFLATNHIYYDSQEAIDFTDCFFYAMAYYAFKASNHLAKEKG-TFEGFSESSYADGSYFYQYT--EQNF-EPKTQRVKNLLAEYGLTLPSQEDWRKLVQSIKEIGLANAHLLAVAPTGSISYLSSCTPSLQPVVSPVEVRKEGALGRVYVPAYKIDADNYVYYKKGAYEVGPEAIINIAAAAQKHVDQAISLTLFMTDQATTRDLNKAYIQAFKQKCASIYYVRVRQDILEGSESYDDDMLDDFTSSDLEDCQSCMI 722
>gi|77411320|ref|ZP_00787669.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae CJB111] >gi|77162656|gb|EAO73618.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae CJB111] (722 aa)
Score = 2379, Expect = 0.0e+00, Identities = 461/712 (64%), Positives = 571/712 (80%)
  Q:    14 IVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEK-------------LFECTTCVI 725
           +   D+Y+SLNA  +  D  GN+ F +D  AVE+Y+   ++PN   F S+ EKL+YL   NYY+ ++ K+Y+  F+  IFE A    F F +FMGA+KFY  YALK+ DN+ Y EH+EDR+V NAL    G+E+ A   +D+M+  R+Q ATPTFLNAGKK+RGEY+SCYLLR+EDNMESI RA +T LQLSKRGGGVA CLTNLREFGAPIKGIKNQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ NKDMALFSPYDI+R YGKPMSDISITEEYE LL N +I K +ISARKLFQ IAE+ FESGYP+ILF+D  N KN      RI+MSNLC+EI Q+NT S  + DLT+ ++G DVCCNLGS+NIA+ M+  A+F K +  +I+ALD I+  +DL SAP+I+ GN+ N AVGLGAMNLHGFLATN IYYDS+EA+DFT+ FFY MAY+A+KASN  AKE G  FE F  + YADGSYF +YT  E+N+  PKT+RVK LL EY L +P+++DW +L + IK+ GLAN+HL+AVAPTGSISYLSSCTPSLQP+VSP+E+RKEG +GRVYVPAYKID +NY+YY KGAYE+G   II+I +AAQ+H+DQAIS+TLF+T+ ATTRDLNKAYI AF +KC SIYY+R+RQ++L+ SE              L +C +C+I
  S:     1 MTQSDAYLSLNAKTRFRDRTGNYHFASDKEAVEQYMIEHVEPNTMTFTSLIEKLDYLVSNNYYESDLLKQYNLEFICQIFEHAYAKKFAFLNFMGALKFYNAYALKTEDNRYYLEHYEDRVVMNALFLAAGDEKAAYDLVDDMLANRFQPATPTFLNAGKKRRGEYISCYLLRIEDNMESISRAISTSLQLSKRGGGVALCLTNLREFGAPIKGIKNQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLSLGLVIPDITFELAKANKDMALFSPYDIERVYGKPMSDISITEEYETLLANADIRKTFISARKLFQTIAELHFESGYPYILFEDTVNAKNPHKKEGRIVMSNLCSEIAQVNTASQFSEDLTFTKVGHDVCCNLGSINIARAMDQAADFEKLIANSIRALDRISRTSDLDSAPSIKKGNAANHAVGLGAMNLHGFLATNHIYYDSQEAIDFTDCFFYAMAYYAFKASNHLAKEKG-TFEGFSESSYADGSYFYQYT--EQNF-EPKTQRVKNLLAEYGLTLPSQEDWRKLVQSIKEIGLANAHLLAVAPTGSISYLSSCTPSLQPVVSPVEVRKEGALGRVYVPAYKIDADNYVYYKKGAYEVGPEAIINIAAAAQKHIDQAISLTLFMTDQATTRDLNKAYIQAFKQKCASIYYVRVRQDILEGSESYDDDMLDDFTSSDLEDCQSCMI 722
>gi|22536603|ref|NP_687454.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus agalactiae 2603V/R] >gi|76798640|ref|ZP_00780866.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 18RS21] >gi|77407709|ref|ZP_00784464.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae COH1] >gi|22533440|gb|AAM99326.1|AE014211_3 ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 2603V/R] >gi|76586005|gb|EAO62537.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 18RS21] >gi|77173708|gb|EAO76822.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae COH1] (721 aa)
Score = 2377, Expect = 0.0e+00, Identities = 460/712 (64%), Positives = 571/712 (80%)
  Q:    14 IVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEK------------LFECTTCVI 725
           +   D+Y+SLNA  +  D  GN+ F +D  AVE+Y+   ++PN   F S+ EKL+YL   NYY+ ++ K+Y+  F+  IFE A    F F +FMGA+KFY  YALK+ DN+ Y EH+EDR+V NAL    G+E+ A   +D+M+  R+Q ATPTFLNAGKK+RGEY+SCYLLR+EDNMESI RA +T LQLSKRGGGVA CLTNLREFGAPIKGIKNQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ NKDMALFSPYDI+R YGKPMSDISITEEYE LL N +I K +ISARKLFQ IAE+ FESGYP+ILF+D  N KN      RI+MSNLC+EI Q+NT S  + DLT+ ++G DVCCNLGS+NIA+ M+  A+F K +  +I+ALD ++  +DL SAP+I+ GN+ N AVGLGAMNLHGFLATN IYYDS+EA+DFT+ FFY MAY+A+KASN  AKE G  FE F  + YADGSYF +YT  E+N+  PKT+RVK LL EY L +P+++DW +L + IK+ GLAN+HL+AVAPTGSISYLSSCTPSLQP+VSP+E+RKEG +GRVYVPAYKID +NY+YY KGAYE+G   II+I +AAQ+H+DQAIS+TLF+T+ ATTRDLNKAYI AF +KC SIYY+R+RQ++L+ SE             L +C +C+I
  S:     1 MTQSDAYLSLNAKTRFRDRTGNYHFTSDKEAVEQYMIEHVEPNTMVFTSLIEKLDYLVSNNYYESDLLKQYNLEFICQIFEHAYAKKFAFLNFMGALKFYNAYALKTEDNRYYLEHYEDRVVMNALFLAAGDEKAAYDLVDDMLANRFQPATPTFLNAGKKRRGEYISCYLLRIEDNMESISRAISTSLQLSKRGGGVALCLTNLREFGAPIKGIKNQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLSLGLVIPDITFELAKANKDMALFSPYDIERVYGKPMSDISITEEYETLLANADIRKTFISARKLFQTIAELHFESGYPYILFEDTVNAKNPHKKEGRIVMSNLCSEIAQVNTASQFSEDLTFTKVGHDVCCNLGSINIARAMDQAADFEKLIANSIRALDRVSRTSDLDSAPSIKKGNAANHAVGLGAMNLHGFLATNHIYYDSQEAIDFTDCFFYAMAYYAFKASNHLAKEKG-TFEGFSESSYADGSYFYQYT--EQNF-EPKTQRVKNLLAEYGLTLPSQEDWRKLVQSIKEIGLANAHLLAVAPTGSISYLSSCTPSLQPVVSPVEVRKEGALGRVYVPAYKIDADNYVYYKKGAYEVGSEAIINIAAAAQKHIDQAISLTLFMTDQATTRDLNKAYIQAFKQKCASIYYVRVRQDILEGSESYDDMLDDFTSSDLEDCQSCMI 721
>gi|25010528|ref|NP_734923.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus agalactiae NEM316] >gi|23094881|emb|CAD46099.1| Unknown [Streptococcus agalactiae NEM316] (722 aa)
Score = 2377, Expect = 0.0e+00, Identities = 456/702 (64%), Positives = 564/702 (80%)
  Q:    14 IVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE 715
           +   D+Y+SLNA  +  D  GN+ F +D  AVE+Y+   ++PN   F S+ EKL+YL   NYY+ ++ K+Y+  F+  IFE A    F F +FMGA+KFY  YALK+ DN+ Y EH+EDR+V NAL    G+E+ A   +D+M+  R+Q ATPTFLNAGKK+RGEY+SCYLLR+EDNMESI RA +T LQLSKRGGGVA CLTNLREFGAPIKGIKNQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ NKDMALFSPYDI+R YGKPMSDISITEEYE LL N +I K +ISARKLFQ IAE+ FESGYP+ILF+D  N KN      RI+MSNLC+EI Q+NT S  + DLT+ ++G DVCCNLGS+NIA+ M+  A+F K +  +I+ALD ++  +DL SAP+I+ GN+ N AVGLGAMNLHGFLATN IYYDS+EA+DFT+ FFY MAY+A+KASN  AKE G  FE F  + YADGSYF +YT  E+N+  PKT+RVK LL EY L +P+++DW +L + IK+ GLAN+HL+AVAPTGSISYLSSCTPSLQP+VSP+E+RKEG +GRVYVPAYKID +NY+YY KGAYE+G   II+I +AAQ+H+DQAIS+TLF+T+ ATTRDLNKAYI AF +KC SIYY+R+RQ++L+ SE
  S:     1 MTQSDAYLSLNAKTRFRDRTGNYHFASDKEAVEQYMIEHVEPNTMAFTSLIEKLDYLVSNNYYESDLLKQYNLEFICQIFEHAYAKKFAFLNFMGALKFYNAYALKTEDNRYYLEHYEDRVVMNALFLAAGDEKAAYDLVDDMLANRFQPATPTFLNAGKKRRGEYISCYLLRIEDNMESISRAISTSLQLSKRGGGVALCLTNLREFGAPIKGIKNQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLSLGLVIPDITFELAKANKDMALFSPYDIERVYGKPMSDISITEEYETLLANADIRKTFISARKLFQTIAELHFESGYPYILFEDTVNAKNPHKKEGRIVMSNLCSEIAQVNTASQFSEDLTFTKVGHDVCCNLGSINIARAMDQAADFEKLIANSIRALDRVSRTSDLDSAPSIKKGNAANHAVGLGAMNLHGFLATNHIYYDSQEAIDFTDCFFYAMAYYAFKASNHLAKEKG-TFEGFSESSYADGSYFYQYT--EQNF-EPKTQRVKNLLAEYGLTLPSQEDWRKLVQSIKEIGLANAHLLAVAPTGSISYLSSCTPSLQPVVSPVEVRKEGALGRVYVPAYKIDADNYVYYKKGAYEVGPEAIINIAAAAQKHIDQAISLTLFMTDQATTRDLNKAYIQAFKQKCASIYYVRVRQDILEGSE 699
>gi|77414135|ref|ZP_00790301.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 515] >gi|77159805|gb|EAO70950.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 515] (722 aa)
Score = 2367, Expect = 0.0e+00, Identities = 459/712 (64%), Positives = 569/712 (79%)
  Q:    14 IVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEK-------------LFECTTCVI 725
           +   D+Y+SLNA  +  D  GN+ F +D  AVE+Y+   ++PN   F S+ EKL+YL   NYY+ ++ K+Y+  F+  IFE A    F F +FMGA+KFY  YALK+ DN+ Y EH+EDR+V NAL    G+E+ A   +D+M+  R+Q ATPTFLNAGKK+RGEY+SCYLLR+EDNMESI RA +T LQLSKRGGGVA CLTNLREFGAPIKGIKNQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ NKDMALFSPYDI+R YGKPMSDISITEEYE LL N +I K +ISARKLFQ IAE+ FESGYP+ILF+D  N KN      RI+MSNLC+EI Q+NT S  + DLT+ ++G DVCCNLGS+NIA+ M+  A+F K +  +I+ALD ++  +DL SAP+I+  N+ N AVGLG MNLHGFLATN IYYDS+EA+DFT+ FFY MAY+A+KASN  AKE G  FE F  + YADGSYF +YT  E+N+  PKT+RVK LL EY L +P+++DW +L + IK+ GLAN+HL+AVAPTGSISYLSSCTPSLQP+VSP+E+RKEG +GRVYVPAYKID +NY+YY KGAYE+G   II+I +AAQ+HVDQAIS+TLF+T+ ATTRDLNKAYI AF +KC SIYY+R+RQ++L+ SE              L +C +C+I
  S:     1 MTQSDAYLSLNAKTRFRDRTGNYHFASDKEAVEQYMIEHVEPNTMAFTSLIEKLDYLVSNNYYESDLLKQYNLEFICQIFEHAYAKKFTFLNFMGALKFYNAYALKTEDNRYYLEHYEDRVVMNALFLAAGDEKAAYDLVDDMLANRFQPATPTFLNAGKKRRGEYISCYLLRIEDNMESISRAISTSLQLSKRGGGVALCLTNLREFGAPIKGIKNQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLSLGLVIPDITFELAKANKDMALFSPYDIERVYGKPMSDISITEEYETLLANADIRKTFISARKLFQTIAELHFESGYPYILFEDTVNAKNPHKKEGRIVMSNLCSEIAQVNTGSQFSEDLTFTKVGHDVCCNLGSINIARAMDQAADFEKLIANSIRALDRVSRTSDLDSAPSIKKSNAANHAVGLGVMNLHGFLATNHIYYDSQEAIDFTDCFFYAMAYYAFKASNHLAKEKG-TFEGFSESSYADGSYFYQYT--EQNF-EPKTQRVKNLLAEYGLTLPSQEDWRKLVQSIKEIGLANAHLLAVAPTGSISYLSSCTPSLQPVVSPVEVRKEGALGRVYVPAYKIDADNYVYYKKGAYEVGPEAIINIAAAAQKHVDQAISLTLFMTDQATTRDLNKAYIQAFKQKCASIYYVRVRQDILEGSESYDDDMLDDFTSSDLEDCQSCMI 722
>gi|13508063|ref|NP_110012.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma pneumoniae M129] >gi|2500208|sp|P78027|RIR1_MYCPN Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) >gi|1674206|gb|AAB96160.1| ribonucleoside-diphosphate reductase alpha chain [Mycoplasma pneumoniae M129] (721 aa)
Score = 2349, Expect = 0.0e+00, Identities = 448/710 (63%), Positives = 573/710 (80%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE----KLFECTTCVI 725
           D +SYISLNA  K++ +     F+ DL AVE Y++  +KP  K F+S KE+L++L   +YYD N+   YS      I  KA  Y FR+++FMGA KFY  YALK+FD K Y E++EDR+V N L    GN   AL  L +++T R+Q ATPTFLNAG+K+RGE+VSCYLLR+EDNMESIGRA TT LQLSKR GGVA  LTN+RE GAPIK I+NQ++GIIP+MK+LED FSYANQLGQRQGAGAVYL+A HPD+++FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ N++MALFSPYD+  EYGKP+SDIS+TE Y  LL N  I K +I+ARK FQ +AE+ FESGYP+ILFDD  N +N A  NRI+MSNLC+EI Q +TPS  + DL ++++G D+ CNLGSLNIAK ME G  F + VK AI++LD ++ +++L +AP+I+ GNS+N A+GLGAMNLHGFLATN+IYY+S EA+DFTN+FFYT+AYHA+KAS+E A E G  F+NF+NTK+ADGSYFDKY + E ++WTPKTERVK L ++Y++ IPT+++W +L  +I+K GLANSHL+A+APTGSISYLSSCTPSLQP+VSP+E+RKEG++GR+YVPAY+++ ++Y +Y  GAYE+G  PII+I +AAQQHVDQAIS+TLF+T+ ATTRDLNKAYIYAF K C SIYY+R+RQEVL+DSE    ++ +C  CVI
  S:    15 DLESYISLNAYTKVYGD-----FKMDLHAVEAYIQEHVKPKTKVFHSTKERLDFLVKNDYYDENIINMYSFEQFEEITRKAYAYRFRYANFMGAFKFYNAYALKTFDGKWYLENYEDRVVMNVLFLANGNYNKALKLLKQIITNRFQPATPTFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSKRDGGVALLLTNIRESGAPIKKIENQSSGIIPIMKLLEDSFSYANQLGQRQGAGAVYLHAHHPDVMQFLDTKRENADEKIRIKSLSLGLVIPDITFTLAKNNEEMALFSPYDVYEEYGKPLSDISVTEMYYELLANQRIKKTFINARKFFQTVAELHFESGYPYILFDDTVNRRN-AHPNRIVMSNLCSEIVQPSTPSEFHHDLAFKKVGNDISCNLGSLNIAKAMESGPEFSELVKLAIESLDLVSRVSNLETAPSIQKGNSENHALGLGAMNLHGFLATNQIYYNSPEAIDFTNIFFYTVAYHAFKASSELALEKG-KFKNFENTKFADGSYFDKYIKVEPDFWTPKTERVKALFQKYQVEIPTRENWKELALNIQKNGLANSHLLAIAPTGSISYLSSCTPSLQPVVSPVEVRKEGRLGRIYVPAYQLNKDSYPFYKDGAYELGPEPIINIAAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVRQEVLEDSEDHTIQMQQCEACVI 721
>gi|94987983|ref|YP_596084.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS9429] >gi|94991865|ref|YP_599964.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS2096] >gi|94541491|gb|ABF31540.1| ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS9429] >gi|94545373|gb|ABF35420.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS2096] (726 aa)
Score = 2338, Expect = 0.0e+00, Identities = 436/701 (62%), Positives = 546/701 (77%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           SY+SLNA  +    +G++ F++D  AV +YLE  + PN   FNS+++KL YL  E YY+  +F  Y +  +   F  A    +RF + MGAMKFY +YALK+ D K Y E FEDR V NAL    G++      +D ++  R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+R YGK MSDISITEEY+ LL NP I K YISARKLFQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ ++DL+ AP++E GN+ N AVGLGAMNLHGFLATN IYYD++EAVDFT++FF+ MAYHA+KAS + AKE G  F  F  + YADG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+ID  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     7 SYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQMAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSYALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKRVYGKDMSDISITEEYDKLLANPAIKKTYISARKLFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAANHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYHAFKASCQLAKEKG-AFAGFSLSTYADGTYFAKYLQEDAK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 704
>gi|42561372|ref|NP_975823.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492870|emb|CAE77465.1| ribonucleoside-diphosphate reductase alpha subunit [Mycoplasma mycoides subsp. mycoides SC str. PG1] (723 aa)
Score = 2334, Expect = 0.0e+00, Identities = 455/719 (63%), Positives = 562/719 (78%)
  Q:     7 NNNKNNIIVDK--DSYISLNATIKLF-DENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSA-LNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           N NKN I++D   D YI LNA  K+F  +  NFQ   D+ A E YL+  I+P  KKF+S+KE+L+YL    YYD  +  KYS   +  +   A ++N  F SFMGA+KF+  Y LK+FD   Y E + DR++ NAL  G GN   A   L +MM GR+Q ATPTFLNA KK RGEYVSCYLLR EDNMESI R  +T LQLSKRGGGVA CLTNLRE G+PIK I   ++G IPVMKILED F+YA+QLGQRQGAGAVY++A HPDI+  LD+KRENADEKIRIKSLSLG+V+PDI F LAR+NKDMALFSPYD+Q+ YGKP+SDISITE+Y  +L NPNI K YISARK F  +AE+ FESGYP+ILF+D  N +N+     RIIMSNLC+EI Q++T S  N+DL++ + GED+CCNLGSLNI K+M+ G  F  ++  AI ALD ++  +DLS++P+I+ GN+ N AVGLGAMNLHGFLA NKI YDS EAVDFTNMFFYT+AY+A+KASN+ A+E    F +F  +++ADGS+FDKYT+CE + WTP+T RVKEL K+Y + IP++ DWIQL E+IKK GLANSHLMAVAP+GSISYLSSCTPSLQP+VS +E+RKEGK+GRVYVPAY+I+ +N  YYA GAYE+G +PII+I +AAQQHVDQAIS+TLF+T+ ATTRDLNKAY+ AF + C SIYY+RIRQ+VL+DSE  +EC  C I
  S:     5 NENKNTIVLDDVDDEYIKLNARSKIFLKDQDNFQL--DVKAAELYLKNYIEPRMKKFSSLKERLDYLLENQYYDSEILNKYSFDQISQLNHYAYSFNHHFPSFMGALKFFNAYGLKTFDTTMYLETYTDRVLMNALFLGNGNFNKAKDLLKDMMLGRFQPATPTFLNAAKKHRGEYVSCYLLRTEDNMESICRTISTSLQLSKRGGGVAICLTNLRETGSPIKNISGLSSGPIPVMKILEDSFTYADQLGQRQGAGAVYISAHHPDIISVLDTKRENADEKIRIKSLSLGLVIPDITFELARDNKDMALFSPYDVQKTYGKPLSDISITEKYYEMLENPNIKKTYISARKFFLTVAELHFESGYPYILFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTASEYNSDLSFIKTGEDICCNLGSLNIDKMMKSGKEFSDSIYNAISALDIVSRNSDLSASPSIQKGNALNHAVGLGAMNLHGFLAINKIMYDSPEAVDFTNMFFYTVAYNAFKASNKLAQEFE-KFASFDQSRFADGSWFDKYTKCEFDKWTPQTNRVKELFKDYDVQIPSQADWIQLVEEIKKTGLANSHLMAVAPSGSISYLSSCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAMGAYELGPDPIINIVAAAQQHVDQAISLTLFMTDKATTRDLNKAYVNAFKQGCSSIYYVRIRQDVLEDSEN-YECDACKI 723
>gi|195977667|ref|YP_002122911.1| ribonucleotide reductase of class Ib (aerobic) alpha subunit NrdE [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974372|gb|ACG61898.1| ribonucleotide reductase of class Ib (aerobic) alpha subunit NrdE [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (724 aa)
Score = 2332, Expect = 0.0e+00, Identities = 435/705 (61%), Positives = 546/705 (77%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECT 721
           K+SY+SLNA  +    +G + F++D  AV++YLE  + P    F+S++EK  YL   +YYD  + K YS+  +   F  A    F F S MGAMKFY +YALK+ D   Y EHFEDR V NAL    G+       +D++++ R+Q ATPTFLNAGKK+RGEY+SCYLLR+EDNMESI RA  T LQLSKRGGGVA CLTNLRE G+PIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYLN  HP+IL FLD+KRENADEKIRIKSL+LGVV+PDI F LARENKDMALFSPYDI+R YGK MSDI+ITEEY+ L+ NP I K YISARKLFQ IAE+ FESGYP++LFDD  N++N      RI+MSNLC+EI Q++T S    DLT++Q+GED+CCNLGS+NIA+ M+  A F + +  +I+ALD ++  +D+S AP++E GN+ N AVGLGAMNLHGFLATN I+YDS EAVDFT++FF+TMAY+A+KAS++ AKE G  F  F+ + YADGSYF +Y   E     PKT +V  LL+ Y   +P+  DW +L   I++ GLAN+HLMAVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+I  +NY YY +GAYE+G  PII+I +AAQ+HVDQAIS+TLF+T+ ATTRDLN+AYI+AF  KC SIYY+R+RQ++L+ SE+  E T
  S:     4 KESYLSLNALTRFKRADGTYHFDSDKEAVQRYLEEHVYPQSLSFDSLEEKWRYLVAHDYYDQEILKAYSAECITEAFTYAYQQKFSFLSLMGAMKFYQSYALKTLDGSQYLEHFEDRAVMNALFLANGDPDLVRDLIDQILSRRFQPATPTFLNAGKKRRGEYISCYLLRIEDNMESISRAIGTSLQLSKRGGGVALCLTNLREVGSPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLNVHHPEILTFLDTKRENADEKIRIKSLALGVVIPDITFQLARENKDMALFSPYDIKRVYGKDMSDIAITEEYDRLVANPAIKKTYISARKLFQLIAELHFESGYPYLLFDDTVNKRNPHPQKGRIVMSNLCSEIAQVSTASTFEEDLTFKQIGEDICCNLGSINIAEAMKHAAGFEQLIATSIRALDHVSRASDVSCAPSVEKGNAANHAVGLGAMNLHGFLATNHIFYDSAEAVDFTDLFFHTMAYYAFKASSQLAKEKG-AFAGFEQSTYADGSYFARYLTKEAK---PKTAKVAALLERYGFRVPSVADWQELVATIQETGLANAHLMAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGHLGRIYVPAYQISDDNYAYYERGAYEVGPEPIINIVAAAQKHVDQAISLTLFMTDQATTRDLNRAYIHAFKLKCASIYYVRVRQDILEGSEQYEEDT 705
>gi|83319418|ref|YP_424095.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283304|gb|ABC01236.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (720 aa)
Score = 2329, Expect = 0.0e+00, Identities = 452/719 (62%), Positives = 566/719 (78%)
  Q:     7 NNNKNNIIVDK--DSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSA-LNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           N NKN I++D   D YI LNA  K+F ++ +  F+ D+ A E YL+  I+P  KKF+S+KE+L+YL    YYD  +  KYS   +  + + A ++N  F SFMGA+KF+  Y LK+FD   Y E + DR++ NAL  G GN   A   L +MM GR+Q ATPTFLNA KK RGEYVSCYLLR EDNMESI R  +T LQLSKRGGGVA CLTNLRE G+PIK I   ++G IPVMKILED F+YA+QLGQRQGAGAVY++A HPDI+  LD+KRENADEKIRIKSLSLG+V+PDI F LAR+NKDMALFSPYD+Q+ YGKP+SDISITE+Y  +L NPNI K YISARK F  +AE+ FESGYP+ILF+D  N +N+     RIIMSNLC+EI Q++T S  ++DL++ + GED+CCNLGSLNI K+M+ G  F  ++  AI ALD ++  +DLS++P+I+ GN++N AVGLGAMNLHGFLATNKI YDS EAVDFTNMFFYT+AY+A+KASN+ A+E    F +F  +++ADGS+FDKYT+CE + WTP+T RVKEL K+Y + IP++ DWI+L E+IKK GLANSHLMAVAPTGSISYLSSCTPSLQP+VS +E+RKEGK+GRVYVPAY+I+ +N  YYA GAYE+G +PII+I +AAQQHVDQAIS+TLF+T+ ATTRDLN+AY+ AF + C SIYY+RIRQ+VL+DSE  +EC  C I
  S:     2 NENKNTIVLDDVDDEYIKLNARSKIFSKDQD-NFQLDIKAAELYLKNYIEPRMKKFSSLKERLDYLLENQYYDSEILNKYSFDQISQLNDYAYSFNHHFPSFMGALKFFNAYGLKTFDTTMYLETYTDRVLMNALFLGNGNFTKAKNLLKDMMLGRFQPATPTFLNAAKKHRGEYVSCYLLRTEDNMESICRTISTSLQLSKRGGGVAICLTNLRETGSPIKNISGLSSGPIPVMKILEDSFTYADQLGQRQGAGAVYISAHHPDIISVLDTKRENADEKIRIKSLSLGLVIPDITFELARDNKDMALFSPYDVQKVYGKPLSDISITEKYYEMLENPNIKKTYISARKFFLTVAELHFESGYPYILFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTASEYSSDLSFIKTGEDICCNLGSLNIDKMMKSGKEFSDSIYNAISALDIVSRNSDLSASPSIKKGNAENHAVGLGAMNLHGFLATNKIMYDSPEAVDFTNMFFYTVAYNAFKASNKLAQEFE-KFASFDQSRFADGSWFDKYTKCEFDKWTPQTNRVKELFKDYDVQIPSQTDWIELVEEIKKTGLANSHLMAVAPTGSISYLSSCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAMGAYELGPDPIINIVAAAQQHVDQAISLTLFMTDKATTRDLNRAYVNAFKQGCSSIYYVRIRQDVLEDSEN-YECDACKI 720
>gi|94993747|ref|YP_601845.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS10750] >gi|94547255|gb|ABF37301.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS10750] (726 aa)
Score = 2329, Expect = 0.0e+00, Identities = 435/701 (62%), Positives = 545/701 (77%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           SY+SLNA  +    +G++ F++D  AV +YLE  + PN   FNS+++KL YL  E YY+  +F  Y +  +   F  A    +RF + MGAMKFY +YALK+ D K Y E FEDR V NAL    G++      +D ++  R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+R YGK MSDISITEEY+ LL NP I K YISARK FQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ L+DL+ AP++E GN+ N AVGLGAMNLHGFLATN IYYD++EAVDFT++FF+ MAY+A+KAS + AKE G  F  F  + YADG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+ID  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     7 SYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQMAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSYALKTLDGKHYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISARKFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRLSDLNCAPSVETGNAANHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKG-AFAGFSLSTYADGTYFAKYLQEDAK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 704
>gi|50913720|ref|YP_059692.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS10394] >gi|50902794|gb|AAT86509.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS10394] (726 aa)
Score = 2325, Expect = 0.0e+00, Identities = 434/701 (61%), Positives = 544/701 (77%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           SY+SLNA  +    +G++ F++D  AV +YLE  + PN   FNS+++KL YL  E YY+  +F  Y +  +   F  A    +RF + MGAMKFY +YALK+ D K Y E FEDR V NAL    G++      +D ++  R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+  YGK MSDISITEEY+ LL NP I K YISARKLFQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ ++DL+ AP++E GN+ N AVGLG MNLHGFLATN IYYD++EAVDFT++FF+ MAYHA+KAS + AKE G  F  F  + YADG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+ID  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     7 SYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQMAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKDAFHYAYQQGYRFLNLMGAMKFYQSYALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKCAYGKDMSDISITEEYDKLLANPAIKKTYISARKLFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVEAGNAANHAVGLGVMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYHAFKASCQLAKEKG-AFAGFSLSTYADGTYFAKYLQEDAK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 704
>gi|21909839|ref|NP_664107.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS315] >gi|28896466|ref|NP_802816.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes SSI-1] >gi|71903002|ref|YP_279805.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS6180] >gi|139474320|ref|YP_001129036.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes str. Manfredo] >gi|21904025|gb|AAM78910.1| putative ribonucleoside-diphosphate reductase large chain [Streptococcus pyogenes MGAS315] >gi|28811717|dbj|BAC64649.1| putative ribonucleoside diphosphate reductase, large chain [Streptococcus pyogenes SSI-1] >gi|71802097|gb|AAX71450.1| ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS6180] >gi|134272567|emb|CAM30833.1| ribonucleoside-diphosphate reductase alpha subunit [Streptococcus pyogenes str. Manfredo] (726 aa)
Score = 2325, Expect = 0.0e+00, Identities = 434/701 (61%), Positives = 545/701 (77%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           SY+SLNA  +    +G++ F++D  AV +YLE  + PN   FNS+++KL YL  E YY+  +F  Y +  +   F  A    +RF + MGAMKFY +YALK+ D K Y E FEDR V NAL    G++      +D ++  R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+R YGK MSDISITEEY+ LL NP I K YISARK FQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ ++DL+ AP++E GN+ N AVGLGAMNLHGFLATN IYYD++EAVDFT++FF+ MAY+A+KAS + AKE G  F  F  + YADG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+ID  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     7 SYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQMAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSYALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISARKFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAANHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKG-AFAGFSLSTYADGTYFAKYLQEDAK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 704
>gi|94989857|ref|YP_597957.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS10270] >gi|94543365|gb|ABF33413.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS10270] (726 aa)
Score = 2324, Expect = 0.0e+00, Identities = 434/701 (61%), Positives = 545/701 (77%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           SY+SLNA  +    +G++ F++D  AV +YLE  + PN   FNS+++KL YL  E YY+  +F  Y +  +   F  A    +RF + MGAMKFY +YALK+ D K Y E FEDR V NAL    G++      +D ++  R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+R YGK MSDISITEEY+ LL NP I K YISARK FQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ ++DL+ AP++E GN+ N AVGLGAMNLHGFLATN IYYD++EAVDFT++FF+ MAY+A+KAS + AKE G  F  F  + YADG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+ID  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     7 SYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQMAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSYALKTLDGKHYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKRVYGKDMSDISITEEYDKLLANPAIKKTYISARKFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAANHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKG-AFAGFSLSTYADGTYFAKYLQEDAK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 704
>gi|15674554|ref|NP_268728.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes M1 GAS] >gi|71910162|ref|YP_281712.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS5005] >gi|13621660|gb|AAK33449.1| ribonucleoside-diphosphate reductase, large chain [Streptococcus pyogenes M1 GAS] >gi|71852944|gb|AAZ50967.1| ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS5005] (726 aa)
Score = 2322, Expect = 0.0e+00, Identities = 433/701 (61%), Positives = 545/701 (77%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           SY+SLNA  +    +G++ F++D  AV +YLE  + PN   FNS+++KL YL  E YY+  +F  Y +  +   F  A    +RF + MGAMKFY +YALK+ D K Y E FEDR V NAL    G++      +D ++  R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+R YGK MSDISITEEY+ LL NP I K YISARK FQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ ++DL+ AP++E GN+ N AVGLGAMNLHGFLATN IYYD++EAVDFT++FF+ MAY+A+KAS + AKE G  F  F  + Y+DG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+ID  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     7 SYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPNQMAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSYALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISARKFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAANHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKG-AFAGFSLSTYSDGTYFAKYLQEDAK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 704
>gi|188159075|ref|ZP_02998509.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma mycoides subsp. mycoides LC str. GM12] (720 aa)
Score = 2321, Expect = 0.0e+00, Identities = 451/717 (62%), Positives = 564/717 (78%)
  Q:     9 NKNNIIVDK--DSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSA-LNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           NKN I++D   D YI LNA  K+F ++ +  F+ D+ A E YL+  I+P  KKF+S+KE+L+YL    YYD  +  KYS   +  + + A ++N  F SFMGA+KF+  Y LK+FD   Y E + DR++ NAL  G GN   A   L +MM GR+Q ATPTFLNA KK RGEYVSCYLLR EDNMESI R  +T LQLSKRGGGVA CLTNLRE G+PIK I   ++G IPVMKILED F+YA+QLGQRQGAGAVY++A HPDI+  LD+KRENADEKIRIKSLSLG+V+PDI F LAR+NKDMALFSPYD+Q+ Y KP+SDISITE+Y  +L NPNI K YISARK F  +AE+ FESGYP+ILF+D  N +N+     RIIMSNLC+EI Q++T S  ++DL++ + GED+CCNLGSLNI K+M+ G  F  ++  AI ALD ++  +DLS+AP+I+ GN++N AVGLGAMNLHGFLATNKI YDS EAVDFTNMFFYT+AY+A+KASN+ A+E    F +F  +++ADGS+FDKYT+CE + WTP+T RVKEL K+Y + IP++ DWIQL E+IKK GLANSHLMAVAPTGSISYLSSCTPSLQP+VS +E+RKEGK+GRVYVPAY+I+ +N  YYA GAYE+G +PII+I +AAQQHVDQAIS+TLF+T+ ATTRDLN+AY+ AF + C SIYY+RIRQ+VL++SE  +EC  C I
  S:     4 NKNTIVLDDVDDEYIKLNARSKIFSKDQD-NFQLDVKAAELYLKNYIEPRMKKFSSLKERLDYLLENKYYDSEILNKYSFDQISQLNDYAYSFNHHFPSFMGALKFFNAYGLKTFDTTMYLETYTDRVLMNALFLGNGNFTKAKNLLKDMMLGRFQPATPTFLNAAKKHRGEYVSCYLLRTEDNMESICRTISTSLQLSKRGGGVAICLTNLRETGSPIKNISGLSSGPIPVMKILEDSFTYADQLGQRQGAGAVYISAHHPDIISVLDTKRENADEKIRIKSLSLGLVIPDITFELARDNKDMALFSPYDVQKVYNKPLSDISITEKYYEMLENPNIKKTYISARKFFLTVAELHFESGYPYILFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTASEYSSDLSFVKTGEDICCNLGSLNIDKMMKSGKEFSDSIYNAISALDIVSRNSDLSAAPSIQKGNAQNHAVGLGAMNLHGFLATNKIMYDSPEAVDFTNMFFYTVAYNAFKASNKLAQEFE-KFASFDESRFADGSWFDKYTKCEFDKWTPQTNRVKELFKDYDVQIPSQTDWIQLVEEIKKTGLANSHLMAVAPTGSISYLSSCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAMGAYELGADPIINIVAAAQQHVDQAISLTLFMTDKATTRDLNRAYVNAFKQGCSSIYYVRIRQDVLENSEN-YECDACKI 720
>gi|12045086|ref|NP_072897.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma genitalium G37] >gi|1350599|sp|P47473|RIR1_MYCGE Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) >gi|3844834|gb|AAC71452.1| ribonucleoside-diphosphate reductase, alpha chain [Mycoplasma genitalium G37] >gi|166078758|gb|ABY79376.1| ribonucleoside-diphosphate reductase, alpha chain [synthetic Mycoplasma genitalium JCVI-1.0] (721 aa)
Score = 2316, Expect = 0.0e+00, Identities = 445/710 (62%), Positives = 564/710 (79%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE----KLFECTTCVI 725
           D +SYIS NA  K++D+     F  DL AVE Y++  +KP  K F+S KE+L++L   +YYD  +   YS      I  KA +Y FR+++FMGA KFY  YALK+FD K Y E++EDR+V N L+   GN   AL  L +++  R+Q ATPTFLNAG+K+RGE+VSCYLLR+EDNMESIGRA TT LQLSKR GGVA  L+NLRE GAPIK I+NQ++GIIP+MK+LED FSY+NQLGQRQGAGAVYL+  HPD+++FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ N+ MALFSPYDI +EYGK +SDIS+TE Y  LL N  I K +ISARK FQ IAE+ FESGYP+ILFDD  N +N A  NRI+MSNLC+EI Q + PS   +DLT++++G D+ CNLGSLNIA+ ME G+   + ++ AI++LD ++ ++ L +AP+I+ GNS+N A+GLGAMNLHGFLATN IYYDS+EAVDFTN+FFYT+AYHA+ ASN+ A E G  F++F+NTK+ADGSYFDKYT+   ++WT KTE+V+ L  +Y++ IPT+++W QL   I+K GLANSHLMA+APTGSISYLSSCTPSLQP+VSP+E+RKEGK+GR+YVPAYK+D +NY Y+  GAYE+G  PII+I +AAQQHVDQAIS+TLF+T+ ATTRDLNKAYIYAF K C SIYY+R+RQ+VLKDSE    K+ +C  C I
  S:    15 DVESYISFNAQAKIYDD-----FAIDLQAVESYIQEHVKPKTKVFHSTKERLDFLIKNDYYDEKIINMYSFEQFEEITHKAYSYRFRYANFMGAFKFYNAYALKTFDGKYYLENYEDRVVMNVLMLANGNFNKALKLLKQIILNRFQPATPTFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSKRDGGVALLLSNLREAGAPIKKIENQSSGIIPIMKLLEDSFSYSNQLGQRQGAGAVYLHCHHPDVMQFLDTKRENADEKIRIKSLSLGLVIPDITFQLAKNNEMMALFSPYDIYQEYGKALSDISVTEMYYELLENQRIKKTFISARKFFQTIAELHFESGYPYILFDDTVNRRN-AHKNRIVMSNLCSEIVQPSLPSEFYSDLTFKKVGSDISCNLGSLNIARAMESGSELAELIQLAIESLDLVSRISSLETAPSIKKGNSENHALGLGAMNLHGFLATNAIYYDSKEAVDFTNIFFYTVAYHAFSASNKLALELG-KFKDFENTKFADGSYFDKYTKVASDFWTCKTEKVQALFDKYQVKIPTQENWKQLVASIQKDGLANSHLMAIAPTGSISYLSSCTPSLQPVVSPVEVRKEGKLGRIYVPAYKLDNDNYQYFKDGAYELGFEPIINIVAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVRQDVLKDSEDHTIKIKDCEVCSI 721
>gi|19745565|ref|NP_606701.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS8232] >gi|19747688|gb|AAL97200.1| ribonucleoside-diphosphate reductase, large chain [Streptococcus pyogenes MGAS8232] (726 aa)
Score = 2316, Expect = 0.0e+00, Identities = 432/701 (61%), Positives = 544/701 (77%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           SY+SLNA  +    +G++ F++D  AV +YLE  + P+   FNS+++KL YL  E YY+  +F  Y +  +   F  A    +RF + MGAMKFY +YALK+ D K Y E FEDR V NAL    G++      +D ++  R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+R YGK MSDISITEEY+ LL NP I K YISARK FQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ ++DL+ AP++E GN+ N AVGLG MNLHGFLATN IYYD++EAVDFT++FF+ MAY+A+KAS + AKE G  F  F  + YADG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+ID  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     7 SYLSLNALTRFKKPDGSYHFDSDKEAVRRYLEEHVSPDQMAFNSLEDKLAYLINEGYYEQAIFDAYPNDLIKEAFHYAYQQGYRFLNLMGAMKFYQSYALKTLDGKQYLETFEDRAVMNALFLADGDQTFVFDVIDAILHRRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISARKFFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVEAGNAANHAVGLGVMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKG-AFAGFSLSTYADGTYFAKYLQEDVK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQIDQANYAYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 704
>gi|161508075|ref|YP_001578042.1| ribonucleotide-diphosphate reductase subunit alpha [Lactobacillus helveticus DPC 4571] >gi|160349064|gb|ABX27738.1| ribonucleoside-diphosphate reductase [Lactobacillus helveticus DPC 4571] (729 aa)
Score = 2315, Expect = 0.0e+00, Identities = 456/711 (64%), Positives = 560/711 (78%)
  Q:    15 VDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLF----------ECTTCVI 725
           ++ DSYISLNA  K  DE GN+ F+ D  A ++YLE  I+P  KKF S++EKL YL   NYYD  V   Y++ F+  IF+ A   NF F +FMGA KFY  YALK+ DNK + E FEDR V NAL    GNE+ AL  + ++++ R+Q ATPTFLNAGKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIK +KN ++GIIPVMK+LED FSYANQLGQRQGAGAVYL+A HP I++FLD+KRENADEK+RIKSLSLGVV+PDI F LA+ENK MALFSPYDI+REYGKPMSDISIT+EY+NLLNNP I K +ISARK FQ IAEVQFESGYP+I+++D  N +N      RI+MSNLC+EI Q+NTPS  N DL++ + G DVCCNLGSLNIA  M      G  V  +++AL+ +A  +DL  AP+I+ GN  NRA+GLGAMNLHGFLATN IYYDS EAV+FT +FFYT+AYHA+K SN+ A++ G  F+ FK++ YA G YF K+   E    +PKT+++KE++ +YKL IPTK+DW +L   IKK G+AN++L+AVAPTGSISYLSSCTPSLQP+V+P+E RKE  +GR+YVPAYKI+ +NY YY KGAYE+G N IIDI +AAQ++VDQ+IS+TLFL +NATTRDLNKAYIYAF K+C SIYY+RIR++VL  SE L           EC  C+I
  S:    12 LNNDSYISLNALTKFKDEKGNYNFKADKEATKQYLENHIEPRMKKFASLEEKLAYLVDNNYYDKKVLDLYTAKFIKEIFKLAYAQNFSFLNFMGAAKFYKAYALKTNDNKQFLERFEDRAVMNALFLADGNEELALNLVKDIISNRFQPATPTFLNAGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLRELGAPIKKMKNLSSGIIPVMKLLEDSFSYANQLGQRQGAGAVYLSAHHPQIMQFLDTKRENADEKVRIKSLSLGVVIPDITFELAKENKKMALFSPYDIKREYGKPMSDISITKEYQNLLNNPCIKKTFISARKFFQTIAEVQFESGYPYIMYEDTVNRRNPQKKLGRIVMSNLCSEIAQVNTPSTYNEDLSFNKTGYDVCCNLGSLNIAAAMNSADKLGSLVSDSVQALNRVARSSDLDCAPSIKKGNKANRAIGLGAMNLHGFLATNHIYYDSPEAVEFTGIFFYTIAYHAFKESNKLAEKYG-AFKGFKDSSYASGDYFKKFIDEEV---SPKTDKIKEIVAKYKLVIPTKEDWEELITKIKKTGIANANLLAVAPTGSISYLSSCTPSLQPVVAPVETRKEAALGRIYVPAYKINKDNYEYYEKGAYEVGPNAIIDITAAAQKYVDQSISLTLFLEDNATTRDLNKAYIYAFKKRCNSIYYVRIREKVLAGSENLTADECLIQNGAECQKCMI 729
>gi|54020061|ref|YP_115672.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma hyopneumoniae 232] >gi|53987234|gb|AAV27435.1| ribonucleoside-diphosphate reductase alpha chain [Mycoplasma hyopneumoniae 232] (720 aa)
Score = 2297, Expect = 0.0e+00, Identities = 447/709 (63%), Positives = 559/709 (78%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + SY+SLNA  K+F  + +   + DLLA EKY+  EI P FK FNS KE++E+L   NYYD  V  +YS   L  +  KA +YN  FSSFMGA KFY+TY LKS DN  YFEHF DR++ N+L  G+G+ Q A   L+++M GR+Q ATPTFLNAGK  RGE+VSCYL+RVEDNMESI RA TT LQLSKRGGGV+  L+NLRE GAPIK I+NQATG+IPVMKILED FSYANQLGQRQGAGAVYLN  HPDIL FLD+KRENADEKIRIKSLSLG+++P+I F LA+ N+ MALFS YD+++ Y K  SDISI+E+Y  +L NP I K +ISARKLF+ IAE+ FESGYP+ILF+DI N++N A  +R++MSNLC+EITQ +TPS    DL+++++G+D+CCNLGSLNI K ME G +F + V Y++ ALD ++  +DLS AP+I+ GN+ N A+GLGAMNLHGFLA N+I+YDSEEA+DFTN+FFYT+A+ A+KAS + AK+ G  F  F+ TK+A G YFDKYT+   N + PKT ++KEL  +Y++ IPT++DWI L E IKK G+ANSHLMA+APTGSISYLSSCTPSLQP+V+P+EIRKEGK+GR+YVP+YK+    Y +Y  GAYE+G  PII+I S AQ+HVDQAISMTLF+T+ ATTRDLN+AYIYAF K C SIYY+RIRQ+VL+DSE    C +C I
  S:    15 EKSYLSLNANSKIFTNHPD-SHKFDLLAAEKYINEEINPKFKFFNSFKERIEFLVQNNYYDPKVLGQYSFQELEKLNTKAWSYNHFFSSFMGAFKFYSTYGLKSNDNLVYFEHFPDRVLLNSLFLGKGDFQKAEKILEQIMLGRFQPATPTFLNAGKLNRGEFVSCYLIRVEDNMESISRAITTSLQLSKRGGGVSVLLSNLREQGAPIKNIENQATGVIPVMKILEDSFSYANQLGQRQGAGAVYLNVHHPDILAFLDTKRENADEKIRIKSLSLGIIIPNITFELAKNNEKMALFSVYDVEKVYQKAFSDISISEKYYQMLANPEIKKTFISARKLFKIIAELHFESGYPYILFEDIVNKEN-AHPDRVVMSNLCSEITQPSTPSTFLPDLSFKEIGKDICCNLGSLNIDKAMESGPDFEQMVYYSVLALDVVSRNSDLSVAPSIQKGNNLNHAIGLGAMNLHGFLAKNEIFYDSEEALDFTNIFFYTLAFSAFKASEKLAKKYG-PFSGFEKTKFASGEYFDKYTKVSPNTFLPKTHKIKELFAKYQVEIPTQEDWIHLVEKIKKTGIANSHLMAIAPTGSISYLSSCTPSLQPVVAPVEIRKEGKLGRIYVPSYKLSPKTYKFYQNGAYELGPIPIINIVSEAQKHVDQAISMTLFMTDKATTRDLNRAYIYAFKKNCKSIYYVRIRQDVLEDSENYETCQSCQI 720
>gi|144227518|gb|AAZ44306.2| ribonucleoside-diphosphate reductase alpha chain [Mycoplasma hyopneumoniae J] (720 aa)
Score = 2297, Expect = 0.0e+00, Identities = 447/709 (63%), Positives = 559/709 (78%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + SY+SLNA  K+F  + +   + DLLA EKY+  EI P FK FNS KE++E+L   NYYD  V  +YS   L  +  KA +YN  FSSFMGA KFY+TY LKS DN  YFEHF DR++ N+L  G+G+ Q A   L+++M GR+Q ATPTFLNAGK  RGE+VSCYL+RVEDNMESI RA TT LQLSKRGGGV+  L+NLRE GAPIK I+NQATG+IPVMKILED FSYANQLGQRQGAGAVYLN  HPDIL FLD+KRENADEKIRIKSLSLG+++P+I F LA+ N+ MALFS YD+++ Y K  SDISI+E+Y  +L NP I K +ISARKLF+ IAE+ FESGYP+ILF+DI N++N A  +R++MSNLC+EITQ +TPS    DL+++++G+D+CCNLGSLNI K ME G +F + V Y++ ALD ++  +DLS AP+I+ GN+ N A+GLGAMNLHGFLA N+I+YDSEEA+DFTN+FFYT+A+ A+KAS + AK+ G  F  F+ TK+A G YFDKYT+   N + PKT ++KEL  +Y++ IPT++DWI L E IKK G+ANSHLMA+APTGSISYLSSCTPSLQP+V+P+EIRKEGK+GR+YVP+YK+    Y +Y  GAYE+G  PII+I S AQ+HVDQAISMTLF+T+ ATTRDLN+AYIYAF K C SIYY+RIRQ+VL+DSE    C +C I
  S:    15 EKSYLSLNANSKIFANHPD-SHKFDLLAAEKYINEEINPKFKFFNSFKERIEFLVQNNYYDPKVLGQYSFQELEKLNTKAWSYNHFFSSFMGAFKFYSTYGLKSNDNLVYFEHFPDRVLLNSLFLGKGDFQKAEKILEQIMLGRFQPATPTFLNAGKLNRGEFVSCYLIRVEDNMESISRAITTSLQLSKRGGGVSVLLSNLREQGAPIKNIENQATGVIPVMKILEDSFSYANQLGQRQGAGAVYLNVHHPDILAFLDTKRENADEKIRIKSLSLGIIIPNITFELAKNNEKMALFSVYDVEKVYQKAFSDISISEKYYQMLANPEIKKTFISARKLFKIIAELHFESGYPYILFEDIVNKEN-AHPDRVVMSNLCSEITQPSTPSTFLPDLSFKEIGKDICCNLGSLNIDKAMESGPDFEEMVYYSVLALDVVSRNSDLSVAPSIQKGNNLNHAIGLGAMNLHGFLAKNEIFYDSEEALDFTNIFFYTLAFSAFKASEKLAKKYG-PFSGFEKTKFASGEYFDKYTKVSPNTFVPKTHKIKELFAKYQVEIPTQKDWIHLVEKIKKTGIANSHLMAIAPTGSISYLSSCTPSLQPVVAPVEIRKEGKLGRIYVPSYKLSPKTYKFYQNGAYELGPIPIINIVSEAQKHVDQAISMTLFMTDKATTRDLNRAYIYAFKKNCKSIYYVRIRQDVLEDSENYETCQSCQI 720
>gi|71893571|ref|YP_279017.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma hyopneumoniae J] (713 aa)
Score = 2294, Expect = 0.0e+00, Identities = 447/709 (63%), Positives = 559/709 (78%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + SY+SLNA  K+F  + +   + DLLA EKY+  EI P FK FNS KE++E+L   NYYD  V  +YS   L  +  KA +YN  FSSFMGA KFY+TY LKS DN  YFEHF DR++ N+L  G+G+ Q A   L+++M GR+Q ATPTFLNAGK  RGE+VSCYL+RVEDNMESI RA TT LQLSKRGGGV+  L+NLRE GAPIK I+NQATG+IPVMKILED FSYANQLGQRQGAGAVYLN  HPDIL FLD+KRENADEKIRIKSLSLG+++P+I F LA+ N+ MALFS YD+++ Y K  SDISI+E+Y  +L NP I K +ISARKLF+ IAE+ FESGYP+ILF+DI N++N A  +R++MSNLC+EITQ +TPS    DL+++++G+D+CCNLGSLNI K ME G +F + V Y++ ALD ++  +DLS AP+I+ GN+ N A+GLGAMNLHGFLA N+I+YDSEEA+DFTN+FFYT+A+ A+KAS + AK+ G  F  F+ TK+A G YFDKYT+   N + PKT ++KEL  +Y++ IPT++DWI L E IKK G+ANSHLMA+APTGSISYLSSCTPSLQP+V+P+EIRKEGK+GR+YVP+YK+    Y +Y  GAYE+G  PII+I S AQ+HVDQAISMTLF+T+ ATTRDLN+AYIYAF K C SIYY+RIRQ+VL+DSE    C +C I
  S:     8 EKSYLSLNANSKIFANHPD-SHKFDLLAAEKYINEEINPKFKFFNSFKERIEFLVQNNYYDPKVLGQYSFQELEKLNTKAWSYNHFFSSFMGAFKFYSTYGLKSNDNLVYFEHFPDRVLLNSLFLGKGDFQKAEKILEQIMLGRFQPATPTFLNAGKLNRGEFVSCYLIRVEDNMESISRAITTSLQLSKRGGGVSVLLSNLREQGAPIKNIENQATGVIPVMKILEDSFSYANQLGQRQGAGAVYLNVHHPDILAFLDTKRENADEKIRIKSLSLGIIIPNITFELAKNNEKMALFSVYDVEKVYQKAFSDISISEKYYQMLANPEIKKTFISARKLFKIIAELHFESGYPYILFEDIVNKEN-AHPDRVVMSNLCSEITQPSTPSTFLPDLSFKEIGKDICCNLGSLNIDKAMESGPDFEEMVYYSVLALDVVSRNSDLSVAPSIQKGNNLNHAIGLGAMNLHGFLAKNEIFYDSEEALDFTNIFFYTLAFSAFKASEKLAKKYG-PFSGFEKTKFASGEYFDKYTKVSPNTFVPKTHKIKELFAKYQVEIPTQKDWIHLVEKIKKTGIANSHLMAIAPTGSISYLSSCTPSLQPVVAPVEIRKEGKLGRIYVPSYKLSPKTYKFYQNGAYELGPIPIINIVSEAQKHVDQAISMTLFMTDKATTRDLNRAYIYAFKKNCKSIYYVRIRQDVLEDSENYETCQSCQI 713
>gi|144575329|gb|AAZ53595.2| ribonucleoside-diphosphate reductase alpha chain [Mycoplasma hyopneumoniae 7448] (720 aa)
Score = 2293, Expect = 0.0e+00, Identities = 447/709 (63%), Positives = 558/709 (78%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + SY+SLNA  K+F  + +   + DLLA EKY+  EI P FK FNS KE++E+L   NYYD  V  +YS   L  +  KA +YN  FSSFMGA KFY+TY LKS DN  YFEHF DR++ N+L  G+G+ Q A   L+++M GR+Q ATPTFLNAGK  RGE+VSCYL+RVEDNMESI RA TT LQLSKRGGGV+  L+NLRE GAPIK I+NQATG+IPVMKILED FSYANQLGQRQGAGAVYLN  HPDIL FLD+KRENADEKIRIKSLSLG+++P+I F LA+ N+ MALFS YD+++ Y K  SDISI+E Y  +L NP I K +ISARKLF+ IAE+ FESGYP+ILF+DI N++N A  +R++MSNLC+EITQ +TPS    DL+++++G+D+CCNLGSLNI K ME G +F + V Y++ ALD ++  +DLS AP+I+ GN+ N A+GLGAMNLHGFLA N+I+YDSEEA+DFTN+FFYT+A+ A+KAS + AK+ G  F  F+ TK+A G YFDKYT+   N + PKT ++KEL  +Y++ IPT++DWI L E IKK G+ANSHLMA+APTGSISYLSSCTPSLQP+V+P+EIRKEGK+GR+YVP+YK+    Y +Y  GAYE+G  PII+I S AQ+HVDQAISMTLF+T+ ATTRDLN+AYIYAF K C SIYY+RIRQ+VL+DSE    C +C I
  S:    15 EKSYLSLNANSKIFANHPD-SHKFDLLAAEKYINEEINPKFKFFNSFKERIEFLVQNNYYDPKVLGQYSFQELEKLNTKAWSYNHFFSSFMGAFKFYSTYGLKSNDNLVYFEHFPDRVLLNSLFLGKGDFQKAEKILEQIMLGRFQPATPTFLNAGKLNRGEFVSCYLIRVEDNMESISRAITTSLQLSKRGGGVSVLLSNLREQGAPIKNIENQATGVIPVMKILEDSFSYANQLGQRQGAGAVYLNVHHPDILAFLDTKRENADEKIRIKSLSLGIIIPNITFELAKNNEKMALFSVYDVEKVYQKAFSDISISENYYQMLANPEIKKTFISARKLFKIIAELHFESGYPYILFEDIVNKEN-AHPDRVVMSNLCSEITQPSTPSRFLPDLSFKEIGKDICCNLGSLNIDKAMESGPDFEEMVYYSVLALDVVSRNSDLSVAPSIQKGNNLNHAIGLGAMNLHGFLAKNEIFYDSEEALDFTNIFFYTLAFSAFKASEKLAKKYG-PFSGFEKTKFASGEYFDKYTKVSPNTFLPKTHKIKELFAKYQVEIPTQEDWIHLVEKIKKTGIANSHLMAIAPTGSISYLSSCTPSLQPVVAPVEIRKEGKLGRIYVPSYKLSPKTYKFYQNGAYELGPIPIINIVSEAQKHVDQAISMTLFMTDKATTRDLNRAYIYAFKKNCKSIYYVRIRQDVLEDSENYETCQSCQI 720
>gi|72080560|ref|YP_287618.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma hyopneumoniae 7448] (713 aa)
Score = 2290, Expect = 0.0e+00, Identities = 447/709 (63%), Positives = 558/709 (78%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + SY+SLNA  K+F  + +   + DLLA EKY+  EI P FK FNS KE++E+L   NYYD  V  +YS   L  +  KA +YN  FSSFMGA KFY+TY LKS DN  YFEHF DR++ N+L  G+G+ Q A   L+++M GR+Q ATPTFLNAGK  RGE+VSCYL+RVEDNMESI RA TT LQLSKRGGGV+  L+NLRE GAPIK I+NQATG+IPVMKILED FSYANQLGQRQGAGAVYLN  HPDIL FLD+KRENADEKIRIKSLSLG+++P+I F LA+ N+ MALFS YD+++ Y K  SDISI+E Y  +L NP I K +ISARKLF+ IAE+ FESGYP+ILF+DI N++N A  +R++MSNLC+EITQ +TPS    DL+++++G+D+CCNLGSLNI K ME G +F + V Y++ ALD ++  +DLS AP+I+ GN+ N A+GLGAMNLHGFLA N+I+YDSEEA+DFTN+FFYT+A+ A+KAS + AK+ G  F  F+ TK+A G YFDKYT+   N + PKT ++KEL  +Y++ IPT++DWI L E IKK G+ANSHLMA+APTGSISYLSSCTPSLQP+V+P+EIRKEGK+GR+YVP+YK+    Y +Y  GAYE+G  PII+I S AQ+HVDQAISMTLF+T+ ATTRDLN+AYIYAF K C SIYY+RIRQ+VL+DSE    C +C I
  S:     8 EKSYLSLNANSKIFANHPD-SHKFDLLAAEKYINEEINPKFKFFNSFKERIEFLVQNNYYDPKVLGQYSFQELEKLNTKAWSYNHFFSSFMGAFKFYSTYGLKSNDNLVYFEHFPDRVLLNSLFLGKGDFQKAEKILEQIMLGRFQPATPTFLNAGKLNRGEFVSCYLIRVEDNMESISRAITTSLQLSKRGGGVSVLLSNLREQGAPIKNIENQATGVIPVMKILEDSFSYANQLGQRQGAGAVYLNVHHPDILAFLDTKRENADEKIRIKSLSLGIIIPNITFELAKNNEKMALFSVYDVEKVYQKAFSDISISENYYQMLANPEIKKTFISARKLFKIIAELHFESGYPYILFEDIVNKEN-AHPDRVVMSNLCSEITQPSTPSRFLPDLSFKEIGKDICCNLGSLNIDKAMESGPDFEEMVYYSVLALDVVSRNSDLSVAPSIQKGNNLNHAIGLGAMNLHGFLAKNEIFYDSEEALDFTNIFFYTLAFSAFKASEKLAKKYG-PFSGFEKTKFASGEYFDKYTKVSPNTFLPKTHKIKELFAKYQVEIPTQEDWIHLVEKIKKTGIANSHLMAIAPTGSISYLSSCTPSLQPVVAPVEIRKEGKLGRIYVPSYKLSPKTYKFYQNGAYELGPIPIINIVSEAQKHVDQAISMTLFMTDKATTRDLNRAYIYAFKKNCKSIYYVRIRQDVLEDSENYETCQSCQI 713
>gi|15829012|ref|NP_326372.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma pulmonis UAB CTIP] >gi|14089956|emb|CAC13714.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE ALPHA CHAIN (RIBONUCLEOTIDE REDUCTASE) [Mycoplasma pulmonis] (711 aa)
Score = 2268, Expect = 0.0e+00, Identities = 449/710 (63%), Positives = 561/710 (79%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +++ YI+LNA  KL+ ++G      DL A   Y E++IKP+F+ F S ++++E+L   NYY+ ++  +Y+ S L  + + A +YN  F SFMG +KFY  YALKSFD K Y E+FEDR + NAL    G+ + A   L E+M  R+Q ATPTFLNAGK QRGEYVSCYL+R EDNMESI R+ TT LQLSKRGGGVA  LTNLRE GAPIK I+NQATGIIP+MKILED FSYANQLGQRQGAGAVYLN  HPDIL+FLDSKRENADEKIRIKSLSLG+VV DIAF LA+ N+ +ALFSPYDIQ+EY KPMSDISIT+EY NLL N  I K YI+ARKLF  IAE+ FESGYP++LFDD  N +N A  NRI+MSNLC+EI Q +T S  + DL+Y ++G+D+ CNLGSLNIAK +E G  F   V  +I AL+ ++  ADLSSAP+IE GN+KN A+GLGAMNLHGFLA N+I+Y+S+EA+DFTNMFFY MAY+A++AS E +   G  F  F+ TK+ADGSYF+KYT+ +EN W  KT++V+++L++Y   IP+++DWI+L E IKK G+ANSHLMA+APTGSISYLSSCTPSLQP+V+P+E RKEGK+GRVYVPAY ++ NN+ YY +GAYE+G  PIIDI + AQQH+DQAIS+TLFLT+ ATTRDLNKAYI+AF K C SIYY+R+RQ+VL++SE  +EC +C I
  S:     6 NQEKYINLNAMAKLYWQDGQ-NINYDLQAAHDYYESKIKPHFRVFESFEKRIEFLVKNNYYEKSLIDQYTISQLKELNDLAYSYNHFFPSFMGILKFYNAYALKSFDGKEYLENFEDRALMNALFLANGDFEKAKAILKEIMLKRFQPATPTFLNAGKAQRGEYVSCYLIRTEDNMESISRSITTSLQLSKRGGGVAVLLTNLRELGAPIKNIQNQATGIIPIMKILEDSFSYANQLGQRQGAGAVYLNIHHPDILQFLDSKRENADEKIRIKSLSLGLVVTDIAFELAKNNEKLALFSPYDIQKEYKKPMSDISITQEYYNLLKNDKIKKTYINARKLFTLIAELHFESGYPYLLFDDTVNRRN-AHPNRIVMSNLCSEIVQPSTASEYSADLSYTKVGDDISCNLGSLNIAKALESGREFKSLVANSIFALNQVSRKADLSSAPSIEKGNNKNHAIGLGAMNLHGFLANNEIFYNSQEALDFTNMFFYAMAYYAFEASQELSLIYG-KFHGFEKTKFADGSYFEKYTKGDENKWKAKTKKVQDILEKYDFYIPSQKDWIELVEKIKKTGIANSHLMAIAPTGSISYLSSCTPSLQPVVAPVEARKEGKLGRVYVPAYNLNSNNFKYYIEGAYEMGPIPIIDIAAEAQQHIDQAISLTLFLTDKATTRDLNKAYIHAFKKGCSSIYYVRVRQDVLENSEN-YECESCAI 711
>gi|71894416|ref|YP_278524.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma synoviae 53] >gi|71851204|gb|AAZ43813.1| ribonucleoside-diphosphate reductase alpha chain [Mycoplasma synoviae 53] (724 aa)
Score = 2266, Expect = 0.0e+00, Identities = 434/708 (61%), Positives = 549/708 (77%)
  Q:    18 DSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--------FECTTCVI 725
           + Y++ NA  KL    G    +ND  A+  Y+  EI P   ++ +I ++++YL    YY+  V    + + L  +++  + YN RF SFMG +KF+ +Y LKSFD   + E + +R + NAL  G  + +     L E+++GR+Q ATPTFLNAGKKQRGEYVSCYLLRVEDNMESI RA TT LQLSKRGGGVA  LTNLREFGAPIK I+ QATG+IPVMKILED FSYANQLGQRQGAGAVYL+A HPDI+ FLDSKRENADEKIRIKSLSLG+VVP+I F LA+ N+DMALFSPYD+++ YG P SDI +TEEY N+LNNP I K ++ ARK FQ +AE+ FESGYP++LFDD  N++N     RI+MSNLC+EI Q ++ +  +TDLT ++LGED+ CNLGS+N+ K+M  G++FGK+V YAIK+LD ++   DLS AP+I +GN  NRA+GLGAMNLHGF A N++YYDS EA++FTN+FFY +AYHAYKASN  AKE    ++NFK++KYA G YFDKYT+C+ + +T K  +V EL K++ + +PT+ DW +L E IKK+GLANSH++AVAPTGSISYLSSCTPSLQP+VSP+E+RKEGK+GRVY  AYK+D NNY YY  GAYE+G NPIIDI + AQ+HVDQAIS+TLF+ + ATTRDLNKAYI AF  KC SIYY+RIRQEVL+DSE +        FEC++C I
  S:    12 NEYLAYNAMSKL--SEGKDSHDNDQKAIGAYMRVEILPKMMQWENIHQRMQYLVENQYYEEEVVNNVTKAQLEELYQLIEKYNHRFPSFMGVVKFFNSYCLKSFDGSKFLESYSERALMNALFLGGKDFESVKNILVEILSGRFQPATPTFLNAGKKQRGEYVSCYLLRVEDNMESIARAVTTSLQLSKRGGGVALSLTNLREFGAPIKQIQGQATGVIPVMKILEDSFSYANQLGQRQGAGAVYLHAHHPDIMTFLDSKRENADEKIRIKSLSLGIVVPNITFELAKNNEDMALFSPYDVEKVYGVPFSDIKVTEEYYNMLNNPKIRKTFVKARKFFQTVAELHFESGYPYLLFDDTVNDRNPNAG-RIVMSNLCSEIVQSSSLTEYDTDLTVKKLGEDISCNLGSMNVDKLMNAGSDFGKSVFYAIKSLDHVSRGCDLSCAPSINHGNRNNRALGLGAMNLHGFFAVNEVYYDSPEALEFTNLFFYALAYHAYKASNLLAKERNETYKNFKSSKYATGEYFDKYTKCKSDLYTAKLPKVIELFKKHNVTLPTQIDWSELVESIKKYGLANSHVLAVAPTGSISYLSSCTPSLQPVVSPVEVRKEGKLGRVYSLAYKLDENNYKYYKDGAYELGPNPIIDIVAQAQKHVDQAISLTLFMNDKATTRDLNKAYIRAFKAKCSSIYYVRIRQEVLEDSEHIDWEKDGQSFECSSCTI 724
>gi|31544247|ref|NP_852825.1| ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma gallisepticum R] >gi|5565930|gb|AAD45273.1|AF152114_1 ribonucleoside-diphosphate reductase alpha chain [Mycoplasma gallisepticum] >gi|31541091|gb|AAP56393.1| NrdA [Mycoplasma gallisepticum R] (722 aa)
Score = 2233, Expect = 0.0e+00, Identities = 426/702 (60%), Positives = 538/702 (76%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL 717
           + + Y++ NA  KL  + G     ND  AV  Y++  +KP  KKFNSI E+++YL   ++Y+  V +  S   L  ++   K ++  F SFMGA KFY +Y LKS D K ++E + +R + NAL  G  N Q+    L E+++GR+Q ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRA  T LQLSKRGGGVA CLTNLREFGAPIK I+ QA+G+IPVMKILED FSYANQLGQR G G  YL+A HPD++ FLDSKRENADEKIRIKSL+LG+VVPDI F LA+ N+ MALFSPYD+QREYGKP SDI +TEEY N++NNP I K YISARK FQ IAE+ FESGYP++LFDD  N +N     RI+MSNLC+EI Q +T +  N D + ++LG+D+ CNLGS+NI K+M     F  +V YAIK+LD ++  A+L  AP+++NGN+ N A+GLGAMNLHGFLAT++IYYDS EA++FT+ FFYT+AY+A+KASN  A E    + NFK +KYADGSYFDKYT+C+ N +  K  ++KE+   YK+ +PT+ DW  LTE+IKK GLAN+HL+A+APTGSISYLSSCTPS+QP+V+P+E+RKEGK+GRVY  AYK++ +NY YY  GAYE+G NP IDIC+ AQ+HVDQAIS+TLF+ + ATTRDLNKAYI A+  KC S+YY+R+RQ VL+DSE L
  S:     7 EANGYLAYNAMSKL--DEGKNSVLNDAKAVALYMQVHVKPRTKKFNSIHERMDYLIKNDFYEKEVVENVSKEQLEELYGVIKEFDHEFPSFMGAFKFYNSYCLKSNDGKEFYETYSERCLMNALFLGGKNFQNVKNILIEILSGRFQPATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRAIVTSLQLSKRGGGVALCLTNLREFGAPIKNIEGQASGVIPVMKILEDSFSYANQLGQRPGVGVAYLHAHHPDVMVFLDSKRENADEKIRIKSLALGLVVPDITFELAKNNEQMALFSPYDVQREYGKPFSDIKVTEEYHNMVNNPRIKKTYISARKFFQTIAELHFESGYPYLLFDDTVNNRNPNA-GRIVMSNLCSEIVQSSTSTEYNEDFSIKKLGQDISCNLGSVNIDKMMRSAERFEDSVYYAIKSLDHVSKSANLDCAPSVKNGNANNHALGLGAMNLHGFLATHEIYYDSPEALEFTDFFFYTLAYYAFKASNRLAVEQKQTYANFKTSKYADGSYFDKYTKCDPNTYVIKNPKIKEIFSNYKIKVPTQADWQALTEEIKKTGLANAHLLAIAPTGSISYLSSCTPSIQPVVAPVEVRKEGKIGRVYSLAYKLNEHNYKYYKDGAYELGPNPYIDICAQAQKHVDQAISLTLFMNDTATTRDLNKAYIRAYKSKCASVYYVRVRQNVLEDSENL 705
>gi|17989275|ref|NP_541908.1| ribonucleotide-diphosphate reductase subunit alpha [Brucella melitensis 16M] >gi|189023016|ref|YP_001932757.1| ribonucleotide-diphosphate reductase alpha subunit [Brucella abortus S19] >gi|17985138|gb|AAL54172.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE ALPHA CHAIN [Brucella melitensis 16M] >gi|189021590|gb|ACD74311.1| ribonucleotide-diphosphate reductase alpha subunit [Brucella abortus S19] (738 aa)
Score = 2087, Expect = 0.0e+00, Identities = 394/710 (55%), Positives = 527/710 (74%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D   Y +LNA + L+DE+G  Q + D  A  +Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL   RG+EQ A   ++E+++GRYQ ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA CLTNLRE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYL+A HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI F LAR N+DM LFSPYD+QR YG P+++IS+TE+Y  ++N+  I KK I+AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ RI MSNLC+EI Q++  S+ + DL+YE LG+D+ CNLGSLNIA  M D  +FGKT++ +I+AL +++ ++ +   P++  GN+++ A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+AYHA +ASN  A ETG  F+ F+ +KYA G YFDKYT   +  W P TE+V+ + ++  +AIPT+ DW  L + + + GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYYIR+RQ  L+ ++ +  C +C +
  S:    36 DGLDYHALNAMLNLYDEDGKIQLDCDRQAARQYFLQHVNQNTVFFHNLREKLDYLVAEGYYEQTVLDQYSFNFVRDLFDEAYARKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLARGDEQLARDLVEEIISGRYQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFELARNNEDMYLFSPYDVQRVYGVPLTEISVTEKYREMVNDAQIAKKKINAREFFQVLAEIQFESGYPYIMFEDTVNRAN-PIDGRITMSNLCSEILQVSEASLFHEDLSYEYLGKDISCNLGSLNIAAAM-DAPDFGKTIETSIRALTAVSDMSHIGCVPSVARGNAESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVAYHAVRASNRIAVETGKSFKGFEKSKYASGEYFDKYT---DQAWAPATEKVRRIFEDAGIAIPTQDDWCALKKAVMEGGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAAFMTNDNLEYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTIYYIRLRQMALEGTQ-VQGCVSCAL 738
>gi|23500071|ref|NP_699511.1| ribonucleotide-diphosphate reductase subunit alpha [Brucella suis 1330] >gi|62317764|ref|YP_223617.1| ribonucleotide-diphosphate reductase subunit alpha [Brucella abortus bv. 1 str. 9-941] >gi|83269750|ref|YP_419041.1| ribonucleotide-diphosphate reductase subunit alpha [Brucella melitensis biovar Abortus 2308] >gi|148558300|ref|YP_001257347.1| ribonucleotide-diphosphate reductase subunit alpha [Brucella ovis ATCC 25840] >gi|161620389|ref|YP_001594275.1| ribonucleotide-diphosphate reductase subunit alpha [Brucella canis ATCC 23365] >gi|23463662|gb|AAN33516.1| ribonucleoside-diphosphate reductase, alpha subunit [Brucella suis 1330] >gi|62197957|gb|AAX76256.1| NrdE, ribonucleoside-diphosphate reductase, alpha subunit [Brucella abortus biovar 1 str. 9-941] >gi|82940024|emb|CAJ13055.1| Ribonucleotide reductase large subunit:Prenyl group binding site (CAAX box) [Brucella melitensis biovar Abortus 2308] >gi|148369585|gb|ABQ62457.1| ribonucleoside-diphosphate reductase, alpha subunit [Brucella ovis ATCC 25840] >gi|161337200|gb|ABX63504.1| ribonucleoside-diphosphate reductase, alpha subunit [Brucella canis ATCC 23365] (713 aa)
Score = 2083, Expect = 0.0e+00, Identities = 394/710 (55%), Positives = 527/710 (74%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D   Y +LNA + L+DE+G  Q + D  A  +Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL   RG+EQ A   ++E+++GRYQ ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA CLTNLRE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYL+A HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI F LAR N+DM LFSPYD+QR YG P+++IS+TE+Y  ++N+  I KK I+AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ RI MSNLC+EI Q++  S+ + DL+YE LG+D+ CNLGSLNIA  M D  +FGKT++ +I+AL +++ ++ +   P++  GN+++ A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+AYHA +ASN  A ETG  F+ F+ +KYA G YFDKYT   +  W P TE+V+ + ++  +AIPT+ DW  L + + + GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYYIR+RQ  L+ ++ +  C +C +
  S:    11 DGLDYHALNAMLNLYDEDGKIQLDCDRQAARQYFLQHVNQNTVFFHNLREKLDYLVAEGYYEQTVLDQYSFNFVRDLFDEAYARKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLARGDEQLARDLVEEIISGRYQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFELARNNEDMYLFSPYDVQRVYGVPLTEISVTEKYREMVNDAQIAKKKINAREFFQVLAEIQFESGYPYIMFEDTVNRAN-PIDGRITMSNLCSEILQVSEASLFHEDLSYEYLGKDISCNLGSLNIAAAM-DAPDFGKTIETSIRALTAVSDMSHIGCVPSVARGNAESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVAYHAVRASNRIAVETGKSFKGFEKSKYASGEYFDKYT---DQAWAPATEKVRRIFEDAGIAIPTQDDWCALKKAVMEGGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAAFMTNDNLEYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTIYYIRLRQMALEGTQ-VQGCVSCAL 713
>gi|163844497|ref|YP_001622152.1| ribonucleotide-diphosphate reductase subunit alpha [Brucella suis ATCC 23445] >gi|163675220|gb|ABY39330.1| ribonucleoside-diphosphate reductase, alpha subunit [Brucella suis ATCC 23445] (713 aa)
Score = 2080, Expect = 0.0e+00, Identities = 393/710 (55%), Positives = 527/710 (74%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D   Y +LNA + L+DE+G  Q + D  A  +Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL   RG+EQ A   ++E+++GRYQ ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA CLTNLRE GAPIK I+NQ++GIIPVMK+LED FSYANQ+G RQGAGAVYL+A HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI F LAR N+DM LFSPYD+QR YG P+++IS+TE+Y  ++N+  I KK I+AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ RI MSNLC+EI Q++  S+ + DL+YE LG+D+ CNLGSLNIA  M D  +FGKT++ +I+AL +++ ++ +   P++  GN+++ A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+AYHA +ASN  A ETG  F+ F+ +KYA G YFDKYT   +  W P TE+V+ + ++  +AIPT+ DW  L + + + GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYYIR+RQ  L+ ++ +  C +C +
  S:    11 DGLDYHALNAMLNLYDEDGKIQLDCDRQAARQYFLQHVNQNTVFFHNLREKLDYLVAEGYYEQTVLDQYSFNFVRDLFDEAYARKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLARGDEQLARDLVEEIISGRYQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGIIPVMKLLEDSFSYANQVGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFELARNNEDMYLFSPYDVQRVYGVPLTEISVTEKYREMVNDAQIAKKKINAREFFQVLAEIQFESGYPYIMFEDTVNRAN-PIDGRITMSNLCSEILQVSEASLFHQDLSYEYLGKDISCNLGSLNIAAAM-DAPDFGKTIETSIRALTAVSDMSHIGCVPSVARGNAESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVAYHAVRASNRIAVETGKSFKGFEKSKYASGEYFDKYT---DQAWAPATEKVRRIFEDAGIAIPTQDDWCALKKAVMEGGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAAFMTNDNLEYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTIYYIRLRQMALEGTQ-VQGCVSCAL 713
>gi|62425397|ref|ZP_00380531.1| COG0209: Ribonucleotide reductase, alpha subunit [Brevibacterium linens BL2] (718 aa)
Score = 2078, Expect = 0.0e+00, Identities = 382/709 (53%), Positives = 524/709 (73%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +  Y +LNA + LF  +G+ QF+ D  A  +YL   + PN K F+S+ E+LE+L   +YY+      Y+  FL ++ E A+    RF++F+GA KF+T+YALK+FD  TY E FE+R+V  AL  G+G+EQ A   +DEM++GR+Q ATPTFLNAGK QRGE VSC+LLRVEDN+ESIGR+  + LQLSKRGGGVA  L+NLRE GAPIK I+NQA+G++PVMKILED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PD+ F LA++N+DM LFSPYD+QREYG P+SD+S+++ Y+ L+ NP I K  +SAR+ F+ +AE+QFESGYP++LF+D  N  N  L   I MSNLC+EI Q NTPS  +  + Y+++G+D+ CNLGSLNIA+ M + ++ G TV+ A++AL S++   ++ + P++  GN  + A+GLG MNLHG+LA+ +I+Y SEE +DFT+++F T+ YHA +ASN+ A E G  F  F+++ YADGSYFDKYTQ +   W P T+RV+EL  +  + IP  +DW +L E +K  G+ N++L AV PTGSISY+++ T S+ P+ + IEIRKEGK+GRVY PA  +  +N  +Y + AYEIG   IID  +AA +HVDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    17 RKDYHALNAELNLFAPDGSIQFDKDRQAAAEYLRQHVVPNTKVFSSVAERLEWLVDHDYYESGFLAAYTPEFLTALHEHARAAGHRFATFLGAFKFFTSYALKTFDGTTYLEGFEERVVATALYLGQGDEQLATGLVDEMLSGRFQPATPTFLNAGKAQRGELVSCFLLRVEDNLESIGRSVNSALQLSKRGGGVALLLSNLREAGAPIKQIENQASGVVPVMKILEDSFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDVTFQLAKDNRDMHLFSPYDVQREYGTPLSDLSVSDHYDELVANPQIRKNTVSAREFFRTLAELQFESGYPYVLFEDTVNRANP-LAGHINMSNLCSEILQTNTPSTYDNAIGYQEIGQDISCNLGSLNIAQAM-NSSDLGSTVETAVRALTSVSDQTNVDAVPSVAKGNDASHAIGLGQMNLHGYLASQRIHYGSEEGIDFTDIYFLTITYHAIRASNQIAIERGKTFAGFEDSTYADGSYFDKYTQHD---WQPATQRVRELFADAGVTIPAGEDWERLRESVKAQGIYNAYLQAVPPTGSISYVNNSTASIHPVAAKIEIRKEGKLGRVYYPAPHMTDDNVDFY-QDAYEIGYEKIIDTYAAATRHVDQGLSLTLFFRDTATTRDINRAQIYAWRKGIKTLYYIRLRQPALEGTE-IENCVSCAL 718
>gi|56807675|ref|ZP_00365559.1| COG0209: Ribonucleotide reductase, alpha subunit [Streptococcus pyogenes M49 591] (587 aa)
Score = 2062, Expect = 0.0e+00, Identities = 377/567 (66%), Positives = 468/567 (82%)
  Q:   153 LDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE 719
           +D ++  R+Q ATPTFLN+GKK+RGEY+SCYLLRVEDNMESI RA +T LQLSKRGGGVA CLTNLRE GAPIKGI+NQATGI+PVMK+LED FSYANQLGQRQGAGAVYL+A HP++L FLD+KRENADEKIRIKSL+LG+V+PDI F LA+ENKDMALFSPYDI+R YGK MSDISITEEY+ LL NP I K YISARKLFQ IAE+ FESGYP++LFDD  N++N  A   RI+MSNLC+EI Q++TPS    DL++E +GED+CCNLGS+NIA+ M D  +F + +  +I+ALD ++ ++DL+ AP++E GN+ N AVGLGAMNLHGFLATN IYYD++EAVDFT++FF+ MAY+A+KAS + AKE G  F  F  + YADG+YF KY Q +     P+T +V  LL++Y   +PT  DW  L  DIK+FGLAN+HL+AVAPTGSISYLSSCTPSLQP+V+P+E+RKEG +GR+YVPAY+I+  NY YY +GAYE+G   IID+ +AAQ+HVDQAIS+TLF+T+ ATTRDLN++YI AF + C SIYY+R+RQ+VL  SE+  E
  S:     2 IDAILHRRFQPATPTFLNSGKKRRGEYISCYLLRVEDNMESISRAISTSLQLSKRGGGVALCLTNLREIGAPIKGIENQATGIVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALGLVIPDITFQLAKENKDMALFSPYDIKRAYGKDMSDISITEEYDKLLANPAIKKTYISARKLFQLIAELHFESGYPYLLFDDTVNKRNPHAKKGRIVMSNLCSEIAQVSTPSTFKEDLSFETIGEDICCNLGSINIAQAMADAPHFEQLITTSIRALDRVSRVSDLNCAPSVETGNAANHAVGLGAMNLHGFLATNHIYYDTKEAVDFTDLFFHAMAYYAFKASCQLAKEKG-AFAGFSLSTYADGTYFAKYLQEDAK---PQTAKVATLLQDYGFTLPTVADWQALVADIKQFGLANAHLLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGSLGRIYVPAYQINQANYTYYERGAYEVGPKAIIDVVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKQNCASIYYVRVRQDVLAGSEQYDE 565
>gi|167362056|ref|ZP_02296608.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167071089|gb|EDR75013.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM1325] (744 aa)
Score = 2059, Expect = 0.0e+00, Identities = 394/706 (55%), Positives = 520/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G  Q + D +A ++Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   AL   RG+E  A   +DE+++GR+Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYLNA HPDI++FLD+KRENADEKIRIK+LSLGVVVPDI F LAR N+DM LFSPYD++R YG P ++IS+TE+Y  + ++  I+KK I AR+ FQ +AE+QFESGYP+I+F+D  N  N  +  R+ MSNLC+EI Q++  S  N DL+Y+ LG+D+ CNLGSLNIA  M D  +FGKT++ +I+AL +++ ++ +SS P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+ Y+A +ASN  A E G  F+ F+N+KYA G YFDKYT   +  W P TERVK L +   + IPT++DW+ L + +   GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA I+A+ K   +IYYIR+RQ  L  +E +  C +C +
  S:    46 YHALNAMLNLYDDQGRIQLDKDRMAAKQYFLQHVNQNTVFFHNLREKLDYLVTEGYYEQEVLDQYSFNFVRDLFDQAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICMVALALARGDESLARDMVDEIISGRFQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALSLTNIREAGAPIKHIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDIMRFLDTKRENADEKIRIKTLSLGVVVPDITFELARNNEDMYLFSPYDVERVYGVPFTEISVTEKYREMADDARISKKKIKAREFFQVLAEIQFESGYPYIMFEDTVNRAN-PIAGRVSMSNLCSEILQVSEASEYNDDLSYKHLGKDISCNLGSLNIAAAM-DSVDFGKTIETSIRALSAVSDMSHISSVPSIEKGNDESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVTYYAIRASNLLAVERGASFKGFENSKYASGDYFDKYT---DRLWEPATERVKALFETSGIHIPTQEDWVALKKAVMASGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAPFMTNDNLDYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIHAWKKGIKTIYYIRLRQMALSGTE-VQGCVSCTL 744
>gi|159184147|ref|NP_353104.2| ribonucleotide-diphosphate reductase subunit alpha [Agrobacterium tumefaciens str. C58] >gi|159139482|gb|AAK85889.2| ribonucleoside-diphosphate reductase 2 alpha chain [Agrobacterium tumefaciens str. C58] (693 aa)
Score = 2059, Expect = 0.0e+00, Identities = 389/699 (55%), Positives = 520/699 (74%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+DENG  Q + D LA  +Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  ++++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL   RG+EQ A   +DE+++GR+Q ATPTFLNAGKK RGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+REFGAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI F LAR N+DM LFSPYD++R YG P+++IS+TE+Y  ++ +  I KK I AR+ FQ IAE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q++  S  N DL+Y  +G+D+ CNLGSLNIA  M D A+FGKT++ +I+AL +++ ++ +SS P++E GN  + A+GLG MNLHG+LA  +I+Y SEE +DFTN++FYT+ YHA +ASN  A E G  F+ F+N+KYA G YFDKYT  E   W P TE+V++L ++  +AIPT++DW  L +D+   GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ +   +IYYIR+RQ  L+ ++ +  C +C +
  S:     2 LNLYDENGKIQLDKDRLAARQYFLQHVNQNTVFFHNLREKLDYLVTEGYYEQEVLDQYSFNFVRDLYDEAYSRKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALALARGDEQLARDLMDEIISGRFQPATPTFLNAGKKSRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALSLTNIREFGAPIKQIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFELARNNEDMYLFSPYDVERVYGVPLTEISVTEKYHEMVADSRIRKKKIKAREFFQVIAEIQFESGYPYIMFEDTVNRAN-PVAGRISMSNLCSEILQVSEASEFNADLSYSHMGKDISCNLGSLNIASAM-DSADFGKTIETSIRALTAVSDMSHISSVPSVEKGNDASHAIGLGQMNLHGYLARERIFYGSEEGIDFTNIYFYTVTYHAIRASNRLAVERGQSFKGFENSKYASGDYFDKYTDRE---WLPATEKVRDLFEKAGIAIPTQEDWTALKQDVMASGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPASYLSNDNLEYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWRRGIKTIYYIRLRQMALEGTQ-VQGCVSCTL 693
>gi|153010277|ref|YP_001371491.1| ribonucleotide-diphosphate reductase subunit alpha [Ochrobactrum anthropi ATCC 49188] >gi|151562165|gb|ABS15662.1| ribonucleoside-diphosphate reductase, alpha subunit [Ochrobactrum anthropi ATCC 49188] (739 aa)
Score = 2058, Expect = 0.0e+00, Identities = 396/720 (55%), Positives = 529/720 (73%)
  Q:     6 SNNNKNNIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           SN++K +  +D   Y +LNA + L+D+ G  Q + D  A  +Y    +  N   F++++EK++YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL   RGNEQ A   ++E++ GRYQ ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYL+A HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N+DM LFSPYD++R YG P+++ISITE+Y  L+++  ITKK I+AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ RI MSNLC+EI Q++  SI   DL+Y+ LG+D+ CNLGSLNIA  M D ++FGKT++ +I+AL +++ ++ + S P++  GN ++ A+GLG MNLHG+LA  +IYY SEE VDFTN++FYT+ YHA +ASN  A ETG  F+ F+ +KYA G YF KYT   E  W P T++V+E+ ++  +AIPT+ DW  L   + + GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYYIR+RQ  L  +E +  C +C +
  S:    27 SNSSKPSKSLDGLDYHALNAMLNLYDDEGKIQLDRDRQAARQYFLQHVNQNTVFFHNLREKIDYLVTEGYYEQEVLDQYSFNFVRDLFDEAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLARGNEQLARNLMEEIIAGRYQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALSLTNIREAGAPIKQIQNQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKNNEDMYLFSPYDVERVYGVPLTEISITEKYRELVDDARITKKKINAREFFQVLAEIQFESGYPYIMFEDTVNRAN-PIDGRITMSNLCSEILQVSEASIFGEDLSYDHLGKDISCNLGSLNIASAM-DSSDFGKTIETSIRALTAVSDMSQIGSVPSVARGNDESHAIGLGQMNLHGYLARERIYYGSEEGVDFTNIYFYTVTYHAIRASNLIAVETGKSFKGFEKSKYATGEYFAKYT---EQLWEPATQKVREIFEKAGIAIPTQDDWRDLKNAVMEGGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAAFMTNDNLDYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTIYYIRLRQMALSGTE-VQGCVSCAL 739
>gi|121602719|ref|YP_988675.1| ribonucleotide-diphosphate reductase subunit alpha [Bartonella bacilliformis KC583] >gi|120614896|gb|ABM45497.1| ribonucleoside-diphosphate reductase, alpha subunit [Bartonella bacilliformis KC583] (716 aa)
Score = 2049, Expect = 0.0e+00, Identities = 399/704 (56%), Positives = 518/704 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y +LNA + L+DENG+ QF+ D  A  +Y    +  N   F+++KEK+ YL  E YY+  +F+ Y  SF+  +F++A  + FRF +F+GA K+YT+Y LK+FD   Y E +EDR+   AL   +GN+  A + +DE+MTGR+Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA CLTNLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A H DI+KFLD+KRENADEK+RIK+LSLGVV+PDI F LAR N+DM LFSPYDI+R  GKP SDIS+TE Y + ++NP I KK ISAR  FQ +AE+QFESGYP+ILF+D AN  N  +  RI MSNLC+EI QIN  S L TDL Y  +G D+ CNLGS+NIAK M D ++FG+TV+ A++AL +++ +++++  P+I  GN+++ A+GLG MNLHGFLA  KIYY S EA+DFTN++FYT+ YHA +ASN  A+E    F  F+ + YADG +F+KY + E   W P+   V+E+     + IPT+ DW +L E I K+GL N +L AV PTGSISY++  T S+ PI S IEIRKEGK+GRVY PA  +D  N  +Y + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   SIYYIR+RQ+ L  +E +  C +C
  S:    18 YHALNAMLNLYDENGHIQFDMDRRAARQYFLQHVNQNTVFFHNLKEKINYLIEEGYYEKALFELYDFSFIKRLFKRAYAFKFRFPTFLGAFKYYTSYTLKTFDGTRYLERYEDRVCLVALYLAQGNKDFAESCVDEIMTGRFQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSVNSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGVLPVMKLLEDSFSYANQLGARQGAGAVYLHAHHLDIMKFLDTKRENADEKVRIKTLSLGVVIPDITFELARNNEDMYLFSPYDIERVVGKPFSDISLTEHYRSFVDNPKIRKKKISARVFFQTLAEIQFESGYPYILFEDTANRAN-PVAGRINMSNLCSEILQINEASELETDLGYRTVGSDISCNLGSMNIAKAM-DSSDFGRTVETAVRALTAVSDMSNIACVPSIAKGNAESHAIGLGQMNLHGFLAREKIYYGSPEAIDFTNIYFYTVTYHALRASNLIARERQEKFAGFEKSAYADGCFFEKYIKRE---WKPQFLLVQEIFARNNILIPTQGDWKKLKELIAKYGLYNRNLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRVYYPAPYMDNTNLNFY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFPDTATTRDINRAQIYAWKKGIKSIYYIRLRQKALSGTE-VEGCVSC 714
>gi|169196016|ref|ZP_02855388.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169092608|gb|EDS71317.1| ribonucleoside-diphosphate reductase, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM2304] (734 aa)
Score = 2042, Expect = 0.0e+00, Identities = 395/706 (55%), Positives = 519/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G  Q + D +A ++Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   AL   RG+E  A   +DE+++GR Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE  APIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYLNA HPDI++FLD+KRENADEKIRIK+LSLGVVVPDI+F LAR N+DM LFSPYD++R YG P ++IS+TE+Y  ++ +  I+KK I AR+ FQ IAE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q++  S  N DL+Y+ LG+D+ CNLGSLNIA  M D A+FGKT++ +I+AL +++ ++ ++S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+ YHA +ASN  A E G  F+ F+N+KYA G YFDKYT+ E   W P TE+V+ L     + +PT++DW+ L   +   GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L  +E +  C +C +
  S:    36 YHALNAMLNLYDDEGRIQLDKDRMAAKQYFLQHVNQNTVFFHNLREKLDYLVTEGYYEQEVLDQYSFNFVRDLFDQAYARKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICMVALSLARGDEALARDMVDEIISGRLQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALSLTNIREASAPIKQIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDIMRFLDTKRENADEKIRIKTLSLGVVVPDISFELARNNEDMYLFSPYDVERIYGVPFTEISVTEKYREMVADARISKKKIKAREFFQVIAEIQFESGYPYIMFEDTVNRAN-PIAGRISMSNLCSEILQVSEASEYNDDLSYKHLGKDISCNLGSLNIAAAM-DSADFGKTIETSIRALTAVSDMSHIASVPSIEKGNDESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVTYHAIRASNLLAVERGTSFKGFENSKYASGEYFDKYTEQE---WQPATEKVRALFDNAGIPVPTQEDWLALKTAVMTSGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAPFMTNDNLDYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALSGTE-VQGCVSCTL 734
>gi|167558099|ref|ZP_02351109.1| hypothetical protein Sententeri_14813 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (705 aa)
Score = 2041, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +  T ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E + +C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFATHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEDCVSCAL 705
>gi|152971533|ref|YP_001336642.1| ribonucleotide-diphosphate reductase subunit alpha [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956382|gb|ABR78412.1| ribonucleotide-diphosphate reductase alpha subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (693 aa)
Score = 2038, Expect = 0.0e+00, Identities = 372/699 (53%), Positives = 507/699 (72%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+D  G   FE D  AVE ++ T+++PN   F S ++KL +L  E YYD  V   Y   F++++F  A+   FRF +F+GA KFYT+YALK+FD K Y E F +R V  AL   RG+EQ A    +E+++GR+Q ATPTFLNAGK+QRGE +SC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAV+L+  HPDIL+FLD++RENADEKIRIK+LSLGVV+PDI F LA+E+  MALFSPYD++R YGKP +D +I + Y  L+ +  + K++I AR LFQ++AE+QFESGYP+I+F+D  N + S +  R+ MSNLC+EI Q++TPS  N DL+Y  +GED+ CNLGSLNIA  M D  +FG+T+  A++AL +++ ++ + S P++  GN+ + A+GLG MNLHG+LA   I Y S E +DFTN++FYT+ +HA   S + A+E G  F  F+ ++YA G+YFDKY Q E   W PKTERV+ L     +++P ++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIVS IEIRKEGK GRVY PA  ++ +N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     2 LNLYDSEGRIPFEKDRQAVEAFMATQVQPNALTFPSQEDKLSWLVSEGYYDPQVLAGYDRGFVLALFAHARRAPFRFQTFLGAWKFYTSYALKTFDGKHYLEDFAERSVMVALTLARGDEQQARQLTEEILSGRFQPATPTFLNAGKQQRGELISCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVVPVMKMLEDAFSYANQLGARQGAGAVWLHVHHPDILRFLDTRRENADEKIRIKTLSLGVVIPDITFQLAKEDAQMALFSPYDVERLYGKPFADCAIGDLYPQLVADERVRKRWIRARDLFQRLAEIQFESGYPYIMFEDTVN-RASPVAGRVTMSNLCSEILQVSTPSAYNEDLSYAHIGEDISCNLGSLNIAHTM-DSPDFGRTIATAVRALTAVSDMSHIQSVPSVAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEGLDFTNIYFYTVTWHALHTSMQLARERGQRFAGFEQSRYASGAYFDKYLQEE---WQPKTERVRTLFARAGISLPDRESWRQLRDDVMRYGIYNRYLQAVPPTGSISYINHATSSIHPIVSKIEIRKEGKTGRVYYPAPFMNNDNLALY-QDAYEIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWKKGIKTLYYIRLRQLALEGTE-IEGCVSCAL 693
>gi|99080360|ref|YP_612514.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Silicibacter sp. TM1040] >gi|99036640|gb|ABF63252.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Silicibacter sp. TM1040] (710 aa)
Score = 2038, Expect = 0.0e+00, Identities = 389/704 (55%), Positives = 515/704 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y +LNA + L+D+ GN QF+ D +A  +Y    +  N   F+S+ EKL YL  + YY+  V  +YS +F   I++ A    FRF SF+GA K+YT+Y LK+ D + Y E +EDR+V NAL   RG+E+ A+  + E++ GR+Q ATPTFLNAGKK RGE+VSC+LLR+EDNMESIGR   + LQLSKRGGGVA  LTN+RE GAPIKGI+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSP+D+++ YG+  S+IS+TE+Y  +++NP I KK I+AR  FQ IAE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N PS  N DL+YEQ+G D+ CNLGS+NIA+ M DG +   TV  AI+AL++++ ++ + S P+I  GN +  A+GLG MNLHG+LA  +I+Y S E VDFTN++F T+ YHA  ASN  AKE    F+ F+++ YADGS+F+KY    E  W P+T+RVKEL +   + IPT++DW  L + + K GL N +L AV PTGSISY++  T S+ PI + IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF    A+TRD+N+A IYA+ K   +IYYIR+RQ+ L+ +E +  C +C
  S:    12 YHALNAMLNLYDDEGNIQFDADRMAARQYFLQHVNQNTVFFHSLDEKLGYLVEKGYYEPEVLDQYSRNFHRKIWDAAYAKKFRFPSFLGAFKYYTSYTLKTRDGQRYLERYEDRVVMNALTLARGDEKLAMKLMSEIIDGRFQPATPTFLNAGKKARGEFVSCFLLRLEDNMESIGRGINSALQLSKRGGGVALMLTNIREHGAPIKGIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFQLAKKNEDMYLFSPHDVEKVYGQAFSEISVTEKYHEMVDNPQIRKKKINARAFFQTIAEIQFESGYPYIMFEDTVNAAN-PIAGRIAMSNLCSEILQVNEPSKFNDDLSYEQMGTDISCNLGSMNIARAM-DGGDLAGTVGTAIRALNAVSEMSSIDSVPSIRKGNEEGHAIGLGQMNLHGYLARERIHYGSAEGVDFTNIYFCTVLYHAISASNALAKEKKSKFKGFEDSAYADGSFFEKYV---EKDWLPETDRVKELFETAGVEIPTRKDWEALRDKVMKHGLYNRNLQAVPPTGSISYINYATSSIHPITAKIEIRKEGKIGRVYYPAPYMTNDNLEYY-RDAYEIGPEAIIDTYAAATQHVDQGLSLTLFFPAEASTRDINRAQIYAWKKGIKTIYYIRLRQQALEGTE-VEGCVSC 708
>gi|92112512|ref|YP_572440.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Chromohalobacter salexigens DSM 3043] >gi|91795602|gb|ABE57741.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Chromohalobacter salexigens DSM 3043] (723 aa)
Score = 2037, Expect = 0.0e+00, Identities = 387/706 (54%), Positives = 511/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G  Q + D  A  +Y    +  N   F+++ EKLEYL  ENYY+  V  +Y   F+ S+FE+A    FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL   +G+E  A   +DE++ GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++GIIP+MK+LED FSYANQLG RQGAGAVYLNA HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N+ M LFSPYD++  YGKP  DIS+TE+Y  ++++  I K  I+AR+LFQ +AEVQFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+NTPS    DL YE++GED+ CNLGSLNIAK M D ++FG TV+ AI+ L +++ ++D+ S P+I   N ++ A+GLG MNLHG+LA   I+Y SEE +DFTN++FYT+ YHA +ASN  A E G  F  F+ + YA G YFDKYT   E  W P+T RV+EL  +  + +PT++DW +L   +   GL N +L AV PTGSISY++  T S+ P+VS IEIRKEGK+GRVY PA  ++ +N  YY + AYEIG   IID  + A QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YY+R+RQ  L+ +E +  C +C +
  S:    25 YHALNAMLNLYDDQGRLQLDADREASRQYFLQHVNQNTVFFHTLAEKLEYLVAENYYEQEVLDQYDFPFIKSLFERAYAVKFRFQSFLGAFKYYTSYTLKTFDGRRYLERFEDRVCMVALTLAQGDEALARQLVDEIIHGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREAGAPIKHIENQSSGIIPIMKMLEDAFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNEPMYLFSPYDVENVYGKPFGDISVTEKYYEMVDDARIRKTKINARELFQTLAEVQFESGYPYVMFEDTVNRAN-PIAGRINMSNLCSEILQVNTPSDYEADLGYERIGEDISCNLGSLNIAKTM-DSSDFGATVETAIRGLTAVSEMSDIRSVPSIAEANKQSHAIGLGQMNLHGYLAREHIHYGSEEGLDFTNLYFYTVTYHALRASNRLAIERGRAFAGFEASDYASGVYFDKYT---EQAWGPRTARVRELFDKAGIHVPTQEDWRELKASVMAHGLFNRNLQAVPPTGSISYINHSTSSIHPVVSKIEIRKEGKLGRVYYPAPYLNDDNQDYY-QDAYEIGPEKIIDTYAEATQHVDQGLSLTLFFRDTATTRDINRAQIYAWRKGIKTLYYVRLRQAALEGTE-VEGCVSCTL 723
>gi|30064042|ref|NP_838213.1| ribonucleotide-diphosphate reductase subunit alpha [Shigella flexneri 2a str. 2457T] >gi|56480159|ref|NP_708489.2| ribonucleotide-diphosphate reductase subunit alpha [Shigella flexneri 2a str. 301] >gi|30042298|gb|AAP18023.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Shigella flexneri 2a str. 2457T] >gi|56383710|gb|AAN44196.2| ribonucleoside-diphosphate reductase 2, alpha subunit [Shigella flexneri 2a str. 301] (701 aa)
Score = 2037, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 510/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     3 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFSRTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSCITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 701
>gi|49473849|ref|YP_031891.1| ribonucleotide-diphosphate reductase subunit alpha [Bartonella quintana str. Toulouse] >gi|49239352|emb|CAF25685.1| Ribonucleotide reductase alpha-chain [Bartonella quintana str. Toulouse] (716 aa)
Score = 2037, Expect = 0.0e+00, Identities = 393/704 (55%), Positives = 520/704 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y +LNA + L+DE+G  QF+ D LA  +Y    +  N   F+++KEK++YL  E YY+  +F+ Y  SF+  +F++A  + FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   AL   +GN+  A +++DE++TGR+Q ATPTFLNAGKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA CLTNLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A H DI+KFLD+KRENADEK+RIK+LSLGVV+PDI F LA+ N+DM LFSPYDI+R  GKP SDIS+TE Y + ++N  I KK I+AR  FQ +AE+QFESGYP+ILF+D AN  N  +  RI MSNLC+EI Q++  S L TDLTY  +G D+ CNLGS+NIAK ME   NFG+TV+ A++AL +++ +++++  P+I  GN+++ A+GLG MNLHGFLA  +IYY S EA+DFTN++FYT+AYHA +ASN  A+E   VF  F+ + YADGS+F KY + E   W P+   V+EL     + IP ++DW +L + + ++GL N +L AV PTGSISY++  T S+ PI S IEIRKEGK+GRVY PA  +D  N  +Y + AYEIG   IID  + A QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   SIYY+R+RQ  L  +E +  C +C
  S:    18 YHALNAMLNLYDEDGRIQFDMDRLATRQYFLQHVNQNTVFFHNLKEKIDYLIEEGYYEKTLFELYDFSFIKKLFKRAYAFKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICLVALYLAQGNKSLAESFVDEIITGRFQPATPTFLNAGKKQRGELVSCFLLRIEDNMESIGRSVNSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGVLPVMKLLEDSFSYANQLGARQGAGAVYLHAHHLDIMKFLDTKRENADEKVRIKTLSLGVVIPDITFELAQNNEDMYLFSPYDIERVTGKPFSDISLTEHYRSFVDNAKIRKKKINARVFFQTLAEIQFESGYPYILFEDTANRAN-PIAGRISMSNLCSEILQVSEASELETDLTYRTIGSDISCNLGSMNIAKAMES-TNFGRTVEIAVRALTAVSDMSNIACVPSIAKGNAESHAIGLGQMNLHGFLAREQIYYGSLEAIDFTNIYFYTVAYHAIRASNLIARERQKVFAGFEKSAYADGSFFTKYIEKE---WKPQCVLVQELFARNNIVIPDQKDWQELKKLVIEYGLYNRNLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRVYYPAPYMDNTNLNFY-QDAYEIGPEKIIDTYAVATQHVDQGLSLTLFFPDTATTRDINRAQIYAWKKGIKSIYYVRLRQVALSGTE-VDGCVSC 714
>gi|167544312|ref|ZP_02339883.1| hypothetical protein Sentent_13608 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] (705 aa)
Score = 2037, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +  T ++P+   F S  E+LE L  E YYD  V  +Y  +F+  +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYDIQR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFATHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVFRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|110806692|ref|YP_690212.1| ribonucleotide-diphosphate reductase subunit alpha [Shigella flexneri 5 str. 8401] >gi|110616240|gb|ABF04907.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Shigella flexneri 5 str. 8401] (714 aa)
Score = 2037, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 510/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFSRTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSCITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|161615702|ref|YP_001589667.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|161365066|gb|ABX68834.1| hypothetical protein SPAB_03487 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (714 aa)
Score = 2037, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 714
>gi|16766118|ref|NP_461733.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella typhimurium LT2] >gi|585859|sp|Q08698|RIR3_SALTY Ribonucleoside-diphosphate reductase 2 subunit alpha (Ribonucleotide reductase 2) (R1E protein) >gi|49258467|pdb|1PEM|A Chain A, Ribonucleotide Reductase Protein R1e From Salmonella Typhimurium >gi|49258468|pdb|1PEO|A Chain A, Ribonucleotide Reductase Protein R1e From Salmonella Typhimurium >gi|49258469|pdb|1PEQ|A Chain A, Ribonucleotide Reductase Protein R1e From Salmonella Typhimurium >gi|49258470|pdb|1PEU|A Chain A, Ribonucleotide Reductase Protein R1e From Salmonella Typhimurium >gi|109157244|pdb|2BQ1|E Chain E, Ribonucleotide Reductase Class 1b Holocomplex R1e,R2f From Salmonella Typhimurium >gi|109157245|pdb|2BQ1|F Chain F, Ribonucleotide Reductase Class 1b Holocomplex R1e,R2f From Salmonella Typhimurium >gi|1184247|emb|CAA51699.1| ribonucleoside-diphosphate reductase [Salmonella typhimurium] >gi|16421356|gb|AAL21692.1| ribonucleoside diphosphate reductase 2, alpha subunit [Salmonella typhimurium LT2] (714 aa)
Score = 2037, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +  T ++P+   F S  E+L  L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYDIQR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 714
>gi|56414766|ref|YP_151841.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56129023|gb|AAV78529.1| ribonucleoside-diphosphate reductase 2 alpha chain [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (714 aa)
Score = 2037, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 714
>gi|194451930|ref|YP_002046770.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194410234|gb|ACF70453.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (714 aa)
Score = 2037, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGETFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 714
>gi|168822878|ref|ZP_02834878.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (705 aa)
Score = 2037, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|191167117|ref|ZP_03028938.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli B7A] >gi|190902899|gb|EDV62627.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli B7A] (714 aa)
Score = 2036, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+   AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  NF +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDATLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPNFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|156932795|ref|YP_001436711.1| ribonucleotide-diphosphate reductase subunit alpha [Enterobacter sakazakii ATCC BAA-894] >gi|156531049|gb|ABU75875.1| hypothetical protein ESA_00591 [Enterobacter sakazakii ATCC BAA-894] (706 aa)
Score = 2036, Expect = 0.0e+00, Identities = 385/706 (54%), Positives = 500/706 (70%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QFE D  AV  ++   + P    F     +L YL  E YYD NV ++Y +SF+  +F++A  Y F F +F+GA KFYT+Y LK+FD K Y EHF DR    AL    G+E  A   LDE+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGRA    LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N  MALFSPYD++R YGKP  DIS++E Y  L+ +  I K+YISAR+LFQ++AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y   G D+ CNLGSLNIA  M D  +FG+TV+ A++AL +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S E +DFTN++FYT+ +HA   S + A+E G  FE F+ ++YA G YFDKY       WTP+T RV EL     + +PT + W  L +D+ + GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     8 YHALNAMLNLYDADGRIQFEKDREAVAAFMTAHVAPRSVTFPDTHARLAYLVSEGYYDENVLRRYDASFVAGLFDEAHRYGFTFKTFLGAWKFYTSYTLKTFDGKRYLEHFPDRACMVALTLACGDETLARQILDEILSGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRAVNAALQLSKRGGGVAFSLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLSAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKANAQMALFSPYDVERIYGKPFGDISVSEMYSQLVEDERIRKRYISARELFQRLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASTFDENLNYATTGHDISCNLGSLNIAHTM-DSPDFGRTVEVAVRALTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEGLDFTNLYFYTVTWHALNTSMKLARERGERFEGFEASRYASGEYFDKYLS---QIWTPRTARVAELFARAGITLPTPEMWRALRDDVMRHGLYNRNLQAVPPTGSISYINHATSSIHPIVSKIEIRKEGKIGRVYYPAPFMTNENLSLY-QDAYEIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWKKGIKTLYYIRLRQLALEGTE-IEGCVSCAL 706
>gi|167992528|ref|ZP_02573626.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] (705 aa)
Score = 2036, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +  T ++P+   F S  E+L  L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYDIQR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|168476630|ref|ZP_02705653.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (705 aa)
Score = 2036, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGIMLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|168464073|ref|ZP_02697990.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195633333|gb|EDX51747.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] (705 aa)
Score = 2035, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|168244604|ref|ZP_02669536.1| hypothetical protein Senterienterica_23395 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] (705 aa)
Score = 2035, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGETFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|194737455|ref|YP_002115763.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194712957|gb|ACF92178.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (714 aa)
Score = 2035, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 506/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN +FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 714
>gi|62181311|ref|YP_217728.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62128944|gb|AAX66647.1| ribonucleoside diphosphate reductase 2, alpha subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (714 aa)
Score = 2034, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 506/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYDIQR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN +FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENVQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 714
>gi|41409198|ref|NP_962034.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41398018|gb|AAS05648.1| NrdE [Mycobacterium avium subsp. paratuberculosis K-10] (726 aa)
Score = 2034, Expect = 0.0e+00, Identities = 385/710 (54%), Positives = 521/710 (73%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D+  Y +LNA + L+D +G  QF+ D+LA  +Y    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ S+ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    ++S P+IE GN+ + A+GLG MNLHG+LA   I+Y SEE +DFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   E  W P TE+V++L  +  + IPT+ DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    24 DETDYHALNAMLNLYDADGKIQFDKDVLAARQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKSLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTGLAEKLVDEIIEGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERVYGLPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIDGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLAREGIFYGSEEGIDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT---EQVWEPATEKVRQLFADAGIRIPTQDDWKRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 726
>gi|168233768|ref|ZP_02658826.1| hypothetical protein Sententerica_22503 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194470517|ref|ZP_03076501.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194456881|gb|EDX45720.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (705 aa)
Score = 2034, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNIYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|194445580|ref|YP_002042052.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194404243|gb|ACF64465.1| ribonucleoside-diphosphate reductase, alpha subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] (714 aa)
Score = 2034, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 506/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    + P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYDIQR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDRDQQAIDAFFAAHVCPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 714
>gi|193065976|ref|ZP_03047035.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli E22] >gi|192926390|gb|EDV81025.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli E22] (714 aa)
Score = 2033, Expect = 0.0e+00, Identities = 378/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+   AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  NF +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDATLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPNFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|168219123|ref|ZP_02644355.1| hypothetical protein Senterenterica_01925 [Salmonella enterica subsp. enterica serovar Agona str. SL483] (705 aa)
Score = 2033, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAKMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSSEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRTLFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|168262085|ref|ZP_02684058.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (705 aa)
Score = 2033, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 506/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F+  +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYDIQR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVFRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|188025724|ref|ZP_02959589.2| hypothetical protein PROSTU_01460 [Providencia stuartii ATCC 25827] >gi|188020254|gb|EDU58294.1| hypothetical protein PROSTU_01460 [Providencia stuartii ATCC 25827] (723 aa)
Score = 2033, Expect = 0.0e+00, Identities = 388/718 (54%), Positives = 529/718 (73%)
  Q:     8 NNKNNIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           N KN   VD   Y +LNA + L++  G  QFE D  A   Y    +  N   F+ +KEKL++L  ENYY+  V ++Y  +F+  +F++A  + FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL   +GN+  A   +DE+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ +TNLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ENK+M LFSPYDI+REYG PMS+IS+TE+Y  ++NN  I K  I+AR+ FQ +AE+QFESGYP+ILF+D AN  N  +  RI MSNLC+EI Q+N PS    DL+Y ++G+D+ CNLGS+NIAK+M D  +F ++V  AI+AL +++ ++ + S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEEA+DFTN++FYT+ YHA K SN+ A E    F+ F++++YA+G YFDKY       W PKT+ V+EL +   + IPT+ DW+ L + + + G+ N +L A+ PTGSISY+++ T S+ PIV+ IEIRKEGK+GRVY PA  ++ +N  YY + AY+IG   IID  + A QHVDQ +S+TLF  ++ATTRD+N+A IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 NTKNKTTVD---YHALNAMLNLYNSAGEIQFEKDKEAAHHYFRQHVNQNTVFFHDLKEKLDFLVNENYYEPQVIEQYDFAFIKKLFKQAYAHKFRFQTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLAQGNQALASYLVDEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSVNSALQLSKRGGGVAFLMTNLREQGAPIKLIENQSSGVVPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITFQLAKENKEMYLFSPYDIEREYGVPMSEISVTEKYHEMVNNKAIKKYKINAREFFQTLAEIQFESGYPYILFEDTANRAN-PIAGRINMSNLCSEILQVNRPSFYEDDLSYREVGKDISCNLGSMNIAKMM-DAPDFAQSVAIAIRALTAVSDMSHIRSVPSIEQGNHQSHAIGLGQMNLHGYLARERIHYGSEEALDFTNIYFYTITYHALKTSNQLAIERKATFKGFEHSEYANGRYFDKYIN---QSWLPKTQTVQELFRRSGIEIPTQADWLSLKQSVMEHGIYNQNLQAIPPTGSISYINNSTSSIHPIVARIEIRKEGKIGRVYYPAPFMNNDNLEYY-QDAYQIGPEKIIDTYAVATQHVDQGLSLTLFFKDDATTRDINRAQIYAWRKGIKTLYYIRLRQTALEGTE-IDGCVSCTL 723
>gi|170765802|ref|ZP_02900613.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia albertii TW07627] >gi|170124948|gb|EDS93879.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia albertii TW07627] (714 aa)
Score = 2032, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD  V  +YS  F+I++F  A    FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ N +I KKYI+AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  NF +TV+ AI+ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N ++ AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDNAGRIQFDKDRQAVDAFMATHVRPNTVTFSSQQQRLNWLVNEGYYDEGVLNRYSRDFVITLFAHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLATQLADEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEYYDELVANKHIRKKYINARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASAYDENLDYARTGHDISCNLGSLNIAHTM-DSPNFARTVETAIRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFAHSSITLPTREMWAQLRDDVMRYGIYNQNIQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|193071023|ref|ZP_03051951.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli E110019] >gi|192955681|gb|EDV86156.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli E110019] (714 aa)
Score = 2032, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  NF +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA   YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPNFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASSEYFSQYLQ---GNWQPKTTKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|22125125|ref|NP_668548.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis KIM] >gi|45442236|ref|NP_993775.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis biovar Microtus str. 91001] >gi|108808371|ref|YP_652287.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis Antiqua] >gi|108811298|ref|YP_647065.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis Nepal516] >gi|145598905|ref|YP_001162981.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis Pestoides F] >gi|165925303|ref|ZP_02221135.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939924|ref|ZP_02228462.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166008354|ref|ZP_02229252.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212442|ref|ZP_02238477.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398490|ref|ZP_02304014.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421233|ref|ZP_02312986.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423147|ref|ZP_02314900.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468721|ref|ZP_02333425.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis FV-1] >gi|170023363|ref|YP_001719868.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pseudotuberculosis YPIII] >gi|21957984|gb|AAM84799.1|AE013726_2 ribonucleoside-diphosphate reductase 2, alpha subunit [Yersinia pestis KIM] >gi|45437100|gb|AAS62652.1| ribonucleoside-diphosphate reductase 2 alpha chain [Yersinia pestis biovar Microtus str. 91001] >gi|108774946|gb|ABG17465.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Yersinia pestis Nepal516] >gi|108780284|gb|ABG14342.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Yersinia pestis Antiqua] >gi|145210601|gb|ABP40008.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Yersinia pestis Pestoides F] >gi|165912143|gb|EDR30782.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165922910|gb|EDR40061.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992736|gb|EDR45037.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206373|gb|EDR50853.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960722|gb|EDR56743.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050994|gb|EDR62402.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057317|gb|EDR67063.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749897|gb|ACA67415.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pseudotuberculosis YPIII] (716 aa)
Score = 2031, Expect = 0.0e+00, Identities = 387/714 (54%), Positives = 528/714 (73%)
  Q:    10 KNNIIVDKDS---YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           K N+I   DS   Y SLNA + L+D +G  QF+ D LA  +Y    +  N   F++++EK++YL  E YY+  V  +Y  SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN+  A   ++E+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEK+RIK+LSLGVV+PDI F LA+ N++M LFSPYDI++ YG PMS+ISI+E+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N P+  + DL+Y ++G+D+ CNLGSLNIA+VM D  +FGK+++ AI+ L +++ ++++ S P+IE GN ++ A+GLG MNLHG+LA  +++Y SEEA+DFTN++FYT+AYHA +ASN+ A E    F+ F  + YA G++F KY    E  W PKT RV+ L  +  +AIP +QDWI L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:     5 KLNVIDSSDSELDYHSLNAMLNLYDADGRIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKIDYLIEEGYYEKEVLDQYDFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLATGNQTLARELVEEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKVRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDIEQVYGVPMSEISISEKYREMVDNKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNAPTEYHEDLSYRRIGKDISCNLGSLNIAQVM-DSPDFGKSIEIAIRGLTAVSEMSNIRSVPSIEKGNQESHAIGLGQMNLHGYLARERLFYGSEEALDFTNIYFYTVAYHAIRASNQLAIERASHFKGFDESDYASGAFFSKYI---EQSWQPKTARVQALFADAGIAIPNQQDWIALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALEGTE-VEGCVSC 714
>gi|168238722|ref|ZP_02663780.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] (705 aa)
Score = 2031, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 506/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN +FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|51597272|ref|YP_071463.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pseudotuberculosis IP 32953] >gi|153949726|ref|YP_001400044.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pseudotuberculosis IP 31758] >gi|186896376|ref|YP_001873488.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pseudotuberculosis PB1/+] >gi|51590554|emb|CAH22195.1| ribonucleoside-diphosphate reductase 2 alpha chain [Yersinia pseudotuberculosis IP 32953] >gi|152961221|gb|ABS48682.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pseudotuberculosis IP 31758] >gi|186699402|gb|ACC90031.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pseudotuberculosis PB1/+] (716 aa)
Score = 2031, Expect = 0.0e+00, Identities = 387/714 (54%), Positives = 527/714 (73%)
  Q:    10 KNNIIVDKDS---YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           K N+I   DS   Y SLNA + L+D +G  QF+ D LA  +Y    +  N   F++++EK++YL  E YY+  V  +Y  SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN+  A   ++E+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEK+RIK+LSLGVV+PDI F LA+ N++M LFSPYDI++ YG PMS+ISI+E+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N P+  + DL+Y  +G+D+ CNLGSLNIA+VM D  +FGK+++ AI+ L +++ ++++ S P+IE GN ++ A+GLG MNLHG+LA  +++Y SEEA+DFTN++FYT+AYHA +ASN+ A E    F+ F  + YA G++F KY    E  W PKT RV+ L  +  +AIP +QDWI L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:     5 KLNVIDSSDSELDYHSLNAMLNLYDADGRIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKIDYLIEEGYYEKEVLDQYDFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLATGNQTLARELVEEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKVRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDIEQVYGVPMSEISISEKYREMVDNKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNAPTEYHEDLSYRHIGKDISCNLGSLNIAQVM-DSPDFGKSIEIAIRGLTAVSEMSNIRSVPSIEKGNQESHAIGLGQMNLHGYLARERLFYGSEEALDFTNIYFYTVAYHAIRASNQLAIERASHFKGFDESDYASGAFFSKYI---EQSWQPKTARVQALFADAGIAIPNQQDWIALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALEGTE-VEGCVSC 714
>gi|23335915|ref|ZP_00121146.1| COG0209: Ribonucleotide reductase, alpha subunit [Bifidobacterium longum DJO10A] >gi|23465252|ref|NP_695855.1| ribonucleotide-diphosphate reductase subunit alpha [Bifidobacterium longum NCC2705] >gi|189440324|ref|YP_001955405.1| Ribonucleotide reductase alpha subunit [Bifidobacterium longum DJO10A] >gi|23325883|gb|AAN24491.1| NrdE [Bifidobacterium longum NCC2705] >gi|189428759|gb|ACD98907.1| Ribonucleotide reductase alpha subunit [Bifidobacterium longum DJO10A] (731 aa)
Score = 2030, Expect = 0.0e+00, Identities = 395/706 (55%), Positives = 501/706 (70%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYA----DGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QF+ D  A  +Y+   +  N K+F S  E+LEYL    YY+  VF +YS+ FL  I+E  ++  F F +F+GA KFYT+YALK+FD + Y E F  R    AL    GNEQ A+ Y DEM+ GR+Q ATPTFLN GK QRGE VSC+L+R+EDNMESI R     LQLSKRGGGVA  L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL+FLD+KRENADEKIRIKSL+LGVV+PDI F LA++   MALFSPYD++R YGKP +DIS+TE Y+ ++ +  I K YI ARK F  IAE+QFESGYP+I+F+D  N  N  +  R+ MSNLC+EI Q+  PS  N DLTY  +G D+ CNLGSLNIAK M+ G   G TV+ AI+AL S+A    +++ P+I   N +  A+GLG MNLHGFLA   I Y SEE +DFT+M+F T+AYHAY+AS+  A E G  F +F  + YA     G+YFDKYT    +  TP+TERV+ L ++Y +AIPT  DW  L + I K G+ N +L AV PTGSISY++  T S+ PI S IEIRKEGK+GRVY PA  +  +N  YY K AYEIG   I+D  + A QHVDQ +S+TLF  + ATTRDLNKA IYA+ K   ++YYIRIRQ+ L+ +E +  C +C++
  S:    28 YHALNAMLNLYDADGKIQFDKDKAAEREYVTGHVATNSKRFASTAERLEYLISNQYYNPAVFNQYSAEFLDRIYEHVESAGFEFGTFLGAFKFYTSYALKTFDGRLYLEDFPQRCAAVALELAAGNEQQAIEYADEMLAGRFQPATPTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLRELGAPIKHIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKSLALGVVIPDITFELAKQKAQMALFSPYDVERVYGKPFADISVTEHYDEMVADDRIKKTYIDARKFFTTIAELQFESGYPYIVFEDTVNRAN-PIEGRVTMSNLCSEILQVQEPSAYNEDLTYAHVGRDISCNLGSLNIAKAMDGG--LGHTVETAIRALTSVAEHTSINAVPSIRRANEEGHAIGLGQMNLHGFLAREGIQYGSEEGLDFTDMYFMTVAYHAYRASHALAVEHGRTFASFATSDYAKPAGQGNYFDKYTDGRRSL-TPRTERVRALFEQYGIAIPTAADWEALRDAILKDGIYNQNLQAVPPTGSISYINHSTSSIHPIASKIEIRKEGKIGRVYYPAAYMTNDNLGYY-KDAYEIGWKAIVDTYAEATQHVDQGLSLTLFFPDTATTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTE-VQGCVSCML 731
>gi|157162126|ref|YP_001459444.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli HS] >gi|188494464|ref|ZP_03001734.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli 53638] >gi|157067806|gb|ABV07061.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli HS] >gi|188489663|gb|EDU64766.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli 53638] (714 aa)
Score = 2030, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYTRTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFTRSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|170019073|ref|YP_001724027.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli ATCC 8739] >gi|169754001|gb|ACA76700.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli ATCC 8739] (701 aa)
Score = 2030, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     3 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYTRTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFTRSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 701
>gi|167552694|ref|ZP_02346446.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (705 aa)
Score = 2029, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 506/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN +FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLVQEGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENVQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|16130589|ref|NP_417161.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Escherichia coli str. K-12 substr. MG1655] >gi|89109468|ref|AP_003248.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Escherichia coli W3110] >gi|170082261|ref|YP_001731581.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Escherichia coli str. K12 substr. DH10B] >gi|2507305|sp|P39452|RIR3_ECOLI Ribonucleoside-diphosphate reductase 2 subunit alpha (Ribonucleotide reductase 2) (R1E protein) >gi|1789030|gb|AAC75722.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Escherichia coli str. K-12 substr. MG1655] >gi|85675520|dbj|BAA16539.2| ribonucleoside-diphosphate reductase 2, alpha subunit [Escherichia coli W3110] >gi|169890096|gb|ACB03803.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Escherichia coli str. K12 substr. DH10B] (714 aa)
Score = 2029, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFTHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYTRTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFTRSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|194427894|ref|ZP_03060440.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli B171] >gi|194414127|gb|EDX30403.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli B171] (714 aa)
Score = 2029, Expect = 0.0e+00, Identities = 378/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+   AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  NF +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDATLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAVRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPNFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|194432998|ref|ZP_03065281.1| ribonucleoside-diphosphate reductase, alpha subunit [Shigella dysenteriae 1012] >gi|194418725|gb|EDX34811.1| ribonucleoside-diphosphate reductase, alpha subunit [Shigella dysenteriae 1012] (701 aa)
Score = 2029, Expect = 0.0e+00, Identities = 378/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+   AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     3 YHALNAMLNLYDSAGRIQFDKDRQAVDAFMATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDATLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 701
>gi|15803195|ref|NP_289227.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 EDL933] >gi|15832792|ref|NP_311565.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 str. Sakai] >gi|168708183|ref|ZP_02740460.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 str. EC4045] >gi|168719747|ref|ZP_02752024.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 str. EC4206] >gi|168734146|ref|ZP_02766423.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 str. EC4115] >gi|168750918|ref|ZP_02775940.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4113] >gi|168755420|ref|ZP_02780427.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4401] >gi|168762470|ref|ZP_02787477.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4501] >gi|168768766|ref|ZP_02793773.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4486] >gi|168774793|ref|ZP_02799800.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4196] >gi|168778657|ref|ZP_02803664.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4076] >gi|168792061|ref|ZP_02817068.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 str. EC4042] >gi|168800560|ref|ZP_02825567.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC508] >gi|195938429|ref|ZP_03083811.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 str. EC4024] >gi|12517114|gb|AAG57785.1|AE005496_8 ribonucleoside-diphosphate reductase 2, alpha subunit [Escherichia coli O157:H7 EDL933] >gi|13363009|dbj|BAB36961.1| ribonucleoside-diphosphate reductase 2 alpha subunit [Escherichia coli O157:H7 str. Sakai] >gi|187769664|gb|EDU33508.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4196] >gi|188014971|gb|EDU53093.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4113] >gi|189003146|gb|EDU72132.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4076] >gi|189357239|gb|EDU75658.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4401] >gi|189361996|gb|EDU80415.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4486] >gi|189367236|gb|EDU85652.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC4501] >gi|189377190|gb|EDU95606.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli O157:H7 str. EC508] (714 aa)
Score = 2028, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 509/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFMATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-VAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTGKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|157148213|ref|YP_001455532.1| ribonucleotide-diphosphate reductase subunit alpha [Citrobacter koseri ATCC BAA-895] >gi|157085418|gb|ABV15096.1| hypothetical protein CKO_04024 [Citrobacter koseri ATCC BAA-895] (706 aa)
Score = 2028, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 511/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  AVE +  T ++PN   F S  E+LEYL  E YYD +V  +Y  +F++ +F  A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+   AL   +GNE  A+   DE+++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PD+ F LA+EN  MALFSPYD++R YGKP  DI+I+E Y+ LL +  + K+YI+AR+ FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y Q G D+ CNLGSLNIA  M D  NFG+TV+ AI+ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA   S   A+E G  F  FK ++YA G YF++Y Q +   W PKT+ V+ L     + +P ++ W +L +++ ++G+ N +L AV PTGSISY++  T S+ PIVS IEIRKEGK GRVY PA +  + N  MY  + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     8 YHALNAMLNLYDKAGHIQFDKDRQAVEVFFATHVRPNSVSFASQDERLEYLLREGYYDESVLTRYDRAFVVKLFAHAHASGFRFQTFLGAWKYYTSYTLKTFDGKRYLEDFEDRVTMVALTLAQGNEALAMQLTDEILSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDVTFRLAKENAQMALFSPYDVERIYGKPFGDIAISERYDELLADERVRKQYINAREFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASTYDENLDYAQTGHDISCNLGSLNIAHTM-DSPNFGRTVETAIRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTVTWHALNTSMMMARERGKTFAGFKQSRYASGEYFEQYLQGD---WQPKTDTVRALFARSGMTLPGREMWARLRDEVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVSKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYEIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQLALEGTE-IEGCVSCAL 706
>gi|116253996|ref|YP_769834.1| ribonucleotide-diphosphate reductase subunit alpha [Rhizobium leguminosarum bv. viciae 3841] >gi|115258644|emb|CAK09748.1| putative ribonucleoside-diphosphate reductase alpha subunit [Rhizobium leguminosarum bv. viciae 3841] (707 aa)
Score = 2028, Expect = 0.0e+00, Identities = 392/706 (55%), Positives = 519/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G  Q + D +A ++Y    +  N   F++++EKL+YL  E Y +  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   AL   RG+E  A   ++E+++GR+Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYLNA HPDI++FLD+KRENADEKIRIK+LSLGVVVPDI F LA+ N+DM LFSPYD++R YG P ++IS+TE+Y  + ++  I+KK I AR+ FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q++  S  + DL+Y+ LG+D+ CNLGSLNIA  M D A+FGKT++ +I+AL +++ ++ +SS P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+ YHA +ASN  A E G  F+ F+N+KYA G YFDKYT   +  W P TE+VK L +   + IPT++DW  L + +   GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA I+A+ K   +IYYIR+RQ  L  +E +  C +C +
  S:     9 YHALNAMLNLYDDQGRIQLDKDRMAAKQYFLQHVNQNTVFFHNLREKLDYLVTEGYCEQEVLDQYSFNFVRDLFDQAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICMVALALARGDEALARDMVEEIISGRFQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALSLTNIREAGAPIKHIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDIMRFLDTKRENADEKIRIKTLSLGVVVPDITFELAKNNEDMYLFSPYDVERVYGVPFTEISVTEKYREMADDARISKKKIKAREFFQVLAEIQFESGYPYIMFEDTVNRAN-PIAGRISMSNLCSEILQVSEASEYHDDLSYKHLGKDISCNLGSLNIAAAM-DSADFGKTIETSIRALTAVSDMSHISSVPSIEKGNDESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVTYHAIRASNLLAVERGTSFKGFENSKYASGEYFDKYT---DRLWEPATEKVKALFETADIHIPTQEDWAALKKLVMASGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAPFMTNDNLDYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIHAWKKGIKTIYYIRLRQMALSGTE-VQGCVSCTL 707
>gi|163867488|ref|YP_001608687.1| ribonucleotide-diphosphate reductase subunit alpha [Bartonella tribocorum CIP 105476] >gi|161017134|emb|CAK00692.1| ribonucleoside-diphosphate reductase 2 alpha chain [Bartonella tribocorum CIP 105476] (716 aa)
Score = 2027, Expect = 0.0e+00, Identities = 395/716 (55%), Positives = 524/716 (73%)
  Q:     8 NNKNNIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           + K++ I D   Y +LNA + L+DENG+ QF+ D LA  +Y    +  N   F+++KEK++YL  E YY+  +F+ Y  SF+  +F++A  + FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   +L   +GN+  A +++DE++TGR+Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGRA  + LQLSKRGGGVA CLTNLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A H DI+KFLD+KRENADEK+RIK+LSLGVV+PDI F LAR N+DM LFS YDI+R  GKP SDIS+TE Y + ++N  I KK ISAR  FQ +AE+QFESGYP+ILF+D AN  N  +  RI MSNLC+EI Q++  S L TDLTY  +G D+ CNLGS+NIAK ME   +FG+TV+ A++AL +++ +++++  P+I  GN+++ A+GLG MNLHGFLA  +IYY S EA+DFTN++FY + YHA + SN  A+E   +F  F+ + YADG +F+KY + E   W P+   V+EL     + IP ++DW +L + + K+GL N +L AV PTGSISY++  T S+ PI S IEIRKEGK+GRVY PA  +D  N  +Y + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   SIYY+R+RQ  L  +E +  C +C
  S:     9 SQKSDQITD---YHALNAMLNLYDENGHIQFDMDRLAARQYFLQHVNQNTVFFHNLKEKIDYLIEEGYYEKALFELYDFSFIKKLFKRAYAFKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICLVSLYLAQGNKALAESFVDEIITGRFQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRAVNSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGVLPVMKLLEDSFSYANQLGARQGAGAVYLHAHHLDIMKFLDTKRENADEKVRIKTLSLGVVIPDITFELARNNEDMYLFSSYDIERVTGKPFSDISLTEHYRSFVDNAKIRKKKISARVFFQTLAEIQFESGYPYILFEDTANRSN-PIAGRISMSNLCSEILQVSEASELETDLTYRTIGSDISCNLGSMNIAKAMES-PDFGQTVESAVRALTAVSDMSNIACVPSIAKGNAESHAIGLGQMNLHGFLAREQIYYGSPEAIDFTNIYFYIVTYHAIRVSNLIARERQEMFAGFEKSAYADGRFFEKYIEKE---WKPQFALVQELFARNNIVIPDQKDWQELKKRVIKYGLYNRNLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRVYYPAPYMDNTNLNFY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFPDTATTRDINRAQIYAWKKGIKSIYYVRLRQVALSGTE-VDGCVSC 714
>gi|117624911|ref|YP_853851.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli APEC O1] >gi|115514035|gb|ABJ02110.1| ribonucleoside-diphosphate reductase 2 alpha chain [Escherichia coli APEC O1] (701 aa)
Score = 2026, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A    FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     3 YHALNAMLNLYDSAGRIQFDKDSQAVDAFMTTHVRPNSVAFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 701
>gi|168228481|ref|ZP_02653712.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (705 aa)
Score = 2026, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 505/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+   F S  E+LE L  E YYD  V  +Y  +F++ +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLR  GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN +FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  ++ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVTFASQHERLETLIREGYYDDAVLARYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLRGAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLAMEGTE-IEGCVSCAL 705
>gi|74313246|ref|YP_311665.1| ribonucleotide-diphosphate reductase subunit alpha [Shigella sonnei Ss046] >gi|187730558|ref|YP_001881573.1| ribonucleoside-diphosphate reductase, alpha subunit [Shigella boydii CDC 3083-94] >gi|73856723|gb|AAZ89430.1| ribonucleoside-diphosphate reductase 2 alpha subunit [Shigella sonnei Ss046] >gi|187427550|gb|ACD06824.1| ribonucleoside-diphosphate reductase, alpha subunit [Shigella boydii CDC 3083-94] (714 aa)
Score = 2026, Expect = 0.0e+00, Identities = 378/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+   AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N  S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFMATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDATLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-VAGRINMSNLCSEILQVNCASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|16761589|ref|NP_457206.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143069|ref|NP_806411.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25328484|pir||AG0841 ribonucleoside-diphosphate reductase (EC 1.17.4.1) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16503890|emb|CAD05918.1| ribonucleoside-diphosphate reductase 2 alpha chain [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138702|gb|AAO70271.1| ribonucleoside-diphosphate reductase 2 alpha chain [Salmonella enterica subsp. enterica serovar Typhi Ty2] (714 aa)
Score = 2026, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 505/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  A++ +    ++P+  KF S  E+LE L  E YYD  V  +Y  +F+  +FE A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYDIQR YGKP  DI+I+E Y+ L+ +P++ K YI+AR  FQ +AE+QFESGY +I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN +FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDKAGHIQFDKDQQAIDAFFAAHVRPHSVKFASQHERLETLVREGYYDDAVLARYDRAFVFRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYLYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYDIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALESTE-IEGCVSCAL 714
>gi|49475006|ref|YP_033047.1| ribonucleotide-diphosphate reductase subunit alpha [Bartonella henselae str. Houston-1] >gi|49237811|emb|CAF27006.1| Ribonucleotide reductase alpha-chain [Bartonella henselae str. Houston-1] (716 aa)
Score = 2025, Expect = 0.0e+00, Identities = 395/716 (55%), Positives = 524/716 (73%)
  Q:     8 NNKNNIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           + K++ I D   Y +LNA + L+DENG+ QF+ D LA  +Y    +  N   F+++KEK++YL  E YY+  +F+ Y  SF+  +F++A  + FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   AL   +GN+  A +++DE++TGR+Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA CLTNLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A H DI+KFLD+KRENADEK+RIK+LSLGV++PDI F LAR N+DM LFS YDI+R  GKP SDIS+TE Y + ++N  I KK ISAR  FQ +AE+QFESGYP+ILF+D AN  N  +  RI MSNLC+EI Q+N  S L  DLTY  +G D+ CNLGS+NIAK M D  +FG+TV+ A++AL +++ +++++  P+I  GN+++ A+GLG MNLHGFLA  +IYY S EA+DFTN++FY +AYHA + SN  A+E   +F  F+ + YADGS+F KY + E   W P+   V+EL     + IP ++DW +L + + ++GL N +L AV PTGSISY++  T S+ PI S IEIRKEGK+GRVY PA  +D  N  +Y + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   SIYY+R+RQ  L  +E +  C +C
  S:     9 SQKSDQITD---YHALNAMLNLYDENGHIQFDMDRLAARQYFLQHVNQNTVFFHNLKEKIDYLIEEGYYEKALFELYDFSFIKKLFKRAYAFKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICLVALYLAQGNKALAESFVDEIITGRFQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSVNSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGVLPVMKLLEDSFSYANQLGARQGAGAVYLHAHHLDIMKFLDTKRENADEKVRIKTLSLGVIIPDITFELARNNEDMYLFSSYDIERVTGKPFSDISLTEHYRSFVDNAKIRKKKISARVFFQTLAEIQFESGYPYILFEDTANRAN-PIAGRINMSNLCSEILQVNEASELEADLTYRTVGSDISCNLGSMNIAKAM-DSDDFGRTVEAAVRALTAVSDMSNIACVPSIAKGNAESHAIGLGQMNLHGFLAREQIYYGSPEAIDFTNIYFYIVAYHAIRVSNLIARERQKMFVGFEKSAYADGSFFAKYIEQE---WKPQFSLVQELFARNNIVIPDQKDWQELKKLVIEYGLYNRNLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRVYYPAPYMDNTNLDFY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFPDTATTRDINRAQIYAWKKGIKSIYYVRLRQVALSGTE-VDGCVSC 714
>gi|62425855|ref|ZP_00380986.1| COG0209: Ribonucleotide reductase, alpha subunit [Brevibacterium linens BL2] (720 aa)
Score = 2025, Expect = 0.0e+00, Identities = 387/706 (54%), Positives = 516/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D++G  QFE D  A  +Y    +  N   F+ +KEKL+YL  + YY+  V  +YS  F+  + + A +  FRF +F+GA KFYT+Y LK+FD K Y E FEDR+V  AL   RG+E  A   +DE++ GR+Q ATPTFLNAGKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ LTN+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDI KFLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N+DM LFSPYD++R YG P SD+++TE+YE +++N  I K  I+AR+ FQ +AE+QFESGYP+++F+D  N+ N  ++ +IIMSNLC+EI Q++ PS  ++DL Y+ +G+D+ CNLGSLNIA  M D  +FG+T++ AI+ L ++A  +D+ S P+I  GN  + A+GLG MNLHG+LA   IYY S+E +DFTNM+FYT+AYH  +AS E AKE    F  F+ +KYA G YFDKYT   +  W P+T RV E+  E  + IPT+ DW +L   + + G+ N +L AV PTGSISY+++ T S+ P+ S +EIRKEGK+GRVY PA  +D +N  YY + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C++
  S:    22 YHALNAMLNLYDQDGRIQFERDKQAARQYFLQHVNNNTVFFHDLKEKLDYLVEKEYYEPEVLDQYSFDFIEELSKHAYSAKFRFQTFLGAFKFYTSYTLKTFDGKRYLERFEDRVVMVALFLARGDETLAKQLVDEIIHGRFQPATPTFLNAGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFALTNIRESGAPIKKIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYKFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNEDMYLFSPYDVERVYGMPFSDVNVTEKYEEMVDNAAIKKNKINAREFFQTLAEIQFESGYPYVMFEDTVNKAN-PIDGKIIMSNLCSEILQVSEPSKYDSDLGYDVVGKDISCNLGSLNIALTM-DSTDFGQTIETAIRGLTAVAETSDIQSVPSIARGNDMSHAIGLGQMNLHGYLAREHIYYGSDEGLDFTNMYFYTVAYHCVRASMEIAKERKTAFAGFERSKYASGEYFDKYT---DEVWEPRTRRVAEMFTEAGVHIPTQDDWRELKAAVAEHGIYNQNLQAVPPTGSISYINNSTSSIHPVASKVEIRKEGKIGRVYYPAPFMDNDNLKYY-QDAYEIGYEKIIDTYAEATKHVDQGLSLTLFFMDTATTRDINKAQIYAWRKGIKTIYYIRLRQLALEGTE-VDGCVSCML 720
>gi|190893562|ref|YP_001980104.1| ribonucleoside-diphosphate reductase protein, alpha subunit [Rhizobium etli CIAT 652] >gi|190698841|gb|ACE92926.1| ribonucleoside-diphosphate reductase protein, alpha subunit [Rhizobium etli CIAT 652] (693 aa)
Score = 2024, Expect = 0.0e+00, Identities = 390/699 (55%), Positives = 515/699 (73%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+D+ G  Q + D +A ++Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   AL   RG+E  A   +DE+++GR+Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYLNA HPDI++FLD+KREN DEKIRIK+LSLGVVVPDI F LA+ N+DM LFSPYD++R YG P ++IS+TE+Y  ++ +  I+KK I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ RI MSNLC+EI Q++  S  N DL+Y+ LG+D+ CNLGSLNIA  M D A+FGKT++ +I+AL +++ ++ ++S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+ YHA +ASN  A E G  F+ F+N+KYA G YFDKYT+ E   W P TE+V+ L  +  + IPT+ DW +L   +   GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L  +E +  C +C +
  S:     2 LNLYDDEGRIQLDKDRMAAKQYFLQHVNQNTVFFHNLREKLDYLVTEGYYEQEVLDQYSFNFVRDLFDQAYARKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICMVALTLARGDEALARDMVDEIISGRFQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALSLTNIREAGAPIKQIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDIMRFLDTKRENVDEKIRIKTLSLGVVVPDITFELAKNNEDMYLFSPYDVERVYGVPFTEISVTEKYREMVGDARISKKKIKAREFFQVLAEIQFESGYPYIMFEDTVNRAN-PIDGRISMSNLCSEILQVSEASEYNDDLSYKHLGKDISCNLGSLNIAAAM-DSADFGKTIETSIRALTAVSDMSHIASVPSIEKGNDESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVTYHAIRASNLLAVERGTSFKGFENSKYACGDYFDKYTEQE---WKPATEKVQALFDKSGIHIPTQDDWAELKTAVMASGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAPFMTNDNLDYY-QDAYEIGAEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALSGTE-VQGCVSCTL 693
>gi|152964773|ref|YP_001360557.1| ribonucleoside-diphosphate reductase, alpha subunit [Kineococcus radiotolerans SRS30216] >gi|151359290|gb|ABS02293.1| ribonucleoside-diphosphate reductase, alpha subunit [Kineococcus radiotolerans SRS30216] (720 aa)
Score = 2024, Expect = 0.0e+00, Identities = 383/707 (54%), Positives = 514/707 (72%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           SY +LNA + L+DE G  QFE D+ A  +Y    + P  ++F + + +L ++    YY+ +V  +YS  F+ S+ ++A    FRF++F+GA KFYT+YALKSFD   Y E FEDR V  AL    G+E  A   +DE++ GR+Q ATPTFLNAGK  RGE VSC+LLR+ED+MESIGR   + LQLSKRGGGVA  L+N+RE+GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVVVPDI F LA+ N+ M LFSPYD++R YGKP  D++++E Y  ++ +  I K  I AR+ F+ +AE+QFESGYP+I+F+D  N+ N  +  RI MSNLC+EI Q+NTPS L  DLTY ++G+D+ CNLGSLNIA  M DG N G++V+ A++AL +++  +D+ S P++  GNSK+ A+GLG MNLHG+LA  +++Y SEE +DFTN++F  + +HA +ASN  A E G  FE F+N+KYADG++FDKY    EN + P TERV  L  +  +A+PT+ +W QL   + + G+ N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYYIRIRQ  L+ +E +  C +C++
  S:    21 SYHTLNAMLNLWDEEGKIQFEADVEAARQYFLQHVNPRTRRFPTFEARLAHMVENGYYEQHVLDQYSPDFVRSLTDRAHAAKFRFATFLGAFKFYTSYALKSFDGTEYLEGFEDRAVMTALTLAVGDEALATAIVDEVIAGRFQPATPTFLNAGKASRGELVSCFLLRIEDDMESIGRGINSALQLSKRGGGVALLLSNIREYGAPIKRIQNQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLSAHHPDILRFLDTKRENADEKIRIKTLSLGVVVPDITFELAKNNEPMHLFSPYDVERVYGKPFGDVAVSEHYREMVADDRIRKTQIDAREFFKTLAELQFESGYPYIVFEDTVNKANP-IAGRINMSNLCSEILQVNTPSTLAEDLTYSEIGKDISCNLGSLNIALAM-DGGNLGQSVETAVRALTAVSVASDIQSVPSVAYGNSKSHAIGLGQMNLHGYLARERVHYGSEEGIDFTNVYFAAVLFHALRASNAIAIERGETFEGFENSKYADGTFFDKYL---ENDFLPATERVAGLFADAGIALPTRAEWAQLKASVVEHGIFNQNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKLGRVYYPAPFMTNDNLEYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTIYYIRIRQMALEGTE-VEGCVSCML 720
>gi|118464322|ref|YP_883081.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium avium 104] >gi|118165609|gb|ABK66506.1| ribonucleoside-diphosphate reductase, alpha subunit [Mycobacterium avium 104] (705 aa)
Score = 2023, Expect = 0.0e+00, Identities = 384/710 (54%), Positives = 521/710 (73%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D+  Y +LNA + L+D +G  QF+ D+LA  +Y    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    ++S P+IE GN+ + A+GLG MNLHG+LA   I+Y SEE +DFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   E  W P TE+V++L  +  + IPT+ DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     3 DETDYHALNAMLNLYDADGKIQFDKDVLAARQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKALLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTGLAEKLVDEIIEGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERVYGLPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIDGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLAREGIFYGSEEGIDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT---EQVWEPATEKVRQLFADAGIRIPTQDDWKRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 705
>gi|191171419|ref|ZP_03032968.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli F11] >gi|190908353|gb|EDV67943.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli F11] (714 aa)
Score = 2023, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A    FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDSQAVDAFMTTHVRPNSVAFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLAAQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISERYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIHSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQSN---WQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|91212036|ref|YP_542022.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli UTI89] >gi|91073610|gb|ABE08491.1| ribonucleoside-diphosphate reductase 2 alpha chain [Escherichia coli UTI89] (714 aa)
Score = 2023, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A    FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDSQAVDAFMTTHVRPNSVAFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|162420596|ref|YP_001607866.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis Angola] >gi|162353411|gb|ABX87359.1| ribonucleoside-diphosphate reductase, alpha subunit [Yersinia pestis Angola] (716 aa)
Score = 2022, Expect = 0.0e+00, Identities = 386/714 (54%), Positives = 527/714 (73%)
  Q:    10 KNNIIVDKDS---YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           K N+I   DS   Y SLNA + L+D +G  QF+ D LA  +Y    +  N   F++++EK++YL  E YY+  V  +Y  SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN+  A   ++E+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEK+RIK+LSLGVV+PDI F LA+ N++M LFSPYDI++ YG PMS+ISI+E+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N P+  + DL+Y ++G+D+ CNLGSLNIA+VM D  +FGK+++ AI+ L +++ ++++ S  +IE GN ++ A+GLG MNLHG+LA  +++Y SEEA+DFTN++FYT+AYHA +ASN+ A E    F+ F  + YA G++F KY    E  W PKT RV+ L  +  +AIP +QDWI L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:     5 KLNVIDSSDSELDYHSLNAMLNLYDADGRIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKIDYLIEEGYYEKEVLDQYDFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLATGNQTLARELVEEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKVRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDIEQVYGVPMSEISISEKYREMVDNKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNAPTEYHEDLSYRRIGKDISCNLGSLNIAQVM-DSPDFGKSIEIAIRGLTAVSEMSNIRSVTSIEKGNQESHAIGLGQMNLHGYLARERLFYGSEEALDFTNIYFYTVAYHAIRASNQLAIERASHFKGFDESDYASGAFFSKYI---EQSWQPKTARVQALFADAGIAIPNQQDWIALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALEGTE-VEGCVSC 714
>gi|194439439|ref|ZP_03071515.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli 101-1] >gi|194421615|gb|EDX37626.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli 101-1] (714 aa)
Score = 2022, Expect = 0.0e+00, Identities = 376/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKE K GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYTRTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFTRSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKESKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|170683654|ref|YP_001744826.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli SMS-3-5] >gi|170521372|gb|ACB19550.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli SMS-3-5] (714 aa)
Score = 2022, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A    FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+  +G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFMTTHVRPNSVAFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASDYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQSN---WQPKTAKVGELFARSGVTLPTREMWAQLRDDVMCYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|82545244|ref|YP_409191.1| ribonucleotide-diphosphate reductase subunit alpha [Shigella boydii Sb227] >gi|81246655|gb|ABB67363.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Shigella boydii Sb227] (714 aa)
Score = 2022, Expect = 0.0e+00, Identities = 378/704 (53%), Positives = 506/704 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+   AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N  S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFMATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAYAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDATLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-VAGRINMSNLCSEILQVNCASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSC 712
>gi|26249070|ref|NP_755110.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli CFT073] >gi|26109477|gb|AAN81680.1|AE016765_82 Ribonucleoside-diphosphate reductase 2 alpha chain [Escherichia coli CFT073] (714 aa)
Score = 2021, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 507/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A    FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +DI+I+E Y  L+ +  I KKYI+AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFMTTHVRPNSVAFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADIAISEHYAELVTDERIRKKYINARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFTRSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINYATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|161502143|ref|YP_001569255.1| ribonucleotide-diphosphate reductase subunit alpha [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160863490|gb|ABX20113.1| hypothetical protein SARI_00166 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (705 aa)
Score = 2021, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 505/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA-YKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ QF+ D  AV+ +    ++P+   F S  E+L+ L  E YYD  +  +Y  +F++S+F  A    FRF +F+GA KFYT+Y LK+FD K Y EHFEDR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN  MALFSPYD+QR YGKP  DI+I+E Y+ LL + ++ K YI+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA VM D  + G+TV+ AI+ L +++ ++ + S P+I  GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN +FYT+ +HA   S   A+E G  F  F  ++YA G YF +Y Q   + W PKT +V+ L     + +PT++ W++L +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ IEIRKEGK GRVY PA +  + N  MY  + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   S+YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDKAGHIQFDKDQQAVDAFFAAHVRPHSVTFASQDERLDTLVREGYYDDAILARYDRAFVLSLFGHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIQNQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDVQRRYGKPFGDIAISERYDELLADSHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASRYDDNLDYIHIGHDISCNLGSLNIAHVM-DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNFYFYTITWHALHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQ---DDWQPKTAKVRALFARSGITLPTREMWLKLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPAPFMTNENLDMY--QDAYEIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|194681801|emb|CAR41038.1| ribonucleoside-diphosphate reductase alpha chain [Proteus mirabilis HI4320] (708 aa)
Score = 2019, Expect = 0.0e+00, Identities = 387/711 (54%), Positives = 511/711 (71%)
  Q:    15 VDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +++  Y +LNA + L+DE GN QF+ D LA   +    +  N   F+ +KEKL++L  ++YY+  V ++Y   F+  +F+ A +  FRF SF+GA K+YT+Y LK+FD + Y E +EDR+   AL   +GN + A   +DE+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ LTNLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A HPDI  FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N+DM LFSPYD++R YG PMS+ISI+E+Y  ++NN  I KK I AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+ S  N DL+Y Q+G D+ CNLGS+NIA  M D  +F  TV  AI+AL S+A +  + S P+IE GN  + A+GLG MNLHG+LA   IYY SEE +DFTN++FYT+ Y+A  ASN+ A ET   F+ F+ +KYA G YFDKY   +   W PKT++V +L  +  + IPT++DW +L   I   G+ N +L A+ PTGSISY++  T S+ PIV+PIEIRKEGK+GRVY PA  +   N  +Y + AYEIG   IID  + A QH+DQ +S+TLF ++ ATTRD+NKA IYA+ K   ++YYIRIRQ  L  +E +  C +C +
  S:     5 IEQLDYHALNAMLNLYDEQGNIQFDKDKLATHHFFRQHVNQNTVFFHDLKEKLDFLVQQHYYEAQVLEQYDFPFIKQLFKHAYSKKFRFQSFLGAFKYYTSYTLKTFDGERYLERYEDRVCMVALTLAQGNTKLATHLVDEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLTNLREAGAPIKRIENQSSGVVPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDIYHFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNEDMYLFSPYDVERVYGVPMSEISISEKYTEMVNNAEIRKKKIKARAFFQTLAEIQFESGYPYIMFEDTVNRAN-PIAGRINMSNLCSEILQVNSASEYNPDLSYRQIGHDISCNLGSMNIAMAM-DSPDFAHTVNVAIRALTSVAQMTKIESVPSIEKGNQASHAIGLGQMNLHGYLAREGIYYGSEEGLDFTNIYFYTVTYYALLASNQLAIETKQRFKGFEQSKYATGEYFDKYLSKQ---WLPKTQKVHQLFSQSNIHIPTQEDWQKLKLSIMTHGIYNQNLQAIPPTGSISYINHSTSSIHPIVAPIEIRKEGKIGRVYYPAPFMTNENRHFY-QDAYEIGAEKIIDTYAQASQHIDQGLSLTLFFSDEATTRDVNKAQIYAWRKGIKTLYYIRIRQTALAGTE-IKGCVSCAL 708
>gi|157159104|ref|YP_001463985.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli E24377A] >gi|157081134|gb|ABV20842.1| ribonucleoside-diphosphate reductase, alpha subunit [Escherichia coli E24377A] (714 aa)
Score = 2018, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+   AL   DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y +   D+ CNLGSLNIA  M D  NF +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    16 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDATLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTDHDISCNLGSLNIANTM-DSPNFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 714
>gi|157371958|ref|YP_001479947.1| ribonucleotide-diphosphate reductase subunit alpha [Serratia proteamaculans 568] >gi|157323722|gb|ABV42819.1| ribonucleoside-diphosphate reductase, alpha subunit [Serratia proteamaculans 568] (714 aa)
Score = 2016, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 516/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y SLNA + L+D  G  QF+ D LA  +Y    +  N   F++++EKL YL  E YY+ +V  +Y  +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   A+    G+   A   ++EM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYLNA HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N++M LFSPYD+++ YG P S+IS++E+Y  ++++  I K  I+AR+ FQ +AE+QFESGYP+++F+D  N +N  +  RI MSNLC+EI Q+N  S  + DL+Y+Q+G+D+ CNLGSLNIAK M D  +FGK V  AI+AL ++A ++D+ S P+I  GN  + A+GLG MNLHG+LA  +I+Y SEE +DFTN++FY +AYHA +ASN+ A E G  F  F+++ YA G YF KYT   E  W P+TERV+ L  +  +AIP +++W+ L + +   GL N +L AV PTGSISY+++ T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYYIR+RQ  L+ +E +  C +C +
  S:    16 YHSLNAMLNLYDAEGRIQFDKDRLAARQYFLQHVNQNTVFFHNLEEKLRYLVEEGYYEQSVLAQYDFAFIKQLFQQAYAKKFRFETFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVAMTLAAGDTALAQDLVEEMISGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLTNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDVEQVYGVPFSEISVSEKYREMVDDKRIRKSRINAREFFQVLAEIQFESGYPYMMFEDTVNREN-PIAGRINMSNLCSEILQVNRASTYHDDLSYDQVGKDISCNLGSLNIAKTM-DAPDFGKAVDTAIRALTAVADMSDIRSVPSIAEGNRSSHAIGLGQMNLHGYLARERIFYGSEEGIDFTNIYFYAVAYHAIRASNQLAIERGSAFGGFEDSTYASGEYFSKYT---ERDWLPQTERVRTLFADANIAIPGREEWLALRQSVMMHGLYNQNLQAVPPTGSISYINNSTSSIHPIVSRIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYDIGPEKIIDTYAAASQHVDQGLSLTLFFRDTATTRDINRAQIYAWRKGIKTIYYIRLRQMALEGTE-VQGCVSCAL 714
>gi|50122259|ref|YP_051426.1| ribonucleotide-diphosphate reductase subunit alpha [Pectobacterium atrosepticum SCRI1043] >gi|49612785|emb|CAG76235.1| ribonucleoside-diphosphate reductase 2 alpha chain [Erwinia carotovora subsp. atroseptica SCRI1043] (715 aa)
Score = 2015, Expect = 0.0e+00, Identities = 387/706 (54%), Positives = 512/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  GN QFE D LA  +Y    +  N   F++++EKL YL  E YY+  V  +Y   F+ S+F++A  + FRF +F+GA K+YT Y LK+FD K Y E +EDR+   AL   +G+   A   +DE+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++GIIP+MK+LED FSYANQLG RQGAGAVYLNA HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N+ M LFSPYD+++ YG P+S+IS+TE+Y  ++N+  I K  I AR  FQ +AE+QFESGYP+++F+D  N  N  ++ RI MSNLC+EI Q+N  S+ + DL Y  +G+D+ CNLGS+NIA  M    +FG+TV+ AI+AL +++ ++ +SS P+IE GN ++ A+GLG MNLHG+LA  +I+Y +EEAVDFTN++FYT+A+HA +ASN  A E    F  F+ +KYA G YFDKY    E  W P T R +EL ++  + IP +QDW  L E +   G+ N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  ++ +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIRIRQ  L+ +E +  C +C +
  S:    17 YHALNAMLNLYDAEGNIQFEMDKLAARRYFLQHVNQNTVFFHNLEEKLRYLVEEGYYEAEVLDQYHFDFIKSLFQQAYAHKFRFQTFLGAFKYYTGYTLKTFDGKRYLERYEDRVCLVALALAKGDTTLASALVDEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRAINSALQLSKRGGGVAFMLSNIRETGAPIKRIENQSSGIIPIMKMLEDAFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFQLAKNNQVMYLFSPYDVEQVYGVPLSEISVTEKYHEMVNDKRIRKSQIKARDFFQILAEIQFESGYPYMMFEDTVNRAN-PIHGRINMSNLCSEILQVNDASLYDDDLGYRHIGKDISCNLGSMNIANAMAS-PDFGQTVEMAIRALTAVSDMSHISSVPSIEKGNDESHAIGLGQMNLHGYLAKERIFYGTEEAVDFTNIYFYTVAFHAIRASNALAIERNQRFSGFELSKYATGEYFDKYI---EQQWEPITARARELFEQAGIHIPNQQDWAALRESVIAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSRIEIRKEGKIGRVYYPAPYMNNDNLEYY-QDAYEIGPQKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIYAWTKGIKTIYYIRIRQMALEGTE-VQGCVSCAL 715
>gi|15842617|ref|NP_337654.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium tuberculosis CDC1551] >gi|148824242|ref|YP_001288996.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium tuberculosis F11] >gi|61230675|sp|P0A5W8|RIR1_MYCTU Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase R1 subunit) >gi|61230680|sp|P0A5W9|RIR1_MYCBO Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase R1 subunit) >gi|13882932|gb|AAK47468.1| ribonucleoside-diphosphate reductase, alpha subunit [Mycobacterium tuberculosis CDC1551] >gi|148722769|gb|ABR07394.1| ribonucleoside-diphosphate reductase alpha subunit nrdE [Mycobacterium tuberculosis F11] (725 aa)
Score = 2015, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 516/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QF+ D  A  +Y    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    + S P+IE GN+ + A+GLG MNLHG+LA  +I+Y S+E +DFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   +  W PKT++V++L  +  + IPT+ DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    27 YHALNAMLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTALAELLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTIEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT---DQIWEPKTQKVRQLFADAGIRIPTQDDWRRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLEYY-EDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 725
>gi|86359306|ref|YP_471198.1| ribonucleotide-diphosphate reductase subunit alpha [Rhizobium etli CFN 42] >gi|86283408|gb|ABC92471.1| ribonucleotide-diphosphate reductase, alpha subunit protein [Rhizobium etli CFN 42] (693 aa)
Score = 2015, Expect = 0.0e+00, Identities = 390/699 (55%), Positives = 511/699 (73%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+D+ G  Q + D  A ++Y    +  N   F++++EKL+YL  E YY+  V  +YS +F+  +F++A    FRF +F+GA K+YT+Y LK+FD K Y E +EDRI   AL   RG+E  A   +DE+++GR+Q ATPTFLNAGKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYLNA HPDI++FLD+KRENADEKIRIK+LSLGVVVPDI F LAR N+DM LFSPYD++R YG P ++IS+TE+Y  ++ +  I+KK I AR+ FQ IAE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q++  S  N DL+Y+ LG+D+ CNLGSLNIA  M+ G +FGKT++ AI+AL +++ ++ ++S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEE V+FTN++FYT+ YHA +ASN  A E G  F  F+N+KYA G YFDKYT+ E   W P TE+V+ L  +  + IPT+ DW+ L   +   GL N +L AV PTGSISY++  T S+ PIVS IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+T F  + ATTRD+NK  IYA+ K   +IYYIR+RQ  L  +E +  C +C +
  S:     2 LNLYDDEGRIQLDKDRTAAKQYFLQHVNQNTVFFHNLREKLDYLVTEGYYEQEVLDQYSFNFVRDLFDQAYARQFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRICMVALTLARGDEALARDMVDEIISGRFQPATPTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALSLTNIREAGAPIKQIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDIMRFLDTKRENADEKIRIKTLSLGVVVPDITFELARNNEDMYLFSPYDVERVYGMPFTEISVTEKYREMVADARISKKKIKAREFFQVIAEIQFESGYPYIMFEDTVNRAN-PVAGRISMSNLCSEILQVSEASEYNDDLSYKHLGKDISCNLGSLNIAAAMDSG-DFGKTIETAIRALTAVSDMSHIASVPSIEKGNDESHAIGLGQMNLHGYLARERIFYGSEEGVNFTNIYFYTVTYHAIRASNLLAVERGASFRGFENSKYASGDYFDKYTEQE---WKPATEKVQALFDKSGIHIPTQDDWVALKTGVMTTGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAPFMTDDNLDYY-QDAYEIGPEKIIDTYAAATQHVDQGLSLTSFFRDTATTRDINKTQIYAWKKGIKTIYYIRLRQMALSGTE-VQGCVSCTL 693
>gi|110642800|ref|YP_670530.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli 536] >gi|110344392|gb|ABG70629.1| ribonucleoside-diphosphate reductase 2 alpha chain [Escherichia coli 536] (701 aa)
Score = 2014, Expect = 0.0e+00, Identities = 374/706 (52%), Positives = 506/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS  F+I++F  A    FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  A    DEM++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I+E Y+ L+ +  I KKY++AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y + G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FYT+ +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT++ W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA  +   N   Y + AYEIG   IID  +   +HVDQ +S+TL   + ATTRD++KA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     3 YHALNAMLNLYDSAGRIQFDKDSQAVDAFMTTHVRPNSVAFSSQQQRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLAAQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISERYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYARTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIHSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYTITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQSN---WQPKTAKVGELFARSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGAEKIIDTYAETTRHVDQGLSLTLLFLDTATTRDIDKAQIYAWRKGIKTLYYIRLRQMALEGTE-IEGCVSCAL 701
>gi|177673419|ref|ZP_02945763.1| ribonucleoside-diphosphate reductase, alpha subunit [Micrococcus luteus NCTC 2665] >gi|172070301|gb|EDT56365.1| ribonucleoside-diphosphate reductase, alpha subunit [Micrococcus luteus NCTC 2665] (725 aa)
Score = 2013, Expect = 0.0e+00, Identities = 384/706 (54%), Positives = 512/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y  LNA + L+  +G  QFE D  A  +Y    +  N   F+ ++EKL+YL   +YY+   F++Y   F+  +F++A    FRF +F+GA KFYT+YALK+FD K Y E +EDR+   AL   RG+++ A   +DEM+ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESI R   + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P S+IS+TE+Y  ++++  I K  ISAR+ FQ IAE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q++  S  N DL+Y  +G+D+ CNLGS+NIAK M D  +FG++V+ AI+AL +++ ++D+ S P+I  GN+ + A+GLG MNLHG+LA   ++Y SEE +DFTNM+FY + +HA +ASN  A ETG  F  F+++KYA G +FDKYT  E   W P TERV EL  +  +A+PT+ DW +L   + + G+ N +L AV PTGSISY+++ T S+ P+ S IEIRKEGK+GRVY PA  +   N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRDLN+A IYA+ K   +IYYIR+RQ  L+ +E +  C +C++
  S:    27 YHELNAMLNLYGADGRIQFEADHAAARQYFLQHVNTNTVFFHDLEEKLDYLQKNDYYETETFEQYPFEFIRGLFDRAYKAKFRFPTFLGAFKFYTSYALKTFDGKRYLERYEDRVAVVALHLARGDQELATHLVDEMIAGRFQPATPTFLNSGKKQRGELVSCFLLRIEDNMESIARGINSALQLSKRGGGVALSLTNIREHGAPIKQIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDIHRFLDTKRENADEKIRIKTLSLGVVIPDITFQLAKKNEDMYLFSPYDVERVYGVPFSEISVTEKYYEMVDDARIKKTKISAREFFQTIAEIQFESGYPYVVFEDTVNAAN-PIKGRITMSNLCSEILQVSEASEYNEDLSYAHVGQDISCNLGSMNIAKTM-DSPDFGRSVETAIRALTAVSVMSDIQSVPSIAKGNAASHAIGLGQMNLHGYLAREHVHYGSEEGIDFTNMYFYAVLFHALRASNRIAIETGQRFGGFEDSKYASGEFFDKYTDQE---WAPATERVAELFADAGIALPTQDDWRELKASVMEHGIFNRNLQAVPPTGSISYINNSTSSIHPVASKIEIRKEGKLGRVYYPAPYLTNENLEYY-EDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDLNRAQIYAWRKGIKTIYYIRLRQLALEGTE-VEGCVSCML 725
>gi|183981656|ref|YP_001849947.1| ribonucleoside-diphosphate reductase (alpha chain) NrdE [Mycobacterium marinum M] >gi|183174982|gb|ACC40092.1| ribonucleoside-diphosphate reductase (alpha chain) NrdE [Mycobacterium marinum M] (721 aa)
Score = 2010, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 513/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QF+ D+LA  ++    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  +  +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIA+ M D  +F +T++ AI+AL +++    ++S P+IE GN+ + A+GLG MNLHG+LA   I+Y SEE VDFTN++FY + YHA +ASN  A E G  F+ F  +KYA G +FDKYT   E  W PKTE+V++L  +  + IP + DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +   N  YY + AYEIG   IID  +AA +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    23 YHALNAMLNLYDADGKIQFDRDVLAARQFFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLASGDATLAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDSRIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIEGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIARTM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLAREHIFYGSEEGVDFTNIYFYAVLYHALRASNRIAVERGTRFKGFDQSKYASGEFFDKYT---ERVWEPKTEKVRQLFADAGIRIPNQDDWQRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNENLDYY-QDAYEIGYEKIIDTYAAATEHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VAGCVSCML 721
>gi|37525252|ref|NP_928596.1| ribonucleotide-diphosphate reductase subunit alpha [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36784679|emb|CAE13579.1| ribonucleoside-diphosphate reductase alpha-chain (ribonucleotide reductase R1 subunit) [Photorhabdus luminescens subsp. laumondii TTO1] (709 aa)
Score = 2010, Expect = 0.0e+00, Identities = 380/707 (53%), Positives = 522/707 (73%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           +  Y +LNA + L+D  GN QF+ D LA+  Y    + PN   F+S+KEKL++L  E YY+ NV ++Y  + +  +F++A +  FRF +F+GA K+YT+Y LK+FDNK Y E +EDR+   AL   +G++  A   +DEM++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LS+GVV+PDI F LA+ N+DM LFSPYDIQR YG PMS+IS+TE+Y  ++NN  I K  I+AR+ F  +AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S    DL+Y  +G+D+ CNLGS+NIA  M D  +F  +++ A++AL +++ ++ + S P+IE GN  + A+GLG MNLHG+LA  KI+Y SEE +DFTN++FY + YHA + SN+ A E    F+ FK+++YA+G +F+KYT   E  W P+T++V +L ++  + IP +QDW++L   I   G+ N +L A+APTGSISY+++ T S+ PIVS IEIRK+GK GRVY PA  +  NN  YY + AYEIG   IID  + A QHVDQ +S+TLF  ++ATTRD+NKA IYA+ K+  ++YYIR++Q  L+ +E + +C +C
  S:     8 QQDYHALNALLNLYDSEGNIQFDKDKLAIHCYFRQHVNPNTLFFHSLKEKLDFLQQEGYYEINVLEQYDFTVIKKLFQQAYSKKFRFQTFLGAFKYYTSYTLKTFDNKRYLERYEDRVCMVALTLAQGDQMLACRLVDEMISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSVNSALQLSKRGGGVAFLLSNLRETGAPIKMIQNQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSIGVVIPDITFKLAKHNEDMYLFSPYDIQRVYGVPMSEISMTEKYAEMVNNQQIRKSKINAREFFMALAELQFESGYPYIMYEDTVNNAN-PIKGRINMSNLCSEILQVNSASEYEEDLSYHHIGKDISCNLGSMNIAHTM-DSPDFTLSIETAVRALTAVSDMSHIRSVPSIEKGNQDSHAIGLGQMNLHGYLAREKIHYGSEEGIDFTNIYFYIVTYHALRTSNQIAIERNSYFKGFKDSRYANGEFFNKYT---EITWQPQTKKVSQLFEQAGIKIPNQQDWLELKASIMAHGIYNQNLQAIAPTGSISYINNSTSSIHPIVSRIEIRKDGKTGRVYYPAPFMTNNNLEYY-QDAYEIGPEKIIDTYAIATQHVDQGLSLTLFFKDDATTRDINKAQIYAWRKRIKTLYYIRLKQTALEGTE-VQDCVSC 707
>gi|557567|gb|AAA64444.1| ribonucleotide reductase R1 subunit (723 aa)
Score = 2008, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 514/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QF+ D  A  +Y    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE G  IK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL ++ H   + S P+IE GN+ + A+GLG MNLHG+LA  +I+Y S+E +DFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   +  W PKT++V++L  +  + IPT+ DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +E+RKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    25 YHALNAMLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTALAELLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGGAIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTIEVAIRALTAVRHQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT---DQIWEPKTQKVRQLFADAGIRIPTQDDWRRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEVRKEGKIGRVYYPAPYMTNDNLEYY-EDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 723
>gi|123441278|ref|YP_001005265.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122088239|emb|CAL11028.1| ribonucleoside-diphosphate reductase 2 alpha chain [Yersinia enterocolitica subsp. enterocolitica 8081] (693 aa)
Score = 2008, Expect = 0.0e+00, Identities = 378/697 (54%), Positives = 514/697 (73%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           + L+D +G  QF+ D  A  +Y    +  N   F++++EKL YL  E YY+ +V +KY  SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN+Q A   ++E++TGR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N+DM LFSPYD+++ YG P+S+IS++E+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N+P+  N DL+Y  +G+D+ CNLGSLNIA +M D  +FGK+++ AI+ L +++ ++++ S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEEA+DFTN++FYT+AYHA +ASN+ A E G  F+ F  + YA G YF KY    E  W PKT +V  L  +  +++P +QDW  L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  + A QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:     2 LNLYDADGRIQFDKDRQAARQYFLQHVNQNTVFFHNLQEKLNYLVEEGYYEKDVLEKYDFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLAAGNQQVARDLVEEIITGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRAINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKNNEDMYLFSPYDVEQVYGVPLSEISVSEKYREMVDNKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNSPTEYNDDLSYRHIGKDISCNLGSLNIAHIM-DSPDFGKSIETAIRGLTAVSDMSNIRSVPSIEKGNQESHAIGLGQMNLHGYLARERIFYGSEEALDFTNIYFYTVAYHAIRASNQLAIERGSHFKGFDQSTYASGHYFTKYI---EQSWQPKTAKVSALFAQAGISVPDQQDWAALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAEATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALEGTE-VEGCVSC 691
>gi|116670902|ref|YP_831835.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Arthrobacter sp. FB24] >gi|116611011|gb|ABK03735.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Arthrobacter sp. FB24] (727 aa)
Score = 2007, Expect = 0.0e+00, Identities = 380/706 (53%), Positives = 519/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y  LNA + L+  NG  QFE D  A  +Y    +  N   F+ ++EKL+YL    YY+     +Y+ +F+  +F +A    FRF +F+GA KFYT+Y LK+FD K + E +EDR+   AL   RG+EQ AL  +DE++ GR+Q ATPTFLNAGKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ LTN+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ ++DM LFSPYD++R YG P SD+S+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N +N  ++ +IIMSNLC+EI Q++ P+  + DL+Y+Q G+D+ CNLGSLNIAK M D  +FG T++ AI++L +++ +++++S P+I  GN ++ A+GLG MNLHG+LA  +++Y SEE +DFTN++FY++ YHA +ASN+ A +TG  F  F+ +KYA G +FDKYT  E   W P+TE+V EL K   + IPT+ DW +L   + + G+ N +L AV PTGSISY+++ T S+ P+ S IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   +ID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C++
  S:    31 YHELNAMLNLYGPNGEIQFEADREAAHQYFLQHVNNNTVFFHDLEEKLDYLVKNQYYERETLDQYTMNFIRELFNRAYKKKFRFETFLGAFKFYTSYTLKTFDGKRFLERYEDRVCMVALHLARGDEQLALQMVDEIIEGRFQPATPTFLNAGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFALTNIREVGAPIKQIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRDEDMYLFSPYDVERVYGMPFSDVSVTEKYYEMVDDSRIKKTKIKAREFFQTLAEIQFESGYPYIMFEDTVNREN-PIDGKIIMSNLCSEILQVSQPTTYHDDLSYDQTGKDISCNLGSLNIAKTM-DSPDFGLTIETAIRSLSAVSDMSNITSVPSIARGNDQSHAIGLGQMNLHGYLARERVHYGSEEGLDFTNIYFYSVVYHAVRASNKLAIQTGQTFGGFEKSKYASGEFFDKYTDQE---WVPQTEKVAELFK--NIHIPTQDDWRELKASVMEHGIYNQNLQAVPPTGSISYINNSTSSIHPVASKIEIRKEGKLGRVYYPAPYLTNDNLEYY-QDAYEIGYEKVIDTYAAATQHVDQGLSLTLFFKDTATTRDINKAQIYAWKKGIKTIYYIRLRQLALEGTE-VEGCVSCML 727
>gi|16122858|ref|NP_406171.1| ribonucleotide-diphosphate reductase subunit alpha [Yersinia pestis CO92] >gi|149365456|ref|ZP_01887491.1| ribonucleoside-diphosphate reductase 2 alpha chain [Yersinia pestis CA88-4125] >gi|115348337|emb|CAL21270.1| ribonucleoside-diphosphate reductase 2 alpha chain [Yersinia pestis CO92] >gi|149291869|gb|EDM41943.1| ribonucleoside-diphosphate reductase 2 alpha chain [Yersinia pestis CA88-4125] (693 aa)
Score = 2006, Expect = 0.0e+00, Identities = 377/697 (54%), Positives = 517/697 (74%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           + L+D +G  QF+ D LA  +Y    +  N   F++++EK++YL  E YY+  V  +Y  SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN+  A   ++E+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEK+RIK+LSLGVV+PDI F LA+ N++M LFSPYDI++ YG PMS+ISI+E+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N P+  + DL+Y ++G+D+ CNLGSLNIA+VM D  +FGK+++ AI+ L +++ ++++ S P+IE GN ++ A+GLG MNLHG+LA  +++Y SEEA+DFTN++FYT+AYHA +ASN+ A E    F+ F  + YA G++F KY    E  W PKT RV+ L  +  +AIP +QDWI L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:     2 LNLYDADGRIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKIDYLIEEGYYEKEVLDQYDFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLATGNQTLARELVEEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKVRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDIEQVYGVPMSEISISEKYREMVDNKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNAPTEYHEDLSYRRIGKDISCNLGSLNIAQVM-DSPDFGKSIEIAIRGLTAVSEMSNIRSVPSIEKGNQESHAIGLGQMNLHGYLARERLFYGSEEALDFTNIYFYTVAYHAIRASNQLAIERASHFKGFDESDYASGAFFSKYI---EQSWQPKTARVQALFADAGIAIPNQQDWIALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALEGTE-VEGCVSC 691
>gi|77957733|ref|ZP_00821781.1| COG0209: Ribonucleotide reductase, alpha subunit [Yersinia bercovieri ATCC 43970] (716 aa)
Score = 2005, Expect = 0.0e+00, Identities = 379/704 (53%), Positives = 515/704 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y SLNA + L+D +G+ QF+ D LA  +Y    +  N   F++++EKL YL  E YY+  V  +Y  SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN Q A   ++E+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEK+RIK+LSLGVV+PDI F LA+ ++DM LFSPYD+++ YG PMS+ISI+E+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N+P+  N DL+Y  +G+D+ CNLGSLNIA  M D  +FGK+++ AI+ L +++ ++++ S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEEA+DFTN++FYT+ YHA +ASN  A E G  F+ F  + YA GSYF KY       W PKT +V+ L  +  + IP +QDW  L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  + A QHVDQ +S+TLF  + ATTRD+N+A IYA+ +   +IYYIR+RQ  L+ +E +  C +C
  S:    18 YHSLNAMLNLYDADGHIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKLNYLIEEEYYEKEVLDQYDFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLAAGNPQLARELVEEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKVRIKTLSLGVVIPDITFELAKNSEDMYLFSPYDVEQVYGVPMSEISISEKYREMVDNKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNSPTEYNDDLSYRHIGKDISCNLGSLNIAHTM-DSPDFGKSIETAIRGLTAVSDMSNIRSVPSIEKGNQESHAIGLGQMNLHGYLARERIFYGSEEALDFTNIYFYTVVYHAIRASNLLAIERGCHFKGFDESAYASGSYFTKYIA---QRWQPKTAKVEALFADVGITIPDQQDWAALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAEATQHVDQGLSLTLFFRDTATTRDINRAQIYAWKRGIKTIYYIRLRQMALEGTE-VEGCVSC 714
>gi|118468034|ref|YP_886648.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium smegmatis str. MC2 155] >gi|118469666|ref|YP_885419.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium smegmatis str. MC2 155] >gi|118169321|gb|ABK70217.1| ribonucleoside-diphosphate reductase, alpha subunit [Mycobacterium smegmatis str. MC2 155] >gi|118170953|gb|ABK71849.1| ribonucleoside-diphosphate reductase, alpha subunit [Mycobacterium smegmatis str. MC2 155] (706 aa)
Score = 2002, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 517/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QFE D  A ++Y    +  N   F+S  EKL+YL    YY+  V  +YS  F+ S+ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+ + A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +D+S+TE+Y  ++++  I K  I+AR+ FQ +AE+QFESGYP+I+F+D  N  N  +  +I  SNLC+EI Q++TPS  N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    ++S P+IE GN+ + A+GLG MNLHG+LA  +IYY SEE +DFTN++FYT+ +HA +ASN+ A E G  F+ F+ +KYA G +FDKYT   +  W PKT++V+ L  +  + IPT+ DW QL E ++K G+ N +L AV PTGSISY++  T S+ P+ S IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     8 YHALNAMLNLYDADGKIQFEKDREAAKQYFLQHVNQNTVFFHSQDEKLDYLIENEYYEREVLDQYSRDFIKSLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTELAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERVYGVPFADVSVTEKYYEMVDDARIRKTKINAREFFQTLAELQFESGYPYIMFEDTVNRSN-PIAGKITHSNLCSEILQVSTPSEFNDDLSYAKVGKDISCNLGSLNIAKAM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLARERIYYGSEEGIDFTNIYFYTVLFHALRASNKIAIERGTHFKGFEKSKYASGEFFDKYT---DQVWEPKTDKVRRLFADADIHIPTQDDWKQLKESVQKHGIYNQNLQAVPPTGSISYINHSTSSIHPVASKIEIRKEGKIGRVYYPAPYMTNDNLDYY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 706
>gi|77973119|ref|ZP_00828671.1| COG0209: Ribonucleotide reductase, alpha subunit [Yersinia frederiksenii ATCC 33641] (711 aa)
Score = 2001, Expect = 0.0e+00, Identities = 381/704 (54%), Positives = 514/704 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y SLNA + L+D +G  QF+ D LA  +Y    +  N   F++++EKL+YL  E YY+  V ++Y+ SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN Q A   ++EM +GR+Q ATPTFLN GK QRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N++M LFSPYD++  YG PMS+ISI+E+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N+P+  N DL+Y  +G+D+ CNLGSLNIA  M D  +FGK+++ AI+ L +++ ++++ S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEEA+DFTN++FYT+ YHA +ASN  A E G  F+ F  + YA G YF KY    E  W PKT +V+ L  +  +AIP +QDW +L   + + G+ N +L A+ PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +   N  YY + AY+IG   IID  + A QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:    13 YHSLNAMLNLYDADGRIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKLDYLVEEGYYEKEVLERYNFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLAAGNPQVARDLVEEMTSGRFQPATPTFLNCGKNQRGELVSCFLLRMEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDVELVYGVPMSEISISEKYREMVDDKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNSPTEYNDDLSYHHIGKDISCNLGSLNIAHTM-DSPDFGKSIETAIRGLTAVSDMSNIRSVPSIEKGNQESHAIGLGQMNLHGYLARERIFYGSEEALDFTNIYFYTVVYHAIRASNLLAIERGSHFKGFDESDYASGRYFTKYV---EQSWQPKTAKVQALFAKSGIAIPNQQDWEKLRNSVMEHGIYNQNLQAIPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNENLEYY-QDAYQIGPEKIIDTYAEATQHVDQGLSLTLFFRDTATTRDINKAQIYAWQKGIKTIYYIRLRQMALEGTE-VEGCVSC 709
>gi|77977847|ref|ZP_00833286.1| COG0209: Ribonucleotide reductase, alpha subunit [Yersinia intermedia ATCC 29909] (716 aa)
Score = 1998, Expect = 0.0e+00, Identities = 376/704 (53%), Positives = 517/704 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y SLNA + L+D +G+ QF+ D LA  +Y    +  N   F++++EKL+YL  E YY+  V ++Y  SF+  +F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN   A   ++E+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEK+RIK+LSLGVV+PDI F LA+ N++M LFSPYD+++ YG PMS+ISI+E+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N+P+  N DL+Y  +G+D+ CNLGSLNIA  M D  +FGK+++ AI+ L +++ ++++ S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEEA+DFTN++FYT+ YHA +ASN+ A E G  F+ F  + YA G+YF KY    E  W PKT +V+ L  +  + +P +QDW  L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  + A QHVDQ +S+TLF  + A+TRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:    18 YHSLNAMLNLYDADGHIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKLDYLVEEGYYEKEVLERYDFSFIKGLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLAAGNPTLAQELVEEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKVRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDVEQVYGVPMSEISISEKYRAMVDDKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNSPTEYNDDLSYRHIGKDISCNLGSLNIAHTM-DSPDFGKSIETAIRGLTAVSDMSNIRSVPSIEKGNQESHAIGLGQMNLHGYLARERIFYGSEEALDFTNIYFYTVVYHALRASNQLAIERGKHFKGFDESDYASGTYFTKYI---EQRWQPKTAKVQALFAQAAIVLPDQQDWAALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAEATQHVDQGLSLTLFFRDTASTRDINKAQIYAWKKGIKTIYYIRLRQMALEGTE-VEGCVSC 714
>gi|111023402|ref|YP_706374.1| ribonucleotide-diphosphate reductase subunit alpha [Rhodococcus sp. RHA1] >gi|110822932|gb|ABG98216.1| ribonucleoside-diphosphate reductase [Rhodococcus sp. RHA1] (693 aa)
Score = 1997, Expect = 0.0e+00, Identities = 376/699 (53%), Positives = 512/699 (73%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+  NG  QF+ D+ A  +Y    +  N   F+++ EKL+YL  ENYY+  V  +YS +F+ S+ + A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+   AL    G+E+ A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +D+++TE+Y  ++++  I K  I AR+ FQ IAE+QFESGYP+I+F+D  N  N  +  +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ +I+AL +++    + S P+IE GN+ + A+GLG MNLHG+LA  +IYY S+E +DFTN++FYT+ +HA +ASN  A E G  F+ F  +KYA G YFDKYT   +  W PKTERV++L  E  + IPT+ DW +L   ++K+G+ N +L AV PTGSISY++  T S+ P+ S IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   I+D  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     2 LNLYGPNGEIQFDKDVAAARQYFLQHVNQNTVFFHNLDEKLDYLVEENYYEPEVLDQYSRAFVKSLIDHAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVCMVALTLAAGDEELATKLVDEIIAGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNVREHGAPIKKIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERIYGVPFADVNVTEKYYEMVDDKRIRKSKIKAREFFQTIAELQFESGYPYIMFEDTVNRAN-PIEGKITHSNLCSEILQVSTPSLFNDDLSYSEVGKDISCNLGSLNIAKTM-DSPDFARTIEVSIRALTAVSDQTHIYSVPSIEQGNNDSHAIGLGQMNLHGYLARERIYYGSDEGIDFTNIYFYTVVFHAVRASNRIAIERGTHFKGFPQSKYASGEYFDKYT---DQVWEPKTERVRQLFAESGVHIPTQDDWRELKASVQKYGIYNQNLQAVPPTGSISYINYSTSSIHPVASKIEIRKEGKIGRVYYPAPYLTNDNLEYY-QDAYEIGYEKIVDTYAAATQHVDQGLSLTLFFKDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 693
>gi|184200806|ref|YP_001855013.1| ribonucleoside-diphosphate reductase alpha subunit [Kocuria rhizophila DC2201] >gi|183581036|dbj|BAG29507.1| ribonucleoside-diphosphate reductase alpha subunit [Kocuria rhizophila DC2201] (719 aa)
Score = 1997, Expect = 0.0e+00, Identities = 383/706 (54%), Positives = 512/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y  LNA + L+D  GN QFE D  A  +Y    +  N   F+ ++EKL+YL    YY+  V +KYS  F+  + ++A  Y FRF +F+GA KFYT+Y LK+FD + Y E FEDR+V  +L    G+E  A   + E+++GR+Q ATPTFLNAGKKQRGE VSC+L+R EDNMESIGR   + LQLSKRGGGVA+ LTNLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +D++++E+Y  ++++  ITK  I+AR+ FQ +AEVQFESGYP+I+F+D  N  N  ++ +IIMSNLC+EI Q++ PS+ N DLTY ++G+D+ CNLGS+NIA  ME   +FG +++ AI+ L +++ ++++ S P+I  GN  + AVGLG MNLHG+LA   ++Y SEE VDFTNM+FY + YHA +ASN  AKE G  F  F+ + YA+G+YFDKY    +  W P T RV+EL     +A+PT QDW +L E +   G+ N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  ++  N  Y+ + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YY RIRQ  L+ +E +  C +C++
  S:    21 YHELNALLNLYDAEGNIQFEADRQAARQYFLQHVNKNTVFFHDLEEKLKYLVDHQYYEAEVLEKYSVEFIKELSKQAYGYKFRFQTFLGAFKFYTSYTLKTFDGQRYLERFEDRVVMVSLYLADGDETLAKRLVGEIISGRFQPATPTFLNAGKKQRGELVSCFLVRFEDNMESIGRNINSALQLSKRGGGVAFALTNLRESGAPIKMIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDILNFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNQDMYLFSPYDVERIYGMPFADVNVSEKYHEMVDDSRITKTKINAREFFQTVAEVQFESGYPYIMFEDTVNRAN-PIDGKIIMSNLCSEILQVSEPSVYNEDLTYAEVGKDISCNLGSMNIAMAMES-PDFGASIETAIRGLTAVSDMSNIDSVPSIRRGNQMSHAVGLGQMNLHGYLAKEHVFYGSEEGVDFTNMYFYAVTYHAIRASNLIAKERGESFVGFEKSDYANGTYFDKYI---DGTWEPATARVRELFARAGVALPTAQDWRELREKVMADGMYNQNLQAVPPTGSISYINNSTSSIHPIASRIEIRKEGKLGRVYYPAPFMNDENLEYF-QDAYEIGFEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTMYYSRIRQLALEGTE-VEGCVSCML 719
>gi|169630494|ref|YP_001704143.1| ribonucleoside-diphosphate reductase alpha subunit [Mycobacterium abscessus] >gi|169242461|emb|CAM63489.1| Ribonucleoside-diphosphate reductase alpha subunit [Mycobacterium abscessus] (712 aa)
Score = 1996, Expect = 0.0e+00, Identities = 379/706 (53%), Positives = 514/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  QF+ D  A  +Y    +  N   F++  EKL+YL  + YY+  V  +YS +F+ S+ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+ Q A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +DI++TE+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+I+++D  N  N  +  +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    + S P+IE GN+ + A+GLG MNLHG+LA  +I+Y SEE VDFTN++FYT+ YHA +ASN  A E G  F  F  +KYA G +FDKYT   +  W PKTE+V++L  +  + IPT+ DW++L E +++ G+ N +L AV PTGSISY++  T S+ P+ S IEIRKEGK+GR Y PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + A+TRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    14 YHALNAMLNLYDAEGKIQFDKDAAAARQYFLQHVNQNTVFFHNQDEKLDYLIEKEYYEREVLDQYSRNFVKSLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDLQLAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERTYGVPFADINVTEKYYEMVDNGQIRKTKIKAREFFQTLAELQFESGYPYIMYEDTVNRAN-PIEGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTIEVAIRALTAVSDQTHIWSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVLYHALRASNRIAIERGTKFGGFDRSKYASGEFFDKYT---DQVWEPKTEKVRQLFADAGIRIPTQDDWLRLKESVQQHGIYNQNLQAVPPTGSISYINHSTSSIHPVASKIEIRKEGKIGRAYYPAPYLTNDNLEYY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTASTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 712
>gi|120403036|ref|YP_952865.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium vanbaalenii PYR-1] >gi|119955854|gb|ABM12859.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Mycobacterium vanbaalenii PYR-1] (722 aa)
Score = 1994, Expect = 0.0e+00, Identities = 377/706 (53%), Positives = 516/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QFE D+ A  +Y    +  N   F++  EKL+YL  + YY+  V  +YS +F+  + ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE+M GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+++D  N  N  ++ +I  SNLC+EI Q++TPS  N DL+Y+++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    ++S P+IE GN+ + A+GLG MNLHG+LA  +I+Y S+E VDFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   E  W PKT++V++L  +  + IP + DW QL E +++ G+ N +L AV PTGSISY++  T S+ PI S +EIRKEGK+GRVY PA  +   N  YY + AYEIG   +ID  +AA QHVDQ +S+TLF  + ATTR++NKA IYA+ K   ++YYIR+RQ  L+ ++ +  C +C++
  S:    24 YHALNAMLNLYDADGKIQFEKDVQAAREYFLQHVNQNTVFFHNQDEKLDYLVQKEYYEREVLDQYSRNFVKELLDRAYAKKFRFPTFVGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLASGDTTLAEKLVDEIMDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMYEDTVNRAN-PIDGKITHSNLCSEILQVSTPSEFNDDLSYKKIGKDISCNLGSLNIAKAM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGVDFTNIYFYTVLYHALRASNRIAIERGTAFKGFEKSKYASGEFFDKYT---EQVWEPKTDKVRQLFTDAGIRIPNQDDWKQLKESVQQHGIYNQNLQAVPPTGSISYINHSTSSIHPIASKVEIRKEGKIGRVYYPAPYMTNENLEYY-QDAYEIGYEKVIDTYAAATQHVDQGLSLTLFFKDTATTREVNKAQIYAWRKGIKTLYYIRLRQMALEGTQ-VENCVSCML 722
>gi|154508381|ref|ZP_02044023.1| hypothetical protein ACTODO_00878 [Actinomyces odontolyticus ATCC 17982] >gi|153798015|gb|EDN80435.1| hypothetical protein ACTODO_00878 [Actinomyces odontolyticus ATCC 17982] (718 aa)
Score = 1994, Expect = 0.0e+00, Identities = 378/706 (53%), Positives = 516/706 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D NG+ QF+ D  A  +Y    +  N   F+ ++EKL+YL  E YY+ +V  +Y  + +  ++++A  + FRF +F+GA K+YT+Y LK+FD K Y E FEDR+   +L   RG+ + A +++DE+MTGR+Q ATPTFLNAGK  RGE VSC+LLR+EDNMESI R   + LQLSKRGGGVA  LTNLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI F LAR+N+DM LFSPYD++R YG P S+IS+TE+Y  ++++  I K+ I+AR+ FQ IAE+QFESGYP+I+F+D  N+ N  +  RI MSNLC+EI Q++  S  N DL+Y+ +G+D+ CNLGSLNIAK M D ++F KT++ AI+ L +++ L+D+ S P+I  GN+ + A+GLG MNLHG+LA   ++Y SEEA+DFTNM+F T+ + A KAS + A+E G  FE F+ +KYA G +F KY   E   W P T++ +ELL    + +PT+ DW  L  D+ K+G+ N +L AV PTGSISY+++ T S+ PIVS +EIRKEGK+GRVY PA  +   N  YY + AYEIG   IID  + A QHVDQ +S+TLF  +  TTRDLNK+YIYA+ K   ++YY+R+RQ  L+ +E +  C +C++
  S:    20 YHALNAQLNLYDANGHIQFDADRAAARQYFLQHVNQNTVFFHDLEEKLKYLVDEGYYEKHVLDQYDFADIKELYKQAYAHKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVAMVSLYLARGDIELARSFVDEIMTGRFQPATPTFLNAGKAARGELVSCFLLRIEDNMESIARGINSALQLSKRGGGVALQLTNLRESGAPIKKIQNQSSGVVPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIMQFLDTKRENADEKIRIKTLSLGVVIPDITFELARKNEDMYLFSPYDVERVYGVPFSEISVTEKYHEMVDDGRIHKRKINARRFFQTIAEIQFESGYPYIVFEDTVNKAN-PIKGRITMSNLCSEILQVSEASTYNDDLSYDHVGKDISCNLGSLNIAKTM-DSSDFSKTIEMAIRGLTAVSDLSDIGSVPSIARGNAMSHAIGLGQMNLHGYLAREHVHYGSEEALDFTNMYFMTVLFEAIKASCKIARERGETFEGFEESKYASGEFFRKYIDEE---WAPTTDKCRELLAASSIKVPTQADWEALAADVAKYGMYNQNLQAVPPTGSISYINNSTSSIHPIVSRVEIRKEGKIGRVYYPAPYMSNENLEYY-QDAYEIGPEKIIDTYAVATQHVDQGLSLTLFYPDTVTTRDLNKSYIYAWKKGIKTLYYMRLRQMALEGTE-VEGCVSCML 718
>gi|188533085|ref|YP_001906882.1| Ribonucleoside-diphosphate reductase 2, alpha subunit [Erwinia tasmaniensis] >gi|188028127|emb|CAO95984.1| Ribonucleoside-diphosphate reductase 2, alpha subunit [Erwinia tasmaniensis] (693 aa)
Score = 1991, Expect = 0.0e+00, Identities = 369/697 (52%), Positives = 505/697 (72%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           + L+D+N + QFE D  A  +Y    + PN  +F+SI E+L++L  E YY+ +V   Y   F+ S+F +A    FRF +F+GA KFYT+Y LK+FD K Y E F +R+   AL   +G++  AL   DE+++GR+Q ATPTFLN GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+ MALFSPYD++R YG P +DISI+E+Y  +LN+  I + +I+ R+ FQ +AE+QFESGYP+I+F+D  N  N  ++ RI MSNLC+EI Q+N+P+  + DL+Y ++G+D+ CNLGSLNIA  M D A+F +TV+ A++ L +++  + + S P+IE GN+++ A+GLG MNLHG+LA   I Y SE  +DFTN++FYT+ YHA + SN+ A+E    F  F  ++YA G YF+ Y    E  W P+T +V  L     +AIPT+Q W  L + + ++GL N +L A+ PTGSISY++  T S+ PIVS IEIRKEGK GRVY PA  ++ +N  +Y + AY+IG   IID  + A +HVDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L+ +E +  C +C
  S:     2 LNLYDDNAHIQFEKDREATRQYFIQHVIPNSVQFDSIAERLQFLVAEGYYEADVLNAYPFEFVCSLFAEATARRFRFQTFLGAWKFYTSYTLKTFDGKRYLEGFTERVCMVALTLAKGDQPLALALTDEILSGRFQPATPTFLNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFQLAKDNQQMALFSPYDVERIYGLPFADISISEKYHEMLNDARIRRTFINPREFFQTLAEIQFESGYPYIMFEDTVNRANP-VHGRINMSNLCSEILQVNSPTEYHDDLSYRRIGKDISCNLGSLNIAHAM-DSADFARTVEIAVRGLTAVSDQSHIHSVPSIEQGNAQSHAIGLGQMNLHGYLAREGIQYGSEAGLDFTNIYFYTVTYHALRTSNQLARERSTTFSGFAQSRYASGEYFNPYL---EQSWQPRTSQVAALFANAGIAIPTRQQWQTLKDAVMQYGLYNQNLQAIPPTGSISYINHATSSIHPIVSRIEIRKEGKTGRVYYPAPFMNNDNQAFY-RDAYDIGPEAIIDTYAEATRHVDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTLYYIRLRQMALQGTE-VEGCVSC 691
>gi|15610188|ref|NP_217567.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium tuberculosis H37Rv] >gi|31794229|ref|NP_856722.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium bovis AF2122/97] >gi|121638935|ref|YP_979159.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662904|ref|YP_001284427.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium tuberculosis H37Ra] >gi|167969653|ref|ZP_02551930.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium tuberculosis H37Ra] >gi|3261509|emb|CAA16136.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE (ALPHA CHAIN) NRDE (RIBONUCLEOTIDE REDUCTASE SMALL SUBUNIT) (R1F PROTEIN) [Mycobacterium tuberculosis H37Rv] >gi|31619824|emb|CAD96764.1| PROBABLE RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE (ALPHA CHAIN) NRDE (RIBONUCLEOTIDE REDUCTASE SMALL SUBUNIT) (R1F PROTEIN) [Mycobacterium bovis AF2122/97] >gi|121494583|emb|CAL73064.1| Probable ribonucleoside-diphosphate reductase (alpha chain) nrdE [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148507056|gb|ABQ74865.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium tuberculosis H37Ra] (693 aa)
Score = 1989, Expect = 0.0e+00, Identities = 377/699 (53%), Positives = 511/699 (73%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+D +G  QF+ D  A  +Y    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    + S P+IE GN+ + A+GLG MNLHG+LA  +I+Y S+E +DFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   +  W PKT++V++L  +  + IPT+ DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     2 LNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTALAELLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTIEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT---DQIWEPKTQKVRQLFADAGIRIPTQDDWRRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLEYY-EDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 693
>gi|118617479|ref|YP_905811.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium ulcerans Agy99] >gi|118569589|gb|ABL04340.1| ribonucleoside-diphosphate reductase (alpha chain) NrdE [Mycobacterium ulcerans Agy99] (693 aa)
Score = 1988, Expect = 0.0e+00, Identities = 376/699 (53%), Positives = 508/699 (72%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+D +G  QF+ D+LA  ++    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  +  +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIA+ M D  +F +T++ AI+AL +++    ++S P+IE GN+ + A+GLG MNLHG+LA   I+Y SEE VDFTN++FY + YHA +ASN  A E G  F+ F  +KYA G +FDKYT   E  W PKTE+V++L  +  + IP + DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +   N  YY + AYEIG   IID  +AA +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     2 LNLYDADGKIQFDRDVLAARQFFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKALLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLASGDATLAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDSRIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIEGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIARTM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLAREHIFYGSEEGVDFTNIYFYAVLYHALRASNRIAVERGTRFKGFDQSKYASGEFFDKYT---ERVWEPKTEKVRQLFADAGIRIPNQDDWQRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNENLDYY-QDAYEIGYEKIIDTYAAATEHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VAGCVSCML 693
>gi|146312796|ref|YP_001177870.1| ribonucleotide-diphosphate reductase subunit alpha [Enterobacter sp. 638] >gi|145319672|gb|ABP61819.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Enterobacter sp. 638] (705 aa)
Score = 1987, Expect = 0.0e+00, Identities = 375/706 (53%), Positives = 502/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G+ QF  D  AV+ +    ++PN   F S   +L+YL  E YY+  V  +Y   F++++FE+A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+   AL   +G+E  A   +DEM++ R+Q ATPTFLN GK QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN +MALFSPYDI+R YGKP  D++I+E Y+ L+ +  + KK+I+AR  FQ +AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y   G+D+ CNLGSLNIA  M D  +FG+TV+ AI+ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S E +DFTN++FYT+ +HA   S   A+E    F  F+ ++YA G YF++Y    EN W PKTE+V+ L     + +PT++ W QL +D+  FG+ N +L AV PTGSISY++  T S+ PIVS IEIRKEGK GRVY PA  +   N   Y + AYEIG   IID  + A +HVDQ +S+TLF  + ATTRD+NKA I+A+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     7 YHALNAMLNLYDREGHIQFGKDAEAVDAFFAAHVRPNSVPFASQDARLDYLVSEGYYEERVLTRYDRPFVLNLFERAHASGFRFQTFLGAWKYYTSYTLKTFDGKRYLESFEDRVCMVALTLAQGDENLAEQLMDEMLSARFQPATPTFLNCGKAQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLRESGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFQLAKENAEMALFSPYDIERIYGKPFGDVTISELYDELVADDRVRKKFINARDFFQTLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASTYDENLDYAHTGKDISCNLGSLNIAHTM-DSPDFGRTVETAIRGLTAVSDMSHIRSVPSIETGNAASHAIGLGQMNLHGYLAREGIAYGSPEGLDFTNLYFYTITWHALNTSMMLARERNQRFAGFEKSRYASGEYFNQYL---ENSWQPKTEKVRALFARAGVTLPTREMWQQLRDDVMTFGIYNQNLQAVPPTGSISYINHATSSIHPIVSKIEIRKEGKTGRVYYPAPFMTNENLALY-QDAYEIGPEKIIDTYAEATKHVDQGLSLTLFFPDTATTRDINKAQIHAWKKGIKTLYYIRLRQLALEGTE-IEGCVSCAL 705
>gi|38234437|ref|NP_940204.1| ribonucleotide-diphosphate reductase subunit alpha [Corynebacterium diphtheriae NCTC 13129] >gi|38200700|emb|CAE50396.1| ribonucleoside-diphosphate reductase alpha chain [Corynebacterium diphtheriae] (719 aa)
Score = 1984, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 508/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D NG  QF+ D  A  ++    +  N   F+ ++EK+EYL   NYY+  V  KYS + +  +F++A  + FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+ + A   +DE+MTGR+Q ATPTFLN+GK QRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLG+V+PDI F LA+ N+DM LFSPYD++R YGKP +DIS+TE Y +++ +P I K  I+AR  FQ IAE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N+PS+LN DLTYE +GED+ CNLGS+NIA  M D  +F KTV+ AI+ L +++    + S P+I+ GN    A+GLG MNLHG+L    I+Y SEE +DFTN +F  + Y   +AS++ A E G  FE F+ + YADGSYFD++   +   + PKT +V+EL +   + +PT +DW +L + + K GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  YY + AYEIG   +ID  + A ++VDQ +S+TLF  +N TTRD+N+A IYA+ K   S+YYIR+RQ  L+ +E +  C +C++
  S:    21 YHALNALLNLYDANGRIQFDKDREAANQFFLQHVNQNTVFFHDLEEKIEYLVENNYYEPEVLDKYSFAGIKDLFKQAYAHKFRFKSFLGAYKYYTSYTLKTFDGRRYLERFEDRVCMVALTLADGSIELARNLVDEIMTGRFQPATPTFLNSGKAQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNLRESGAPIKKIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDILNFLDTKRENADEKIRIKTLSLGIVIPDITFELAKRNEDMYLFSPYDVERVYGKPFADISVTELYADMVEDPRIRKTKINARSFFQTIAEIQFESGYPYIMFEDTVNRAN-PIEGRINMSNLCSEILQVNSPSVLNADLTYEHVGEDISCNLGSMNIAMAM-DSTDFAKTVETAIRGLTAVSEQTSIDSVPSIKKGNDAAHAIGLGQMNLHGYLGREHIFYGSEEGLDFTNAYFAAVLYQCLRASHKIAAERGQRFEGFETSDYADGSYFDRFDPAD---FAPKTAKVQELFENSTIVVPTAEDWEELKQLVMKDGLFNRYLQAVPPTGSISYINNSTSSIHPIASRIEIRKEGKIGRVYYPAPHMDNDNLEYY-QDAYEIGFEKVIDTYAVATKYVDQGLSLTLFFKDNVTTRDINRAQIYAWRKGIKSLYYIRLRQVALEGTE-VEGCVSCML 719
>gi|163842201|ref|YP_001626606.1| ribonucleoside-diphosphate reductase alpha chain [Renibacterium salmoninarum ATCC 33209] >gi|162955677|gb|ABY25192.1| ribonucleoside-diphosphate reductase alpha chain [Renibacterium salmoninarum ATCC 33209] (706 aa)
Score = 1984, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 514/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y  LNA + L+D +GN QF+ D  A  +Y    +  N   F+ ++EKL+YL    YY+     +Y+ +F+  ++ +A    FRF +F+GA KFYT+Y LK+FD K + E +EDR+   AL   RGNE  AL  +DE++ GR+Q ATPTFLNAGK QRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ LTN+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVVVPDI F LA+ ++DM LFSPYD+++ YG P SDIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  +  +IIMSNLC+EI Q++ P++ N DL+Y + G+D+ CNLGSLNIA+ M D  +FG T++ +I+AL +++ ++D+ S P+I  GN  +RA+GLG MNLHG+LA  +++Y SEE +DFTN++FYT+ YHA +ASN  A ETG  F  F+N+KYA G +FDKYT  E     P+TERV+EL     + IPT+ DW  L   I + G+ N +L AV PTGSISY+++ T S+ P+ S IEIRKEGK+GRVY PA  +  +N  +Y + AYEIG   IID  +AA QHVDQ +S+TLF  + A+TRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    10 YHELNAMLNLYDADGNIQFDADREAAHQYFLQHVNNNTVFFHDLEEKLDYLVKNQYYERETLDQYTMNFIRELYNRAYKKKFRFETFLGAFKFYTSYTLKTFDGKRFLERYEDRVCMVALHLARGNEDLALKLVDEIIDGRFQPATPTFLNAGKAQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFALTNIREVGAPIKQIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDINRFLDTKRENADEKIRIKTLSLGVVVPDITFELAKRDEDMYLFSPYDVEKVYGIPFSDISVTEKYYEMVDDSRIKKTKIKAREFFQTLAEIQFESGYPYIMFEDTVNRAN-PIEGKIIMSNLCSEILQVSKPTVYNDDLSYAETGKDISCNLGSLNIARTM-DSPDFGNTIETSIRALSAVSDMSDIRSVPSIAKGNRASRAIGLGQMNLHGYLARERVHYGSEEGLDFTNIYFYTVVYHALRASNLLAIETGETFGGFENSKYASGEFFDKYTDQER---LPQTERVRELFA--NVHIPTQDDWRSLKASIMEHGIYNQNLQAVPPTGSISYINNSTSSIHPVASKIEIRKEGKIGRVYYPAPYLTNDNLEFY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTASTRDINKAQIYAWRKGIKTVYYIRLRQLALEGTE-VEGCVSCML 706
>gi|68535548|ref|YP_250253.1| ribonucleotide-diphosphate reductase subunit alpha [Corynebacterium jeikeium K411] >gi|68263147|emb|CAI36635.1| ribonucleoside-diphosphate reductase alpha chain [Corynebacterium jeikeium K411] (720 aa)
Score = 1984, Expect = 0.0e+00, Identities = 381/706 (53%), Positives = 510/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+++ G  QF+ D  A  +Y    +  N   F+ ++EK++YL    YYD  V  +Y  SF+ S+F++A    FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+ + A   +DE+M GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YGKP +D+SITE YE ++ +P I K  I+AR  FQ +AE+QFESGYP+I+F+D  N+ N  +  RI  SNLC+EI Q++TPS  N DL+Y+Q+G+D+ CNLGS+NIAK M D  +F KT++ AI+ L ++A    + S P++  GN  + A+GLG MNLHGFL    I+Y SEEA+DFTN +F T+ Y A KASN+ A+E G  F NF+N++YA G +FD+Y   E   + PKTER+++++    + +PT QDW QL +D++  GL N +L A+ PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYYIR+RQ  L  +E +  C +C++
  S:    22 YHALNAMLNLYNDAGEIQFDKDREAANQYFLQHVNQNTVYFHDLEEKVKYLVDNEYYDPEVLDQYEFSFVKSLFKQAYAKKFRFQSFLGAYKYYTSYTLKTFDGRRYLERFEDRVCMVALGLAAGDTELASNLVDEIMDGRFQPATPTFLNIGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNVREAGAPIKHIENQSSGVIPVMKLLEDAFSYANQLGARQGAGAVYLSAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGKPFADVSITEHYEEMVEDPRIRKSKINARAFFQTLAEIQFESGYPYIMFEDTVNKAN-PIEGRITHSNLCSEILQVSTPSEFNADLSYKQIGDDISCNLGSMNIAKAM-DSEDFSKTIETAIRGLTAVADQTSIDSVPSVRQGNDNSHAIGLGQMNLHGFLGREHIHYGSEEALDFTNAYFATVMYEALKASNKIAQERGEKFHNFENSQYATGEFFDRYDPAE---FAPKTERIRQIIGNSSIQVPTAQDWQQLKDDVQAHGLYNRNLQAIPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPYMTNDNLEYY-EDAYEIGYEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTIYYIRLRQTALTGTE-VEGCVSCML 720
>gi|145224884|ref|YP_001135562.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium gilvum PYR-GCK] >gi|145217370|gb|ABP46774.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Mycobacterium gilvum PYR-GCK] (701 aa)
Score = 1983, Expect = 0.0e+00, Identities = 376/706 (53%), Positives = 512/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D +G  QFE D+ A  +Y    +  N   F+S  EKL+YL  +NYY+  V  +YS +F+  + ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  +L    G+   A   +DE+M GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+++D  N  N  ++ +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ +I+AL +++    + S P+IE GN+ + A+GLG MNLHG+LA  +I+Y S+E VDFTN++FY + YHA +ASN  A E G  F  F+ +KY  G +FDKYT   +  W PKTE+V+ L  +  + IP ++DW QL   +++ G+ N +L AV PTGSISY++  T S+ PI S +EIRKEGK+GRVY PA  +   N  YY + AYEIG   +ID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     3 YHALNAMLNLYDADGKIQFEKDVQAAREYFLQHVNQNTVFFHSQDEKLDYLIEKNYYEREVLDQYSRNFVKGLLDRAYAKKFRFPTFVGAFKYYTSYTLKTFDGKRYLERFEDRVVMVSLTLASGDTTLAEKLVDEIMDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIFRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERVYGLPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMYEDTVNRAN-PIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKAM-DSPDFAQTIEVSIRALTAVSDQTHIWSVPSIEQGNNSSHAIGLGQMNLHGYLARERIFYGSDEGVDFTNIYFYCVLYHALRASNRIAIERGTAFGGFEKSKYKSGEFFDKYT---DQVWEPKTEKVRGLFADAGIRIPDQEDWKQLKASVQEHGIYNQNLQAVPPTGSISYINHSTSSIHPIASKVEIRKEGKIGRVYYPAPYMTNENLEYY-QDAYEIGYEKVIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 701
>gi|77961614|ref|ZP_00825447.1| COG0209: Ribonucleotide reductase, alpha subunit [Yersinia mollaretii ATCC 43969] (716 aa)
Score = 1983, Expect = 0.0e+00, Identities = 384/704 (54%), Positives = 516/704 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y SLNA + L+D +G  QF+ D LA  +Y    +  N   F++++EKL YL  E YY+  V  +Y  SF+ S+F++A +  FRF +F+GA K+YT+Y LK+FD K Y E +EDR+   AL    GN Q A   ++E+++GR+Q ATPTFLN GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N++M LFSPYD+++ YG PMS+ISI+E+Y  +++N  I K  I AR+ FQ +AE+QFESGYP+++F+D  N  N  +  RI MSNLC+EI Q+N+P+  N DL+Y Q+G+D+ CNLGSLNIA  M D  +FGK+++ AI+ L +++ ++ + S P+IE GN ++ A+GLG MNLHG+LA  +I+Y SEEA+DFTN++FYT+AYHA +ASN  A E G  F+ F  + YA GSYF KY    E  W PKT +V+ L  +  + IP +QDW  L + + + G+ N +L AV PTGSISY++  T S+ PIVSPIEIRKEGK+GRVY PA  +  +N  YY + AY+IG   IID  + A QHVDQ +S+TLF  + ATTRD+NKA IYA+ +   +IYYIR+RQ  L+ +E +  C +C
  S:    18 YHSLNAMLNLYDADGRIQFDKDRLAARQYFLQHVNQNTVFFHNLQEKLNYLVEEEYYEKEVLDQYDFSFIKSLFQQAYSKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLAAGNPQLARELVEEIISGRFQPATPTFLNCGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFLLSNIREVGAPIKRIENQSSGVIPIMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKNNEEMYLFSPYDVEQVYGVPMSEISISEKYREMVDNKRIRKSKIKAREFFQILAEIQFESGYPYMMFEDTVNRAN-PIKGRINMSNLCSEILQVNSPTEYNDDLSYRQIGKDISCNLGSLNIAHTM-DSPDFGKSIETAIRGLTAVSDMSHIRSVPSIEKGNQESHAIGLGQMNLHGYLARERIFYGSEEALDFTNIYFYTVAYHAIRASNLLAIERGCHFKGFDESTYASGSYFTKYV---EQRWQPKTAKVQALFADAGIHIPDQQDWAALRQSVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSPIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYQIGPEKIIDTYAEATQHVDQGLSLTLFFRDTATTRDINKAQIYAWKRGIKTIYYIRLRQMALEGTE-VEGCVSC 714
>gi|69938057|ref|ZP_00632608.1| Ribonucleoside-diphosphate reductase [Paracoccus denitrificans PD1222] >gi|119387082|ref|YP_918137.1| ribonucleoside-diphosphate reductase, alpha subunit [Paracoccus denitrificans PD1222] >gi|119377677|gb|ABL72441.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Paracoccus denitrificans PD1222] (708 aa)
Score = 1982, Expect = 0.0e+00, Identities = 378/706 (53%), Positives = 505/706 (71%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D  G  +F+ D  A  +Y    +  N   F+S+ EKL YL  E YY+  V  +Y  +FL  I++ A    FRF +F+GA K+YT+Y LK+ D + Y E +EDR+V  AL   RG+E  A+ +++E+++GR+Q ATPTFLNAGKK RGE +SC+LLR+EDNMESIGR   + LQLSKRGGGVA  LTNLRE GAPIKGI+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL+FLD+KRENADEKIRIK+LSLGVV+PD+ F LA+ N+DM LFSP+D+++ YG P S+IS+TE+Y  ++++  I KK I+AR  FQ +AE+QFESGYP+I+F+D  N  N  +  RI MSNLC+EI Q+N  S  + DL Y  LG D+ CNLGSLNIA  M DG +FG TV+ AI+AL +++ ++ + + P+I  GN +  AVGLG MNLHGFLA  +I+Y S E V+FT+++F  +AYHA +ASN  A+E G  F++F  +KYADGS+FDKY   +   W P    V  + +   +++PT++DW  L E + + GL N +L AV PTGSISY+++ T S+ PIV+ IEIRKEGK+GRVY PA  +   N  YY + AYEIG   IID  +AA +HVDQ +S+TLF    ATTRD+N+A IYA+ K   +IYYIR+RQ  L+ +E +  C +C +
  S:    12 YHALNAMLNLYDGEGRIRFDADRKAARQYFLQHVNQNTVFFHSLDEKLGYLVDEGYYEAEVLDQYPRAFLHRIWDAAYARKFRFPTFLGAFKYYTSYTLKTRDGRRYLERYEDRVVMVALALARGDEDLAMRFMEEILSGRFQPATPTFLNAGKKSRGELISCFLLRLEDNMESIGRGINSALQLSKRGGGVALMLTNLREAGAPIKGIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDVTFELAKRNEDMYLFSPHDVEKVYGLPFSEISVTEKYAEMVDDKRIRKKKINARAFFQTLAEIQFESGYPYIMFEDTVNRANP-VAGRISMSNLCSEILQVNEASEFDEDLGYRHLGTDISCNLGSLNIAATM-DGPDFGATVEAAIRALTAVSEMSAIEAVPSIRRGNDEAHAVGLGQMNLHGFLARERIHYGSPEGVEFTSVYFAAVAYHAIRASNLLAQEKGRTFKDFDKSKYADGSFFDKYVAQD---WLPTLPDVARVFE--GVSLPTREDWAALRESVMRHGLYNRNLQAVPPTGSISYINNSTSSIHPIVAKIEIRKEGKIGRVYYPAAFMSNENLDYY-RDAYEIGPEAIIDTYAAATEHVDQGLSLTLFFPAEATTRDINRAQIYAWKKGIKTIYYIRLRQTALEGTE-VQGCVSCTL 708
>gi|108798785|ref|YP_638982.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium sp. MCS] >gi|119867903|ref|YP_937855.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium sp. KMS] >gi|126434386|ref|YP_001070077.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium sp. JLS] >gi|108769204|gb|ABG07926.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Mycobacterium sp. MCS] >gi|119693992|gb|ABL91065.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Mycobacterium sp. KMS] >gi|126234186|gb|ABN97586.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Mycobacterium sp. JLS] (693 aa)
Score = 1982, Expect = 0.0e+00, Identities = 375/699 (53%), Positives = 514/699 (73%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+D++G  QF+ D+LA  +Y    +  N   F++  EKL+YL  ++YY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+++D  N  N  +  +I  SNLC+EI Q++TPS  N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    ++S P+IE GN+ + A+GLG MNLHG+LA  +I+Y S+E VDFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   E  W PKTERV++L  +  + IP + DW +L E +++ G+ N +L AV PTGSISY++  T S+ P+ S IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     2 LNLYDKDGKIQFDKDVLAAREYFLQHVNQNTVFFHNQDEKLDYLIQKDYYEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTTLAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDSRIRKTKIKAREFFQTLAELQFESGYPYIMYEDTVNRSN-PIEGKITHSNLCSEILQVSTPSEFNDDLSYAKVGKDISCNLGSLNIAKAM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGVDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT---EQPWEPKTERVRQLFADAGIRIPNQDDWRRLKESVQQHGIYNQNLQAVPPTGSISYINHSTSSIHPVASKIEIRKEGKIGRVYYPAPYLTNDNLEYY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 693
>gi|194541740|ref|YP_002076771.1| ribonucleoside-diphosphate reductase (alpha chain) nrdE [Mycobacterium tuberculosis C] >gi|124599210|gb|EAY58314.1| ribonucleoside-diphosphate reductase (alpha chain) nrdE [Mycobacterium tuberculosis C] (732 aa)
Score = 1979, Expect = 0.0e+00, Identities = 370/675 (54%), Positives = 496/675 (73%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAF 694
           Y +LNA + L+D +G  QF+ D  A  +Y    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ ++ ++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+V  AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLRVEDNMESIGR+  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YG P +DIS+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    + S P+IE GN+ + A+GLG MNLHG+LA  +I+Y S+E +DFTN++FYT+ YHA +ASN  A E G  F+ F+ +KYA G +FDKYT   +  W PKT++V++L  +  + IPT+ DW +L E ++  G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+
  S:    27 YHALNAMLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTALAELLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRAN-PIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTIEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT---DQIWEPKTQKVRQLFADAGIRIPTQDDWRRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLEYY-EDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAW 695
>gi|172041161|ref|YP_001800875.1| ribonucleoside-diphosphate reductase alpha chain [Corynebacterium urealyticum DSM 7109] >gi|171852465|emb|CAQ05441.1| ribonucleoside-diphosphate reductase alpha chain [Corynebacterium urealyticum DSM 7109] (719 aa)
Score = 1974, Expect = 0.0e+00, Identities = 380/710 (53%), Positives = 508/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +K  Y +LNA + L+DENG  QF+ D  A  ++    +  N   F+++ EKLEYL    YYD  +  KY   F+ ++F++A    FRF SF+GA K+YT+Y LK+FD K Y E FEDR+   AL    G+E+ A + +DE++ GR+Q ATPTFLN GK QRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++GIIPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLGVV+PD+ F LAR+N DM LFSPYD++R YGKP +DIS+TE Y+ ++ +P I KK I+AR  FQ +AE+QFESGYP+I+++D  N  N  +  RI  SNLC+EI Q++TPS  N DLTYE +G+D+ CNLGS+NIA  M D A+F KT++ AI+AL +++   D+ S P+I  GN  + A+GLG MNLHG+L    I+Y SEEA+DFTN +F  + Y   KASN+ A E G  F +F+N++YA G++FD+Y   E   + PKTE+VKE+     + +PT +DW +L   + K G+ N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY  A  ++  N  Y+ + AYE+G   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   +IYY+R+RQ  L  +E +  C +C++
  S:    17 EKLDYHALNAMLNLYDENGQIQFDADHKAANQFFLQHVNQNTVFFHNLAEKLEYLVENKYYDKEILDKYDFPFIKALFKQAYAKKFRFQSFLGAYKYYTSYTLKTFDGKRYLERFEDRVCMVALGLADGDEEMAKSLVDEILDGRFQPATPTFLNIGKAQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNIREAGAPIKHIENQSSGIIPVMKLLEDAFSYANQLGARQGAGAVYLNAHHPDILNFLDTKRENADEKIRIKTLSLGVVIPDVTFELARKNADMYLFSPYDVERVYGKPFADISVTEHYDEMVEDPRIRKKKINARDFFQTLAEIQFESGYPYIMYEDTVNRAN-PIAGRITHSNLCSEILQVSTPSAFNEDLTYETIGDDISCNLGSMNIAMAM-DSADFSKTIEIAIRALTAVSDQTDIDSVPSIRQGNDHSHAIGLGQMNLHGYLGREHIHYGSEEALDFTNAYFAAVMYECLKASNKIAIERGTAFHDFENSEYASGAFFDRYDPAE---FAPKTEKVKEIFAASSIEVPTTEDWAELKASVAKHGIYNRNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYAAPHMNNENLEYF-EDAYEVGFEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTIYYVRLRQTALSGTE-VEGCVSCML 719
>gi|18202755|sp|Q9CBQ0|RIR1_MYCLE Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase R1 subunit) (721 aa)
Score = 1973, Expect = 0.0e+00, Identities = 376/714 (52%), Positives = 515/714 (72%)
  Q:    12 NIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +++ ++  Y +LNA + L+D +G  QF+ D+LA  ++    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ S+ ++A    FRFS+F+GA K+YT+Y LK+FD K Y E  EDR+   AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I++Q++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGV++PDI F LA+ N+DM LFS YD++R Y  P +DIS+TE+Y  +L++  I K  I AR+ FQ++AE+QFESGYP+++F+D  N  N  +  +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +TV+ AI+AL +++    + S P+IE GN+ + A+GLG MNLHG+L+   I+Y SEE VDFTN++FYT+ +H   ASN  A E G  F+ F+ +KYA G +FDKY    E  W PKT++V++L  E  + IPT+ DW +L E +   G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:    15 HMLSNETDYHALNAMLNLYDADGKIQFDKDVLAARQFFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKSLLDRAYAKKFRFSTFLGAFKYYTSYTLKTFDGKRYLERLEDRVCMVALTLAAGDTGLAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSVNSALQLSKRGGGVALLLSNIREHGAPIKNIEHQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVIIPDITFELAKRNEDMYLFSSYDVERVYEVPFADISVTEKYYEMLDDARIRKTKIKAREFFQKLAELQFESGYPYVMFEDTVNRAN-PIEGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTVEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLSREGIFYGSEEGVDFTNIYFYTVLFHVLLASNSIAIERGTFFKGFERSKYASGEFFDKYI---EQTWEPKTDKVRQLFAEAAIRIPTQNDWKRLKELVVAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLQYY-QDAYEIGYQKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCTL 721
>gi|59859089|gb|AAX09329.1| NrdE [Corynebacterium ammoniagenes] (720 aa)
Score = 1972, Expect = 0.0e+00, Identities = 377/710 (53%), Positives = 506/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +K  + +LNA + L+DE+G  QF+ D  A  +Y    +  N   F+ ++EK+EYL    YY+  V + Y   F+ S+F++A ++ FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+   A + +DE+M+GR+Q ATPTFLNAGK QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++GIIP+MK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLG+V+PDI F LA+ N+DM LFSPYD++R YGKP  DIS+++ Y  ++ +P ITKK I+AR  FQ +AE+QFESGYP+I+F+D  N  N     RI MSNLC+EI Q+N+PS  N DL+YE++G D+ CNLGS+NIA  M D  +FG TV+ AI+ L ++A    + S P+I +GN ++ A+GLG MNLHG+L    IYY SEE +DFTN +F  + Y A +ASN+ AKE G  F  FK++ YA G +FD Y   E   + P+T++VKEL     +  P+ +DW  L  ++ + GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  Y+ + AYE+G   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L  +E +  C +C++
  S:    17 EKLDFHALNALLNLYDEDGKIQFDKDREAANQYFLQHVNQNTVYFHDLEEKIEYLVENKYYEPEVIEAYDWEFIKSLFKRAYSFKFRFKSFLGAYKYYTSYTLKTFDGRRYLERFEDRVSMTALFLADGDTAVAESMVDEIMSGRFQPATPTFLNAGKAQRGELVSCFLLRIEDNMESIGRAINSSLQLSKRGGGVALLLSNIRESGAPIKHIENQSSGIIPIMKMLEDAFSYANQLGARQGAGAVYLNAHHPDILNFLDTKRENADEKIRIKTLSLGIVIPDITFDLAKRNEDMYLFSPYDVERVYGKPFGDISVSDHYAEMVEDPRITKKKINARHFFQTVAELQFESGYPYIMFEDTVNNANPVKTGRINMSNLCSEILQVNSPSSFNDDLSYEEMGSDISCNLGSMNIALAM-DSPDFGGTVEAAIRGLTAVADKTAIDSVPSIRHGNDQSHAIGLGQMNLHGYLGREHIYYGSEEGLDFTNAYFAAVLYAALRASNKIAKERGETFSEFKDSDYASGVFFDNYDPAE---FAPQTDKVKELFANSTIHTPSAEDWADLKAEVMEHGLYNRNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPHMDNDNLDYF-QDAYEVGHEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTLYYIRLRQMALAGTE-IEGCVSCML 720
>gi|114766103|ref|ZP_01445112.1| ribonucleotide-diphosphate reductase alpha subunit [Roseovarius sp. HTCC2601] >gi|114541658|gb|EAU44699.1| ribonucleotide-diphosphate reductase alpha subunit [Roseovarius sp. HTCC2601] (707 aa)
Score = 1970, Expect = 0.0e+00, Identities = 373/706 (52%), Positives = 512/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y +LNA + L+D+ G+ +F+ D +A  +Y    +  N   F+S+ EKL+YL  E YY+  V + Y  +FL  I++ A    FRF +F+GA K+YT+Y LK+ D K + E +EDR+V  AL   RG++  A+++++E+++GR+Q ATPTFLNAGKK RGE +SC+LLR+EDNMESIGR   + LQLSKRGGGVA  LTN+RE GAPIKGI+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYLNA HPDIL+FLD+KRENADEKIRIK+LSLGVV+PD+ F LA+ N+ M LFSP+D+++ YG P S+IS+TE+Y+ ++ +  I K  I+AR  FQ +AE+QFESGYP+I+F+D  N  N  ++ RI MSNLC+EI Q+N  S  N DL+Y ++G D+ CNLGSLNIAK M DG + G TV+ AI+AL +++ ++ + S P+I  GN ++ A+GLG MNLHGFLA   I+Y S E V+FT+++F T+AYHA +AS   AKE G  F+ F  + YA G +FDKYT   E  W P+++RV EL     +A+P++ DW  L  D+ + GL N +L AV PTGSISY+++ T S+ PIVS IEIRKEGK+GRVY PA  ++ +N  YY + AYEIG   +I+  +AA +HVDQ +S+TLF    ATTRD+N+A I A+ K   +IYY+R+RQ  L+ +E +  C +C +
  S:    11 YHALNAMLNLYDDEGHIRFDADRMAARQYFLQHVNQNTVFFHSLDEKLDYLVEEGYYEAEVLEAYPRAFLQQIWDAAFKKKFRFPTFLGAFKYYTSYTLKTRDGKRFLERYEDRVVMVALALARGDQDLAMSFMEEILSGRFQPATPTFLNAGKKSRGELISCFLLRLEDNMESIGRGINSALQLSKRGGGVALMLTNIREHGAPIKGIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDVTFELAKRNEPMYLFSPHDVEKIYGVPFSEISVTEKYDEMVEDKRIRKTKINARSFFQTLAEIQFESGYPYIMFEDTVNRMN-PIDGRITMSNLCSEILQVNEASEYNEDLSYARMGTDISCNLGSLNIAKSM-DGRDLGATVEAAIRALTAVSEMSAIDSVPSIRKGNDESHAIGLGQMNLHGFLAREHIHYGSPEGVEFTSVYFATVAYHAIRASCALAKERGESFKGFAASDYASGVFFDKYT---ERDWLPESDRVAELFD--GIALPSRADWAALKADVMEHGLYNRNLQAVPPTGSISYINNSTSSIHPIVSKIEIRKEGKIGRVYYPAAFMNNDNLEYY-RDAYEIGPEALIETYAAATEHVDQGLSLTLFFPAEATTRDINRAQILAWKKGIKTIYYVRLRQTALEGTE-VEGCVSCTL 707
>gi|60202516|gb|AAX14644.1| ribonucleotide reductase large catalytic subunit mutant [Corynebacterium ammoniagenes] (720 aa)
Score = 1970, Expect = 0.0e+00, Identities = 377/710 (53%), Positives = 506/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +K  + +LNA + L+DE+G  QF+ D  A  +Y    +  N   F+ ++EK+EYL    YY+  V + Y   F+ S+F++A ++ FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+   A + +DE+M+GR+Q ATPTFLNAGK QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++GIIP+MK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLG+V+PDI F LA+ N+DM LFSPYD++R YGKP  DIS+++ Y  ++ +P ITKK I+AR  FQ +AE+QFESGYP+I+F+D  N  N     RI MSNLC+EI Q+N+PS  N DL+YE++G D+ CNLGS+NIA  M D  +FG TV+ AI+ L ++A    + S P+I +GN ++ A+GLG MNLHG+L    IYY SEE +DFTN +F  + Y A +ASN+ AKE G  F  FK++ YA G +FD Y   E   + P+T++VKEL     +  P+ +DW  L  ++ + GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  Y+ + AYE+G   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L  +E +  C +C++
  S:    17 EKLDFHALNALLNLYDEDGKIQFDKDREAANQYFLQHVNQNTVYFHDLEEKIEYLVENKYYEPEVIEAYDWEFIKSLFKRAYSFKFRFKSFLGAYKYYTSYTLKTFDGRRYLERFEDRVSMTALFLADGDTAVAESMVDEIMSGRFQPATPTFLNAGKAQRGELVSCFLLRIEDNMESIGRAINSSLQLSKRGGGVALLLSNIRESGAPIKHIENQSSGIIPIMKMLEDAFSYANQLGARQGAGAVYLNAHHPDILNFLDTKRENADEKIRIKTLSLGIVIPDITFDLAKRNEDMYLFSPYDVERVYGKPFGDISVSDHYAEMVEDPRITKKKINARHFFQTVAELQFESGYPYIMFEDTVNNANPVKTGRINMSNLCSEILQVNSPSSFNDDLSYEEMGSDISCNLGSMNIALAM-DFPDFGGTVEAAIRGLTAVADKTAIDSVPSIRHGNDQSHAIGLGQMNLHGYLGREHIYYGSEEGLDFTNAYFAAVLYAALRASNKIAKERGETFSEFKDSDYASGVFFDNYDPAE---FAPQTDKVKELFANSTIHTPSAEDWADLKAEVMEHGLYNRNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPHMDNDNLDYF-QDAYEVGHEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTLYYIRLRQMALAGTE-IEGCVSCML 720
>gi|3077613|emb|CAA70765.1| ribonucleotide reductase subunit R1E [Corynebacterium ammoniagenes] (720 aa)
Score = 1969, Expect = 0.0e+00, Identities = 375/710 (52%), Positives = 505/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +K  + +LNA + L+DE+G  QF+ D  A  +Y    +  N   F+ ++EK+EYL    YY+  V + Y   F+ S+F++A ++ FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+   A + +DE+M+GR+Q ATPTFLNAGK QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++GIIP+MK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLG+V+PDI F LA+ N+DM LFSPYD++R YGKP  DIS+++ Y  ++ +P ITKK I+AR  FQ +AE+QFESGYP+I+F+D  N  N     RI MSNLC+EI Q+N+PS  N DL+YE++G D+ CNLGS+NIA  M D  +FG TV+ AI+ L ++A    + S P+I +GN ++ A+GLG MNLHG+L    IYY SEE +DFTN +F  + Y A +ASN+ AKE G  F  FK++ YA G +FD Y   E   + P+T++VKEL     +  P+ +DW  L  ++ + GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  Y+ + AYE+G   IID  + A ++VDQ +S+TLF  + A TRD+N+A I+A+ K   ++YYIR+RQ  L  +E +  C +C++
  S:    17 EKLDFHALNALLNLYDEDGKIQFDKDREAANQYFLQHVNQNTVYFHDLEEKIEYLVENKYYEPEVIEAYDWEFIKSLFKRAYSFKFRFKSFLGAYKYYTSYTLKTFDGRRYLERFEDRVSMTALFLADGDTAVAESMVDEIMSGRFQPATPTFLNAGKAQRGELVSCFLLRIEDNMESIGRAINSSLQLSKRGGGVALLLSNIRESGAPIKHIENQSSGIIPIMKMLEDAFSYANQLGARQGAGAVYLNAHHPDILNFLDTKRENADEKIRIKTLSLGIVIPDITFDLAKRNEDMYLFSPYDVERVYGKPFGDISVSDHYAEMVEDPRITKKKINARHFFQTVAELQFESGYPYIMFEDTVNNANPVKTGRINMSNLCSEILQVNSPSSFNDDLSYEEMGSDISCNLGSMNIALAM-DSPDFGGTVEAAIRGLTAVADKTAIDSVPSIRHGNDQSHAIGLGQMNLHGYLGREHIYYGSEEGLDFTNAYFAAVLYAALRASNKIAKERGETFSEFKDSDYASGVFFDNYDPAE---FAPQTDKVKELFANSTIHTPSAEDWADLKAEVMEHGLYNRNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPHMDNDNLDYF-QDAYEVGHEKIIDTYAVATKYVDQGLSLTLFFRDTAATRDINRAQIFAWRKGIKTLYYIRLRQMALAGTE-IEGCVSCML 720
>gi|119960800|ref|YP_948076.1| ribonucleoside-diphosphate reductase alpha chain [Arthrobacter aurescens TC1] >gi|119947659|gb|ABM06570.1| Ribonucleoside-diphosphate reductase alpha chain [Arthrobacter aurescens TC1] (727 aa)
Score = 1969, Expect = 0.0e+00, Identities = 378/706 (53%), Positives = 513/706 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           Y  LNA + L+  NG  QFE D  A  +Y    +  N   F+ ++EKL+YL    YY+     +Y+ +F+  +F +A    FRF +F+GA KFYT+Y LK+FD K + E +EDR+   AL   RG+E  A   +DE++ GR+Q ATPTFLNAGK QRGE VSC+LLR+EDNMESI RA  + LQLSKRGGGVA  LTN+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVVVPDI F LA++N+DM LFSPYD+++ YG P SDIS+TE+Y  ++++  I K  ISAR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +I MSNLC+EI Q+++PSI   DL+YE +G+D+ CNLGS+NIAK M D  +FG +++ +I+AL +++ ++ ++S P+I  GN+++ A+GLG MNLHG+LA   ++Y SEE +DFTN++FYT+ +HA +ASN  A ETG  F  F+ + YA G +FDKYT+ E   W P+TERV+EL   +   IPT+ DW +L   + + G+ N +L AV PTGSISY+++ T S+ P+ + IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    31 YHELNAMLNLYGPNGEIQFEADREAAHQYFLQHVNNNTVFFHDLEEKLDYLVKNQYYERETLDQYTMNFIRDLFNRAYKKKFRFETFLGAFKFYTSYTLKTFDGKRFLERYEDRVCMVALHLARGDEDLANRLVDEIIDGRFQPATPTFLNAGKAQRGELVSCFLLRIEDNMESIARAINSALQLSKRGGGVALSLTNIREHGAPIKQIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIHRFLDTKRENADEKIRIKTLSLGVVVPDITFELAKKNEDMYLFSPYDVEKVYGVPFSDISVTEKYYEMVDDSRIKKTKISAREFFQTLAEIQFESGYPYIMFEDTVNRAN-PIDGKITMSNLCSEILQVSSPSIYAEDLSYETVGKDISCNLGSMNIAKTM-DSPDFGLSIETSIRALSAVSDMSYINSVPSIAQGNAQSHAIGLGQMNLHGYLAREHVHYGSEEGLDFTNIYFYTVLFHALRASNRLAIETGQKFGGFEKSTYASGEFFDKYTEQE---WVPETERVRELFAGHH--IPTQDDWRELKASVMEHGIYNQNLQAVPPTGSISYINNSTSSIHPVAAKIEIRKEGKIGRVYYPAPYLTNDNLEYY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDINKAQIYAWRKGIKTLYYIRLRQLALEGTE-VEGCVSCML 727
>gi|25028979|ref|NP_739033.1| ribonucleotide-diphosphate reductase subunit alpha [Corynebacterium efficiens YS-314] >gi|23494266|dbj|BAC19233.1| ribonucleotide reductase alpha chain [Corynebacterium efficiens YS-314] (721 aa)
Score = 1969, Expect = 0.0e+00, Identities = 376/710 (52%), Positives = 507/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D+  + +LNA + L+D++G  QF+ D  A  +Y    +  N   F+++ EKL+YL   NYY+  V  KY   ++  +F++A +Y FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+ + A   +DE+MTGR+Q ATPTFLN+GK QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA  L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YGKP +DIS+TE Y  ++++  I K  I+AR+ FQ +AE+QFESGYP+I+F+D  NE N  +  R+  SNLC+EI Q++TPS  + DL+Y+++GED+ CNLGSLNIA  M D  +F +T++ AI+ L +++    + S P+I  GN    A+GLG MNLHG+L    I+Y SEE +DFTN +F  + Y   +ASN+ A+E G  F NF+N+ YA G YFD++   E   + PKT++VKEL     +  PT ++W QL  D+ + GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  Y+ + AYEIG   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    19 DQMDFHALNALLNLYDDDGKIQFDKDREAANQYFLQHVNQNTVFFHNLHEKLDYLVENNYYEKEVLDKYDFEYIKDLFKRAYSYKFRFKSFLGAYKYYTSYTLKTFDGRRYLERFEDRVCMVALTLADGDRETANALVDEIMTGRFQPATPTFLNSGKAQRGEPVSCFLLRIEDNMESIGRAINSALQLSKRGGGVALLLSNLREAGAPIKKIENQSSGVIPVMKLLEDAFSYANQLGARQGAGAVYLNAHHPDILSFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERIYGKPFADISVTELYNEMVDDDRIRKTKINARQFFQTLAEIQFESGYPYIMFEDTVNEAN-PIEGRVTHSNLCSEILQVSTPSTYHEDLSYDEVGEDISCNLGSLNIAMAM-DSPDFSRTIETAIRGLTAVSEQTSIDSVPSIRKGNEAAHAIGLGQMNLHGYLGREHIFYGSEEGLDFTNAYFAAVLYECLRASNKIARERGQRFANFENSDYASGVYFDRFDPAE---FAPKTDKVKELFANSTIHTPTAEEWAQLKADVMEHGLFNRYLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPHMDNDNLEYF-QDAYEIGYEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTLYYIRLRQVALEGTE-IDGCVSCML 721
>gi|15827932|ref|NP_302195.1| ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium leprae TN] >gi|13093485|emb|CAC30687.1| ribonucleoside diphosphate reductase [alpha] chain [Mycobacterium leprae] (693 aa)
Score = 1952, Expect = 0.0e+00, Identities = 372/699 (53%), Positives = 505/699 (72%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+D +G  QF+ D+LA  ++    +  N   F++  EKL+YL  ENYY+  V  +YS +F+ S+ ++A    FRFS+F+GA K+YT+Y LK+FD K Y E  EDR+   AL    G+   A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I++Q++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGV++PDI F LA+ N+DM LFS YD++R Y  P +DIS+TE+Y  +L++  I K  I AR+ FQ++AE+QFESGYP+++F+D  N  N  +  +I  SNLC+EI Q++TPS+ N DL+Y ++G+D+ CNLGSLNIAK M D  +F +TV+ AI+AL +++    + S P+IE GN+ + A+GLG MNLHG+L+   I+Y SEE VDFTN++FYT+ +H   ASN  A E G  F+ F+ +KYA G +FDKY    E  W PKT++V++L  E  + IPT+ DW +L E +   G+ N +L AV PTGSISY++  T S+ PIVS +EIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRD+NKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C +
  S:     2 LNLYDADGKIQFDKDVLAARQFFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKSLLDRAYAKKFRFSTFLGAFKYYTSYTLKTFDGKRYLERLEDRVCMVALTLAAGDTGLAEKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSVNSALQLSKRGGGVALLLSNIREHGAPIKNIEHQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVIIPDITFELAKRNEDMYLFSSYDVERVYEVPFADISVTEKYYEMLDDARIRKTKIKAREFFQKLAELQFESGYPYVMFEDTVNRAN-PIEGKITHSNLCSEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIAKTM-DSPDFAQTVEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLSREGIFYGSEEGVDFTNIYFYTVLFHVLLASNSIAIERGTFFKGFERSKYASGEFFDKYI---EQTWEPKTDKVRQLFAEAAIRIPTQNDWKRLKELVVAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLQYY-QDAYEIGYQKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCTL 693
>gi|145296528|ref|YP_001139349.1| ribonucleotide-diphosphate reductase subunit alpha [Corynebacterium glutamicum R] >gi|140846448|dbj|BAF55447.1| hypothetical protein [Corynebacterium glutamicum R] (715 aa)
Score = 1949, Expect = 0.0e+00, Identities = 377/710 (53%), Positives = 505/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D+  + +LNA + L+D+NG  QFE D  A  +Y    +  N   F++++EK++YL    YYD  V  KY   F+  +F++A  + FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+   A   +DE+M+GR+Q ATPTFLN+GK QRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YGKP +DISITE Y+ ++++  I K  I+AR+ FQ +AE+QFESGYP+I+++D  N  N  +  RI  SNLC+EI Q++TPS  N DLTY ++GED+ CNLGSLN+A  M D  NF KT++ AI+ L +++    + S P+I  GN    A+GLG MNLHG+     ++Y SEEA+DFTN +F  + Y   +ASN+ A E G  F+NF+N+KYA G YFD +   + N + PK+++VKEL  +  +  PT +DW  L  D+ + GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  Y+ + AYEIG   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    13 DQMDFHALNALLNLYDDNGKIQFEKDREAANQYFLQHVNQNTVFFHNLQEKIDYLVENKYYDPIVLDKYDFQFIKDLFKRAYGFKFRFQSFLGAYKYYTSYTLKTFDGRRYLERFEDRVCMVALTLADGDRPLAENLVDEIMSGRFQPATPTFLNSGKAQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNLREAGAPIKKIENQSSGVIPVMKLLEDAFSYANQLGARQGAGAVYLNAHHPDILSFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERIYGKPFADISITEHYDEMVDDDRIRKSKINARQFFQTLAEIQFESGYPYIMYEDTVNASN-PIEGRITHSNLCSEILQVSTPSEFNDDLTYAEVGEDISCNLGSLNVAMAM-DSPNFEKTIETAIRGLTAVSEQTSIDSVPSIRKGNEAAHAIGLGQMNLHGYFGREHMHYGSEEALDFTNAYFAAVLYQCLRASNKIATERGERFKNFENSKYATGEYFDDF---DANDFAPKSDKVKELFAKSNIHTPTVEDWAALKADVMEHGLFNRNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPHMDNDNLEYF-EDAYEIGYEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTLYYIRLRQVALEGTE-VDGCVSCML 715
>gi|19553728|ref|NP_601730.1| ribonucleotide-diphosphate reductase subunit alpha [Corynebacterium glutamicum ATCC 13032] >gi|62391369|ref|YP_226771.1| ribonucleotide-diphosphate reductase subunit alpha [Corynebacterium glutamicum ATCC 13032] >gi|41326710|emb|CAF21192.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE ALPHA CHAIN [Corynebacterium glutamicum ATCC 13032] (715 aa)
Score = 1946, Expect = 0.0e+00, Identities = 376/710 (52%), Positives = 505/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D+  + +LNA + L+D+NG  QFE D  A  +Y    +  N   F++++EK++YL    YYD  V  KY   F+  +F++A  + FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+   A   +DE+M+GR+Q ATPTFLN+GK QRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YGKP +D+SITE Y+ ++++  I K  I+AR+ FQ +AE+QFESGYP+I+++D  N  N  +  RI  SNLC+EI Q++TPS  N DLTY ++GED+ CNLGSLN+A  M D  NF KT++ AI+ L +++    + S P+I  GN    A+GLG MNLHG+     ++Y SEEA+DFTN +F  + Y   +ASN+ A E G  F+NF+N+KYA G YFD +   + N + PK+++VKEL  +  +  PT +DW  L  D+ + GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  Y+ + AYEIG   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:    13 DQMDFHALNALLNLYDDNGKIQFEKDREAANQYFLQHVNQNTVFFHNLQEKIDYLVENKYYDPIVLDKYDFQFIKDLFKRAYGFKFRFQSFLGAYKYYTSYTLKTFDGRRYLERFEDRVCMVALTLADGDRALAENLVDEIMSGRFQPATPTFLNSGKAQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNLREAGAPIKKIENQSSGVIPVMKLLEDAFSYANQLGARQGAGAVYLNAHHPDILSFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERIYGKPFADVSITEHYDEMVDDDRIRKTKINARQFFQTLAEIQFESGYPYIMYEDTVNASN-PIEGRITHSNLCSEILQVSTPSEFNDDLTYAEVGEDISCNLGSLNVAMAM-DSPNFEKTIETAIRGLTAVSEQTSIDSVPSIRKGNEAAHAIGLGQMNLHGYFGREHMHYGSEEALDFTNAYFAAVLYQCLRASNKIATERGERFKNFENSKYATGEYFDDF---DANDFAPKSDKVKELFAKSNIHTPTVEDWAALKADVMEHGLFNRNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPHMDNDNLEYF-EDAYEIGYEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTLYYIRLRQVALEGTE-VDGCVSCML 715
>gi|5230835|gb|AAD41036.1|AF112535_3 ribonucleotide reductase alpha-chain [Corynebacterium glutamicum] >gi|21325302|dbj|BAB99923.1| Ribonucleotide reductase alpha subunit [Corynebacterium glutamicum ATCC 13032] (707 aa)
Score = 1946, Expect = 0.0e+00, Identities = 376/710 (52%), Positives = 505/710 (71%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           D+  + +LNA + L+D+NG  QFE D  A  +Y    +  N   F++++EK++YL    YYD  V  KY   F+  +F++A  + FRF SF+GA K+YT+Y LK+FD + Y E FEDR+   AL    G+   A   +DE+M+GR+Q ATPTFLN+GK QRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLGVV+PDI F LA+ N DM LFSPYD++R YGKP +D+SITE Y+ ++++  I K  I+AR+ FQ +AE+QFESGYP+I+++D  N  N  +  RI  SNLC+EI Q++TPS  N DLTY ++GED+ CNLGSLN+A  M D  NF KT++ AI+ L +++    + S P+I  GN    A+GLG MNLHG+     ++Y SEEA+DFTN +F  + Y   +ASN+ A E G  F+NF+N+KYA G YFD +   + N + PK+++VKEL  +  +  PT +DW  L  D+ + GL N +L AV PTGSISY+++ T S+ PI S IEIRKEGK+GRVY PA  +D +N  Y+ + AYEIG   IID  + A ++VDQ +S+TLF  + ATTRD+N+A IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:     5 DQMDFHALNALLNLYDDNGKIQFEKDREAANQYFLQHVNQNTVFFHNLQEKIDYLVENKYYDPIVLDKYDFQFIKDLFKRAYGFKFRFQSFLGAYKYYTSYTLKTFDGRRYLERFEDRVCMVALTLADGDRALAENLVDEIMSGRFQPATPTFLNSGKAQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNLREAGAPIKKIENQSSGVIPVMKLLEDAFSYANQLGARQGAGAVYLNAHHPDILSFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERIYGKPFADVSITEHYDEMVDDDRIRKTKINARQFFQTLAEIQFESGYPYIMYEDTVNASN-PIEGRITHSNLCSEILQVSTPSEFNDDLTYAEVGEDISCNLGSLNVAMAM-DSPNFEKTIETAIRGLTAVSEQTSIDSVPSIRKGNEAAHAIGLGQMNLHGYFGREHMHYGSEEALDFTNAYFAAVLYQCLRASNKIATERGERFKNFENSKYATGEYFDDF---DANDFAPKSDKVKELFAKSNIHTPTVEDWAALKADVMEHGLFNRNLQAVPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPHMDNDNLEYF-EDAYEIGYEKIIDTYAVATKYVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTLYYIRLRQVALEGTE-VDGCVSCML 707
>gi|32491359|ref|NP_871613.1| ribonucleotide-diphosphate reductase subunit alpha [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166566|dbj|BAC24756.1| nrdE [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (704 aa)
Score = 1945, Expect = 0.0e+00, Identities = 388/707 (54%), Positives = 518/707 (73%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           K  Y +LNA + L+D+NG  Q E D+ A+  Y E  + PN KKF+S+++++ YL  E YY+ NVF+ Y   F+ +IF ++K   F+F +FMGA+KFY++YALK+FDNK Y E FEDR    AL  G GNE+ A+  + E+++GR+Q ATPTFLN GKKQRGEYVSC+LLR+EDNMESIGRA  + LQLSKRGGGV++ LTNLRE GAPIK IKNQ++GI+PVMK+LED FSYANQLG RQGAGAVYL+A HPDIL FLD+KRENADEKIRIK+LSLGV++PDI F LA+EN++M LFSPYDI++ Y KP S++ I++ Y  L+N+  I K  I+AR  FQ++AEVQFESGYP+I+F+D  N++N  +  +I MSNLC+EI Q+NT S  N DL+Y+++G D+ CNLGSLNIAK M D +N GKTV+ AI+ L +++ +  ++S  ++  GN K+ ++GLG MNLHG+LA   I+Y S EA++FTN +FY + YHA + SN  A E    F  F  +KYA+G +F KYT+     W PK++R+  L     + +PT ++W  L   + K+GL N +L A+ PTGSISY++  T S+ P+VS IEIRKEGK+GRVY PA  +   N  YY + AYEIG   IID  +AA +HVDQ +S+TLF  ++ATTRD+NKA IYA+ K   ++YY+RIRQ  LK +E LF C +C
  S:     3 KIDYHALNAMLNLYDKNGLLQIEKDVFAINSYYEQHVLPNKKKFSSLEDRITYLLKEEYYESNVFENYKKDFIKNIFFQSKKQGFKFKTFMGAIKFYSSYALKTFDNKYYLEDFEDRACMVALTLGGGNEKFAINIMQEILSGRFQPATPTFLNCGKKQRGEYVSCFLLRIEDNMESIGRALNSALQLSKRGGGVSFLLTNLRESGAPIKCIKNQSSGIVPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILNFLDTKRENADEKIRIKTLSLGVIIPDITFKLAKENQNMCLFSPYDIKKVYNKPFSELIISKIYYKLINDIRIKKISINARSFFQKLAEVQFESGYPYIMFEDTVNKENP-IYGKINMSNLCSEILQVNTASEYNEDLSYKKIGRDISCNLGSLNIAKTM-DSSNLGKTVEVAIRCLTAVSDITKINSVSSVVKGNKKSHSIGLGQMNLHGYLARENIFYGSPEAIEFTNFYFYVITYHAIRTSNLLAIERKKTFSGFSRSKYANGKFFKKYTK---KTWIPKSDRILNLFNNNNIHLPTLKEWKILENSVMKYGLYNQNLQAIPPTGSISYINYSTSSIHPVVSRIEIRKEGKIGRVYYPAPYMTNKNLCYY-QDAYEIGPKKIIDTYAAATKHVDQGLSLTLFFRDDATTRDINKAQIYAWKKGIKTLYYVRIRQLTLKGTE-LFGCVSC 702
>gi|86148041|ref|ZP_01066343.1| ribonucleotide-diphosphate reductase alpha subunit [Vibrio sp. MED222] >gi|85834174|gb|EAQ52330.1| ribonucleotide-diphosphate reductase alpha subunit [Vibrio sp. MED222] (693 aa)
Score = 1929, Expect = 0.0e+00, Identities = 361/697 (51%), Positives = 503/697 (72%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           + L DE G  QFE D  A  ++    +  N   F+++ EK++YL  E YY+  V ++Y  SFL  I+  A    FRF +F+GA KF+T+YALK+ D K Y E FEDR+V  ALL  RG+ + AL  ++E++  R+Q ATPTF+N+GKK RGE +SC+LLR+EDNMESIGRA  + LQLS+RGGGVA  LTNLRE GAPIKGI NQ++G++PVMK+LED FSYANQLG RQGAGAVYLN  HPDI++FLD+KRENADEKIRIK+LSLGVV+PDI   LA++NKDM LFSP+D++R YG P S+IS+TE+Y  ++++P I K  +SAR LFQ +AE+QFESGYP+I+F+D  N+ N  +  R+ MSNLC+EI Q+N  S  + DL Y  +G D+ CNLGS+NIAK + DG    +TV  AI+AL++++ ++ ++S P+I  GN ++ A+GLG MNLHGFLA  +I+YDS EA+DFT+ +F  + YH   ASN+ A+E    F+ F+++ Y+DGS+FDKY Q +   ++PK + V++L     + IPT  +W +L + +   GL N +L A+ PTGSISY++  T S+ P+ + +EIRKEGK+GRVY PA  ++ +N  Y+ + A+ IG   IID+ +AA +HVDQ +S+TLF  +  TTRD+NKA IYA+ KK  ++YYIR+RQ+ L+ ++ +  C +C
  S:     2 LNLLDEQGTIQFEADKQAARQFFLQHVNQNTVFFHNLDEKIDYLLREGYYEAQVIEQYDRSFLHQIWANAYQAKFRFRTFLGAYKFFTSYALKTRDGKRYLERFEDRVVMTALLLARGDCEFALALMEEIIHQRFQPATPTFINSGKKSRGELISCFLLRIEDNMESIGRAINSSLQLSRRGGGVALLLTNLREQGAPIKGILNQSSGVVPVMKLLEDSFSYANQLGSRQGAGAVYLNVHHPDIMQFLDTKRENADEKIRIKTLSLGVVIPDITLELAKQNKDMYLFSPHDVERVYGVPFSEISVTEKYHEMVDDPRIRKGKMSARGLFQTLAEIQFESGYPYIMFEDTVNQAN-PIQGRVNMSNLCSEILQVNEASNYDDDLNYSHIGRDISCNLGSINIAKAL-DGGRLSQTVDTAIRALNAVSEMSAINSVPSIRKGNDESHAIGLGQMNLHGFLARERIHYDSPEAIDFTSSYFACVLYHCLAASNKLAQEKKSTFKGFEDSSYSDGSFFDKYLQQD---FSPKLDVVQDLFSRLDIRIPTVSEWSELKQLVMSSGLYNRYLQAIPPTGSISYINDSTASIHPVTAKVEIRKEGKIGRVYFPAPYLNNSNLEYF-RDAFSIGPKAIIDVYAAATEHVDQGLSLTLFFDDEVTTRDINKAQIYAWTKKIKTLYYIRMRQKALEGTQ-VEGCVSC 691
>gi|183601892|ref|ZP_02963261.1| ribonucleotide-diphosphate reductase subunit alpha [Bifidobacterium animalis subsp. lactis HN019] >gi|183218777|gb|EDT89419.1| ribonucleotide-diphosphate reductase subunit alpha [Bifidobacterium animalis subsp. lactis HN019] (698 aa)
Score = 1906, Expect = 0.0e+00, Identities = 366/699 (52%), Positives = 486/699 (69%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYA----DGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           + L+DE+GN QF+ D  AV+ +L   + P   +F S +E+L YL   +YY+++VF KYS  FL + +  A     RF +F+GA KFY +YALK+FD + Y E F  R    +L    G+E  A+  LDE++ GR+Q ATPTFLN GK QRGE VSC+L+R+EDNMESI R     LQLSKRGGGVA  L+NLRE GAPIK I+NQ++G++PVMK+LED FSYANQLG RQGAGAVYL+A HPDILKFLD+KRENADEKIRIKSL+LGVV+PDI F LA+  + MALFSPYD++R YG P +D+++T +YE +L +  I K +I AR+ F  +AE+QFESGYP++LF+D AN  N  ++ RI MSNLC+EI Q+  PS    DL+Y  +G DV CNLGSLNIA+ M+ G      V+ AI+AL +++    + + P+I   N +  A+GLG MNLHGFLA   I Y S EA+DFTNM+F T+A+HAY+AS+  A E G  F  F ++ YA    DG+YFDKY     +   P+T  V+ L + + + IPT +DW +L  +I + G+ N +L AV PTGSISY++  T S+ PI S IEIRKEGK+GR+Y PA  +  +N   Y   AYEIG   I+D  + A  HVDQ +S+TLF  +  TTRDLNKA IYA+ K   ++YYIRIRQ+ L+ +E +  C +C++
  S:     2 LNLYDEDGNIQFDKDHEAVDAFLAEHVAPRMIRFESTRERLRYLVDHHYYEYDVFSKYSPEFLDAFYAHADALPHRFETFLGAFKFYRSYALKTFDGEHYLEDFPQRAAAVSLALADGDEPMAMRTLDEIVLGRFQPATPTFLNLGKAQRGEPVSCFLVRIEDNMESISRGINAALQLSKRGGGVALLLSNLREEGAPIKHIENQSSGVVPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDILKFLDTKRENADEKIRIKSLALGVVIPDITFELAKRREKMALFSPYDVERVYGVPFADVNVTAKYEEMLADDRIRKTFIDAREFFTTLAEIQFESGYPYLLFEDTANAAN-PIDGRITMSNLCSEILQVQEPSTYYEDLSYAHVGRDVSCNLGSLNIARAMDAG--LAGPVETAIRALTAVSQHTHIGAVPSIARANEEGHAIGLGQMNLHGFLAREGIRYGSPEALDFTNMYFETVAFHAYRASHALAVENGHAFARFADSAYARQPSDGNYFDKYLDGSLDT-EPRTGTVRALFERFGVRIPTARDWRELQGEILRDGIYNQYLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRMYYPAPYMTNDNLDLY-DDAYEIGWKAIVDTYAEATPHVDQGLSLTLFFPDTVTTRDLNKAQIYAWRKGIKTLYYIRIRQQALEGTE-VAGCVSCML 698
>gi|169173928|ref|ZP_02835872.1| ribonucleoside-diphosphate reductase, alpha subunit [Arthrobacter chlorophenolicus A6] >gi|169018168|gb|EDS64644.1| ribonucleoside-diphosphate reductase, alpha subunit [Arthrobacter chlorophenolicus A6] (726 aa)
Score = 1890, Expect = 0.0e+00, Identities = 363/704 (51%), Positives = 499/704 (70%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYE--QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           Y  LNA + L+  +G  QF  D  A  +Y +  +  N   F+ + EKL+YL    YY+  + ++Y   F+ S+F++A    FRF +F+GA KFYT+Y LK+FD K + E +EDR+   AL    G++  A   +DE++ GR+Q ATPTFLN+GK QRGE VSC+LLR+EDNMESI RA  + LQLSKRGGGVA+ LTN+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++++DM LFSPYD+++ YG P SDI++TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  +  +IIMSNLC+EI Q++TP+  N +L YE   +G+D+ CNLGS+NIAK M DG + G TV+ AI+AL +++  +++++  ++  GN  + A+GLG MNLHGFLA   +YY S E++DF   +   +A+HA +ASN  AKE G  F+ F+ +KYA G +FDKY       W P TER +EL  ++ + +PT  DW +L   + + G+ N +L AV PTGSISY+++ T S+ PI + IEIRKEGK+GR Y PA  +   N  YY + AYEIG   I+D+ +AA +HVDQ +S+TLF  + ATTRD+NKA IYA+ K   +IYYIR+RQ  L+ +E +  C +C
  S:    26 YHELNAMLNLYGADGKMQFGADREAARQYFKQHVNMNTVFFHDLAEKLDYLVENRYYEPELLEQYGFEFVKSLFQRAYKKKFRFETFLGAFKFYTSYTLKTFDGKRFLERYEDRVTMVALGLAAGDKALAEKLVDEIIDGRFQPATPTFLNSGKAQRGELVSCFLLRIEDNMESISRAINSALQLSKRGGGVAFALTNVRETGAPIKQIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKDEDMYLFSPYDVEKVYGMPFSDINVTEKYYEMVDDARIKKTKIKAREFFQTLAEIQFESGYPYIMFEDTVNRAN-PIEGKIIMSNLCSEILQVSTPTTYNENLNYEVDGIGKDISCNLGSMNIAKAM-DGGDLGATVEIAIRALTAVSDQSNITAVESVARGNRMSHAIGLGQMNLHGFLAREHVYYGSPESIDFFGKYMAAVAFHAIRASNLIAKERGVTFDGFERSKYASGEFFDKYVT---RSWLPTTERGQELFAKFGITLPTIADWEELKASVMEHGIYNQNLQAVPPTGSISYINNSTASIHPIAAKIEIRKEGKIGRTYFPAPYLTNENLEYY-QDAYEIGYEKIVDMYAAATEHVDQGLSLTLFFKDTATTRDINKAQIYAWKKGIKTIYYIRLRQMALEGTE-VTGCVSC 724
>gi|82778047|ref|YP_404396.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Shigella dysenteriae Sd197] >gi|81242195|gb|ABB62905.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Shigella dysenteriae Sd197] (616 aa)
Score = 1823, Expect = 0.0e+00, Identities = 334/614 (54%), Positives = 447/614 (72%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPA 633
           Y +LNA + L+D  G  QF+ D  AV+ ++ T ++PN   F+S +++L +L  E YYD +V  +YS +F+I++F  A T  FRF +F+GA KFYT+Y LK+FD K Y E F DR+   AL   +G+E  AL   DEM++GR+Q ATPTF N GK+QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK LSLGVV+PDI FHLA+EN  MALFSPYD++R YGKP +D++I++ Y+ L+ +  I KKY++AR  FQ++ E+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y   G D+ CNLGSLNIA  M D  +F +TV+ A++ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S EA+DFTN++FY + +HA + S   A+E G  F  FK ++YA G YF +Y Q     W PKT +V EL     + +PT + W QL +D+ ++G+ N +L AV PTGSISY++  T S+ PIV+ +EIRKEGK GRVY PA
  S:     3 YHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRNFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFPNCGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKILSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLVEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASEYDENLDYTCTGHDISCNLGSLNIAHTM-DSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQ---GNWQPKTAKVGELFTRSGITLPTHEMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPA 611
>gi|54026278|ref|YP_120520.1| ribonucleotide-diphosphate reductase alpha subunit [Nocardia farcinica IFM 10152] >gi|54017786|dbj|BAD59156.1| putative ribonucleoside-diphosphate reductase alpha subunit [Nocardia farcinica IFM 10152] (1102 aa)
Score = 1667, Expect = 0.0e+00, Identities = 312/550 (56%), Positives = 412/550 (74%)
  Q:   176 RGEYV-SCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           RG  V +C+LLR+EDNMESIGR+  + LQLSKRGGGVA  L+N+RE GAPIK I+NQ++G+IP+MK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA++N+DM LFSPYD++R YGKP +DI +TE+Y  ++++  I K  I AR+ FQ IAE+QFESGYP+I+F+D  N  N  +  +I  SNLC+EI Q++TPS  N DL+Y ++G+D+ CNLGSLNIAK M D  +F +T++ AI+AL +++    ++S P+IE GN ++ A+GLG MNLHG+LA  +I+Y S+E +DFTNM+FYT+ YHA +ASN  A E G  F  F  +KYA G YFDKYT   E  W PKTERV++L  +  + IPT+ DW +L   + + G+ N +L AV PTGSISY++  T S+ P+ S IEIRKEGK+GRVY PA  +  +N  YY + AYEIG   IID  +AA QHVDQ +S+TLF  + ATTRDLNKA IYA+ K   ++YYIR+RQ  L+ +E +  C +C++
  S:   559 RGAVVHNCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNIREHGAPIKKIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYDVERIYGKPFADIDVTEKYYEMVDDKRIRKSKIKAREFFQTIAELQFESGYPYIMFEDTVNRAN-PIAGKITHSNLCSEILQVSTPSEFNDDLSYAKVGKDISCNLGSLNIAKAM-DSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQGNQQSHAIGLGQMNLHGYLARERIHYGSDEGIDFTNMYFYTVVYHALRASNRLAIERGTYFGGFPESKYASGEYFDKYT---EQVWEPKTERVRQLFADAGVRIPTQDDWRELKASVMEHGIYNQNLQAVPPTGSISYINHSTSSIHPVASKIEIRKEGKIGRVYYPAPYMTNDNLEYY-QDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDLNKAQIYAWRKGIKTLYYIRLRQMALEGTE-VEGCVSCML 1102
Score = 397, Expect = 3.2e-36, Identities = 73/157 (46%), Positives = 104/157 (66%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCY 183
           + L+  +G  QF+ D  A  +Y    +  N   F+++ EKL+YL  ENYY+  V  +YS +F+ S+F++A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR+   AL    G+E+ A   +DE++ GR+Q ATPTFLN+GKKQRGE VSC+
  S:     2 LNLYGPDGKIQFDKDREAARQYFLQHVNQNTVFFHNLDEKLDYLVEENYYEPEVLDRYSRAFVKSLFQQAYDKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVCMVALTLAAGDEELARKLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCF 158
>gi|66880108|ref|ZP_00405093.1| COG0209: Ribonucleotide reductase, alpha subunit [Mycoplasma genitalium G-37] (543 aa)
Score = 1664, Expect = 0.0e+00, Identities = 325/536 (60%), Positives = 415/536 (77%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYW 551
           D +SYIS NA  K++D+     F  DL AVE Y++  +KP  K F+S KE+L++L   +YYD  +   YS      I  KA +Y FR+++FMGA KFY  YALK+FD K Y E++EDR+V N L+   GN   AL  L +++  R+Q ATPTFLNAG+K+RGE+VSCYLLR+EDNMESIGRA TT LQLSKR GGVA  L+NLRE GAPIK I+NQ++GIIP+MK+LED FSY+NQLGQRQGAGAVYL+  HPD+++FLD+KRENADEKIRIKSLSLG+V+PDI F LA+ N+ MALFSPYDI +EYGK +SDIS+TE Y  LL N  I K +ISARK FQ IAE+ FESGYP+ILFDD  N +N A  NRI+MSNLC+EI Q + PS   +DLT++++G D+ CNLGSLNIA+ ME G+   + ++ AI++LD ++ ++ L +AP+I+ GNS+N A+GLGAMNLHGFLATN IYYDS+EAVDFTN+FFYT+AYHA+ ASN+ A E G  F++F+NTK+ADGSYFDKYT+   ++W
  S:    15 DVESYISFNAQAKIYDD-----FAIDLQAVESYIQEHVKPKTKVFHSTKERLDFLIKNDYYDEKIINMYSFEQFEEITHKAYSYRFRYANFMGAFKFYNAYALKTFDGKYYLENYEDRVVMNVLMLANGNFNKALKLLKQIILNRFQPATPTFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSKRDGGVALLLSNLREAGAPIKKIENQSSGIIPIMKLLEDSFSYSNQLGQRQGAGAVYLHCHHPDVMQFLDTKRENADEKIRIKSLSLGLVIPDITFQLAKNNEMMALFSPYDIYQEYGKALSDISVTEMYYELLENQRIKKTFISARKFFQTIAELHFESGYPYILFDDTVNRRN-AHKNRIVMSNLCSEIVQPSLPSEFYSDLTFKKVGSDISCNLGSLNIARAMESGSELAELIQLAIESLDLVSRISSLETAPSIKKGNSENHALGLGAMNLHGFLATNAIYYDSKEAVDFTNIFFYTVAYHAFSASNKLALELG-KFKDFENTKFADGSYFDKYTKVASDFW 543
>gi|90962207|ref|YP_536123.1| ribonucleotide-diphosphate reductase subunit alpha [Lactobacillus salivarius UCC118] >gi|90821401|gb|ABE00040.1| Ribonucleoside-diphosphate reductase alpha chain [Lactobacillus salivarius UCC118] (723 aa)
Score = 1660, Expect = 0.0e+00, Identities = 350/714 (49%), Positives = 480/714 (67%)
  Q:    12 NIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +I + K +Y  LN  I +   NG  Q   D  A+E +L   +KPN K+F+SIKE++ YL   NYY+     KYS  F+  +++  K  +F F +FM A KFY  YALK+ DN  Y E+F DR+  NAL FG G+E+ AL   DE++  RYQ ATP+FLNAG+K+RGE VSC+L+++ D+M SIGR   + LQLS+ GGGV   L+NLR  GAPIKGI   A+G++PVMK+LED F+Y+NQLGQRQGAGAVYLN FHPDI  FL +K+ENADEKIR+K+LSLG+VVPD  + L  +N+DM LF P+ ++R Y KP S + IT+EY+N++ NPNI KK I AR L +QI+++Q ESGYP+++  D AN  N  ++ +I+MSNLC+EI Q+   S++N    YE LG D+ CNLGS NI  +M    NFGK+V+   +AL  +   +D+   P+I++GN     +GLGAM LH +LA N+I Y S EA++FT+++F  + Y    ASN+ AKE    F+NF+N+KYADG YFD Y   E   + PK  RVKEL     + IPTK DW  L E++ K+GL + + +AVAP GSISY++  T SL PI++ IE R+E K+G++Y PA  +  N  + Y K AY+  +  +ID  +AAQQHVDQ +S+TLF+               T+  TTRDL+    YA  K   SIYY+R   +   D+ ++   EC +C I
  S:     5 DIDISKVTYFDLNNEINI-PVNGQIQLGKDEEALEAFLNENVKPNTKQFSSIKERINYLIQNNYYEEEFISKYSFEFIEKLYDYLKKEDFHFKTFMAAYKFYAQYALKTDDNAYYLENFIDRVATNALYFGDGDEKLALELADELIHQRYQPATPSFLNAGRKRRGELVSCFLIQMTDDMNSIGRNINSALQLSRIGGGVGINLSNLRGAGAPIKGIHGAASGVVPVMKLLEDSFTYSNQLGQRQGAGAVYLNVFHPDIEAFLSAKKENADEKIRVKTLSLGLVVPDKYYELVAKNEDMYLFDPWGVERVYHKPFSYVDITKEYDNMVANPNIPKKVIKARDLEEQISKLQQESGYPYVINIDTANRVNP-ISGKIVMSNLCSEILQVQRASVINNRQEYEVLGTDISCNLGSTNIVNLMAS-PNFGKSVEVMTRALTFVTDKSDIDVVPSIQHGNRLAHTIGLGAMGLHAYLAKNQIEYGSPEALEFTSVYFMLLNYWTLVASNKIAKERKVTFDNFENSKYADGRYFDTYLNQE---FAPKNARVKELFD--GIFIPTKSDWTSLKENVMKYGLYHQNRLAVAPNGSISYINDTTASLHPIINRIEERQERKIGKIYYPAPYLS-NETLPYYKSAYDTDMRKVIDTYAAAQQHVDQGMSLTLFMRSTIPAGLYEWKNGRTDKMTTRDLSILRNYAHYKGVKSIYYVRTFTD---DASEVGANECESCSI 723
>gi|29375102|ref|NP_814255.1| ribonucleotide-diphosphate reductase subunit alpha [Enterococcus faecalis V583] >gi|29342561|gb|AAO80326.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Enterococcus faecalis V583] (719 aa)
Score = 1659, Expect = 0.0e+00, Identities = 346/707 (48%), Positives = 479/707 (67%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     +G      D  A+  + +  ++PN +KF+S +EK+ +L  E++ +    +KYS  F+  ++      +F+F SFM A KFY+ YALK+     Y E +EDR+  NAL F  G+E+ ALT  DEM+  RYQ ATP+FLNAG+K+RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI  FL +K+ENADEKIR+K+LSLGV+VPD  + L R N+DM LFSPY ++REYG P S + IT+EY+NL+ NPNI K+ I AR L  +I+++Q ESGYP+I+  D AN KN+ ++ +IIMSNLC+EI Q+ TPS++N    YE LG D+ CNLGS NI  +ME   +FGK+V+   +AL  +   +++   PTI+NGN  +  +GLGAM LH F A N + Y SEE++DFT+++F  + Y     SN+ AKE   VF NF+ + YA G+YFDKY    E  +TPK ++VKE+ K+  + IPT +DW  L + +KK GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +  N+ + Y   AY++ +  +ID+ + AQQHVDQ +S+TLF+             T   TTRDLN    YAFNK   SIYYIR   +   D+E++   +C +CVI
  S:    10 SYFKLNNEINR-PVDGQIPLNKDKEALAAFFKENVEPNTRKFSSAEEKINFLMKEDFIETEFIEKYSMDFIEKLYAFLDEQHFQFKSFMAAYKFYSQYALKNNAGTEYLETYEDRVAFNALYFADGDEELALTLADEMIHQRYQPATPSFLNAGRKRRGELVSCFLVQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYDGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIEMFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRNNEDMYLFSPYSVEREYGVPYSYVDITKEYDNLVANPNIRKRKIKARDLENEISKLQQESGYPYIINIDTAN-KNNPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMES-PDFGKSVRAMTRALTFVTDASEIDVVPTIQNGNRLSHTIGLGAMGLHTFFAKNHMEYGSEESLDFTDIYFMLLNYWTLMESNQIAKERNQVFHNFEKSDYASGAYFDKYI---EGNFTPKFDKVKEIFKD--IQIPTAEDWAALRDAVKKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYL-ANDTIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGLYEWKETPKQTTRDLNILRHYAFNKGIKSIYYIRTFTD---DAEEIGSNQCESCVI 719
>gi|116493226|ref|YP_804961.1| ribonucleotide-diphosphate reductase subunit alpha [Pediococcus pentosaceus ATCC 25745] >gi|116103376|gb|ABJ68519.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Pediococcus pentosaceus ATCC 25745] (721 aa)
Score = 1656, Expect = 0.0e+00, Identities = 342/707 (48%), Positives = 484/707 (68%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE-KLFECTTCVI 725
           +Y  LN  I +  +N       D  A+  +L+  ++ N  +F+S++E+ +YL  E+Y +  + ++YS  F+  +++  K  +F F SFM A KFY  YALK+ +N+ Y E+F DR+  NAL F  GNE+ A+   DE++  RYQ ATP+FLNAG+K RGE VSC+L++  D+M SIGR   + LQLSK GGGV   LTNLRE GAPIKGI+  A+G++PVMK+LED FSYANQLGQRQGAG VYLN FHPDI+ FL +K+ENADEKIR+K+LSLGVVVPD  + L + ++DM LFSPY +++ YG+P + + IT+EY+N++ NP I K  + AR +  +I+++Q ESGYP+I+  D AN +N  +  +I+MSNLC+EI Q+ TPS+++    Y +LG D+ CNLGS NI  +M+   +FGK+V+  ++AL  +   +D+   P+I+NGN+    +GLGAM LHG+LA N +YY   ++++FT+++F  + Y   KASN+ AKE   VF NF  +KYADGSYFDKY    EN + PK+ RVKEL     + IP+ +DW QL  D+   GL + + MAVAPTGSISY++  T SLQPIV+ IE R+E K+G++Y PA  +  N+ + Y + AY+I +  +IDI +AAQQHVDQ +SMT F+               T+  TTRDLN    YA ++   SIYY+R   +   D E  + +C +C I
  S:    10 TYYDLNNEINIPVDN-QIPLSKDREALAAFLKENVQANTMQFDSLRERFDYLLKEDYIEAALVEEYSFDFIEKLYDFLKQQDFHFQSFMAAYKFYAQYALKTNNNEYYLENFIDRVAMNALYFADGNEELAMNIADEIIHQRYQPATPSFLNAGRKHRGELVSCFLIQANDDMNSIGRTINSALQLSKLGGGVGINLTNLREAGAPIKGIEGAASGVVPVMKLLEDSFSYANQLGQRQGAGVVYLNVFHPDIVSFLSAKKENADEKIRVKTLSLGVVVPDKFYDLIKHDEDMYLFSPYSVEKVYGEPYAYVDITKEYDNMVKNPAIKKFKVKARNIENEISKLQQESGYPYIVNVDTANRENP-IYGKIVMSNLCSEIMQVQTPSVIDNKQNYTKLGTDISCNLGSTNIVNMMQT-PHFGKSVETMVRALTFVTDHSDIDVVPSIQNGNALAHTIGLGAMGLHGYLAKNHLYYGEADSIEFTSVYFMLLNYWTLKASNQIAKEKNQVFHNFDKSKYADGSYFDKYV---ENDFGPKSNRVKELFN--GIEIPSVEDWKQLKADVMADGLYHQNRMAVAPTGSISYINDATASLQPIVNKIEERQEKKIGKIYFPAPYLS-NDTLKYYQSAYDIDMRKVIDIYAAAQQHVDQGMSMTFFMRSTIPAGIYDWKEGRTDKMTTRDLNILRNYAHHEGIKSIYYVRTFTD--NDGEVGVNQCESCSI 721
>gi|184154756|ref|YP_001843096.1| ribonucleoside-diphosphate reductase alpha subunit [Lactobacillus fermentum IFO 3956] >gi|183226100|dbj|BAG26616.1| ribonucleoside-diphosphate reductase alpha subunit [Lactobacillus fermentum IFO 3956] (723 aa)
Score = 1649, Expect = 0.0e+00, Identities = 342/715 (47%), Positives = 481/715 (67%)
  Q:    11 NNIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           + I + K  Y  LN  I +  ++G  Q   D  A++ +++  ++PN KKF+S+ E+L +L   +Y + +  ++Y+ +FL  +++  K  +F F SFM A KFY  YA+++ D + Y E++ DR+  NAL    G+EQ A+   DE++  RYQ ATPTFLN G+K+RGE+VSC+ ++  D+M +IGR   + LQLSK GGGV   L NLRE GAPIK IK  A+G++PVMK+LED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLGV VPD  + L  E+  M LFSPYD++R YGKP S + IT+EY+NL+ NP ITKK ++AR+L  +I+++Q ESGYP+I+  D  N+ N  +   I+MSNLC+EI Q+  PS +N D TYE LG DV CNLGS NIA +ME   + G++V+  ++ L  I+    L+  P+I++GN    +VGLGAM LHGFLA + I Y S  A++FT+++F  + Y    ASNE A+E G  F NF+ + YADGSYFDKY   +   W PK+  VKEL   +   IPT  DW +L + +++ GL N++ +AVAP GS SY+   T SL PI++ IE R+E  +G+VY PA  +  N+ M Y + AY+  +  +ID  +AAQ+HVDQ++SMTLF+               TE  TTRDLN    YA  K   SIYYIR   +   D+E++   +C +CVI
  S:     4 SEIDMTKVKYFDLNNEINI-PKDGQIQLNLDQEALDDFIKENVEPNTKKFSSVMERLNWLIENDYLEEDFIRQYTPAFLDRLYQYLKEQDFHFHSFMAAYKFYAQYAMRTNDKEYYLENYIDRVAMNALYLANGDEQLAMDLADELIHQRYQPATPTFLNVGRKRRGEFVSCFEIQATDDMNTIGRTINSALQLSKIGGGVGINLNNLREAGAPIKKIKGAASGVVPVMKLLEDAFSYSNQLGQRQGAGVVYLSVFHPDIIDFLGAKKENADEKVRLKTLSLGVTVPDKFYQLVEEDAPMYLFSPYDVERIYGKPFSYVDITKEYDNLVANPEITKKKVNARELEDEISKLQQESGYPYIVNVDTVNKAN-PIEGTIVMSNLCSEIAQVQIPSRVNDDQTYETLGTDVSCNLGSTNIANLMET-PDLGRSVRAMMRGLTHISDAESLTVVPSIKHGNDLFHSVGLGAMGLHGFLAKHHIMYGSPVALEFTSVYFMLLNYWTLVASNEIAQEKGENFANFERSAYADGSYFDKYLTKD---WGPKSAAVKELFAGF--FIPTPDDWQELKQRVQESGLYNAYRLAVAPNGSTSYIGDSTSSLHPIINRIEERQEKMIGKVYYPAPYLS-NDTMPYYRSAYDTDMRSVIDTYAAAQEHVDQSLSMTLFMRSTIPAGMYEWKDGRTEKMTTRDLNILRHYAHQKGIKSIYYIRTFTD---DNEEVGANQCESCVI 723
>gi|148543560|ref|YP_001270930.1| ribonucleotide-diphosphate reductase subunit alpha [Lactobacillus reuteri F275] >gi|184152967|ref|YP_001841308.1| ribonucleoside-diphosphate reductase alpha subunit [Lactobacillus reuteri F275] >gi|148530594|gb|ABQ82593.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Lactobacillus reuteri F275] >gi|183224311|dbj|BAG24828.1| ribonucleoside-diphosphate reductase alpha subunit [Lactobacillus reuteri F275] (723 aa)
Score = 1644, Expect = 0.0e+00, Identities = 335/715 (46%), Positives = 487/715 (68%)
  Q:    11 NNIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           ++I + K  Y   N  + +  +NG  Q + D LA+E +++  ++PN K+F+S+KE+ ++L   +Y +     KYS +F+  +++  K  NF F SFM A KFY  YAL++ D + Y E++ DR+  NAL    G+E+ A+   DE++  RYQ ATPTFLN G+K+RGE+VSC+ ++  D+M +IGR   + LQLSK GGGV   L+NLRE GAPIK I+  A+G++PVMK+LED FSY+NQLGQRQGAG VYL+ FHPDI++FL +K+ENADEKIR+K+LSLG+ VPD  + L  +N DM LFSPYD++R YG P S + IT+EY NL+ N +I KK ++AR L  +I+++Q ESGYP+I+  D  N  N  +N +I+MSNLC+EI Q+  P+ +N D +Y ++G D+ CNLGS NIA +ME   +FGK++K  ++ L  I+ + DL   PTI+NGN    +VGLGAM LH +LA + I Y S  A++FT ++F  + Y +  ASNE AKE    F +F+N+KYADGSYFDKY   +   W P+++ VK L +   + IP  +DW +L E++ + GL N + +AVAP GS SY++  T SL PI++ +E R+E  +G++Y PA  +  N+ M Y + AY++ +  +ID  +AAQQH+DQ++SMTLF+               T+  TTRDLN    YA+ +   SIYYIR   +   DS+++   +C +CVI
  S:     4 SDIDMTKVKYYDYNNEVNI-PKNGQIQLDKDKLALEDFIKNNVEPNTKRFSSLKERFQWLEENDYIEETFMNKYSEAFIEKLYDYLKAQNFHFHSFMAAYKFYAQYALRTNDKEYYLENYIDRVAMNALYLANGDEELAMQLADEIIHQRYQPATPTFLNVGRKRRGEFVSCFAIQTTDDMNTIGRTINSALQLSKIGGGVGINLSNLREAGAPIKKIQGAASGVVPVMKLLEDSFSYSNQLGQRQGAGVVYLSVFHPDIIEFLGAKKENADEKIRLKTLSLGITVPDKFYELVEQNADMYLFSPYDVERVYGMPFSYVDITKEYNNLVANDDIRKKKVNARDLEDEISKLQQESGYPYIINIDTENRDN-PINGKIVMSNLCSEIAQVQVPAQVNDDQSYSEMGIDISCNLGSTNIANMMES-PDFGKSIKAMMRGLTRISDVEDLDVVPTIQNGNRLAHSVGLGAMGLHSYLAKHHIQYGSPVAIEFTGVYFMLLNYWSLVASNEIAKERQETFHDFENSKYADGSYFDKYVTKD---WGPQSDVVKGLFE--GIFIPGIEDWKKLKENVMQDGLYNQYRLAVAPNGSTSYINDSTASLHPIINRVEERQEKMIGKIYYPAPYLS-NDTMPYYRSAYDMDMRKVIDTYAAAQQHIDQSLSMTLFMRSTIPAGLYEWKNGRTDKMTTRDLNILRHYAYKRGIKSIYYIRTFTD---DSDEIGANQCESCVI 723
>gi|81096917|ref|ZP_00875241.1| Ribonucleoside-diphosphate reductase [Streptococcus suis 89/1591] >gi|80977037|gb|EAP40596.1| Ribonucleoside-diphosphate reductase [Streptococcus suis 89/1591] (719 aa)
Score = 1641, Expect = 1.6e-180, Identities = 345/707 (48%), Positives = 473/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  AV+ + +  + PN K+F+SI +K+ YL  ENY +     +YS  F+I I +  K  NFRF SFM A KFY  YALK+ D   Y E  EDR++ NAL F  GNE+ AL   +EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY ++ EYG P S + ITE+Y+ L+ NP I K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+ TPS++N    Y  +G DV CNLGS NI  +M+   +FG++V+   +AL  +   + +S+ P+IE GNS+  ++GLGAM LH +LA N I Y S+ AV+FTN++F  + Y     SN  A+E    F NF+ +KYADG+YFDKY   +   + P++ERVKEL +   + IP+ QDW  L E +K  GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      +Y K AY++ +  +ID+ +AA +HVDQ +S+TLFL             EN  TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDQEAVKAFFKENVLPNTKQFDSILDKIAYLLEENYLEKEFLDQYSPEFIIKIDQFLKDQNFRFKSFMAAYKFYNQYALKTNDGAYYLESMEDRVLFNALYFAEGNEELALNLANEMIHLRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYSVELEYGVPYSYLDITEKYDELVANPRIRKTKIKARDLETEISKLQQESGYPYVINIDTANRSN-PVDGKIIMSNLCSEILQVQTPSVINDSQEYLTMGTDVSCNLGSTNIVNLMKS-PDFGRSVRTMTRALTYVTDHSHISAVPSIEAGNSQAHSIGLGAMGLHSYLAQNLIDYGSKTAVEFTNIYFMLLNYWTLVESNNIARERKATFHNFEKSKYADGTYFDKYVTGD---YQPQSERVKELFE--GIFIPSGQDWADLREKVKADGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLATETIPFY-KSAYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPKELYEWKKENKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|194468107|ref|ZP_03074093.1| ribonucleoside-diphosphate reductase, alpha subunit [Lactobacillus reuteri 100-23] >gi|194452960|gb|EDX41858.1| ribonucleoside-diphosphate reductase, alpha subunit [Lactobacillus reuteri 100-23] (723 aa)
Score = 1640, Expect = 2.2e-180, Identities = 337/715 (47%), Positives = 484/715 (67%)
  Q:    11 NNIIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           ++I + K  Y   N  + +  +NG  Q + D LA+E +++  ++PN K F+S+KE+ ++L   +Y +     KYS +F+  ++E  K  NF F SFM A KFY  YAL++ D + Y E++ DR+  NAL    G+E+ A+   DE++  RYQ ATPTFLN G+K+RGE+VSC+ L+  D+M +IGR   + LQLSK GGGV   L+NLRE GAPIK I+  A+G++PVMK+LED FSY+NQLGQRQGAG VYL+ FHPDI++FL +K+ENADEKIR+K+LSLG+ VPD  + L  +N DM LFSPYD++R YG P S + IT+EY+NL+ N +I KK ++AR L  +I+++Q ESGYP+I+  D  N  N  +N +I+MSNLC+EI Q+  P+ +N D +Y ++G D+ CNLGS NIA +ME   +FGK++K  ++ L  I+ + DL   PTI+NGN    +VGLGAM LH +LA + I Y S  A++FT ++F  + Y +  ASNE AKE    F +F+N+KYADGSYF+KY   +   W P+++ VK L +   + IP  +DW  L E + K GL N + +AVAP GS SY++  T SL PI++ +E R+E  +G++Y PA  +  N+ M Y + AY++ +  +ID  +AAQQH+DQ++SMTLF+               T+  TTRDLN    YA+ +   SIYYIR   +   DS ++   +C +CVI
  S:     4 SDIDMTKVKYYDYNNEVNI-PKNGQIQLDKDKLALEDFIKNNVEPNTKNFSSLKERFQWLEENDYIEEGFMNKYSEAFIEKLYEYLKAQNFHFHSFMAAYKFYAQYALRTNDKEYYLENYIDRVAMNALYLANGDEELAMQLADEIIHQRYQPATPTFLNVGRKRRGEFVSCFALQTTDDMNTIGRTINSALQLSKIGGGVGINLSNLREAGAPIKKIQGAASGVVPVMKLLEDSFSYSNQLGQRQGAGVVYLSVFHPDIIEFLGAKKENADEKIRLKTLSLGITVPDKFYELVEQNADMYLFSPYDVERVYGMPFSYVDITKEYDNLVANDDIRKKKVNARDLEDEISKLQQESGYPYIINIDTENRDN-PINGKIVMSNLCSEIAQVQVPARVNDDQSYSEMGIDISCNLGSTNIANMMES-PDFGKSIKAMMRGLTRISDVEDLDVVPTIQNGNRLAHSVGLGAMGLHSYLAKHHIQYGSPVAIEFTGVYFMLLNYWSLVASNEIAKERQETFHDFENSKYADGSYFEKYVTKD---WGPQSDVVKGLFE--GIFIPGIEDWKNLKEKVMKDGLYNQYRLAVAPNGSTSYINDSTASLHPIINRVEERQEKMIGKIYYPAPYLS-NDTMPYYRSAYDMDMRKVIDTYAAAQQHIDQSLSMTLFMRSTIPAGLYEWKNGRTDKMTTRDLNILRHYAYKRGIKSIYYIRTFTD---DSGEIGANQCESCVI 723
>gi|81428552|ref|YP_395552.1| ribonucleotide-diphosphate reductase subunit alpha [Lactobacillus sakei subsp. sakei 23K] >gi|78610194|emb|CAI55243.1| Ribonucleoside-diphosphate reductase, alpha chain [Lactobacillus sakei subsp. sakei 23K] (723 aa)
Score = 1636, Expect = 6.3e-180, Identities = 340/707 (48%), Positives = 467/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +Y  LN  I +   NG    + D  A+E +LE  ++PN   F S++++L Y+  ENYY+ +  K YS  F+  + +     +F F SFM A KFY  YALK+ DN  Y E F+DR+  NAL F  G+E  A++  DEM+  RYQ ATPTFLNAG+ +RGE VSC+LL+  D+M SIGR   + LQLS+ GGGV   L+NLR  G PIKGI   A+G++PVMK+LED FSY+NQLGQRQGAG VYLN FHPD++ FL +K+ENADEK R+K+LSLG+ VPD  + L +E+ DM LFSPY ++REYG+P S I IT EY+NL+ N  I K  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+E+ Q+ TPS +N    Y+ LG D+ CNLGS NI  +M    +FG +++  +++L  +   +D+   P++ +GN     +GLG M LH + A N++ Y SEE++DFT+ +F  + Y    ASN+ AKE G  F+NF+N+KYADGSYFD+Y   E   W PKT +VK L     + IPT+ DW  L E I + GL + + +AVAP GSISY++  + SLQPIV+ +E R+E K+G +Y PA  +  N  M Y + AY+I +  +IDI +AAQ+HVDQ +SMTLF+               T+  TTRDLN    YA +K   SIYYIR   +  ++      C +CVI
  S:    12 TYYELNNQINI-PVNGQIPLQKDQEALEAFLEQNVQPNMVTFKSLQDRLNYMVAENYYEADFLKAYSIDFMERLNQYLIDQDFHFKSFMAAYKFYAQYALKTNDNGFYLEDFKDRVFTNALYFADGDEALAMSVADEMIHQRYQPATPTFLNAGRSRRGELVSCFLLQTTDDMNSIGRTINSALQLSRIGGGVGISLSNLRGAGDPIKGIDGAASGVLPVMKLLEDSFSYSNQLGQRQGAGVVYLNVFHPDVVAFLGAKKENADEKYRLKTLSLGLTVPDKYYELVKEDADMYLFSPYSVEREYGQPFSYIDITAEYDNLVANEAIKKTKIKARDLENEISKLQQESGYPYIVNIDTANKAN-PIDGKIIMSNLCSEVLQVQTPSQINNRQEYDVLGTDISCNLGSTNIPNMMTS-PDFGHSIETMVRSLTYVTDHSDIDVVPSVAHGNQLAHTIGLGGMGLHTYFAKNQMMYGSEESIDFTSNYFMLLNYWTLVASNKIAKERGITFDNFENSKYADGSYFDQYLNTE---WAPKTAKVKGLFD--GVFIPTQADWAALKEAIMQDGLYHQNRLAVAPNGSISYINDTSASLQPIVNRVEDRQEKKIGTIYYPAPGLS-NETMPYYESAYDIDMRKVIDIYAAAQKHVDQGMSMTLFMRSTIPAGLYDWKDGRTDKMTTRDLNILRNYAHHKSIKSIYYIRTYTDD-ENEVGANACESCVI 723
>gi|116494954|ref|YP_806688.1| ribonucleotide-diphosphate reductase subunit alpha [Lactobacillus casei ATCC 334] >gi|116105104|gb|ABJ70246.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Lactobacillus casei ATCC 334] (723 aa)
Score = 1634, Expect = 1.1e-179, Identities = 345/710 (48%), Positives = 477/710 (67%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE--CTTCVI 725
           D+ +Y +LN  I +   N       D  A++ +L   + PN  +F+S+ ++L+YL   +YY+ +   KY  +FL  + +     +F+F SFM A K+Y  YALK+ D   Y E F+DR+  NAL F  GNE  A+   DEM+  RYQ ATP+FLNAG+ +RGE VSC+LL++ D+M SIGRA  + L+LS+ GGGV   L+NLRE GAPIKGI+  A+G++PVMK+LED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK R+K+LSLGVVVPD  + L + N DM LFSPY ++R YGKP S + IT+EY+N++ NP I K  I AR L  +I+++Q ESGYP+I+  D AN  N  +  +IIMSNLC+EI Q+  PS LN    YE LG DV CNLGS NI  +M    +FG++V+  ++AL  +   +++   P++++GN +  ++GLGAM LH + A N ++Y S E++DFTN++F  + Y+  KASN+ A+E G  F NF+N+KYADGSYFDKYT   E  W PK ++V+ L     + IPT+ DW  L   + K GL + + MAVAP GSISY++  + SLQPIV+ IE R+E K+G +Y PA  +  N+ M Y + AY+I +  +ID+ +AAQQHVDQ ++MTLF+               T+  TTRDLN    YA +K   SIYYIR   +   D E++    C +C I
  S:     9 DQVTYYALNNEINI-PVNDQIPLNKDKEALQAFLTENVAPNTMQFDSLADRLKYLVDNHYYEADFLNKYQPAFLEKLDQFLSAQHFQFKSFMAAYKYYAQYALKTDDGTQYLEDFKDRVFANALFFADGNEDLAVDLADEMIHQRYQPATPSFLNAGRARRGELVSCFLLQITDDMNSIGRAINSALELSRIGGGVGLTLSNLREAGAPIKGIEGAASGVLPVMKLLEDSFSYSNQLGQRQGAGVVYLNVFHPDIISFLGAKKENADEKYRVKTLSLGVVVPDKYYDLIKANADMYLFSPYSVERVYGKPFSYVDITKEYDNMVANPAIKKYKIKARDLENEISKLQQESGYPYIINIDTANRAN-PIEGKIIMSNLCSEIMQVQVPSKLNNKQEYEVLGTDVSCNLGSTNIPNLMHS-RDFGRSVEAMVRALTYVTDHSNIDVVPSVQHGNHQAHSIGLGAMGLHTYFAKNHMFYGSPESLDFTNIYFLLLNYYTLKASNKIAQERGESFHNFENSKYADGSYFDKYT---EQVWAPKYDKVRALFD--GIHIPTQADWEALKTSVMKDGLYHQNRMAVAPNGSISYINDTSASLQPIVNRIEDRQEKKIGTIYYPAPDLS-NDTMPYYQSAYDIDMRKVIDVYAAAQQHVDQGMAMTLFMRSTIPAGLYPWKDGRTDKMTTRDLNILRNYAHHKGIKSIYYIRTYTD---DQEEIGSNACESCSI 723
>gi|69245953|ref|ZP_00603725.1| Ribonucleoside-diphosphate reductase [Enterococcus faecium DO] >gi|68195483|gb|EAN09927.1| Ribonucleoside-diphosphate reductase [Enterococcus faecium DO] (719 aa)
Score = 1634, Expect = 1.2e-179, Identities = 341/707 (48%), Positives = 471/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A+  + E  +KPN   F SI EK+ YL  + Y +    + YS SF+  +++     +F F SFM A KFY+ YALK+ D   Y E +EDR+  NAL F  G+E+ AL   DEM+  RYQ ATP+FLNAG+K+RGE VSC+L +V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEKIR+K+LSLGV+VPD  + L R+N+DM LFSPY +++EYG P S ++IT EY++L+ NPNI K+ I AR L  +I+++Q ESGYP+++  D AN +N  ++ +IIMSNLC+EI Q+ TPS++N    YE LG D+ CNLGS NI  +M+   NFG++V+   +AL  I   +D+   P I+NGN  N  +GLGAM LH +LA  ++ Y SE+++DFTN++F  + Y     SN  A+E   VF NF+ + YADG+YF+KY   E   + PK+E+VK L +   + IPT +DW  L + + K GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ + AQQHVDQ +S+TLF+             T   TTRDLN    YAF+K   SIYY+R   +   D+E++   +C +CVI
  S:    10 SYFKLNNEINR-PVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENP-IDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQS-PNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGE---FQPKSEKVKALFE--GIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTS-AYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTD---DAEEIGSNQCESCVI 719
>gi|146318861|ref|YP_001198573.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus suis 05ZYH33] >gi|146321069|ref|YP_001200780.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus suis 98HAH33] >gi|145689667|gb|ABP90173.1| Ribonucleotide reductase, alpha subunit [Streptococcus suis 05ZYH33] >gi|145691875|gb|ABP92380.1| Ribonucleotide reductase, alpha subunit [Streptococcus suis 98HAH33] (719 aa)
Score = 1632, Expect = 1.8e-179, Identities = 344/707 (48%), Positives = 471/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  AV+ +    + PN K+F+SI +K+ YL  ENY +     +YS  F+I I +  K  NFRF SFM A KFY  YALK+ D   Y E  EDR++ NAL F  G+E+ AL   +EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY ++ EYG P S + ITE+Y+ L+ NP I K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+ TPSILN    Y  +G DV CNLGS NI  +M+   +FG++V+   +AL  +   + +S+ P+IE GNS+  ++GLGAM LH +LA N I Y S+ AV+FTN++F  + Y     SN  A+E    F NF  +KYADG+YFDKY   +   + P+++RVKEL +   + IP+ QDW +L E +   GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      +Y K AY++ +  +ID+ +AA +HVDQ +S+TLFL             EN  TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDQEAVKAFFTENVLPNTKQFDSILDKIAYLLEENYLEKEFLDQYSPEFIIKIDQFLKDQNFRFKSFMAAYKFYNQYALKTNDGAYYLESMEDRVLFNALYFAEGDEELALNLANEMIHLRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYSVELEYGVPYSYLDITEKYDELVANPRIRKTKIKARDLETEISKLQQESGYPYVINIDTANRSN-PVDGKIIMSNLCSEILQVQTPSILNDSQEYLSMGTDVSCNLGSTNIVNLMKS-PDFGRSVRTMTRALTYVTDHSHISAVPSIEAGNSQAHSIGLGAMGLHSYLAQNLIDYGSKTAVEFTNIYFMLLNYWTLVESNNIARERKATFHNFDKSKYADGTYFDKYVTGD---YQPQSDRVKELFE--GIFIPSGQDWAELREKVMADGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLTTETIPFY-KSAYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPKELYEWKKENKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|191638465|ref|YP_001987631.1| Ribonucleoside-diphosphate reductase, alpha chain [Lactobacillus casei] >gi|190712767|emb|CAQ66773.1| Ribonucleoside-diphosphate reductase, alpha chain [Lactobacillus casei BL23] (723 aa)
Score = 1632, Expect = 1.9e-179, Identities = 344/710 (48%), Positives = 477/710 (67%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE--CTTCVI 725
           D+ +Y +LN  I +   N       D  A++ +L   + PN  +F+S+ ++L+YL   +YY+ +   KY  +FL  + +     +F+F SFM A K+Y  YALK+ D   Y E F+DR+  NAL F  GNE  A+   DEM+  RYQ ATP+FLNAG+ +RGE VSC+LL++ D+M SIGRA  + L+LS+ GGGV   L+NLRE GAPIKGI+  A+G++PVMK+LED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK R+K+LSLGVVVPD  + L + N DM LFSPY ++R YGKP S + IT+EY+N++ NP I K  I AR L  +I+++Q ESGYP+I+  D AN  N  +  +IIMSNLC+EI Q+  PS LN    YE LG DV CNLGS NI  +M    +FG++V+  ++AL  +   +++   P++++GN +  ++GLGAM LH + A N ++Y S E++DFTN++F  + Y+  +ASN+ A+E G  F NF+N+KYADGSYFDKYT   E  W PK ++V+ L     + IPT+ DW  L   + K GL + + MAVAP GSISY++  + SLQPIV+ IE R+E K+G +Y PA  +  N+ M Y + AY+I +  +ID+ +AAQQHVDQ ++MTLF+               T+  TTRDLN    YA +K   SIYYIR   +   D E++    C +C I
  S:     9 DQVTYYALNNEINI-PVNDQIPLNKDKEALQAFLTENVAPNTMQFDSLADRLKYLVDNHYYEADFLNKYQPAFLEKLDQFLSAQHFQFKSFMAAYKYYAQYALKTDDGTQYLEDFKDRVFANALFFADGNEDLAVDLADEMIHQRYQPATPSFLNAGRARRGELVSCFLLQITDDMNSIGRAINSALELSRIGGGVGLTLSNLREAGAPIKGIEGAASGVLPVMKLLEDSFSYSNQLGQRQGAGVVYLNVFHPDIISFLGAKKENADEKYRVKTLSLGVVVPDKYYDLIKANADMYLFSPYSVERVYGKPFSYVDITKEYDNMVANPAIKKYKIKARDLENEISKLQQESGYPYIINIDTANRAN-PIEGKIIMSNLCSEIMQVQVPSKLNNKQEYEVLGTDVSCNLGSTNIPNLMHS-RDFGRSVEAMVRALTYVTDHSNIDVVPSVQHGNHQAHSIGLGAMGLHTYFAKNHMFYGSPESLDFTNIYFLLLNYYTLRASNKIAQERGESFHNFENSKYADGSYFDKYT---EQVWAPKYDKVRALFD--GIHIPTQADWEALKTSVMKDGLYHQNRMAVAPNGSISYINDTSASLQPIVNRIEDRQEKKIGTIYYPAPDLS-NDTMPYYQSAYDIDMRKVIDVYAAAQQHVDQGMAMTLFMRSTIPAGLYPWKDGRTDKMTTRDLNILRNYAHHKGIKSIYYIRTYTD---DQEEIGSNACESCSI 723
>gi|55821275|ref|YP_139717.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus thermophilus LMG 18311] >gi|55823188|ref|YP_141629.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus thermophilus CNRZ1066] >gi|116628013|ref|YP_820632.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus thermophilus LMD-9] >gi|55737260|gb|AAV60902.1| ribonucleotide reductase alpha subunit [Streptococcus thermophilus LMG 18311] >gi|55739173|gb|AAV62814.1| ribonucleotide reductase alpha subunit [Streptococcus thermophilus CNRZ1066] >gi|116101290|gb|ABJ66436.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Streptococcus thermophilus LMD-9] (719 aa)
Score = 1618, Expect = 8.4e-178, Identities = 343/707 (48%), Positives = 468/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A+  +    +KPN   FNSI +K+ YL   +Y +     KY  +F+  +  +     FRF SFM A KFY  YALK+ D +TY E FEDR++ NAL F  G+E  A    +EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDIL FL +K+ENADEK+R+K+LSLGV VPD  + LAR N+DM LFSPY I++EYGKP + I IT  Y+ L+ NPNITK  I+AR+L  +I+++Q ESGYP+I+  D AN  N  ++ +I+MSNLC+EI Q+ TPS LN    + +LG D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + P+I+NGN +    GLGAM LH +LA + I Y S E+++FTN++F  M Y     SN  A+E    F  F+N+KYADGSYFDKY   +   + PK++RVKEL + +   IP  +DW +L E +KK GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   +Y   AY++ +  +ID+ +AA +HVDQ +S+TLFL            TEN  TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDKEALRAFFLENVKPNSMAFNSITDKINYLIENDYIESEFIGKYEPAFIEKLSAEIHAQKFRFQSFMAAYKFYQQYALKTNDGETYLESFEDRVLFNALYFADGDENLASDLANEMIHQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDILAFLSTKKENADEKVRVKTLSLGVTVPDKFYELARNNEDMYLFSPYSIEKEYGKPYNYIDITAMYDELVANPNITKTKINARELETEISKLQQESGYPYIINIDTANRHN-PIDGKIVMSNLCSEILQVQTPSELNDSQEFVKLGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIDAVPSIKNGNQQAHTFGLGAMGLHSYLAKHHIEYGSPESIEFTNIYFMLMNYWTLVESNNIARERQETFVGFENSKYADGSYFDKYVTGQ---YVPKSDRVKELFEGH--FIPQAKDWEELRELVKKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPFYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPKEIYEWKTENKLTTRDLSILRNYAFNKGIKSIYYIRTYTD---DGEEVGSNQCESCVI 719
>gi|28377562|ref|NP_784454.1| ribonucleotide-diphosphate reductase subunit alpha [Lactobacillus plantarum WCFS1] >gi|28270394|emb|CAD63297.1| ribonucleoside-diphosphate reductase, alpha chain [Lactobacillus plantarum WCFS1] (721 aa)
Score = 1616, Expect = 1.5e-177, Identities = 334/707 (47%), Positives = 468/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE-KLFECTTCVI 725
           +Y  LN  I +   N       D  A+  +LE  ++PN  KF+S+K + +YL   +Y +     KY  SF+  +++  ++ +F F +FM A KFY  YALK+ D   Y E+F DR+  NAL F  GNE  A+   DE++  RYQ ATP+FLNAG+ +RGE +SC+L++  D+M SIGR   + LQLS+ GGGV   L+NLR  G PIK I   A+G++PVMK+LED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEKIR+K+LSLGV VPD  + L + + DM LFSPY ++REYG P S + IT+EY+N++ NPNI K  I AR L  +I+++Q ESGYP+++  D AN +N  ++ +I+MSNLC+E+ Q+ TPS+++    YE+LG D+ CNLGS NI  +M    +FG +V+  ++AL  +   +++   P+I+ GN +   +GLGAM LH F A N++ Y S+EAVDFTN++F  + Y   KASNE A+E    F NF+ +KYADGSYFDKYT  +   W PK ++   L     + IPTK DW  L E + + GL + + MAVAP GSISY++  T SL PI++ +E R+E K+G++Y PA  +  N+ + Y K AY+  +  +ID+ +AAQQHVDQ +S+TLF+               T+  TTRDLN    YA+ K   SIYYIR   +   D E  + EC +CVI
  S:    10 TYYDLNNEINI-PVNNQIPLNKDQEALAAFLEQNVEPNTMKFDSLKARFDYLREHDYLETPAIDKYDFSFIEKLYDYLRSQDFHFKTFMAAYKFYAQYALKTDDGDYYLENFIDRVAMNALYFADGNEDLAMDLADEIVHQRYQPATPSFLNAGRARRGELISCFLIQSTDDMNSIGRTINSALQLSRIGGGVGINLSNLRGAGDPIKHIDGAASGVVPVMKLLEDSFSYSNQLGQRQGAGVVYLSVFHPDIIAFLSAKKENADEKIRLKTLSLGVTVPDKFYELIKADADMYLFSPYGVEREYGVPFSYVDITKEYDNMVKNPNIRKTKIKARDLENEISKLQQESGYPYVVNIDTANREN-PIDGKIVMSNLCSEVMQVQTPSLIDDQQQYEKLGTDISCNLGSTNIVNLMTS-PDFGHSVEAMVRALTFVTDHSNVDVVPSIQKGNRQAHTIGLGAMGLHAFFAKNQMEYGSKEAVDFTNIYFLLLNYWTLKASNEIARERHETFVNFEKSKYADGSYFDKYTTQD---WQPKYDKTAALFD--GIFIPTKADWEALKEAVMRDGLYHQNRMAVAPNGSISYINDTTASLHPIINRVEERQEKKIGKIYYPAPYLS-NDTINYYKSAYDTDMRKVIDVYAAAQQHVDQGMSLTLFMRSTIPAGLYEWKDGRTDKMTTRDLNILRNYAYRKGIKSIYYIRTFTD--DDGEVGVNECESCVI 721
>gi|171779599|ref|ZP_02920555.1| hypothetical protein STRINF_01436 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281701|gb|EDT47135.1| hypothetical protein STRINF_01436 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (719 aa)
Score = 1603, Expect = 4.3e-176, Identities = 329/707 (46%), Positives = 466/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK++YL   +Y +     KYS  F+ ++ +  + + FRF SFM A KFY  YALK+ D   Y E  EDR++ NAL F  GNE+ A     EM+  RYQ ATP+FLNAG+ +RGE+VSC+L+ V D+M +IGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAGAVYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ +PD  + LAR+N+DM LFSPY ++REYG P S + IT EY+ ++ NPNI K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+E+ Q+  PSI+N    + ++G D+ CNLGS N+  +M    +FG+++K   +AL  ++  + + S PTI++GN +    GLGAM LH +LA N I+Y S E+++FTN++F  + Y     SN+ A+E    F  F+ +KYADGSYFDKY   +   + PK++RVKEL  E+   IP+ +DW +L + +   GL + + +AVAP GSISY++  + SL PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL  +              TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLNKDKEALKAFFLENVIPNTMTFESITEKIDYLIANDYIEAEFIGKYSPDFIENLSKDLQAHKFRFKSFMAAYKFYQQYALKTNDGSQYLESIEDRVLFNALYFADGNEELARDLALEMINQRYQPATPSFLNAGRSRRGEFVSCFLISVTDDMNAIGRSINSALQLSRIGGGVGINLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGAVYLDVFHPDIMAFLSTKKENADEKVRVKTLSLGITIPDKFYELARKNEDMYLFSPYSVEREYGVPYSYVDITAEYDKMVANPNIVKTKIKARDLETEISKLQQESGYPYVINIDTANRTN-PIDGKIIMSNLCSEVLQVQKPSIINDAQEFVKMGTDISCNLGSTNVVNMMTS-PDFGRSIKAMTRALTFVSDTSSIESVPTIKHGNEQAHTFGLGAMGLHTYLAQNHIHYGSPESIEFTNIYFMLLNYWTLVESNQIARERKQTFVGFEKSKYADGSYFDKYITGD---FVPKSDRVKELFAEH--FIPSGKDWAELRDAVMIDGLYHQNRLAVAPNGSISYINDVSASLHPITQRIEERQEKKIGKIYYPAAGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSDIPEGLYEWKTQSKQTTRDLSILRHYAFNKGLKSIYYIRTFTD---DGEEVGSNQCESCVI 719
>gi|116511804|ref|YP_809020.1| ribonucleotide-diphosphate reductase subunit alpha [Lactococcus lactis subsp. cremoris SK11] >gi|116107458|gb|ABJ72598.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Lactococcus lactis subsp. cremoris SK11] (722 aa)
Score = 1599, Expect = 1.3e-175, Identities = 331/707 (46%), Positives = 470/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL--------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I +   NG+     D  A+  + +  ++PN  + ++  +KL +L  E Y +    +KY   F+ ++ ++   + F F SFM A KFY  YA+K+ D   Y E FEDR++ NAL    G+E+ A      M+  RYQ ATPTFLNAG+K+RGE+VSC+LL++ D+M SIGR   + LQLSK GGGV   LTNLR  GAPIKG    A G++PVMK+ ED FSYANQLGQRQGAG VYL+ FHPDI++FL +K+ENADEKIR+K+LSLGV VPD  + L ++ + M LF PY +++ YGKP +++ IT EY+ ++ NP I K  I+AR+L Q+++++Q ESGYP+I+  D  N+ N  ++  I MSNLC+EI Q+ TPS+LN D TY+ +G DV CNLGS N+  +M     FG +V+  ++AL  I+  ++L + PT+  GN +  A+GLGAM LH FLA N+I+YDS+EAV+FT+++F  + Y+   ASN+ A E G  F+NF+ + YADGSYFDKY     +Y+   + +V+EL K   +A+PT  DW +L + +K  GL NS+ MAVAP GSISY++ C+ S+ PIV+ IE R+E KVG++Y PA  +      YY K AY+  +  +ID+ +AA +HVDQ +S+TLF+                  TTRDL+    YA+ K   +IYYIR   +   D E++   +C +CVI
  S:    10 TYFKLNNEINI-PVNGSIPLAKDKEAITAFFKENVEPNRYEADTYIDKLNWLVKEEYLEAEFLEKYKPEFITNLRKELSKFEFHFDSFMAAYKFYNQYAMKNNDGSLYLEDFEDRVLMNALYMADGDEKLANNLAFAMINRRYQPATPTFLNAGRKRRGEFVSCFLLQLTDDMNSIGRTINSALQLSKNGGGVGLNLTNLRAAGAPIKGYDGVAAGVVPVMKLFEDAFSYANQLGQRQGAGVVYLSLFHPDIMEFLSTKKENADEKIRVKTLSLGVTVPDKFYELVKKGETMYLFEPYFVEKYYGKPFAEVDITAEYDKMVANPEIRKTPINARELEQELSKLQQESGYPYIVNVDTVNQANP-VDGVISMSNLCSEILQVQTPSVLNDDQTYKVVGTDVACNLGSTNVLNMMTSSDEFGTSVESMVRALTFISETSNLDTVPTVRKGNDEMHAIGLGAMGLHSFLAQNQIHYDSKEAVEFTSVYFMLLNYYTLVASNKLAVEKGASFKNFEKSAYADGSYFDKYLT--HDYFAAVSPKVQELFK--GIAVPTIADWTELRDTVKTSGLYNSYRMAVAPNGSISYINDCSSSIHPIVNRIEERQEKKVGKIYYPAAGLATETIPYY-KSAYDTDMRSVIDVYAAATEHVDQGLSLTLFMRSTLPEGLYEWKVANNKMTTRDLSILRNYAYKKGIKTIYYIRTFTD---DQEEVGANQCESCVI 722
>gi|125624346|ref|YP_001032829.1| ribonucleotide-diphosphate reductase subunit alpha [Lactococcus lactis subsp. cremoris MG1363] >gi|124493154|emb|CAL98118.1| ribonucleoside-diphosphate reductase alpha chain [Lactococcus lactis subsp. cremoris MG1363] (722 aa)
Score = 1599, Expect = 1.3e-175, Identities = 331/707 (46%), Positives = 470/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL--------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I +   NG+     D  A+  + +  ++PN  + ++  +KL +L  E Y +    +KY   F+ ++ ++   + F F SFM A KFY  YA+K+ D   Y E FEDR++ NAL    G+E+ A      M+  RYQ ATPTFLNAG+K+RGE+VSC+LL++ D+M SIGR   + LQLSK GGGV   LTNLR  GAPIKG    A G++PVMK+ ED FSYANQLGQRQGAG VYL+ FHPDI++FL +K+ENADEKIR+K+LSLGV VPD  + L ++ + M LF PY +++ YGKP +++ IT EY+ ++ NP I K  I+AR+L Q+++++Q ESGYP+I+  D  N+ N  ++  I MSNLC+EI Q+ TPS+LN D TY+ +G DV CNLGS N+  +M     FG +V+  ++AL  I+  ++L + PT+  GN +  A+GLGAM LH FLA N+I+YDS+EAV+FT+++F  + Y+   ASN+ A E G  F+NF+ + YADGSYFDKY     +Y+   + +V+EL K   +A+PT  DW +L + +K  GL NS+ MAVAP GSISY++ C+ S+ PIV+ IE R+E KVG++Y PA  +      YY K AY+  +  +ID+ +AA +HVDQ +S+TLF+                  TTRDL+    YA+ K   +IYYIR   +   D E++   +C +CVI
  S:    10 TYFKLNNEINI-PVNGSIPLAKDKEAITAFFKENVEPNRYEADTYIDKLNWLVKEEYLEAEFLEKYKPEFITNLRKELSKFEFHFDSFMAAYKFYNQYAMKNNDGSLYLEDFEDRVLMNALYMADGDEKLANNLAFAMINRRYQPATPTFLNAGRKRRGEFVSCFLLQLTDDMNSIGRTINSALQLSKNGGGVGLNLTNLRAAGAPIKGYDGVAAGVVPVMKLFEDAFSYANQLGQRQGAGVVYLSLFHPDIMEFLSTKKENADEKIRVKTLSLGVTVPDKFYELVKKGETMYLFEPYFVEKYYGKPFAEVDITAEYDKMVANPEIRKTPINARELEQELSKLQQESGYPYIVNVDTVNQANP-VDGVISMSNLCSEILQVQTPSVLNDDQTYKVVGTDVACNLGSTNVLNMMTSSDEFGTSVESMVRALTFISETSNLDTVPTVRKGNDEMHAIGLGAMGLHSFLAQNQIHYDSKEAVEFTSVYFMLLNYYTLVASNKLAVEKGSSFKNFEKSAYADGSYFDKYLT--HDYFAAVSPKVQELFK--GIAVPTIADWTELRDTVKTSGLYNSYRMAVAPNGSISYINDCSSSIHPIVNRIEERQEKKVGKIYYPAAGLATETIPYY-KSAYDTDMRAVIDVYAAATEHVDQGLSLTLFMRSTLPEGLYEWKVANNKMTTRDLSILRNYAYKKGIKTIYYIRTFTD---DQEEVGANQCESCVI 722
>gi|116333245|ref|YP_794772.1| ribonucleotide-diphosphate reductase subunit alpha [Lactobacillus brevis ATCC 367] >gi|116098592|gb|ABJ63741.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Lactobacillus brevis ATCC 367] (721 aa)
Score = 1595, Expect = 4.3e-175, Identities = 327/707 (46%), Positives = 464/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE-KLFECTTCVI 725
           +Y  LN  I +   +G      D  A++ +L+  + PN K F S+KE+ ++L  ENY +  V   Y  SF+  +++  K  +F F SFM A KFY  YALK+ DN+ Y E+F DR+  NAL FG G+++ A    DE++  RYQ ATP+FLNAG+ +RGE VSC+L++  D+M +IGR   + LQLS+ GGGV   L+NLR  G PIK I+  A+G++PVMK+LED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEKIR+K+LSLG+ VPD  + L   + DM LFSPYD++R YGKP S + IT EY+NL+ NP+I KK + AR L   I ++Q ESGYP+I+  D AN +N  ++ RI+MSNLC+EI Q+ TPS +N    Y +LG D+ CNLGS NI  +M    +FG +V+  ++AL  +   +D+   P+I+ GN     +GLGAM LH + A N + Y S++++ FT+++F  + Y   KASNE AKE    F NF  + YADG YFD+YT+ +   W P + +V+EL     + +P  +DW +L   + + GL + + MAVAP GSISY++  T SL PI++ IE R+E K+G++Y PA  +  N+ M Y K AY+  +  +ID+ +AAQ+HVDQ +S+TLF+               T+  TTRDL+    YAF K   S+YY+R   +   + E    +C +CVI
  S:    10 TYYDLNNEINI-PVDGQIPLNKDQEALQAFLKENVIPNTKTFASLKERFDFLIAENYIEEAVVTAYPFSFIEDLYDYLKAQDFHFKSFMAAYKFYAQYALKTDDNEFYLENFIDRVAMNALDFGGGDQRLAHDLADEIIHQRYQPATPSFLNAGRSRRGELVSCFLIQSTDDMNTIGRTINSALQLSRIGGGVGISLSNLRGAGDPIKHIEGAASGVVPVMKLLEDSFSYSNQLGQRQGAGVVYLSVFHPDIVAFLSAKKENADEKIRLKTLSLGITVPDKFYELCAADADMYLFSPYDVERIYGKPFSYVDITAEYDNLVANPDIHKKKMKARDLETDIGKLQQESGYPYIVNIDTANREN-PIDGRIVMSNLCSEIMQVQTPSTVNNKQEYVKLGTDISCNLGSTNIVNLMSS-PDFGHSVETMVRALTYVTDHSDIDVVPSIQKGNQLGHTIGLGAMGLHSYFAKNHMMYGSKDSIAFTSVYFMLLNYWTLKASNEIAKERHETFHNFDKSAYADGRYFDRYTETD---WRPTSAKVQELFA--NVWLPAPEDWAELKTAVMQDGLYHQNRMAVAPNGSISYINDTTASLHPIINRIEERQEKKIGKIYYPAPYLS-NDTMPYYKSAYDTDMRRVIDVYAAAQKHVDQGMSLTLFMRSTIPVGLYEWKDGRTDKMTTRDLSILRNYAFRKGIKSLYYVRTFTD--NNGEVGANQCESCVI 721
>gi|182684088|ref|YP_001835835.1| ribonucleotide-diphosphate reductase alpha subunit [Streptococcus pneumoniae CGSP14] >gi|182629422|gb|ACB90370.1| ribonucleotide-diphosphate reductase alpha subunit [Streptococcus pneumoniae CGSP14] (719 aa)
Score = 1595, Expect = 4.3e-175, Identities = 330/707 (46%), Positives = 466/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A++ + +  + PN   F+SIK+K+ YL   NY +    KKY   FL  + +  K  NF+F SFM A KFY  YALK+ D + Y E+ EDR+  NAL F  GNE  A+   +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVVVPD  + LAR+N++M LFSPY +++EYG P + I ITE+Y+ L+ NPNI K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    + Q+G DV CNLGS N+  +M    +FG++++  ++AL  +   + + + PTI++GNS+    GLGAM LH +LA   I Y S E+V+FT+++F  M Y     SN  A+E G  F NF+ + YA+GSYFDKY   E   + P ++RVKEL K   + IP   DW +L + +++ GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDKEALDAFFKENVVPNTMVFDSIKDKINYLIEHNYIETAFIKKYRPEFLEELAQFIKDQNFQFKSFMAAYKFYNQYALKTNDGEYYLENMEDRVFFNALYFADGNEAVAIDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVVPDKFYELARKNEEMYLFSPYSVEKEYGAPFNYIDITEKYDELVVNPNIRKTKIKARDLETEISKLQQESGYPYVVNIDTANRAN-PVDGKIIMSNLCSEILQVQEPSLINDAQEFLQMGTDVSCNLGSTNVVNMMTS-PDFGRSIRAMVRALTFVTDSSHIVAVPTIDHGNSQAHTFGLGAMGLHSYLAQQLIEYGSPESVEFTSIYFMLMNYWTLVESNNIARERGITFHNFEKSDYANGSYFDKYVTGE---FVPTSDRVKELFK--NVFIPGVADWAELRDKVQEDGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKRENKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|15672957|ref|NP_267131.1| ribonucleotide-diphosphate reductase subunit alpha [Lactococcus lactis subsp. lactis Il1403] >gi|12723918|gb|AAK05073.1|AE006332_2 ribonucleoside-diphosphate reductase alpha chain (EC 1.17.4.1) [Lactococcus lactis subsp. lactis Il1403] (722 aa)
Score = 1594, Expect = 4.3e-175, Identities = 330/707 (46%), Positives = 470/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL--------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I +   NG+     D  A+  + +  ++PN  + ++  +KL +L  E Y +    +KY   F+ ++ ++   + F F SFM A KFY  YA+K+ D   Y E FEDR++ NAL    G+E+ A      M+  RYQ ATPTFLNAG+K+RGE+VSC+LL++ D+M SIGR   + LQLSK GGGV   LTNLR  GAPIKG    A G++PVMK+ ED FSYANQLGQRQGAG VYL+ FHPDI++FL +K+ENADEKIR+K+LSLGV VPD  + L ++ + M LF PY +++ YGKP +++ IT EY+ ++ NP I K  I+AR+L Q+++++Q ESGYP+I+  D  N+ N  ++  I MSNLC+EI Q+ TPS+LN D TY+ +G DV CNLGS N+  +M     FG +++  ++AL  I+  ++L + PT+  GN +  A+GLGAM LH FLA N+I+YDS+EAV+FT+++F  + Y+   ASN+ A E G  F+NF+ + YADGSYFDKY     +Y+   + +V+EL K   +A+PT +DW  L + +K  GL NS+ MAVAP GSISY++ C+ S+ PIV+ IE R+E KVG++Y PA  +      YY K AY+  +  +ID+ +AA +HVDQ +S+TLF+                  TTRDL+    YA+ K   +IYYIR   +   D E++   +C +CVI
  S:    10 TYFKLNNEINI-PVNGSIPLAKDKEAITAFFKENVEPNRYEADTYIDKLNWLVKEEYLEAEFLEKYKPEFITNLRKELSKFEFHFDSFMAAYKFYNQYAMKNNDGSLYLEDFEDRVLMNALYMADGDEKLANNLAFAMINRRYQPATPTFLNAGRKRRGEFVSCFLLQLTDDMNSIGRTINSALQLSKNGGGVGLNLTNLRAAGAPIKGYDGVAAGVVPVMKLFEDAFSYANQLGQRQGAGVVYLSLFHPDIMEFLSTKKENADEKIRVKTLSLGVTVPDKFYELVKKGETMYLFEPYFVEKYYGKPFAEVDITAEYDKMVANPEIRKTSINARELEQELSKLQQESGYPYIVNVDTVNQANP-VDGVISMSNLCSEILQVQTPSVLNDDQTYKVVGTDVACNLGSTNVLNMMTSSNEFGTSIEAMVRALTFISETSNLDTVPTVRKGNDEMHAIGLGAMGLHSFLAQNQIHYDSKEAVEFTSVYFMLLNYYTLVASNKLAVEKGSSFKNFEKSAYADGSYFDKYLT--HDYFAAVSSKVQELFK--GIAVPTIEDWTALRDTVKTSGLYNSYRMAVAPNGSISYINDCSSSIHPIVNRIEERQEKKVGKIYYPAAGLATETIPYY-KSAYDTDMRAVIDVYAAATEHVDQGLSLTLFMRSTLPEGLYEWKVANNKMTTRDLSILRNYAYKKGIKTIYYIRTFTD---DQEEVGANQCESCVI 722
>gi|15901044|ref|NP_345648.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae TIGR4] >gi|15903109|ref|NP_358659.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae R6] >gi|111657124|ref|ZP_01407909.1| hypothetical protein SpneT_02001650 [Streptococcus pneumoniae TIGR4] >gi|116516073|ref|YP_816516.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae D39] >gi|148985788|ref|ZP_01818916.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP3-BS71] >gi|148990436|ref|ZP_01821594.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP6-BS73] >gi|148994531|ref|ZP_01823711.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP9-BS68] >gi|148999043|ref|ZP_01826475.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP11-BS70] >gi|149004131|ref|ZP_01828934.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP14-BS69] >gi|149008158|ref|ZP_01831677.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae SP18-BS74] >gi|149013340|ref|ZP_01834071.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae SP19-BS75] >gi|149026428|ref|ZP_01836565.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP23-BS72] >gi|168483242|ref|ZP_02708194.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC1873-00] >gi|168486505|ref|ZP_02711013.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC1087-00] >gi|168489009|ref|ZP_02713208.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae SP195] >gi|168577271|ref|ZP_02723065.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae MLV-016] >gi|14972660|gb|AAK75288.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus pneumoniae TIGR4] >gi|15458688|gb|AAK99869.1| Ribonucleoside-diphosphate reductase (major subunit) [Streptococcus pneumoniae R6] >gi|116076649|gb|ABJ54369.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae D39] >gi|147755113|gb|EDK62168.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP11-BS70] >gi|147757864|gb|EDK64874.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP14-BS69] >gi|147760397|gb|EDK67376.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae SP18-BS74] >gi|147762930|gb|EDK69877.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae SP19-BS75] >gi|147922092|gb|EDK73215.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP3-BS71] >gi|147924288|gb|EDK75382.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP6-BS73] >gi|147927201|gb|EDK78237.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP9-BS68] >gi|147929259|gb|EDK80260.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pneumoniae SP23-BS72] >gi|172043335|gb|EDT51381.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC1873-00] >gi|183570440|gb|EDT90968.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC1087-00] >gi|183572571|gb|EDT93099.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae SP195] >gi|183577174|gb|EDT97702.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae MLV-016] (719 aa)
Score = 1594, Expect = 4.6e-175, Identities = 330/707 (46%), Positives = 466/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A++ + +  + PN   F+SIK+K+ YL   NY +    KKY   FL  + +  K  NF+F SFM A KFY  YALK+ D + Y E+ EDR+  NAL F  GNE  A+   +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVVVPD  + LAR+N++M LFSPY +++EYG P + I ITE+Y+ L+ NPNI K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    + Q+G DV CNLGS N+  +M    +FG++++  ++AL  +   + + + PTI++GNS+    GLGAM LH +LA   I Y S E+V+FT+++F  M Y     SN  A+E G  F NF+ + YA+GSYFDKY   E   + P ++RVKEL K   + IP   DW +L + +++ GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDKEALDAFFKENVVPNTMVFDSIKDKINYLIEHNYIETAFIKKYRPEFLEELAQFIKDQNFQFKSFMAAYKFYNQYALKTNDGEYYLENMEDRVFFNALYFADGNEAVAIDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVVPDKFYELARKNEEMYLFSPYSVEKEYGVPFNYIDITEKYDELVANPNIRKTKIKARDLETEISKLQQESGYPYVVNIDTANRAN-PVDGKIIMSNLCSEILQVQEPSLINDAQEFLQMGTDVSCNLGSTNVVNMMTS-PDFGRSIRAMVRALTFVTDSSHIVAVPTIDHGNSQAHTFGLGAMGLHSYLAQQLIEYGSPESVEFTSIYFMLMNYWTLVESNNIARERGITFHNFEKSDYANGSYFDKYVTGE---FVPTSDRVKELFK--NVFIPGVADWAELRDKVQEDGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKRENKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|125717618|ref|YP_001034751.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus sanguinis SK36] >gi|125497535|gb|ABN44201.1| Ribonucleoside-diphosphate reductase, putative [Streptococcus sanguinis SK36] (719 aa)
Score = 1593, Expect = 6.6e-175, Identities = 330/707 (46%), Positives = 467/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A++ + +  ++PN K+F+SI EK++YL  ENY +    + YS  ++  +       +F+F SFM A KFY  YALK+ D + Y E  EDR++ NAL F  G+E  A    +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVV+PD  + LAR+N++M LFSPY ++REYG P + + ITE+Y+ L+ NPNITK  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +I+MSNLC+EI Q+  PS+LN    Y  LG DV CNLGS N+  +M    +FGK+++   +AL  +   + +++ P+I+NGNS     GLGAM LH +LA   I Y S EAV+FT+++F  M Y     SN  A+E G  F NF+ + YA+G+YFDKY   E   + PK++RVKEL     + IP+ +DW +L + IK  GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDQEALKAFFKENVEPNTKQFSSITEKIKYLIEENYLEKEFIELYSPEYIEELTAFIHAQDFKFKSFMAAYKFYNQYALKTNDGEYYLESMEDRVLFNALYFANGDEAIAKDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIISFLSTKKENADEKVRVKTLSLGVVIPDKFYELARKNEEMYLFSPYSVEREYGVPFAYLDITEKYDELVANPNITKTKIKARDLETEISKLQQESGYPYVVNIDTANRSN-PIDGKIVMSNLCSEILQVQEPSLLNDAQEYLHLGTDVSCNLGSTNVVNMMTS-PDFGKSIRTMTRALTFVTDSSHITAVPSIDNGNSLAHTFGLGAMGLHSYLAQQLIDYGSAEAVEFTSIYFMLMNYWTLVESNNIARERGVTFHNFEKSDYANGTYFDKYLTGE---FVPKSDRVKELFA--GIFIPSPEDWAELRDKIKADGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKKESKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|169834419|ref|YP_001694621.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae Hungary19A-6] >gi|168996921|gb|ACA37533.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae Hungary19A-6] (719 aa)
Score = 1592, Expect = 9.6e-175, Identities = 330/707 (46%), Positives = 465/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A++ + +  + PN   F+SIK+K+ YL   NY +    KKY   FL  + +  K  NF+F SFM A KFY  YALK+ D + Y E  EDR+  NAL F  GNE  A+   +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVVVPD  + LAR+N++M LFSPY +++EY  P + I ITE+Y+ L+ NPNI K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    + Q+G DV CNLGS N+  +M    +FG++++  ++AL  +   + + + PTI++GNS+    GLGAM LH +LA   I Y S E+V+FT+++F  M Y     SN  A+E G  F NF+ + YA GSYFDKY   E   + PK++RVKEL K+  + IP+  DW +L + ++  GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDKEALDAFFKENVVPNTMVFDSIKDKINYLIEHNYIETAFIKKYRPEFLEELSQFIKDQNFQFKSFMAAYKFYNQYALKTNDGEYYLESMEDRVFFNALYFADGNEAVAIDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVVPDKFYELARKNEEMYLFSPYSVEKEYNVPFNYIDITEKYDELVANPNIRKTKIKARDLETEISKLQQESGYPYVVNIDTANRAN-PVDGKIIMSNLCSEILQVQEPSLINDAQEFLQMGTDVSCNLGSTNVVNMMTS-PDFGRSIRAMVRALTFVTDSSHIVAVPTIDHGNSQAHTFGLGAMGLHSYLAQQLIEYGSPESVEFTSIYFMLMNYWTLVESNNIARERGITFHNFEKSDYAKGSYFDKYVTGE---FVPKSDRVKELFKD--VFIPSAADWAELRDKVQADGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKRENKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|168491100|ref|ZP_02715243.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC0288-04] >gi|183574524|gb|EDT95052.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC0288-04] (719 aa)
Score = 1591, Expect = 1.0e-174, Identities = 330/707 (46%), Positives = 466/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A++ + +  + PN   F+SIK+K+ YL   NY +    KKY   FL  + +  K  NF+F SFM A KFY  YALK+ D + Y E+ EDR+  NAL F  GNE  A+   +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVVVPD  + LAR+N++M LFSPY +++EYG P + I ITE+Y+ L+ NPNI K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    + Q+G DV CNLGS N+  +M    +FG++++  ++AL  +   + + + PTI++GNS+    GLGAM LH +LA   I Y S E+V+FT+++F  M Y     SN  A+E G  F NF+ + YA+GSYFDKY   E   + P ++RVKEL K   + IP   DW +L + +++ GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDKEALDAFFKENVVPNTMVFDSIKDKINYLIEHNYIETAFIKKYRPEFLEELAQFIKDQNFQFKSFMAAYKFYNQYALKTNDGEYYLENMEDRVFFNALYFADGNEAVAIDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVVPDKFYELARKNEEMYLFSPYSVEKEYGVPFNYIDITEKYDELVANPNIRKTKIKARDLETEISKLQQESGYPYVVNIDTANRAN-PVDGKIIMSNLCSEILQVQEPSLINDAQEFLQMGTDVSCNLGSTNVVNMMTS-PDFGRSIRAMVRALTFVTDSSHIVAVPTIDHGNSQAHTFGLGAMGLHSYLAQQLIEYGSPESVEFTSIYFMLMNYWTLVESNNIARERGITFHNFEKSDYANGSYFDKYVTGE---FVPTSDRVKELFK--NVFIPGVADWAELRDKVQEDGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKDLYEWKRENKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|157150204|ref|YP_001450837.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus gordonii str. Challis substr. CH1] >gi|157074998|gb|ABV09681.1| ribonucleoside-diphosphate reductase large chain [Streptococcus gordonii str. Challis substr. CH1] (719 aa)
Score = 1591, Expect = 1.1e-174, Identities = 329/707 (46%), Positives = 466/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A+E + +  ++PN K+F+SI EK++YL  ENY +    + YS  ++  +       +F+F SFM A KFY  YALK+ D + Y E  E+R++ NAL F  G+E  A    +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVV+PD  + LAR+N++M LFSPY ++REYG P + + ITE+Y+ L+ NPNITK  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS+LN    Y  LG DV CNLGS N+  +M    +FGK+++   +AL  +   + +++ P+I++GNS     GLGAM LH +LA   I Y S EAV+FT+++F  M Y     SN  A+E G  F NF+ + YA G+YFDKY   E   + PK++RVKEL     + IP+ +DW +L + +K  GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDQEALEAFFKENVEPNTKQFSSITEKIKYLIEENYLEKEFIQLYSPEYIEELAAFIHAQDFKFKSFMAAYKFYNQYALKTNDGEYYLEGMEERVLFNALYFANGDEAIAKDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVIPDKFYELARKNEEMYLFSPYSVEREYGVPFAYLDITEKYDELVANPNITKTKIKARDLETEISKLQQESGYPYVVNIDTANRSN-PIDGKIIMSNLCSEILQVQEPSLLNDAQEYLHLGTDVSCNLGSTNVVNMMTS-PDFGKSIRTMTRALTFVTDSSHITAVPSIDHGNSLAHTFGLGAMGLHSYLAQQLIDYGSAEAVEFTSIYFMLMNYWTLVESNNIARERGVTFHNFEKSDYASGTYFDKYLTGE---FVPKSDRVKELFA--GIFIPSAEDWAELRDKVKADGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKKESKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|194398211|ref|YP_002037787.1| ribonucleoside-diphosphate reductase, alpha subunitv [Streptococcus pneumoniae G54] >gi|194357878|gb|ACF56326.1| ribonucleoside-diphosphate reductase, alpha subunitv [Streptococcus pneumoniae G54] (719 aa)
Score = 1590, Expect = 1.5e-174, Identities = 329/707 (46%), Positives = 465/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A++ + +  + PN   F+SIK+K+ YL   NY +    KKY   FL  + +  K  NF+F SFM A KFY  YALK+ D + Y E+ EDR+  NAL F  GNE  A+   +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVVVPD  + LAR+N++M LFSPY +++EYG P + I ITE+Y+ L+ NPNI K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    + Q+G DV CNLGS N+  +M    +FG++++  ++AL  +   + + + PTI++GNS+    GLGAM LH +LA   I Y S E+V+FT+++F  M Y     SN  A+E G  F NF+ + YA+GSYFDKY   E   + P ++RVKEL K   + IP   DW +L + +++ GL + + +AVAP GSI Y++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDKEALDAFFKENVVPNTMVFDSIKDKINYLIEHNYIETAFIKKYRPEFLEELAQFIKDQNFQFKSFMAAYKFYNQYALKTNDGEYYLENMEDRVFFNALYFADGNEAVAIDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVVPDKFYELARKNEEMYLFSPYSVEKEYGVPFNYIDITEKYDELVANPNIRKTKIKARDLETEISKLQQESGYPYVVNIDTANRAN-PVDGKIIMSNLCSEILQVQEPSLINDAQEFLQMGTDVSCNLGSTNVVNMMTS-PDFGRSIRAMVRALTFVTDSSHIVAVPTIDHGNSQAHTFGLGAMGLHSYLAQQLIEYGSPESVEFTSIYFMLMNYWTLVESNNIARERGITFHNFEKSDYANGSYFDKYVTGE---FVPTSDRVKELFK--NVFIPGVADWAELRDKVQEDGLYHQNRLAVAPNGSIXYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKRENKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|168493104|ref|ZP_02717247.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC3059-06] >gi|183576680|gb|EDT97208.1| ribonucleoside-diphosphate reductase, alpha subunit [Streptococcus pneumoniae CDC3059-06] (719 aa)
Score = 1590, Expect = 1.6e-174, Identities = 329/707 (46%), Positives = 466/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           +Y  LN  I     NG      D  A++ + +  + PN   F+SIK+K+ YL   NY +    KKY   FL  + +  K  NF+F SFM A KFY  YALK+ D + Y E+ +DR+  NAL F  GNE  A+   +E++  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG +  A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLGVVVPD  + LAR+N++M LFSPY +++EYG P + I ITE+Y+ L+ NPNI K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    + Q+G DV CNLGS N+  +M    +FG++++  ++AL  +   + + + PTI++GNS+    GLGAM LH +LA   I Y S E+V+FT+++F  M Y     SN  A+E G  F NF+ + YA+GSYFDKY   E   + P ++RVKEL K   + IP   DW +L + +++ GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +      YY   AY++ +  +ID+ +AA +HVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYY+R   +   D  ++   +C +CVI
  S:    10 TYFRLNNEINR-PVNGQIMLHKDKEALDAFFKENVVPNTMVFDSIKDKINYLIEHNYIETAFIKKYRPEFLEELAQFIKDQNFQFKSFMAAYKFYNQYALKTNDGEYYLENMKDRVFFNALYFADGNEAVAIDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVVPDKFYELARKNEEMYLFSPYSVEKEYGVPFNYIDITEKYDELVANPNIRKTKIKARDLETEISKLQQESGYPYVVNIDTANRAN-PVDGKIIMSNLCSEILQVQEPSLINDAQEFLQMGTDVSCNLGSTNVVNMMTS-PDFGRSIRAMVRALTFVTDSSHIVAVPTIDHGNSQAHTFGLGAMGLHSYLAQQLIEYGSPESVEFTSIYFMLMNYWTLVESNNIARERGITFHNFEKSDYANGSYFDKYVTGE---FVPTSDRVKELFK--NVFIPGVADWTELRDKVQEDGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKRENKQTTRDLSILRNYAFNKGIKSIYYVRTFTD---DGGEVGANQCESCVI 719
>gi|94994622|ref|YP_602720.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS10750] >gi|94548130|gb|ABF38176.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS10750] (719 aa)
Score = 1589, Expect = 1.7e-174, Identities = 331/707 (46%), Positives = 462/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYADGSYFDKY      ++ PK++ VK L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYHPEFITELASIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKTN-PIDGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYADGSYFDKYVT---GHFVPKSDLVKSLFKDH--FIPQASDWEALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|50914443|ref|YP_060415.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS10394] >gi|50903517|gb|AAT87232.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS10394] (719 aa)
Score = 1589, Expect = 1.7e-174, Identities = 331/707 (46%), Positives = 462/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYADGSYFDKY      ++ PK++ VK L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYHPEFITELAGIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PIDGKIIMSNLCSEILQVQTPSLINDTQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYADGSYFDKYVT---GHFVPKSDLVKSLFKDH--FIPQASDWEALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|94988800|ref|YP_596901.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS9429] >gi|94992685|ref|YP_600784.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS2096] >gi|94542308|gb|ABF32357.1| ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS9429] >gi|94546193|gb|ABF36240.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS2096] (719 aa)
Score = 1589, Expect = 2.1e-174, Identities = 331/707 (46%), Positives = 463/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  +N +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++ PK++ VK L K++   IP  +DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYHPEFITELAGIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PINGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVPKSDLVKSLFKDH--FIPQAEDWKALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|94990702|ref|YP_598802.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS10270] >gi|94544210|gb|ABF34258.1| Ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS10270] (719 aa)
Score = 1588, Expect = 2.3e-174, Identities = 331/707 (46%), Positives = 463/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  +N +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++ PK++ VK+L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYHPEFITELDSIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PINGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVPKSDLVKDLFKDH--FIPQASDWEALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|24379141|ref|NP_721096.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus mutans UA159] >gi|24377046|gb|AAN58402.1|AE014910_6 ribonucleotide reductase, large subunit [Streptococcus mutans UA159] (719 aa)
Score = 1587, Expect = 3.4e-174, Identities = 327/707 (46%), Positives = 459/707 (64%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN-------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           SY  LN  I     NG      D  A+E + +  +KPN K F+SI +K+++L   +Y +     KY S F+  + +    Y+F+F SFM A KF+  YALK+ D + Y E  EDR++ NAL F  GNE  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLGV +PD  + LAR N+DM LFSPY I+REYG P + + ITE+Y+ L+ NP I K  I AR L  +I+++Q ESGYP+++  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    + ++G D+ CNLGS N+  +M    +FG+++K   +AL  +   + + + P+I+NGN +    GLGAM LH +LA N I Y S E+++FT+++F  M Y     SN  A+E    F  F+ +KYADGSYFDKY   +   + PK++++KEL K +   IP  +DW  L + + K GL + + +AVAP GSISY++  + S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA QHVDQ +S+TLF+  +              TTRDL+    YAFNK   SIYYIR   +   D     EC +CVI
  S:    10 SYFRLNNEINR-PINGQIPLHKDKEALEAFFKENVKPNTKTFDSITDKIQFLVANDYIEAEFIAKYKSEFIEQLSQDLHAYDFQFKSFMAAYKFHQQYALKTNDGEEYLESIEDRVLFNALYFADGNENLAHDLAMEMIAQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGFAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIMAFLSTKKENADEKVRVKTLSLGVTIPDKFYELARRNEDMYLFSPYSIEREYGVPYNYLDITEKYDELVANPKIIKTKIKARDLETEISKLQQESGYPYVVNIDTANRAN-PIDGKIIMSNLCSEILQVQKPSLINDAQEFVKMGTDISCNLGSTNVVNMMTS-PDFGRSIKAMTRALTFVTDSSHIDAVPSIKNGNKQAHTFGLGAMGLHSYLAQNHIEYGSPESIEFTDIYFMLMNYWTLVESNNIARERQETFVGFEKSKYADGSYFDKYVTGQ---FIPKSDKIKELFKNH--FIPQAEDWEALRQAVIKDGLYHQNRLAVAPNGSISYINDVSASIHPITRRIEERQEKKIGKIYYPAAGLSTDTIPYYTS-AYDMDMRKVIDVYAAATQHVDQGMSLTLFMRSDIPQGIYEWKTESKQTTRDLSILRNYAFNKGIKSIYYIRTFTDD-GDEVGANECESCVI 719
>gi|19746347|ref|NP_607483.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS8232] >gi|19748542|gb|AAL97982.1| putative ribonucleotide reductase alpha-chain [Streptococcus pyogenes MGAS8232] (719 aa)
Score = 1585, Expect = 5.4e-174, Identities = 330/707 (46%), Positives = 462/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +     KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++ PK++ VK+L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIHKYHPEFITELASVIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PIDGKIIMSNLCSEILQVQTPSLVNDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVPKSDLVKDLFKDH--FIPQASDWKALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|21910585|ref|NP_664853.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS315] >gi|28895724|ref|NP_802074.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes SSI-1] >gi|21904786|gb|AAM79656.1| putative ribonucleoside-diphosphate reductase 2 alpha subunit [Streptococcus pyogenes MGAS315] >gi|28810973|dbj|BAC63907.1| putative ribonucleotide reductase alpha-chain [Streptococcus pyogenes SSI-1] (719 aa)
Score = 1583, Expect = 9.2e-174, Identities = 330/707 (46%), Positives = 462/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++ PK++ VK L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYHPEFITELAGIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PIDGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVPKSDLVKSLFKDH--FIPQASDWEALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|71903781|ref|YP_280584.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS6180] >gi|71802876|gb|AAX72229.1| ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS6180] (719 aa)
Score = 1582, Expect = 1.2e-173, Identities = 330/707 (46%), Positives = 462/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++ PK++ VK L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYRPEFITELDSIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PIDGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVPKSDLVKSLFKDH--FIPQASDWEALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|15675307|ref|NP_269481.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes M1 GAS] >gi|71910936|ref|YP_282486.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes MGAS5005] >gi|13622485|gb|AAK34202.1| putative ribonucleotide reductase alpha-chain [Streptococcus pyogenes M1 GAS] >gi|71853718|gb|AAZ51741.1| ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes MGAS5005] (719 aa)
Score = 1581, Expect = 1.5e-173, Identities = 330/707 (46%), Positives = 463/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++ PK++ VK+L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFSAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYRPEFITELDSIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PIDGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVPKSDLVKDLFKDH--FIPQASDWEALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|163791217|ref|ZP_02185633.1| ribonucleotide-diphosphate reductase alpha subunit [Carnobacterium sp. AT7] >gi|159873487|gb|EDP67575.1| ribonucleotide-diphosphate reductase alpha subunit [Carnobacterium sp. AT7] (727 aa)
Score = 1581, Expect = 1.7e-173, Identities = 334/693 (48%), Positives = 461/693 (66%)
  Q:    33 NGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFE--CTTCVI 725
           +G      D  AV  Y    + PN   F ++ EKL YL  E+Y +     KY   F+ ++F+   +  FRF SFM A KFYT YALK+ D + + E +EDRIV NAL    G+ + A    DE++  RYQ ATPTFLNAG+K+RGE VSC+L++  D+M SIGR   + LQLS+ GGGV   L+NLR  G PIK I N ++G++PVMK+LED FSY+NQLGQR GAGAVYLN FHPDI+ FL +K+ENADEKIR+K+LSLG+VVPD  + LA  ++ M LFSPYD++R YG+P + I IT+EY+N++NN  I K  ISAR+L  +I+++Q ESGYP+I+  D AN +N      I MSNLC+EI QI  PS++N D TYE LG D+ CNLGS NI  +M+   NFG+++   ++AL  +   + + + P+I+NGN +   +GLGAM LH FLA N+I+Y S E+V+FT+++F  + Y+   +SN+ AKE G  F NF+ +KYA+G+YFDKY    EN+    +E+V+ L     + +PT +DW  L E +   GL + + +AVAPTGSISY++  + SL PI   IE R+E K G+ Y PA  +  N+ M Y K AY++ +  +ID+ +AAQ+H+DQ +S+TLFL               T   TTRDLN    YA+ K   SIYY+R   E   +SE++    C +C I
  S:    29 DGKIPLNKDREAVRAYFLEHVNPNTVFFYTLDEKLNYLIEEDYIEEEFLLKYDREFVRALFDDIYSRKFRFRSFMSAFKFYTQYALKTNDGERFLERYEDRIVFNALYLADGDTKLASRLADEIVNQRYQPATPTFLNAGRKRRGELVSCFLIQATDDMNSIGRVVNSALQLSRIGGGVGVNLSNLRASGDPIKKIDNASSGVVPVMKLLEDSFSYSNQLGQRNGAGAVYLNVFHPDIVSFLSTKKENADEKIRVKTLSLGLVVPDKFYELAAHDEQMYLFSPYDVERIYGEPFAYIDITKEYDNMVNNEEIRKSKISARELENEISKLQQESGYPYIINVDTANRENPVYGT-ITMSNLCSEILQIQEPSLINNDQTYEHLGTDISCNLGSTNIVNLMKS-PNFGQSIDTMVRALTMVTDQSSIDAVPSIKNGNDRYHTIGLGAMGLHTFLALNQIHYGSPESVEFTDVYFKLLNYYTLVSSNKVAKERGTTFYNFEKSKYANGTYFDKYIN--ENF-VFSSEKVQHLFD--GIQVPTIEDWAALKEAVMSDGLYHQNRLAVAPTGSISYVNETSSSLHPITRLIEERQEKKTGKTYYPAPFLS-NDTMPYYKSAYDMDMRQVIDVYAAAQKHIDQGMSLTLFLRSEIPEGLYEWKNGRTTKQTTRDLNILRHYAWKKGVKSIYYVRTFTE---NSEEIGSNACESCTI 727
>gi|139473585|ref|YP_001128301.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus pyogenes str. Manfredo] >gi|134271832|emb|CAM30067.1| putative ribonucleoside-diphosphate reductase alpha chain [Streptococcus pyogenes str. Manfredo] (719 aa)
Score = 1574, Expect = 9.8e-173, Identities = 329/707 (46%), Positives = 461/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A++ +    + PN   F SI EK+EYL   +Y +    +KY   F+  +    K+ NFRF SFM A KFY  YALK+ D + Y E+ EDR++ NAL F  G E  A     EM+  RYQ ATP+FLNAG+ +RGE VSC+L++V D+M SIGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++  K++ VK L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   SIYYIR   +   D E++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGKIPLHKDKEALKAFFAENVLPNTMSFTSITEKIEYLISNDYIESAFIQKYHPEFITELAGIIKSENFRFKSFMAAYKFYQQYALKTNDGEHYLENLEDRVLFNALYFADGQEDLAKDLAVEMINQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PIDGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVAKSDLVKSLFKDH--FIPQASDWKALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSIYYIRTFTD---DGEEVGANQCESCVI 719
>gi|118586507|ref|ZP_01543951.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Oenococcus oeni ATCC BAA-1163] >gi|118433071|gb|EAV39793.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Oenococcus oeni ATCC BAA-1163] (723 aa)
Score = 1573, Expect = 1.4e-172, Identities = 322/713 (45%), Positives = 468/713 (65%)
  Q:    13 IIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           I ++K  Y  LN  + +  +N   Q E D  A + +L+  ++PN   F+S+KE+ ++L   N+ +  + KKY  +F+  +++     +F+F SFM A KFYT YA+K+ D   Y E +EDRI  NAL +  G+++ A+   DEM+  R+Q ATP+FLNAG+ +RGE VSC++L+  D+M SIGR   + +QLSK GGGV   L+N+RE GA + G+ N A G++P+MK++EDVF+Y++Q G RQGAG  YL+ FHPD++ FL +K+ENADEKIR+K+LSLG+ VPD  + L  + K MALFSP D+++ YG P + + +T+EY+N++ N  I K+++ AR L  +I+++Q ESGYPF++  DI N  N     +++ SNLC+EI Q  T S +N +  Y QLG D+ CNLGS+NI  +M   A+FGK+V+   +AL  ++  +D+S  P+++NGN +  A+GLGAM L  FLA NKIYY  E ++DF N FF    Y+   ASN+ AKE G  F  F+ + YA+G YFDKY   +   W PKT++VK+L  +Y   +PT +DW +L E + K+GL N++  AVAPTGSISY++  T SLQPIVS +E R EG  GRV+ PA  +      YY   AY++    +ID  +AAQ+HVDQ ++MTLF+               T+  TTRDL     YA+N+   SIYYIR   +     + + EC +C I
  S:     6 IDLEKVHYYDLNNEVNIPKQN-TIQVEKDKEARDAFLKENVEPNRLLFSSLKERFDWLVKNNFVESQLVKKYDFTFIEKLYDFLDAVHFQFQSFMAAYKFYTQYAIKTDDGNYYVESYEDRITVNALYYADGDQKLAMRIADEMIHQRFQPATPSFLNAGRARRGELVSCFVLQTTDDMNSIGRVINSAMQLSKIGGGVGINLSNVREAGASVMGLANMAGGVVPIMKLMEDVFTYSSQAGARQGAGVAYLSVFHPDVMSFLSTKKENADEKIRVKTLSLGLTVPDKFYELTEKGKQMALFSPADVEKVYGVPFNYVDLTKEYDNMVANDEIKKQWVDARNLEMEISKLQQESGYPFVINLDIVNRANPVY-GKVVTSNLCSEILQTQTISRINNEQEYTQLGADISCNLGSINIDNMMHT-ADFGKSVETMTRALTFVSESSDISVVPSVQNGNRQKHAIGLGAMGLAAFLAKNKIYYGDEVSLDFVNTFFLMTNYYTLLASNQIAKERGESFFEFEKSDYANGKYFDKYLAKD---WGPKTDKVKKLFSDYH--VPTIEDWQRLKEMVAKYGLYNAYRQAVAPTGSISYVNDTTASLQPIVSRVEARAEGMTGRVFYPANGLSNETLPYYVS-AYDLDQRKVIDTYAAAQEHVDQGLAMTLFMRSTIPEGIYDWKDGDTDKMTTRDLTILRHYAYNQGIKSIYYIRTFTDD-NTEQGVNECESCSI 723
>gi|77408851|ref|ZP_00785578.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae COH1] >gi|77172537|gb|EAO75679.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae COH1] (719 aa)
Score = 1572, Expect = 1.6e-172, Identities = 333/707 (47%), Positives = 464/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A+  + +  ++PN K F+SI +K+ YL   +Y +     KY   F+  +  K     FRF SFM A KFY  YALK+ D + Y E  EDR++ NAL F  G+E+ A     EM++ RYQ ATP+FLNAG+ +RGE VSC+L++V D+M +IGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR N++M LFSPY I+REYG P S I ITE+Y+ L+ NPNITK  I+AR L  +I+++Q ESGYP+I+  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    Y ++G D+ CNLGS N+  +M    +FGK++K   +AL  +   +++ + PTI+NGN++    GLGAM LH +LA N I Y S E+++FT+++F  M Y     SN  A+E    F  F+ +KYADG+YFDKY   +   + P++++VK L   +   IP  +DW  L   + K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +SMTLFL            TE+  TTRDL+    YAFNK   SIYYIR   +   DS ++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDKEALTAFFKENVQPNSKAFDSITDKIAYLLKYDYLEEAFLNKYRPEFIEELSTKLFDKKFRFKSFMAAYKFYQQYALKTNDGEYYLESIEDRVLFNALYFADGDEELATDLALEMISQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNAIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGFAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARNNQEMYLFSPYSIEREYGVPFSYIDITEKYDELVANPNITKTKINARDLETEISKLQQESGYPYIINIDTANRTNP-VDGKIIMSNLCSEILQVQKPSLINDAQEYLEMGTDISCNLGSTNVLNMMTS-PDFGKSIKTMTRALTFVTDSSNIEAVPTIKNGNAQAHTFGLGAMGLHSYLAKNHIEYGSPESIEFTDIYFMLMNYWTLVESNNIARERQTTFVGFEKSKYADGTYFDKYVSGK---FVPQSDKVKSLFTNH--FIPEAKDWENLRYAVMKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLATDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSMTLFLRSELPKELYEWKTESKQTTRDLSILRNYAFNKGVKSIYYIRTFTD---DSSEVGANQCESCVI 719
>gi|76787476|ref|YP_329565.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus agalactiae A909] >gi|76562533|gb|ABA45117.1| ribonucleoside-diphosphate reductase, alpha chain [Streptococcus agalactiae A909] (719 aa)
Score = 1569, Expect = 3.5e-172, Identities = 332/707 (46%), Positives = 463/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A+  + +  ++PN K F+SI +K+ YL   +Y +     KY   F+  +  K     FRF SFM A KFY  YALK+ D + Y E  EDR++ NAL F  G+E+ A     EM++ RYQ ATP+FLNAG+ +RGE VSC+L++V D+M +IGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR N++M LFSPY I+REYG P S I ITE+Y+ L+ NPNITK  I+AR L  +I+++Q ESGYP+I+  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    Y ++G D+ CNLGS N+  +M    +FGK++K   +AL  +   +++ + PTI+NGN++    GLGAM LH +LA N I Y S E+++FT+++F  M Y     SN  A+E    F  F+ +KYADG+YFDKY   +   + P++++VK L   +   IP  +DW  L   + K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +SMTLFL            TE+  TTRDL+    YAFNK   SIYYIR   +   D  ++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDKEALTAFFKENVQPNSKAFDSITDKIAYLLKYDYLEEAFLNKYRPEFIEELSTKLFDKKFRFKSFMAAYKFYQQYALKTNDGEYYLESIEDRVLFNALYFADGDEELATDLALEMISQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNAIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGFAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARNNQEMYLFSPYSIEREYGVPFSYIDITEKYDELVANPNITKTKINARDLETEISKLQQESGYPYIINIDTANRTNP-VDGKIIMSNLCSEILQVQKPSLINDTQEYLEMGTDISCNLGSTNVLNMMTS-PDFGKSIKTMTRALTFVTDSSNIEAVPTIKNGNAQAHTFGLGAMGLHSYLAKNHIEYGSPESIEFTDIYFMLMNYWTLVESNNIARERQTTFVGFEKSKYADGTYFDKYVSGK---FVPQSDKVKSLFANH--FIPEAKDWENLRYAVMKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLATDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSMTLFLRSELPKELYEWKTESKQTTRDLSILRNYAFNKGVKSIYYIRTFTD---DGSEVGANQCESCVI 719
>gi|22536983|ref|NP_687834.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus agalactiae 2603V/R] >gi|77405563|ref|ZP_00782654.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae H36B] >gi|77410694|ref|ZP_00787053.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae CJB111] >gi|22533838|gb|AAM99706.1|AE014229_7 ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 2603V/R] >gi|77163230|gb|EAO74182.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae CJB111] >gi|77175870|gb|EAO78648.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae H36B] (719 aa)
Score = 1569, Expect = 3.9e-172, Identities = 332/707 (46%), Positives = 463/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A+  + +  ++PN K F+SI +K+ YL   +Y +     KY   F+  +  K     FRF SFM A KFY  YALK+ D + Y E  EDR++ NAL F  G+E+ A     EM++ RYQ ATP+FLNAG+ +RGE VSC+L++V D+M +IGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR N++M LFSPY I+REYG P S I ITE+Y+ L+ NPNITK  I+AR L  +I+++Q ESGYP+I+  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    Y ++G D+ CNLGS N+  +M    +FGK++K   +AL  +   +++ + PTI+NGN++    GLGAM LH +LA N I Y S E+++FT+++F  M Y     SN  A+E    F  F+ +KYADG+YFDKY   +   + P++++VK L   +   IP  +DW  L   + K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +SMTLFL            TE+  TTRDL+    YAFNK   SIYYIR   +   D  ++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDKEALTAFFKENVQPNSKAFDSITDKIAYLLKYDYLEEAFLNKYRPEFIEELSTKLFDKKFRFKSFMAAYKFYQQYALKTNDGEYYLESIEDRVLFNALYFADGDEELATDLALEMISQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNAIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGFAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARNNQEMYLFSPYSIEREYGVPFSYIDITEKYDELVANPNITKTKINARDLETEISKLQQESGYPYIINIDTANRTNP-VDGKIIMSNLCSEILQVQKPSLINDAQEYLEMGTDISCNLGSTNVLNMMTS-PDFGKSIKTMTRALTFVTDSSNIEAVPTIKNGNAQAHTFGLGAMGLHSYLAKNHIEYGSPESIEFTDIYFMLMNYWTLVESNNIARERQTTFVGFEKSKYADGTYFDKYVSGK---FVPQSDKVKSLFANH--FIPEAKDWENLRYAVMKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLATDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSMTLFLRSELPKELYEWKTESKQTTRDLSILRNYAFNKGVKSIYYIRTFTD---DGSEVGANQCESCVI 719
>gi|25010892|ref|NP_735287.1| ribonucleotide-diphosphate reductase subunit alpha [Streptococcus agalactiae NEM316] >gi|23095271|emb|CAD46481.1| Unknown [Streptococcus agalactiae NEM316] (719 aa)
Score = 1569, Expect = 4.1e-172, Identities = 332/707 (46%), Positives = 463/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A+  + +  ++PN K F+SI +K+ YL   +Y +     KY   F+  +  K     FRF SFM A KFY  YALK+ D + Y E  EDR++ NAL F  G+E+ A     EM++ RYQ ATP+FLNAG+ +RGE VSC+L++V D+M +IGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR N++M LFSPY I+REYG P S I ITE+Y+ L+ NPNITK  I+AR L  +I+++Q ESGYP+I+  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    Y ++G D+ CNLGS N+  +M    +FGK++K   +AL  +   +++ + PTI+NGN++    GLGAM LH +LA N I Y S E+++FT+++F  M Y     SN  A+E    F  F+ +KYADG+YFDKY   +   + P++++VK L   +   IP  +DW  L   + K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +SMTLFL            TE+  TTRDL+    YAFNK   SIYYIR   +   D  ++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDKEALTAFFKENVQPNSKAFDSITDKIAYLLKYDYLEEAFLNKYRPEFIEELSTKLFDKKFRFKSFMAAYKFYQQYALKTNDGEYYLESIEDRVLFNALYFADGDEKLATDLALEMISQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNAIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGFAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARNNQEMYLFSPYSIEREYGVPFSYIDITEKYDELVANPNITKTKINARDLETEISKLQQESGYPYIINIDTANRTNP-IDGKIIMSNLCSEILQVQKPSLINDAQEYLEMGTDISCNLGSTNVLNMMTS-PDFGKSIKTMTRALTFVTDSSNIEAVPTIKNGNAQAHTFGLGAMGLHSYLAKNHIEYGSPESIEFTDIYFMLMNYWTLVESNNIARERQTTFVGFEKSKYADGTYFDKYVSGK---FVPQSDKVKSLFANH--FIPEAKDWENLRYAVMKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLATDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSMTLFLRSELPKELYEWKTESKQTTRDLSILRNYAFNKGVKSIYYIRTFTD---DGSEVGANQCESCVI 719
>gi|77413116|ref|ZP_00789316.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 515] >gi|77160817|gb|EAO71928.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 515] (719 aa)
Score = 1566, Expect = 9.6e-172, Identities = 331/707 (46%), Positives = 463/707 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
           SY  LN  I     NG      D  A+  + +  ++PN K F+SI +K+ YL   +Y +     KY   F+  +  K     FRF SFM A KFY  YALK+ D + Y E  EDR++ NAL F  G+E+ A     EM++ RYQ ATP+FLNAG+ +RGE VSC+L++V D+M +IGR+  + LQLS+ GGGV   L+NLR+ GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR N++M LFSPY I+REYG P S I ITE+Y+ L+ NPNITK  I+AR L  +I+++Q ESGYP+I+  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    Y ++G D+ CNLGS N+  +M    +FGK++K   +AL  +   +++ + PTI+NGN++    GLGAM LH +LA N I Y S E+++FT+++F  M Y     SN  A+E    F  F+ +KYADG+YFDKY   +   + P++++VK L   +   IP  +DW  L   + K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +SMTLFL            TE+  TTRDL+    YAFNK   SIYYIR   +   D  ++   +C +CVI
  S:    10 SYFRLNNEINR-PVNGQIPLHKDKEALTAFFKENVQPNSKAFDSITDKIAYLLKYDYLEEAFLNKYRPEFIEELSTKLFDKKFRFKSFMAAYKFYQQYALKTNDGEYYLESIEDRVLFNALYFADGDEKLATDLALEMISQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNAIGRSINSALQLSRIGGGVGISLSNLRDAGAPIKGFAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARNNQEMYLFSPYSIEREYGVPFSYIDITEKYDELVANPNITKTKINARDLETEISKLQQESGYPYIINIDTANRTNP-IDGKIIMSNLCSEILQVQKPSLINDAQEYLEMGTDISCNLGSTNVLNMMTS-PDFGKSIKTMTRALTFVTDSSNIEAVPTIKNGNAQAHTFGLGAMGLHSYLAKNHIEYGSPESIEFTDIYFMLMNYWTLVESNNIARERQTTFVGFEKSKYADGTYFDKYVSGK---FVPQSDKVKSLFANH--FIPEAKDWENLRYAVMKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLATDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSMTLFLRSELPKELYEWKTESKQTTRDLSILRNYAFNKGVKSIYYIRTFTD---DGSEVGANQCESCVI 719
>gi|116617383|ref|YP_817754.1| ribonucleotide-diphosphate reductase subunit alpha [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096230|gb|ABJ61381.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (723 aa)
Score = 1564, Expect = 1.5e-171, Identities = 319/707 (45%), Positives = 468/707 (66%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +Y  LN  + +  +N   Q + D  A+  +L+  + PN   F+S++E+L+++F   + +    +KY+ +F+  ++      +F+F SFM A KFY  YALK+ D   Y E +EDR+  NAL +  GNE  AL   DEM+  RYQ ATP+FLNAG+ +RGE VSC++++  D+M SIGR   + LQLSK GGGV   L+N+RE GAP+ GI N A G++P+MK+LED F++++Q+G RQGAG VYL+ FHPDIL FL +K+ENADEKIR+K+LSLG+ VPD  + L ++N+ M LFSP D+++ Y +P + + IT EY+N++ N  I K+ I AR L ++I+++Q ESGYP+I+  D AN  N  +  +I+ SNLC+EI Q+ TPS ++ +  Y +LG D+ CNLGS+NI  +M    +FG +V   ++AL  ++  ++L   P+I+ GN +  A+GLGAM L  + A NK+YY  EEA+DFT+ FF  + Y++ K+S   AKE    F  F  + YADG+YFDKY    E  WTPKTE+V +    +   +PT+QDW QL ED+ K+G+ N++  A+APTGSISY++  T SL PIV+ IE R+EG +G+VY PA  +  N  M Y   AY+  +  +ID+ +AAQ+H+DQ +++TLF+               T   TTRDL     YAFNK   S+YY+R   +  ++S  + EC +C I
  S:    12 TYFDLNNQVNI-PKNNEIQLDKDQEALNAFLDENVLPNVMHFDSLQERLDWMFDHRFLEREFIQKYNITFIEKLYTYLAGEHFKFKSFMAAFKFYNQYALKTNDGAYYIETYEDRVAMNALYYADGNENLALRLADEMIHQRYQPATPSFLNAGRARRGELVSCFIIQTSDDMNSIGRTINSALQLSKMGGGVGINLSNVREAGAPVMGIDNAAGGVVPIMKLLEDSFTFSSQVGARQGAGVVYLSVFHPDILSFLSTKKENADEKIRVKTLSLGLTVPDKFYDLVKQNETMYLFSPDDVEKVYQQPFNYVDITAEYDNMVANDKIRKQRIDARSLEEEISKLQQESGYPYIINIDTANRTNP-VPGKIVSSNLCSEILQVQTPSEIDNEQHYTKLGSDISCNLGSINIVNMMNTN-DFGGSVDTMVRALTFVSDSSNLDVVPSIDLGNKEKHAIGLGAMGLAAYFAQNKMYYGDEEALDFTSTFFMMLNYYSIKSSMGIAKERHETFYQFDQSGYADGTYFDKYV---EKNWTPKTEKVAKAFAGFD--VPTEQDWAQLKEDVAKYGMYNAYRHAIAPTGSISYVNDATASLLPIVNKIEERQEGMIGKVYYPAPGLS-NETMPYYVSAYDTDMRRVIDVYAAAQEHIDQGMALTLFMRSTLPEHLYEWKNNRTNKMTTRDLTILRNYAFNKGIKSLYYVRTFTDDNQES-GVNECESCSI 723
>gi|116490255|ref|YP_809799.1| ribonucleotide-diphosphate reductase subunit alpha [Oenococcus oeni PSU-1] >gi|116090980|gb|ABJ56134.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Oenococcus oeni PSU-1] (723 aa)
Score = 1562, Expect = 2.5e-171, Identities = 320/713 (44%), Positives = 467/713 (65%)
  Q:    13 IIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           I ++K  Y  LN  + +  +N   Q E D  A + +L+  ++PN  +F+S+KE+ ++L   N+ +  + KKY  +F+  +++     +F+F SFM A KFYT YA+K+ D   Y E +EDRI  NAL +  G+++ A+   DEM+  R+Q ATP+FLNAG+ +RGE VSC++L+  D+M SIGR   + +QLSK GGGV   L+N+RE GA +  + N A G++P+MK++ED F+Y++Q G RQGAG  YL+ FHPD++ FL +K+ENADEKIR+K+LSLG+ VPD  + L  + K MALFSP D+++ YG P + + +T+EY+N++ N  I K+++ AR L  +I+++Q ESGYPF++  DI N  N     +++ SNLC+EI Q  T S +N +  Y QLG D+ CNLGS+NI  +M   A+FGK+V+   +AL  ++  +D+S  P+++NGN +  A+GLGAM L  FLA NKIYY  E A+DF N FF    Y+   ASN+ AKE G  F  F+ + YA+G YFDKY   +   W PKT++VK+L  +Y   +PT +DW +L E + K+GL N++  AVAPTGSISY++  T SLQPIVS +E R EG  GRV+ PA  +      YY   AY++    +ID  +AAQ+HVDQ ++MTLF+               T+  TTRDL     YA+++   SIYYIR   +     + + EC +C I
  S:     6 IDLEKVHYYDLNNEVNIPKQN-TIQVEKDKEARDAFLKENVEPNRLRFSSLKERFDWLVKNNFVESQLVKKYDFTFIEKLYDFLDAVHFQFQSFMAAYKFYTQYAIKTDDGNYYVESYEDRITVNALYYADGDQKLAMRIADEMIHQRFQPATPSFLNAGRARRGELVSCFVLQTTDDMNSIGRVINSAMQLSKIGGGVGINLSNVREAGASVMRLANMAGGVVPIMKLMEDAFTYSSQAGARQGAGVAYLSVFHPDVMSFLSTKKENADEKIRVKTLSLGLTVPDKFYELTEKGKQMALFSPADVEKVYGVPFNYVDLTKEYDNMVANDEIKKQWVDARNLEMEISKLQQESGYPFVINLDIVNRANPVY-GKVVTSNLCSEILQTQTISRINNEQEYTQLGADISCNLGSINIDNMMHT-ADFGKSVETMTRALTFVSESSDISVVPSVQNGNRQKHAIGLGAMGLAAFLAKNKIYYGDEVALDFVNTFFLMTNYYTLLASNQIAKERGESFFEFEKSDYANGKYFDKYLVKD---WGPKTDKVKKLFSDYH--VPTIEDWQRLKEMVAKYGLYNAYRQAVAPTGSISYVNDTTASLQPIVSRVEARAEGMTGRVFYPANGLSNETLPYYVS-AYDLDQRKVIDTYAAAQEHVDQGLAMTLFMRSTIPEGIYDWKDGDTDKMTTRDLTILRHYAYHQGIKSIYYIRTFTDD-NTEQGVNECESCSI 723
>gi|171779439|ref|ZP_02920403.1| hypothetical protein STRINF_01284 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282056|gb|EDT47487.1| hypothetical protein STRINF_01284 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (718 aa)
Score = 1555, Expect = 1.5e-170, Identities = 332/692 (47%), Positives = 466/692 (67%)
  Q:    34 GNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKY---SSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE--KLFECTTCVI 725
           G      D  A+ +YL TEIK N K F++I  KL YL   +Y + ++   Y   S +F+  +F+ A  Y F F SFM A KFY  YA+K+ D+K Y E+FEDR V NAL    G+   A   L+E+++ RYQ ATPTFLNAGKK+RGE VSC+L+ +ED+M SIGR   + LQLS+ GGGV   L+NLR  G+PIK I+N ++G++PVMK+LED FSY+NQLGQR GAG VYLN FH DIL+FL +K+ENADEKIR+K+LSLG+VVPD  + L + N+ M LF+PY ++R YG P S + +T+EY+ +++N  I K  I+AR+L Q+I+ +Q ESGYP+IL  D AN  N  +  +IIMSNLC+EI Q   PSILN DL+Y+++G D+ CNLGS+N+  +++   +FGK+++YAI+AL ++     +S  PT+ NGNS    +GLGAM LH  LA N I Y+S+EA++F + FF  M Y++ KAS++ A E    F +F+N++YADGS+FD Y   E ++ + K  ++ E      + +PT +DW  L ED+ K GL + + +A+AP GSISY++  + SL PI   IE R+E KVG ++ PA  +  N  + Y K AY +    IIDI + AQQH+DQ +S+TLF+               +   TTRDLN+   YA+ K   S+YY+R   E   D E   +  C +C+I
  S:    18 GQIPLHYDKEALYEYLNTEIKNNLKSFDNIDAKLNYLIAHDYIEESIIDSYGKNSRAFVKELFDFAYNYGFEFKSFMAAYKFYNQYAMKTNDSKYYLENFEDRAVFNALYLANGDRNLAHKILEELISQRYQPATPTFLNAGKKRRGEMVSCFLIDIEDSMLSIGRNINSALQLSRIGGGVGVNLSNLRATGSPIKEIENASSGVLPVMKLLEDSFSYSNQLGQRNGAGVVYLNVFHQDILEFLSTKKENADEKIRVKTLSLGLVVPDKYYELLKTNEPMYLFNPYHVERVYGIPFSYVDLTKEYDTMVDNDEIEKTVINARELEQEISRLQQESGYPYILNIDTANRTN-PVKGKIIMSNLCSEILQPQEPSILNPDLSYKKVGTDISCNLGSMNMVNLIKS-KDFGKSIEYAIRALTTVTDRGAISEVPTVANGNSLYHTIGLGAMGLHTVLALNGIDYESDEALEFVDAFFLAMNYYSLKASHQIAVEKNETFHDFENSRYADGSHFDYYLAKEFHFTSEKVAKIFE-----NILLPTIEDWQLLKEDVMKDGLYHRNRLAIAPNGSISYINETSASLHPITQLIENRQEKKVGSIFYPAPYLS-NKTLKYYKTAYNMDQRKIIDIYAKAQQHIDQGMSLTLFMRSVLPEGIYEWKKQGSSKLTTRDLNRLRNYAWTKGIKSLYYVRTYTE---DDEFNSVNNCESCMI 718
>gi|146322250|ref|YP_001174721.1| ribonucleotide-diphosphate reductase subunit alpha [Lactococcus lactis] >gi|145968741|gb|ABQ00019.1| putative ribonucleotide reductase subunit alpha [Lactococcus lactis] (718 aa)
Score = 1552, Expect = 3.6e-170, Identities = 336/706 (47%), Positives = 468/706 (66%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSS---FLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTE---------------NATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE--KLFECTTCVI 725
           Y  LN  + +  E G      D  A+E+YL TEI+ N K F+SI EKL+YL   +Y D +V   Y  +   F+  +F  A  Y F+F SFM A KFY  YA+K+ D   Y E+FEDR V NAL    G+   A   L+E+++ RYQ ATPTFLNAGKK+RGE VSC+L+ + D+M SIGR   + LQLS+ GGGV   L+NLR  G+PIK I+N ++G++PVMK+LED FSY+NQLGQR GAG VYLN FH DIL+FL +K+ENADEKIR+K+LSLG+VVPD  + L + N+ M LF+PY ++R YG P S + +T+EY+ ++ N  I K  I+AR+L Q+I+ +Q ESGYP+IL  D AN  N  +  +IIMSNLC+EI Q   PSILN DL+Y+++G D+ CNLGS+N+  +ME   +FGK+++YAI+AL ++     +S  PT+ NGNS    +GLGAM LH  LA N I Y+S+EA++F + FF  M Y++ KAS++ + E    F NF+ ++YADGSYFD Y   + ++ + K  ++ E      + +PT +DW  L E++ K GL + + +A+AP GSISY++  + SL PI   IE R+E KVG ++ PA  +  N  + Y K AY +    IIDI + AQQH+DQ +S+T+F+                   TTRDLN+   YA+ K   S+YY+R   E   D E   +  C +C+I
  S:     5 YFILNNMLNVLVE-GQIPLHYDREALEEYLNTEIRDNLKTFDSIDEKLDYLISHDYIDESVLSIYGENNREFVKKLFIFAYNYGFKFKSFMAAYKFYNQYAMKTNDLNYYLENFEDRAVFNALYLANGDRNLAHKILEELISQRYQPATPTFLNAGKKRRGEMVSCFLIDINDSMLSIGRNINSALQLSRIGGGVGVNLSNLRATGSPIKEIENASSGVLPVMKLLEDSFSYSNQLGQRNGAGVVYLNVFHQDILEFLSTKKENADEKIRVKTLSLGLVVPDKYYELLKTNEPMCLFNPYHVERVYGIPFSYVDLTKEYDTMVANGEIEKTVINARELEQEISRLQQESGYPYILNIDTANRTN-PVKGKIIMSNLCSEILQPQEPSILNLDLSYKKVGTDISCNLGSMNMVNLME-AKDFGKSIEYAIRALTTVTDRGAISEVPTVANGNSLYHTIGLGAMGLHTVLALNGIDYESDEALEFVDAFFLAMNYYSLKASHQISIEKNETFHNFEYSRYADGSYFDYYLAKKFHFTSEKVAKIFE-----NILLPTIEDWQLLKENVMKDGLYHRNRLAIAPNGSISYINETSASLHPITQLIENRQEKKVGSIFYPAPYLS-NKTLRYYKTAYNMDQRKIIDIYAKAQQHIDQGMSLTVFMRSVLPEGIYEWKKQGSLKLTTRDLNRLRNYAWTKGIKSLYYVRTYTE---DDEFNSVNNCESCMI 718
>gi|170017905|ref|YP_001728824.1| ribonucleotide reductase, alpha subunit [Leuconostoc citreum KM20] >gi|169804762|gb|ACA83380.1| Ribonucleotide reductase, alpha subunit [Leuconostoc citreum KM20] (723 aa)
Score = 1538, Expect = 1.4e-168, Identities = 310/713 (43%), Positives = 467/713 (65%)
  Q:    13 IIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL---------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           I +D+ +Y  LN  + +  +N   Q + D  A++ +L+  + PN  KF+S+ ++ ++LF   + +     +Y  SF+  ++   +  +F F SFM A KFY  YALK+ D + Y E + DR+  NAL +  G E  AL   DEM+  RYQ ATP+FLNAG+ +RGE VSC++++  D+M SIGR   + LQLSK GGGV   ++N+RE GAP+ GI N A G++P+MK+LED F++++Q+G RQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + L R+NK M LFSP D+++ YG+  + + IT EY+N++ N  ITK  + AR L ++I+++Q ESGYP+I+  D+AN +N  +  +I+ SNLC+EI Q+  PS ++    Y +LG DV CNLGS+NI  +M    +F  +V   ++AL  ++  ++L   P+I+ GN +  A+GLGAM L  + A N++YY  EEA+DFT  FF T+ Y++ K+S   AKE    F  F+ + YA+G+YFDKY     N W PKT++V +    + L  PTK DW+ L +D+ K+G+ +++  A+APTGSISY++  T +L PIV+ IE R+EG +G+VY PA  +      YY   AY+  +  +ID+ +AAQ+H+DQ +++TLF+               T+  TTRDL     YAFNK   S+YY+R   +  ++S  + EC +C I
  S:     6 INIDEVTYFDLNNQVNI-PKNNQIQLDKDQEALDAFLKENVWPNVLKFDSLAQRFDWLFDNQFIEREFIAQYDLSFIEKLYAYLEGEHFNFKSFMAAFKFYNQYALKTNDGQYYVETYVDRVAMNALYYANGQESLALKLADEMIHQRYQPATPSFLNAGRARRGELVSCFIIQTSDDMNSIGRTINSALQLSKMGGGVGINVSNVREAGAPVMGIANSAGGVVPIMKLLEDSFTFSSQVGARQGAGVVYLSIFHPDIMAFLSTKKENADEKVRVKTLSLGLTVPDKFYELVRQNKTMYLFSPVDVEKVYGQSFNYVDITAEYDNMVENDAITKYRVDARMLEEEISKLQQESGYPYIINIDVANREN-PIAGKIVSSNLCSEILQVQRPSDIDNGQQYTRLGSDVSCNLGSINIVNMMAT-QDFDTSVDTMVRALTFVSDTSNLDVVPSIDKGNKEKHAIGLGAMGLAAYFAQNQMYYGDEEALDFTTTFFMTLNYYSIKSSMRIAKERHETFYEFEKSTYANGAYFDKYIN---NDWQPKTQKVAQAFAPHHL--PTKNDWLTLKDDVAKYGMYHAYRHAIAPTGSISYVNDTTATLLPIVNKIEERQEGMIGKVYYPAPGLSDETMPYYVS-AYDTDMRKVIDVYAAAQEHIDQGMALTLFMRSTLSDKLYEWKKGRTDKMTTRDLTILRHYAFNKGIKSLYYVRTFTDDNQES-GVNECESCSI 723
>gi|184156150|ref|YP_001844490.1| ribonucleoside-diphosphate reductase alpha subunit [Lactobacillus fermentum IFO 3956] >gi|183227494|dbj|BAG28010.1| ribonucleoside-diphosphate reductase alpha subunit [Lactobacillus fermentum IFO 3956] (721 aa)
Score = 1532, Expect = 7.1e-168, Identities = 326/710 (45%), Positives = 453/710 (63%)
  Q:    16 DKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTEN---------------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE--KLFECTTCVI 725
           D  SY   N  + +  ENG+     D  A++ Y +  I P   +F S  ++   L  ++Y D  V ++Y + F+  +  + + ++FRF SFMGA KFY  YA+K+ D K + E + DR+V NAL   RG++Q A    DE++  RYQ ATPTFLNAGKK+RG+ VSC+L+ V+D+M SIGRA  + LQLS+ GGGV   L+NLR  G PIK I+N ++G++PVMK+LED FSY+NQLGQR GAG VYLN FHPDI+ FL++K+ENADEKIR+K+LSLG+VVPD  + L + N  M LFSPYD++RE   P S + +T+EY+ L+ NP I K  ISAR+L Q+I+ +Q ESGYP+IL  D AN  N  +  +IIMSNLC+EI Q   PS L +DL+YE +G D+ CNLGS NI  +++   +FG+ V+ A++AL ++    ++   P+I  GN     +GLGAM LH  LA  +I Y S EA++FT  +F  + Y++  AS++ AKE G  F  FK+++YADGSYFD Y       +T K E+ +       L  PT  DW  L E ++  GL + + +AVAP GSISY++  + SL PI   +E R+E KVG ++ PA  +      YY   AY++    IID  + AQ+HVDQ +S+TLF+                   TTRDLN+   YA+ K   S+YYIR       D E     EC +C+I
  S:     7 DPQSYFYYNNLVNI-PENGSIAVHYDQDALKAYFKDHIIPQTVRFQSPAKRRAKLVADDYLDGAVLEQYPAEFIDQLEARVRAHHFRFKSFMGAYKFYAQYAMKTNDGKRFLEDYNDRVVANALYLARGDQQLAKDLTDELINQRYQPATPTFLNAGKKRRGQMVSCFLIDVQDSMLSIGRALNSALQLSRIGGGVGVNLSNLRAAGDPIKKIENASSGVLPVMKLLEDAFSYSNQLGQRNGAGVVYLNVFHPDIMAFLETKKENADEKIRVKTLSLGLVVPDKYYQLLKSNAPMYLFSPYDVERELKTPFSYVDLTKEYDRLVANPRIKKTAISARELEQKISRLQQESGYPYILNIDHANRDN-PVAGKIIMSNLCSEILQPQEPSTLTSDLSYETVGTDISCNLGSTNIDNMLQ-APDFGRAVEVAVRALTNVTDTTNIEEVPSIAKGNRLYHTIGLGAMGLHTALARRQIEYGSPEALEFTEAYFLALNYYSLLASHQIAKERGETFAGFKDSRYADGSYFDDYVT---KPFTLKFEKNRAAFSGVHL--PTTADWQALKEAVQTDGLYHRNRLAVAPNGSISYVNETSASLTPITQLVEQRQENKVGALFYPAPYLSNETLPYYTP-AYDLDQRKIIDTYAVAQKHVDQGMSLTLFMRSTLPTGLYEWKKPDQPKMTTRDLNRLRNYAWTKGIKSLYYIRT---FTTDDEIHTANECESCMI 721
>gi|158079505|ref|YP_001504318.1| putative ribonucleotide reductase [Enterococcus phage phiEF24C] >gi|157890349|dbj|BAF81477.1| putative ribonucleotide reductase [Enterococcus phage phiEF24C] (716 aa)
Score = 1532, Expect = 8.5e-168, Identities = 320/708 (45%), Positives = 453/708 (63%)
  Q:    18 DSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFK-KYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLF----LTEN----------ATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++YI LN  + +   NG  Q + D  AV  +    +  N   F S++EK+ YL  E Y D  V   KYS  F+  +F+   +  FRF +FMGA +FY  YA+K+ D + Y E +EDR+  NAL  G G+E+ A+   DE++  RYQ ATPTFLNAG+ +RGEYVSC+L++VED+M SIGR   + LQLSK GGGV   L+NLR  G PIKGI+   +G++PVMK+LED F YANQLGQRQGAGAVYLN FH DI+ FL +++ENA+   +IK+LSLGVVVPD  + LA     + LFSPYD+ +EYG P S + I  EY N++ NPNI  K ++AR L ++I+ +Q ESGYP+I+     N+ N  ++ +IIMSNLC+EI Q+ TPS LN +  YE+LG D+ CNLGS+NI  ++E   +   +++  ++AL  I  ++++ + PTI+NGN K   +GLGAM LH + A+N++ Y S E+++ T+  F  + Y    ASN+ AKE    F NF+N+KYADGSYFD+Y        + K   V +      + +P  +DW  L   I + GL + + +AVAP GSI+Y++  T SL PI+S IE R++GK G+ Y PA ++      YY K AY+  +  +I++ + AQ+H+DQ +S+TLF    L EN           +TRDL     YA+ K   +IYY+R   E       + EC +C I
  S:     2 NTYIELNNQLNI-PNNGKIQLDKDKEAVRAFFLEHVNKNTVFFYSLEEKISYLIREGYIDKTVITDKYSMEFIKKLFKFIYSKKFRFDTFMGAYRFYKQYAMKTDDGERYLERYEDRVAFNALTMGDGDEELAMKIADELINRRYQPATPTFLNAGRLRRGEYVSCFLIQVEDSMSSIGRTLNSALQLSKLGGGVGINLSNLRALGDPIKGIEGAGSGVVPVMKMLEDGFRYANQLGQRQGAGAVYLNVFHADIMDFLSTRKENAESAKQIKTLSLGVVVPDKFYELAESGDVIHLFSPYDVAKEYGVPFSFVDIDSEYNNMIQNPNIRSKVMNARDLEEEISRLQQESGYPYIMNVSTVNKAN-PIDGKIIMSNLCSEILQVQTPSKLNDEQVYEELGADISCNLGSINILNLLETSNDVVASIETMVRALTYITDVSNIKAVPTIKNGNDKAHTIGLGAMGLHAWFASNQVEYGSPESIEMTDALFELINYATLVASNKIAKERDTTFYNFENSKYADGSYFDEYVPTLSQEISSKVAEVFD-----GVVLPNVKDWETLRNSIIESGLYHQNRLAVAPNGSIAYVNETTSSLHPIISMIEERQDGKTGKTYYPAPRLSEKTIPYY-KSAYDTSMIDVINVYATAQKHIDQGMSLTLFMRSELPENLYPWKVEGGATSTRDLTLLRHYAWKKGIKTIYYVRTFTEEDGSEVGVSECESCTI 716
>gi|76799234|ref|ZP_00781408.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 18RS21] >gi|76585417|gb|EAO62001.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Streptococcus agalactiae 18RS21] (704 aa)
Score = 1525, Expect = 4.5e-167, Identities = 317/680 (46%), Positives = 444/680 (65%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL------------TENA-TTRDLNKAYIYAFNKKC 698
           SY  LN  I     NG      D  A+  + +  ++PN K F+SI +K+ YL   +Y +     KY   F+  +  K     FRF SFM A KFY  YALK+ D + Y E  EDR++ NAL F  G+E+ A     EM++ RYQ ATP+FLNAG+ +RGE VSC+L++V D+M +IGR+  + LQLS+ GGGV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYL+ FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR N++M LFSPY I+REYG P S I ITE+Y+ L+ NPNITK  I+AR L  +I+++Q ESGYP+I+  D AN  N  ++ +IIMSNLC+EI Q+  PS++N    Y ++G D+ CNLGS N+  +M    +FGK++K   +AL  +   +++ + PTI+NGN++    GLGAM LH +LA N I Y S E+++FT+++F  M Y     SN  A+E    F  F+ +KYADG+YFDKY   +   + P++++VK L   +   IP  +DW  L   + K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +SMTLFL            TE+  TTRD        F ++C
  S:    10 SYFRLNNEINR-PVNGQIPLHKDKEALTAFFKENVQPNSKAFDSITDKIAYLLKYDYLEEAFLNKYRPEFIEELSTKLFDKKFRFKSFMAAYKFYQQYALKTNDGEYYLESIEDRVLFNALYFADGDEELATDLALEMISQRYQPATPSFLNAGRSRRGELVSCFLIQVTDDMNAIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGFAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVRVKTLSLGITVPDKFYELARNNQEMYLFSPYSIEREYGVPFSYIDITEKYDELVANPNITKTKINARDLETEISKLQQESGYPYIINIDTANRTNP-VDGKIIMSNLCSEILQVQKPSLINDAQEYLEMGTDISCNLGSTNVLNMMTS-PDFGKSIKTMTRALTFVTDSSNIEAVPTIKNGNAQAHTFGLGAMGLHSYLAKNHIEYGSPESIEFTDIYFMLMNYWTLVESNNIARERQTTFVGFEKSKYADGTYFDKYVSGK---FVPQSDKVKSLFANH--FIPEAKDWENLRYAVMKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLATDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSMTLFLRSELPKELYEWKTESKQTTRDSXNPTQLCFQQRC 693
>gi|195941045|ref|ZP_03086427.1| ribonucleotide-diphosphate reductase subunit alpha [Escherichia coli O157:H7 str. EC4024] (552 aa)
Score = 1508, Expect = 4.1e-165, Identities = 279/509 (54%), Positives = 373/509 (73%)
  Q:    13 IIVDKDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKE 521
           +I     Y +LNA + L+D  G  QF+ D  AV+ +    ++PN   F S +E+L++L  E YY+  V  +Y  +F++++FE+A    FRF +F+GA K+YT+Y LK+FD K Y E FEDR V  AL   +G+E  A    +E+++GR+Q ATPTFLN GK QRGE VSC+LLR+EDNMESIGRA  + LQLSKRGGGVA+ L+NLRE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDIL+FLD+KRENADEKIRIK+LSLGVV+PDI F LA+EN +MALFSPYDI+R YGK   D++I+E Y+ L+ +  I K  I+AR  FQ++AE+QFESGYP+I+++D  N  N  +  RI MSNLC+EI Q+N+ S  + +L Y  +G D+ CNLGSLNIA  M D  +FG+TV+ AI+ L +++ ++ + S P+IE GN+ + A+GLG MNLHG+LA   I Y S E +DFTN++FYT+ +HA   S   A+E
  S:     9 VIQATPDYHALNAMLNLYDREGRIQFDKDREAVDAFFAAHVRPNSVVFGSQQERLDWLVKEGYYEERVLTRYDRAFVVALFERAHVSGFRFQTFLGAWKYYTSYTLKTFDGKRYLESFEDRTVMVALTLAQGDEALAERLTEEILSGRFQPATPTFLNCGKAQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFKLAKENTEMALFSPYDIERIYGKAFGDVAISELYDELVADDRIRKNTINARDFFQRLAEIQFESGYPYIMYEDTVNRANP-IAGRINMSNLCSEILQVNSASSYDENLDYADVGNDISCNLGSLNIAHTM-DSPDFGRTVETAIRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEGLDFTNLYFYTITWHALHTSMRLARE 515
>gi|30261451|ref|NP_843828.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus anthracis str. Ames] >gi|50196926|ref|YP_052620.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus anthracis str. 'Ames Ancestor'] >gi|30255305|gb|AAP25314.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. Ames] >gi|50082988|gb|AAT70128.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. 'Ames Ancestor'] (694 aa)
Score = 1423, Expect = 3.0e-155, Identities = 312/706 (44%), Positives = 453/706 (64%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+SEEA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESEEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955367|gb|ABW06069.1| NrdE [Bacillus thuringiensis serovar galechiae] (694 aa)
Score = 1422, Expect = 4.9e-155, Identities = 312/706 (44%), Positives = 451/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y+I    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDINQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955383|gb|ABW06081.1| NrdE [Bacillus thuringiensis serovar sotto] (694 aa)
Score = 1420, Expect = 8.4e-155, Identities = 312/706 (44%), Positives = 450/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y+I    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAACGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDINQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|194014861|ref|ZP_03053478.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus pumilus ATCC 7061] >gi|194013887|gb|EDW23452.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus pumilus ATCC 7061] (700 aa)
Score = 1419, Expect = 9.4e-155, Identities = 298/688 (43%), Positives = 442/688 (64%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN--NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIR 707
           +I LN  I +  + G FQF+ D  AV  Y    I  N   F++++EK++YL   +YY+    ++YS + +  +FE A    FRF SFM A KFY  YALK+ D K   E +EDRI   AL F  G+++ AL +++ M+   YQ +TPTFLNAG+K+RGE VSC+LL V D++  I RA    +QLSK GGGV+  L+ LR  G  IK ++N   G++ VMK+L++ F YA+Q+GQRQG+G+ YLN FH DI  FLD+K+ +ADE +R+K+LS+GVV+PD    LARE+K    F P+ + +EYG+ + ++ + E Y+ L+ NP I K+ ++ RKL +++A ++ ESGYP+I+F D  N ++ ALN  +R+  SNLC+E+ Q +  S        +++G D+ CNLGSLNI  VM++  +  KTVK A  +L  ++   D+ +AP +   N   +++GLGAMNLHG+LA N++ Y+SEEA DF N FF  + Y++ K S+E AKE G  F  ++ + YA G YF+KY    EN +TPKTE+   L +   + IPTK+DW  L + + + G+ +S+ + +APTGSISY+ S T S+ PI+  IE R  G   + Y P   +   N+ +Y K AY++ +  ++D+ +  QQHVDQ IS TLFL +  TTRDLN+  +YA +K   ++YY R +
  S:     9 WIQLNNEI-MIQKEGKFQFDKDKEAVHSYFVDYINQNTVFFHNLEEKIDYLIENDYYEEEFLRQYSMADIKEVFEAAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISVVALFFAGGDKEKALEFVELMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGSAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFIELAREDKTAYTFYPHTVYKEYGQHLDEMDMEEMYDELVENPKIKKEKVNPRKLLEKLAVLRSESGYPYIMFQDNVNREH-ALNHISRVKFSNLCSEVLQASEVSSYADYDQEDEIGLDISCNLGSLNIMNVMKN-KSIEKTVKLATDSLTLVSETTDIRNAPAVRKANKAMKSIGLGAMNLHGYLAQNQMAYESEEARDFANTFFMMVNYYSIKRSSELAKEKGETFHRYEGSGYATGEYFNKYV---ENDFTPKTEKAAALFE--GMHIPTKEDWAALKDFVAENGMYHSYRLCIAPTGSISYVQSATASVMPIMERIEERTYGN-SKTYYPMPGLSAQNWFFY-KEAYDMDMFKVVDMIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHKGIKTLYYARTK 688
>gi|157955309|gb|ABW06025.1| NrdE [Bacillus thuringiensis serovar canadensis] (694 aa)
Score = 1419, Expect = 1.0e-154, Identities = 311/706 (44%), Positives = 452/706 (64%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS++E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVEERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|75759354|ref|ZP_00739451.1| Ribonucleoside-diphosphate reductase alpha chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168143195|ref|ZP_02586424.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus cereus G9842] >gi|74493186|gb|EAO56305.1| Ribonucleoside-diphosphate reductase alpha chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|157955363|gb|ABW06066.1| NrdE [Bacillus thuringiensis serovar dendrolimus] >gi|157955375|gb|ABW06075.1| NrdE [Bacillus thuringiensis serovar morrisoni] (694 aa)
Score = 1419, Expect = 1.1e-154, Identities = 311/706 (44%), Positives = 451/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEGVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|30019504|ref|NP_831135.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus cereus ATCC 14579] >gi|29895048|gb|AAP08336.1| Ribonucleoside-diphosphate reductase alpha chain [Bacillus cereus ATCC 14579] >gi|157955304|gb|ABW06021.1| NrdE [Bacillus thuringiensis serovar aizawai] >gi|157955327|gb|ABW06039.1| NrdE [Bacillus thuringiensis serovar entomocidus] >gi|157955331|gb|ABW06042.1| NrdE [Bacillus thuringiensis serovar galleriae] >gi|157955335|gb|ABW06045.1| NrdE [Bacillus thuringiensis serovar kurstaki] >gi|157955343|gb|ABW06051.1| NrdE [Bacillus thuringiensis serovar tolworthi] >gi|157955351|gb|ABW06057.1| NrdE [Bacillus thuringiensis serovar colmeri] >gi|157955379|gb|ABW06078.1| NrdE [Bacillus thuringiensis serovar ostriniae] >gi|157955395|gb|ABW06090.1| NrdE [Bacillus thuringiensis serovar tohokuensis] >gi|157955404|gb|ABW06097.1| NrdE [Bacillus thuringiensis serovar wuhanensis] (694 aa)
Score = 1419, Expect = 1.1e-154, Identities = 311/706 (44%), Positives = 451/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955317|gb|ABW06031.1| NrdE [Bacillus thuringiensis serovar pakistani] (694 aa)
Score = 1418, Expect = 1.3e-154, Identities = 311/706 (44%), Positives = 451/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPTKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955313|gb|ABW06028.1| NrdE [Bacillus thuringiensis serovar finitimus] (694 aa)
Score = 1418, Expect = 1.4e-154, Identities = 311/706 (44%), Positives = 452/706 (64%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955339|gb|ABW06048.1| NrdE [Bacillus thuringiensis serovar thuringiensis] (694 aa)
Score = 1417, Expect = 1.7e-154, Identities = 311/706 (44%), Positives = 451/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI ++S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y+I    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAHESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDINQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955371|gb|ABW06072.1| NrdE [Bacillus thuringiensis serovar indiana] (694 aa)
Score = 1416, Expect = 1.9e-154, Identities = 311/706 (44%), Positives = 450/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAARGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955359|gb|ABW06063.1| NrdE [Bacillus thuringiensis serovar darmstadiensis] (694 aa)
Score = 1416, Expect = 2.0e-154, Identities = 311/706 (44%), Positives = 450/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEGVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAACGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|42780544|ref|NP_977791.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus cereus ATCC 10987] >gi|42736464|gb|AAS40399.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus cereus ATCC 10987] >gi|157955323|gb|ABW06036.1| NrdE [Bacillus thuringiensis serovar tochigiensis] (694 aa)
Score = 1416, Expect = 2.1e-154, Identities = 311/706 (44%), Positives = 451/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E AKE G  F++F  + YA G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYASGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|196040726|ref|ZP_03108025.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus cereus NVH0597-99] >gi|196028516|gb|EDX67124.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus cereus NVH0597-99] (682 aa)
Score = 1416, Expect = 2.4e-154, Identities = 307/694 (44%), Positives = 447/694 (64%)
  Q:    32 ENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     2 QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 682
>gi|168135878|ref|ZP_02579107.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus cereus B4264] (694 aa)
Score = 1415, Expect = 2.5e-154, Identities = 311/706 (44%), Positives = 450/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++       + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKAIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESSEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157692409|ref|YP_001486871.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus pumilus SAFR-032] >gi|157681167|gb|ABV62311.1| ribonucleotide-diphosphate reductase alpha subunit [Bacillus pumilus SAFR-032] (700 aa)
Score = 1415, Expect = 3.0e-154, Identities = 297/688 (43%), Positives = 441/688 (64%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN--NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIR 707
           +I LN  I +  + G FQF+ D  AV  Y    I  N   F++++EK++YL   +YY+    ++YS + +  +FE A    FRF SFM A KFY  YALK+ D K   E +EDRI   AL F  G++  AL +++ M+   YQ +TPTFLNAG+K+RGE VSC+LL V D++  I RA    +QLSK GGGV+  L+ LR  G  IK ++N   G++ VMK+L++ F YA+Q+GQRQG+G+ YLN FH DI  FLD+K+ +ADE +R+K+LS+GVV+PD    LARE+K    F P+ + +EYG+ + ++ + E Y+ L+ NP + K+ ++ RKL +++A ++ ESGYP+I+F D  N ++ ALN  +R+  SNLC+E+ Q +  S        +++G D+ CNLGSLNI  VM++  +  KTVK A  +L  ++   D+ +AP +   N   +++GLGAMNLHG+LA N++ Y+SEEA DF N FF  + Y++ K S+E AKE G  F  ++ + YA G YF+KY    EN +TPKTE+   L +   + IPTK+DW  L + + + G+ +S+ + +APTGSISY+ S T S+ PI+  IE R  G   + Y P   +   N+ +Y K AY++ +  ++D+ +  QQHVDQ IS TLFL +  TTRDLN+  +YA +K   ++YY R +
  S:     9 WIQLNNEI-MIQKEGKFQFDKDKEAVHSYFVDYINQNTVFFHNLEEKIDYLIENDYYEEEFLRQYSMADIKEVFEAAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISVVALFFAGGDKAKALEFVELMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGSAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFIELAREDKTAYTFYPHTVYKEYGQHLDEMDMEEMYDELVENPKVKKEKVNPRKLLEKLAVLRSESGYPYIMFQDNVNREH-ALNHISRVKFSNLCSEVLQASEVSSYADYDQEDEIGLDISCNLGSLNIMNVMKN-KSIEKTVKLATDSLTLVSETTDIRNAPAVRKANKAMKSIGLGAMNLHGYLAQNQMAYESEEARDFANTFFMMVNYYSIKRSSELAKEKGETFHRYEGSGYATGEYFNKYV---ENDFTPKTEKAAALFE--GMHIPTKEDWAALKDFVAENGMYHSYRLCIAPTGSISYVQSATASVMPIMERIEERTYGN-SKTYYPMPGLSAQNWFFY-KEAYDMDMFKVVDMIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHKGIKTLYYARTK 688
>gi|157955391|gb|ABW06087.1| NrdE [Bacillus thuringiensis serovar thompsoni] (694 aa)
Score = 1414, Expect = 3.3e-154, Identities = 311/706 (44%), Positives = 449/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAACGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFKKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955387|gb|ABW06084.1| NrdE [Bacillus thuringiensis serovar subtoxicus] (694 aa)
Score = 1412, Expect = 5.6e-154, Identities = 310/706 (43%), Positives = 450/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLS  GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSNIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955408|gb|ABW06100.1| NrdE [Bacillus cereus] (694 aa)
Score = 1412, Expect = 6.4e-154, Identities = 310/706 (43%), Positives = 449/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLS  GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSNIGGGVALNLSKLRARGEQIKGIDNAACGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955400|gb|ABW06094.1| NrdE [Bacillus thuringiensis serovar toumanoffi] (694 aa)
Score = 1411, Expect = 7.5e-154, Identities = 310/706 (43%), Positives = 449/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLS  GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKARQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSNIGGGVALNLSKLRARGEQIKGIDNAARGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|70727161|ref|YP_254077.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus haemolyticus JCSC1435] >gi|68447887|dbj|BAE05471.1| ribonuceloside diphosphate reductase major subunit [Staphylococcus haemolyticus JCSC1435] (701 aa)
Score = 1407, Expect = 2.6e-153, Identities = 314/709 (44%), Positives = 442/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVY-VPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    +NG F  E D  A+  YLE EI      F+S  E+L YL   N+Y FNVF KYS   L+ I E AK+ NF F+S+M A KFY  YALK+ D   Y E +   +   AL    GN+Q A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++PV K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ +++EYG  + DI + + Y++++ NPNI KK   AR++   IA+ Q +SGYP+++F D AN+ ++  N  +I MSNLCTEI Q+   S++N     +++  D+ CNLGSLNI  VME G     +V   + AL  ++  A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N FF  M Y++ + S E AKE G V+++F+ + YA G YF+ YT  E   + PK E+VK L     + IPT +DW  L E +++ GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y +P    +    M+Y K A+      +ID+ +  Q HVDQ IS  L++    +TR+L++ Y+YA +K   S+YY R +   ++      ECT+C I
  S:     8 KYNHIELNNEVTKRKDNGFFNLEKDQEALAVYLE-EIHDKTIYFDSEIERLHYLVDNNFY-FNVFDKYSEEDLVEITEFAKSINFEFASYMSASKFYKDYALKTNDKSQYLEDYNQHVAIVALYLADGNKQQAKQFILAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPVAKALEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKQEYGVTLDDIDLEKYYDDMVANPNIVKKKKDAREMLNMIAQTQLQSGYPYLMFKDNANKVHANSNIGQIKMSNLCTEIFQLQETSVINDYGIEDEIKRDISCNLGSLNIVNVMETG-KIKDSVHTGMDALTVVSDEANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANTFFMMMNYYSIERSMEIAKERGEVYQDFEQSDYASGKYFEFYTSQE---FEPKFEKVKRLFDH--IDIPTAKDWKALQEQVQQHGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPET---MWYYKSAFNTDQMKLIDLIATIQTHVDQGISTILYVNSEISTRELSRLYVYAHHKGLKSLYYTRNKLLSVE------ECTSCAI 701
>gi|157955355|gb|ABW06060.1| NrdE [Bacillus thuringiensis serovar dakota] (694 aa)
Score = 1406, Expect = 2.7e-153, Identities = 310/706 (43%), Positives = 449/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI  +S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEGVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAARGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIADESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|157955347|gb|ABW06054.1| NrdE [Bacillus thuringiensis serovar alesti] (694 aa)
Score = 1402, Expect = 9.1e-153, Identities = 309/706 (43%), Positives = 448/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +YS   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLS  GGGVA  L+ LR  G  IKGI N A G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI  +S EA +F   FF  + Y++ + S E A E G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVPFNSVAERMEYMKEHDYY-YNVLDEYSLEEVEGVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVSKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSNIGGGVALNLSKLRARGEQIKGIDNAACGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIADESAEAKEFARTFFMMLNYYSIEKSMEIATEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 694
>gi|56964872|ref|YP_176603.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus clausii KSM-K16] >gi|56911115|dbj|BAD65642.1| ribonucleoside-diphosphate reductase alpha chain [Bacillus clausii KSM-K16] (698 aa)
Score = 1400, Expect = 1.4e-152, Identities = 295/706 (41%), Positives = 445/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANE--KNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++ LN  + +  ++G +QFE D  AV  Y    I  N   F+ ++EK++YL   +YY+  + + Y+   + ++ + A    FRF SFM A KFY  YALK+ D     E +EDR+   +L FG G+ + A   ++ M++  +Q ATPTFLNAG+K+RGE VSC+LL + D++  I RA    +QLSK GGGVA  L+ LR  G  IK + N   G++ VMK+L++ F YA+Q+GQRQG+GA YLN FH DI  FLD+++ +ADE +R+K+LS+GVV+PD    L RE+KD  LF P+ + + YG+   ++ + E YE L+++P + K+ I+ R+LFQ++A ++ ESGYP+I+F D  N+   N  ++N +  SNLC+EI Q +  S        +++G D+ CNLGS+NI  VME+  +   TV  A  AL  ++   ++++AP +  GN   +++GLGAMNLHG+LA   I Y+SEEA DF N FF  M Y + K S E A++ G  +  ++ + YADGSYF KY    EN +TPK ++VK L     + +PTK+DW  L   + + GL +S+ +A+APTGSISY+ S T S+ PI+  IE R  G   + Y P   ++ NN+ +Y K AY++ +  ++D+ +  QQHVDQ IS TLFL +  TTRDLN+  +YA +K   ++YY R + +  +D+     C +CV+
  S:     7 WVQLNNEL-MITKDGGYQFEKDKEAVHSYFVDYINQNTVFFHDLEEKIDYLIENDYYEEELLRLYTIDEIKAVMDIAYNKKFRFPSFMSAFKFYNDYALKTNDKSKILERYEDRVAIVSLFFGNGDVEKAKALVNAMISQEFQPATPTFLNAGRKRRGELVSCFLLEINDSLNDISRAVDISMQLSKLGGGVALNLSKLRAKGEAIKDVANATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHADINDFLDTRKISADEDVRVKTLSIGVVIPDKFIELMREDKDAYLFYPHTVYKAYGQHFDEMDMEEMYETLVDDPRVRKEKINPRRLFQKLAILRSESGYPYIMFADNVNKAHANGHISN-VKFSNLCSEILQASEVSTYTDYGEEDEIGLDISCNLGSINIMNVMEN-KSLENTVSLATDALTRVSESTNITNAPAVRRGNKLMKSIGLGAMNLHGYLAKQHIAYESEEARDFANTFFMAMNYFSIKRSAEIARDQGETYHGYEGSTYADGSYFKKYI---ENDFTPKFDKVKALFD--GMFVPTKEDWQALQAFVAEHGLYHSYRLAIAPTGSISYVQSATASVMPIMERIEERTYGN-SKTYYPMPGLNANNWFFY-KEAYDMDMFKVVDMIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHKGIKTLYYARTK-DTGQDN-----CLSCVV 698
>gi|27467431|ref|NP_764068.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus epidermidis ATCC 12228] >gi|57866331|ref|YP_187990.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus epidermidis RP62A] >gi|27314974|gb|AAO04110.1|AE016745_209 ribonuceloside diphosphate reductase major subunit [Staphylococcus epidermidis ATCC 12228] >gi|57636989|gb|AAW53777.1| ribonucleoside-diphosphate reductase 2, alpha subunit [Staphylococcus epidermidis RP62A] (701 aa)
Score = 1399, Expect = 2.0e-152, Identities = 309/709 (43%), Positives = 448/709 (63%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVY-VPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    +NG F  E D  A++ YLE EI      F+   E+L YL   N+Y FNVF+KYS + LI I E AK+ +F+F+S+M A KFY  YALK+ D   + E +   +   AL    GN + A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++PV K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ +++EYG  + DI + + Y++++ NPNI KK   AR++   IA+ Q +SGYP+++F D AN+ ++  N  +I MSNLCTEI Q+   S++N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++  A++ +AP ++  NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M Y++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + PK E+V++L     + IPT  DW +L   ++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y +P    +    M+Y K A+      +ID+ +  Q HVDQ IS  L++    +TR+L++ Y+YA +K   S+YY R +   ++      ECT+C I
  S:     8 KYNHIELNNEVTKRKDNGFFDLEKDQEALKVYLE-EIHDKMISFDDEIERLHYLVDNNFY-FNVFEKYSEAELIEITEYAKSIHFQFASYMSASKFYKDYALKTNDKTKFLEDYNQHVAIVALYLANGNVKQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPVAKALEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKQEYGVTLDDIDLEKYYDDMVANPNIDKKKKDAREMLNMIAQTQLQSGYPYLMFKDNANKVHANSNIGQIKMSNLCTEIFQLQETSVINDYGIEDEIKRDISCNLGSLNIVNVMESG-KFRDSVFTGMDALTVVSDEANIQNAPGVKKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMIMNYYSIERSMEIAKERGEKYQDFEQSDYANGKYFEFYTSQE---FEPKFEKVRQLFD--GIDIPTSNDWKELQNKVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPET---MWYYKSAFNTDQMKLIDLVATIQTHVDQGISTILYVNSEISTRELSRLYVYAHHKGLKSLYYTRNKLLSVE------ECTSCAI 701
>gi|168714124|ref|ZP_02746401.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile QCD-63q42] (699 aa)
Score = 1398, Expect = 2.4e-152, Identities = 299/707 (42%), Positives = 444/707 (62%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++I LN  + + +E G +Q E D  A+  Y+E  I+P  +KFN+++E+L+YL  E YY   V  +YS   + +I++    + F F S+M A KFY  YALKS D K   E + D+++  AL  G G++  AL   D+++   +Q ATPTFLNAG+K+ GE VSC+LL VED+ E I  A ++   LSK GGGVA  L+ LR  G  IK I+  A G++ V K+LE  FSY NQ+G RQG+GAVYL  FHPD    +D+K+ NADEKIR+ +LSLG ++PD    LA +N+    F P+ + ++YG  + +I + E Y+ L+N+ +I KK I+ R++  +IA++Q ESGYP++++ D AN +++  +  II MSNLC EI Q  TPS +       + G+D+ CNLGSLNIA VM D      TV+ AI+AL  +A   D+   PT+ N NSK+ ++GLGAMNLHG+L    I Y S++A+DF+N+FF  + Y++ KAS + A E    FE F  ++Y  G      ++  E  + PK+E+V+ L +   + IPTK+DW +L +++K+ G+ N++LMAVAPT SISY+ + T S+ PI  P+E+R  G    +Y   +    N+ M Y + AY + +  +ID+ +  Q HVDQ IS TLF+T+  TTRD+ + YIYA+ K   S+YY R +  + +D+    EC  C +
  S:     2 NWIELNNQVIIKNEQGKYQLEKDKEALSSYIEAFIQPKLRKFNNLEERLKYLIDEGYYSKEVINQYSIDVIKNIYDMIDKHKFEFQSYMSANKFYQNYALKSNDGKEILETYNDKVLIVALTLGNGDKDLALNLADKIVKQEFQPATPTFLNAGRKRAGEMVSCFLLSVEDSTEGISYAISSSNHLSKIGGGVALNLSKLRASGESIKDIEGAAGGVVGVAKMLEQSFSYFNQMGARQGSGAVYLTVFHPDFELLMDTKKINADEKIRLATLSLGAIIPDKFMELAEKNEVAYAFYPHTVYKKYGVSLDEIEMDEWYDKLVNDSDIRKKEINPRQMLTKIAQMQQESGYPYVVYIDTANREHTLKDVGIIKMSNLCCEIFQYQTPSEIEGYGGKNEWGQDISCNLGSLNIANVM-DNKTIESTVETAIRALSFVADSTDIKPVPTVSNSNSKSHSIGLGAMNLHGYLVRENILYTSDDAIDFSNVFFAMVRYYSIKASMKIAIERNQTFEGFDKSEYVKGRNSKVLSKYYEQSYLPKSEKVRALFE--GIYIPTKEDWTKLLDEVKEKGIYNAYLMAVAPTQSISYVQNATSSIMPITEPVEVRTYGDSTTIYPMPFL--TNDNMLYYQSAYRMDMRKVIDLVATVQNHVDQGISTTLFVTDEKTTRDIARHYIYAYKKGLKSLYYTRTK--MTRDTH---ECLVCSV 699
>gi|85726185|gb|ABC79615.1| ribonucleotide reductase alpha subunit [Borrelia hermsii DAH] (690 aa)
Score = 1398, Expect = 2.9e-152, Identities = 316/706 (44%), Positives = 444/706 (62%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++ LN  I +  ++G ++ E DL A+  +LE E+K    +F++  E++ YL   N Y+ + +K YS + ++ I++  +  NF+F S+M A KFY  YALK  +  TY E +EDRI+  +L    G  + AL    EM+  RYQ ATPTFLNAGK+ RGE VSC+LL V D++ SI    ++ +QLSK GGGVA  L+N+R  G  I+GI N A GIIPVMK+LED F+YA+Q+GQR+GAGAVYLN FH DI  FLD+K+ NADEK R+++LSLGV++PD  F +A++ +    F+PY + +  G+ M++I    EY+ L +NPNI KK I AR +  +IA +QFESGYP+I++    N  N      +I MSNLCTEI QI TPSI+      + +G DV C LGSLNI  V+   +NF  TV  A++AL S+    D+ +AP+I   N+   AVGLG MNLHGFL  NKI Y+S EA+DF   FF  + +++ K+S   AK  G  F++FK ++Y +G+YF+ Y   +   ++PKTE VK +    K  IP K DW  L  D++  GL +++ +AVAPT SISY+ + T SL PIV P+E R  G     Y P   +   N +++ K AY + +  +ID+ S AQ+HVDQ IS  L++T   +TR+L K YIYA NK   S+YY R +   +       EC  C I
  S:     3 HLELNNEIMVL-KDGFYRLEKDLEALSVFLE-EVKAKSLRFSNPNERMHYLIDNNLYE-DFYKNYSEAQILEIYKLVEFENFKFKSYMSASKFYKDYALK-LNGDTYLESYEDRIIAVSLFLADGCFELALKLASEMIKQRYQPATPTFLNAGKRVRGELVSCFLLEVGDSLNSITFNISSAMQLSKIGGGVALNLSNIRARGEEIRGICNIAKGIIPVMKLLEDGFNYADQMGQRKGAGAVYLNIFHYDIEDFLDTKKINADEKSRVQTLSLGVIIPDKFFEIAKQGQSYYAFAPYSLYKATGRFMNEIDFDLEYDLLASNPNILKKEIKARDMLVRIARLQFESGYPYIMYQTACNLNNPLKGIGKIKMSNLCTEIFQIQTPSIIGDYGEGDLIGYDVSCILGSLNIVNVVN--SNFEHTVDIAMQALTSVCDKTDIKNAPSISKANNDYHAVGLGVMNLHGFLIKNKIPYESAEAIDFVRTFFMLLNFYSIKSSMNIAKTRGKTFKDFKQSEYYNGNYFNMYLTED---FSPKTEVVKGIFSGIK--IPLKSDWESLKRDVQMHGLYHAYRLAVAPTQSISYIQNATTSLMPIVEPVEARVYGN-STTYYPMPYLSKENALFF-KSAYYMDMRKLIDLISEAQRHVDQGISTLLYVTNETSTRELVKLYIYAKNKGLKSLYYTRNKNLSVD------ECILCAI 690
>gi|196126123|ref|ZP_03117872.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile ATCC 43255] (699 aa)
Score = 1397, Expect = 3.9e-152, Identities = 299/707 (42%), Positives = 444/707 (62%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++I LN  + + +E G +Q E D  A+  Y+E  I+P  +KFN+++E+L+YL  E YY   V  +YS   + +I++    + F F S+M A KFY  YALKS D K   E + D+++  AL  G G++  AL   D+++   +Q ATPTFLNAG+K+ GE VSC+LL VED+ E I  A ++   LSK GGGVA  L+ LR  G  IK I+  A G++ V K+LE  FSY NQ+G RQG+GAVYL  FHPD    +D+K+ NADEKIR+ +LSLG ++PD    LA +N+    F P+ + ++YG  + +I + E Y+ L+N+ +I KK I+ R++  +IA++Q ESGYP++++ D AN +++  +  II MSNLC EI Q  TPS +       + G+D+ CNLGSLNIA VM D      TV+ AI+AL  +A   D+   PT+ N NSK+ ++GLGAMNLHG+L    I Y S++A+DF+N+FF  + Y++ KAS + A E    FE F  ++Y  G      ++  E  + PK+E+V+ L +   + IPTK+DW +L +++K+ G+ N++LMAVAPT SISY+ + T S+ PI  P+E+R  G    +Y   +    N+ M Y + AY + +  +ID+ +  Q HVDQ IS TLF+T+  TTRD+ + YIYA+ K   S+YY R +  + +D+    EC  C +
  S:     2 NWIELNNQVIIKNEQGKYQLEKDKEALSSYIEEFIQPKLRKFNNLEERLKYLIDEGYYSKEVINQYSIDVIKNIYDMIDKHKFEFQSYMSANKFYQNYALKSNDGKEILETYNDKVLIVALTLGNGDKDLALNLADKIVKQEFQPATPTFLNAGRKRAGEMVSCFLLSVEDSTEGISYAISSSNHLSKIGGGVALNLSKLRASGESIKDIEGAAGGVVGVAKMLEQSFSYFNQMGARQGSGAVYLTVFHPDFELLMDTKKINADEKIRLATLSLGAIIPDKFMELAEKNEVAYAFYPHTVYKKYGVSLDEIEMDEWYDKLVNDSDIRKKEINPRQMLTKIAQMQQESGYPYVVYIDTANREHTLKDVGIIKMSNLCCEIFQYQTPSEIEGYGGKNEWGQDISCNLGSLNIANVM-DNKTIESTVETAIRALSFVADSTDIKPVPTVSNSNSKSHSIGLGAMNLHGYLVRENILYTSDDAIDFSNVFFAMVRYYSIKASMKIAIERNQTFEGFDKSEYVKGRNSKVLSKYYEQSYLPKSEKVRALFE--GIYIPTKEDWTKLLDEVKEKGIYNAYLMAVAPTQSISYVQNATSSIMPITEPVEVRTYGDSTTIYPMPFL--TNDNMLYYQSAYRMDMRKVIDLVATVQNHVDQGISTTLFVTDEKTTRDIARHYIYAYKKGLKSLYYTRTK--MTRDTH---ECLVCSV 699
>gi|57014144|gb|AAT68709.2| ribonucleoside reductase alpha subunit [Borrelia hermsii] (690 aa)
Score = 1396, Expect = 4.9e-152, Identities = 316/706 (44%), Positives = 444/706 (62%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++ LN  I +  ++G ++ E DL A+  +LE E+K    +F++  E++ YL   N Y+ + +K YS + ++ I++  +  NF+F S+M A KFY  YALK  +  TY E +EDRI+  +L    G  + AL    EM+  RYQ ATPTFLNAGK+ RGE VSC+LL V D++ SI    ++ +QLSK GGGVA  L+N+R  G  I+GI N A GIIPVMK+LED F+YA+Q+GQR+GAGAVYLN FH DI  FLD+K+ NADEK R+++LSLGV++PD  F +A++ +    F+PY + +  G+ M++I    EY+ L +NPNI KK I AR +  +IA +QFESGYP+I++    N  N      +I MSNLCTEI QI TPSI+      + +G DV C LGSLNI  V+   +NF  TV  A++AL S+    D+ +AP+I   N+   AVGLG MNLHGFL  NKI Y+S EA+DF   FF  + +++ K+S   AK  G  F++FK ++Y +G+YF+ Y   +   ++PKTE VK +    K  IP K DW  L  D++  GL +++ +AVAPT SISY+ + T SL PIV P+E R  G     Y P   +   N +++ K AY + +  +ID+ S AQ+HVDQ IS  L++T   +TR+L K YIYA NK   S+YY R +   +       EC  C I
  S:     3 HLELNNEIMVL-KDGFYRLEKDLEALSVFLE-EVKAKSLRFSNPNERMHYLIDNNLYE-DFYKNYSEAQILEIYKLVELENFKFKSYMSASKFYKDYALK-LNGDTYLESYEDRIIAVSLFLADGCFEFALKLASEMIKQRYQPATPTFLNAGKRVRGELVSCFLLEVGDSLNSITFNISSAMQLSKIGGGVALNLSNIRARGEEIRGICNIAKGIIPVMKLLEDGFNYADQMGQRKGAGAVYLNIFHYDIEDFLDTKKINADEKSRVQTLSLGVIIPDKFFEIAKQGQSYYAFAPYSLYKATGRFMNEIDFDLEYDLLASNPNILKKEIKARDMLVRIARLQFESGYPYIMYQTACNLNNPLKGIGKIKMSNLCTEIFQIQTPSIIGDYGEGDLIGYDVSCILGSLNIVNVVN--SNFEYTVDIAMQALTSVCDKTDIKNAPSISKANNDYHAVGLGVMNLHGFLIKNKIPYESAEAIDFVRTFFMLLNFYSIKSSMNIAKTRGKTFKDFKQSEYYNGNYFNMYLTED---FSPKTEVVKGIFSGIK--IPLKSDWENLKRDVQMHGLYHAYRLAVAPTQSISYIQNATTSLMPIVEPVEARVYGN-STTYYPMPYLSKENALFF-KSAYYMDMRKLIDLISEAQRHVDQGISTLLYVTNETSTRELVKLYIYAKNKGLKSLYYTRNKNLSVD------ECILCAI 690
>gi|126700616|ref|YP_001089513.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile 630] >gi|115252053|emb|CAJ69889.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile 630] (699 aa)
Score = 1395, Expect = 5.5e-152, Identities = 299/707 (42%), Positives = 443/707 (62%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++I LN  + + +E G +Q E D  A+  Y+E  I+P  +KFN+++E+L+YL  E YY   V  +YS   + +I++    + F F S+M   KFY  YALKS D K   E + D+++  AL  G GN+  AL   D+++   +Q ATPTFLNAG+K+ GE VSC+LL VED+ E I  A ++   LSK GGGVA  L+ LR  G  IK I+  A G++ V K+LE  FSY NQ+G RQG+GAVYL  FHPD    +D+K+ NADEKIR+ +LSLG ++PD    LA +N+    F P+ + ++YG  + +I + E Y+ L+N+ +I KK I+ R++  +IA++Q ESGYP++++ D AN +++  +  II MSNLC EI Q  TPS +       + G+D+ CNLGSLNIA VM D      TV+ AI+AL  +A   D+   PT+ N NSK+ ++GLGAMNLHG+L    I Y S++A+DF+N+FF  + Y++ KAS + A E    FE F  ++Y  G      ++  E  + PK+E+V+ L +   + IPTK+DW +L +++K+ G+ N++LMAVAPT SISY+ + T S+ PI  P+E+R  G    +Y   +    N+ M Y + AY + +  +ID+ +  Q HVDQ IS TLF+T+  TTRD+ + YIYA+ K   S+YY R +  + +D+    EC  C +
  S:     2 NWIELNNQVIIKNEQGKYQLEKDKEALSSYIEEFIQPKLRKFNNLEERLKYLIDEGYYSKEVINQYSIDVIKNIYDMIDKHKFEFQSYMSVNKFYQNYALKSNDGKEILETYNDKVLIVALTLGNGNKDLALNLADKIVKQEFQPATPTFLNAGRKRAGEMVSCFLLSVEDSTEGISYAISSSNHLSKIGGGVALNLSKLRASGESIKDIEGAAGGVVGVAKMLEQSFSYFNQMGARQGSGAVYLTVFHPDFELLMDTKKINADEKIRLATLSLGAIIPDKFMELAEKNEVAYAFYPHTVYKKYGVSLDEIEMDEWYDKLVNDSDIRKKEINPRQMLTKIAQMQQESGYPYVVYIDTANREHTLKDVGIIKMSNLCCEIFQYQTPSEIEGYGGKNEWGQDISCNLGSLNIANVM-DNKTIESTVETAIRALSFVADSTDIKPVPTVSNSNSKSHSIGLGAMNLHGYLVRENILYTSDDAIDFSNVFFAMVRYYSIKASMKIAIERNQTFEGFDKSEYVKGRNSKVLSKYYEQSYLPKSEKVRALFE--GIYIPTKEDWTKLLDEVKEKGIYNAYLMAVAPTQSISYVQNATSSIMPITEPVEVRTYGDSTTIYPMPFL--TNDNMLYYQSAYRMDMRKVIDLVATVQNHVDQGISTTLFVTDEKTTRDIARHYIYAYKKGLKSLYYTRTK--MTRDTH---ECLVCSV 699
>gi|145953439|ref|ZP_01802447.1| hypothetical protein CdifQ_04003427 [Clostridium difficile QCD-32g58] >gi|168695420|ref|ZP_02727697.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile QCD-37x79] >gi|168725897|ref|ZP_02758174.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile QCD-76w55] >gi|168729956|ref|ZP_02762233.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile QCD-97b34] >gi|196161463|ref|ZP_03122024.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile CIP 107932] (699 aa)
Score = 1394, Expect = 7.5e-152, Identities = 299/707 (42%), Positives = 444/707 (62%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++I LN  + + +E G +Q E D  A+  Y+E  I+P  +KFN+++E+L+YL  E YY   V  +YS   + +I++    + F F S+M A KFY  YALKS D K   E + D+++  AL  G G++  AL   D+++   +Q ATPTFLNAG+K+ GE VSC+LL VED+ E I  A ++   LSK GGGVA  L+ LR  G  IK I+  A G++ V K+LE  FSY NQ+G RQG+GAVYL  FHPD    +D+K+ NADEKIR+ +LSLG ++PD    LA +N+    F P+ + ++YG  + +I + E Y+ L+N+ +I KK I+ R++  +IA++Q ESGYP++++ D AN +++  +  II MSNLC EI Q  TPS +       + G+D+ CNLGSLNIA VM D      TV+ AI+AL  +A   D+   PT+ N NSK+ ++GLGAMNLHG+L    I Y S++A+DF+N+FF  + Y++ KAS + A E    FE F  ++Y  G      ++  E  + PK+E+V+ L +   + IPTK+DW +L +++K+ G+ N++LMAVAPT SISY+ + T S+ PI  P+E+R  G    +Y   +    N+ M Y + AY + +  +ID+ +  Q HVDQ IS TLF+T+  TTRD+ + YIYA+ K   S+YY R +  + +D+    EC  C +
  S:     2 NWIELNNQVIIKNEQGKYQLEKDKEALSSYIEEFIQPKLRKFNNLEERLKYLIDEGYYLKEVINQYSIDVIKNIYDMIDKHKFEFQSYMSANKFYQNYALKSNDGKEILETYNDKVLIVALTLGNGDKDLALNLADKIVKQEFQPATPTFLNAGRKRAGEMVSCFLLSVEDSTEGISYAISSSNHLSKIGGGVALNLSKLRASGESIKDIEGAAGGVVGVAKMLEQSFSYFNQMGARQGSGAVYLTVFHPDFELLMDTKKINADEKIRLATLSLGAIIPDKFMELAEKNEVAYAFYPHTVYKKYGVSLDEIEMDEWYDKLVNDSDIRKKEINPRQMLTKIAQMQQESGYPYVVYIDTANREHTLKDVGIIKMSNLCCEIFQYQTPSEIEGYGGKNEWGQDISCNLGSLNIANVM-DNKTIESTVETAIRALSFVADSTDIKPVPTVSNSNSKSHSIGLGAMNLHGYLVRENILYTSDDAIDFSNVFFAMVRYYSIKASMKIAIERNQTFEGFDKSEYVKGRNSKVLSKYYEQSYLPKSEKVRALFE--GIYIPTKEDWTKLLDEVKEKGIYNAYLMAVAPTQSISYVQNATSSIMPITEPVEVRTYGDSTTIYPMPFL--TNDNMLYYQSAYRMDMRKVIDLVATVQNHVDQGISTTLFVTDEKTTRDIARHYIYAYKKGLKSLYYTRTK--MTRDTH---ECLVCSV 699
>gi|154686151|ref|YP_001421312.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus amyloliquefaciens FZB42] >gi|154352002|gb|ABS74081.1| NrdE [Bacillus amyloliquefaciens FZB42] (700 aa)
Score = 1392, Expect = 1.4e-151, Identities = 299/706 (42%), Positives = 445/706 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNN---RIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I +  ++G FQF+ D  AV  Y    I  N   F+ +KEKL+YL    YY+      YS   +  +F+ A    FRF SFM A KFY  YALK+ D K   E +EDRI   AL F  G+ + A  Y++ M+   YQ +TPTFLNAG+K+RGE VSC+LL V D++  I RA    +QLSK GGGV+  L+ LR  G  IK ++N   G++ VMK+L++ F YA+Q+GQRQG+GA YLN FH DI  FLD+K+ +ADE +R+K+LS+GVV+PD    LARE+K   +F P+ I +EYG+ M ++ +T  YE L++NP + K+ ++ARKL +++A ++ ESGYP+I+F D  N++++  NN   ++  SNLC+E+ Q +  S        +++G D+ CNLGSLNI  VM+   +  +TVK A  +L  ++   D+ +AP +   N   +++GLGAMNLHG+LA N I Y+S EA DF N FF  + +++ + S E AKE G  FE+++ + YA G YF+KY + E   ++P  E++  L +   + IPT +DW +L   + + G+ +S+ + +APTGSISY+ S T S+ PI+  IE R  G   + Y P   +  NN+ +Y K AY++ +  ++D+ +  QQH+DQ IS TLFL +  TTRDLN+  +YA ++   +IYY R + +  +DS     C +CV+
  S:     9 WIQLNNEI-MIQQDGKFQFDKDKEAVHSYFVDYINQNTVYFHDLKEKLDYLIENQYYEEEFLSLYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKRILERYEDRISIVALFFANGDTEKAKEYVNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMTAMYEELVDNPRVKKEKVNARKLLEKLAVLRSESGYPYIMFQDNVNKEHA--NNHVSKVKFSNLCSEVLQASQVSAYTDYDEEDEIGLDISCNLGSLNILNVMKH-KSIERTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANTFFMMVNFYSIQRSAELAKEKGETFEHYEGSTYATGEYFNKYIEKE---FSPAYEKIAALFE--GMHIPTIEDWKELKAFVAENGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGN-SKTYYPMPGLASNNWFFY-KEAYDMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTK-DTGQDS-----CLSCVV 700
>gi|4490609|emb|CAB38642.1| ribonucelotide reductase major subunit [Staphylococcus aureus] (718 aa)
Score = 1390, Expect = 2.0e-151, Identities = 304/709 (42%), Positives = 443/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    E+G F  E D  A+  YLE E+K     F++  E+L YL   ++Y FNVF  YS + LI I + AK+  F F+S+M A KF+  YALK+ D   Y E +   +   AL    GN+  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++P+ K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ ++ EYG  + DI + + Y++++ NPN+ KK  +AR++   IA+ Q +SGYP+++F D AN  +   N  +I MSNLCTEI Q+   SI+N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++ +A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M +++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + P+ E+V+EL     +AIPT +DW +L +D++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y   +       M+Y K A+      +ID+ +  Q H+DQ IS  L++    +TR+L + Y+YA  K   S+YY R +   ++      ECT+C I
  S:    25 KYNHIELNNEVTKRREDGFFSLEKDQEALVAYLE-EVKDKTIFFDTEIERLRYLVDNDFY-FNVFDIYSEADLIEITDYAKSIPFNFASYMSASKFFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNAREMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEIKRDISCNLGSLNIVNVMESG-KFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEKSDYANGKYFEFYTTQE---FEPQFEKVRELFD--GMAIPTSEDWKKLQQDVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFL--SPQTMWYCKSAFNTDQMKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE------ECTSCSI 718
>gi|15923721|ref|NP_371255.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus Mu50] >gi|15926408|ref|NP_373941.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus N315] >gi|156979059|ref|YP_001441318.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus Mu3] >gi|13700622|dbj|BAB41919.1| ribonuceloside diphosphate reductase major subunit [Staphylococcus aureus subsp. aureus N315] >gi|14246500|dbj|BAB56893.1| ribonuceloside diphosphate reductase major subunit [Staphylococcus aureus subsp. aureus Mu50] >gi|156721194|dbj|BAF77611.1| ribonuceloside diphosphate reductase major subunit [Staphylococcus aureus subsp. aureus Mu3] (718 aa)
Score = 1390, Expect = 2.1e-151, Identities = 304/709 (42%), Positives = 444/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    E+G F  E D  A+  YLE E+K     F++  E+L YL   ++Y FNVF  YS + LI I + AK+ +F F+S+M A KF+  YALK+ D   Y E +   +   AL    GN+  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++P+ K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ ++ EYG  + DI + + Y++++ NPN+ KK  +AR++   IA+ Q +SGYP+++F D AN  +   N  +I MSNLCTEI Q+   SI+N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++ +A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M +++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + P+ E+V+EL     +AIPT +DW +L +D++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y   +       M+Y K A+      +ID+ +  Q H+DQ IS  L++    +TR+L + Y+YA  K   S+YY R +   ++      ECT+C I
  S:    25 KYNHIELNNEVTKRREDGFFSLEKDQEALVAYLE-EVKDKTIFFDTEIERLRYLVDNDFY-FNVFDIYSEADLIEITDYAKSISFNFASYMSASKFFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNAREMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEIKRDISCNLGSLNIVNVMESG-KFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEKSDYANGKYFEFYTTQE---FEPQFEKVRELFD--GMAIPTSEDWKKLQQDVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFL--SPQTMWYYKSAFNTDQMKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE------ECTSCSI 718
>gi|16078801|ref|NP_389620.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus subtilis subsp. subtilis str. 168] >gi|1710384|sp|P50620|RIR1_BACSU Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) >gi|1154632|emb|CAA92810.1| NrdE [Bacillus subtilis] >gi|2634122|emb|CAB13622.1| ribonucleoside-diphosphate reductase (major subunit) [Bacillus subtilis subsp. subtilis str. 168] (700 aa)
Score = 1390, Expect = 2.5e-151, Identities = 299/706 (42%), Positives = 442/706 (62%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNN---RIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I +  ++G FQF+ D  AV  Y    I  N   F+++KEKL+YL    YY+      YS   +  +F+ A    FRF SFM A KFY  YALK+ D K   E +EDRI   AL F  G+ + A  Y++ M+   YQ +TPTFLNAG+K+RGE VSC+LL V D++  I RA    +QLSK GGGV+  L+ LR  G  IK ++N   G++ VMK+L++ F YA+Q+GQRQG+GA YLN FH DI  FLD+K+ +ADE +R+K+LS+GVV+PD    LARE+K   +F P+ I +EYG+ M ++ + E Y+  ++NP + K+ I+ RKL +++A ++ ESGYP+I+F D  N+ ++  NN   ++  SNLC+E+ Q +  S        +++G D+ CNLGSLNI  VME   +  KTVK A  +L  ++   D+ +AP +   N   +++GLGAMNLHG+LA N I Y+S EA DF N FF  + +++ + S E AKE G  F+ ++ + YA G YFDKY   +   ++PK E++  L +   + IPT +DW +L   + + G+ +S+ + +APTGSISY+ S T S+ PI+  IE R  G   + Y P   +  NN+ +Y K AY++ +  ++D+ +  QQH+DQ IS TLFL +  TTRDLN+  +YA ++   +IYY R + +  +DS     C +CV+
  S:     9 WIQLNNEI-MIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLSLYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEYVNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLRSESGYPYIMFQDNVNKVHA--NNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVMEH-KSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANTFFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTD---FSPKYEKIANLFE--GMHIPTTEDWKKLKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGN-SKTYYPMPGLASNNWFFY-KEAYDMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTK-DTGQDS-----CLSCVV 700
>gi|126650013|ref|ZP_01722246.1| ribonucleotide-diphosphate reductase alpha subunit [Bacillus sp. B14905] >gi|126593185|gb|EAZ87147.1| ribonucleotide-diphosphate reductase alpha subunit [Bacillus sp. B14905] (697 aa)
Score = 1389, Expect = 3.0e-151, Identities = 304/707 (42%), Positives = 433/707 (61%)
  Q:    19 SYISLNATI-KLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITK-KYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEY-KLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +Y+ LN  +   +   G  + E D  A  +Y    +    + F  I+EK+ YL  E YY+ +    Y   F+  +++KA  YNFRF SFM A KFY +YA+KS D +   E +EDRIV  AL   +GN   A   ++ MM   YQ ATPT LN+GKK RGE VSC+ L ++D+M SI       L+LS+ GGGV   LT+LR  G PIK I N+A+G+IPV K+LE+ FSY+NQLGQR G+G VYLN FH DI  F+ SK+ NAD+KIR+ +LS G+++P I F L + +KD+ LFSPYDI + YGK MS+ISI+E Y  LL+NP I K K ++AR+L+ ++ + QFESGYPF +FDD  NE +   N  R+ MSNLCTEI Q+   S++       + G DV CNLGS++I    +   +F   +  A+  L +++ +  + + P++   N    +VGLG MNLHG L T  I Y S++++DF + F   M Y++ K+S E AKE    F  F+++ YA GSYFD+Y    E       E    +LK    + I T + W  L ED+ ++GL +S+ +A+APTGSISY+ SCT S+ P    +E+R       +Y   +  + N+++Y    AY++    +ID+ +A+Q+HVDQ ISMTL++T+N TT  L K YIYA+ K   S+YY+R R + L+      EC  C I
  S:     3 TYLKLNNDVLNRYSTTGLLELEKDREATRRYFLEYVNVRLRYFIDIEEKIRYLVDEGYYEKDFIDMYEMDFIKMLYKKAYDYNFRFPSFMSASKFYDSYAMKSRDGEEILEKYEDRIVIIALYLAQGNTVLAKRSVEAMMEA-YQPATPTALNSGKKARGELVSCFKLSMDDSMNSIAENIGYCLELSRLGGGVGVNLTDLRPLGDPIKEILNRASGVIPVAKLLENSFSYSNQLGQRNGSGVVYLNIFHADIENFISSKKPNADDKIRLATLSTGIIIPSIFFDLMKRDKDIVLFSPYDIFKVYGKRMSEISISEMYYELLDNPKIRKIKRLNARRLYTEVKKAQFESGYPFEIFDDNVNEVHPLKNIGRVKMSNLCTEILQVQETSVITDQDQPNEYGLDVSCNLGSIDIHAASKVN-DFETLIDTAMHLLTNVSQMTYIKNVPSVAKANRLMHSVGLGCMNLHGHLVTEGIMYGSKDSIDFMDRFMEAMNYYSLKSSMEMAKEKAETFYRFEDSDYASGSYFDQYVNKNEE------ELSSAVLKALGNIPIITNKMWELLKEDVMEYGLFHSYRLAIAPTGSISYIRSCTASISPCTERVEVRDYADSRTIYPMPHLTNENSHLYVE--AYDVDPYDLIDLYAASQKHVDQGISMTLYVTDNWTTEQLAKVYIYAWVKGIKSVYYVRQRLQSLE------ECVACQI 697
>gi|151220912|ref|YP_001331734.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus str. Newman] >gi|150373712|dbj|BAF66972.1| ribonucleotide-diphosphate reductase alpha chain [Staphylococcus aureus subsp. aureus str. Newman] (718 aa)
Score = 1388, Expect = 3.9e-151, Identities = 304/709 (42%), Positives = 443/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    E+G F  E D  A+  YLE E+K     F++  E+L YL   ++Y FNVF  YS + LI I + AK+  F F+S+M A KF+  YALK+ D   Y E +   +   AL    GN+  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++P+ K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ ++ EYG  + DI + + Y++++ NPN+ KK  +AR++   IA+ Q +SGYP+++F D AN  +   N  +I MSNLCTEI Q+   SI+N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++ +A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M +++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + P+ E+V+EL     +AIPT +DW +L +D++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y   +       M+Y K A+      +ID+ +  Q H+DQ IS  L++    +TR+L + Y+YA  K   S+YY R +   ++      ECT+C I
  S:    25 KYNHIELNNEVTKRREDGFFSLEKDQEALVAYLE-EVKDKTIFFDTEIERLRYLVDNDFY-FNVFDIYSEADLIEITDYAKSIPFNFASYMSASKFFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNAREMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEIKRDISCNLGSLNIVNVMESG-KFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEKSDYANGKYFEFYTTQE---FEPQFEKVRELFD--GMAIPTSEDWKKLQQDVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFL--SPQTMWYYKSAFNTDQMKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE------ECTSCSI 718
>gi|88194507|ref|YP_499302.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|87202065|gb|ABD29875.1| ribonucleotide-diphosphate reductase alpha chain, putative [Staphylococcus aureus subsp. aureus NCTC 8325] (721 aa)
Score = 1388, Expect = 4.3e-151, Identities = 304/709 (42%), Positives = 443/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    E+G F  E D  A+  YLE E+K     F++  E+L YL   ++Y FNVF  YS + LI I + AK+  F F+S+M A KF+  YALK+ D   Y E +   +   AL    GN+  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++P+ K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ ++ EYG  + DI + + Y++++ NPN+ KK  +AR++   IA+ Q +SGYP+++F D AN  +   N  +I MSNLCTEI Q+   SI+N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++ +A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M +++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + P+ E+V+EL     +AIPT +DW +L +D++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y   +       M+Y K A+      +ID+ +  Q H+DQ IS  L++    +TR+L + Y+YA  K   S+YY R +   ++      ECT+C I
  S:    28 KYNHIELNNEVTKRREDGFFSLEKDQEALVAYLE-EVKDKTIFFDTEIERLRYLVDNDFY-FNVFDIYSEADLIEITDYAKSIPFNFASYMSASKFFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNAREMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEIKRDISCNLGSLNIVNVMESG-KFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEKSDYANGKYFEFYTTQE---FEPQFEKVRELFD--GMAIPTSEDWKKLQQDVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFL--SPQTMWYYKSAFNTDQMKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE------ECTSCSI 721
>gi|196163523|ref|ZP_03124054.1| ribonucleoside-diphosphate reductase alpha chain [Clostridium difficile QCD-23m63] (699 aa)
Score = 1387, Expect = 4.5e-151, Identities = 301/707 (42%), Positives = 445/707 (62%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++I LN  + + +E G +Q E D  A+  Y+E  I+P  +KFN+++E+L+YL  E YY   V  +YS  F+ +I+E      F F S+M A KFY  YALKS D K   E + D+++  AL  G GN+   L   D+++   +Q ATPTFLNAG+K+ GE VSC+LL VED+ E I  A ++   LSK GGGVA  L+ LR  G  IK I+  A G++ V K+LE  FSY NQ+G RQG+GAVYL  FHPD    +D+K+ NADEKIR+ +LSLG ++PD    LA +N+    F P+ + ++YG  + +I + + Y+ L+N+ +I KK I+ R++  +IA++Q ESGYP++++ D AN +++  +  II MSNLC EI Q  T S +       + G+D+ CNLGSLNIA VM D      TV+ AI+AL  +A   D+   PT+ N NSK+ ++GLGAMNLHG+L    I Y S++A+DF+N+FF  + Y++ KAS + A E    FE F  ++YA G      ++  E  + PK+E+VK L +   + IPTK+DW +L +++K+ G+ N++LMA+APT SISY+ + T S+ PI  P+E+R  G    +Y P   +  +N +YY + AY + +  +ID+ +  Q HVDQ IS TLF+T+  TTRD+ + YIYA+ K   S+YY R +  + +D+    EC  C +
  S:     2 NWIELNNQVIIKNEQGKYQLEKDREALSSYIEEFIQPKLRKFNNLEERLKYLIDEGYYSKEVINQYSMDFIKNIYEIIDKQKFEFQSYMSANKFYQNYALKSNDGKKILETYNDKVLIVALTLGNGNKDLVLNLADKIVKQEFQPATPTFLNAGRKRAGEMVSCFLLSVEDSTEGISYAISSSNHLSKIGGGVALNLSKLRASGESIKDIEGAAGGVVGVAKMLEQSFSYFNQMGARQGSGAVYLTVFHPDFELLMDTKKINADEKIRLATLSLGAIIPDKFMELAEKNEVAYAFYPHTVYKKYGVSLDEIEMNKWYDKLVNDNDIRKKEINPRQMLTKIAQMQQESGYPYVVYIDTANREHTLKDIGIIKMSNLCCEIFQYQTHSEIEGYGGKNEWGQDISCNLGSLNIANVM-DNKTIESTVETAIRALSFVADSTDIKPVPTVSNSNSKSHSIGLGAMNLHGYLVRENILYTSDDAIDFSNVFFAMVRYYSIKASMKIAIEKNQTFEGFDKSEYAKGRNSKVLSKYYEQSYLPKSEKVKALFE--GIYIPTKEDWTKLLDEVKEKGIYNAYLMAIAPTQSISYVQNSTSSIMPITEPVEVRTYGDSTTIY-PMPFLTNDNILYY-QSAYRMDMRKVIDLVATVQNHVDQGISTTLFVTDEKTTRDIARHYIYAYKKGLKSLYYTRTK--MTRDTH---ECLVCSV 699
>gi|148267191|ref|YP_001246134.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus JH9] >gi|150393240|ref|YP_001315915.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus JH1] >gi|147740260|gb|ABQ48558.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149945692|gb|ABR51628.1| ribonucleoside-diphosphate reductase, alpha subunit [Staphylococcus aureus subsp. aureus JH1] (701 aa)
Score = 1387, Expect = 5.6e-151, Identities = 304/709 (42%), Positives = 444/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    E+G F  E D  A+  YLE E+K     F++  E+L YL   ++Y FNVF  YS + LI I + AK+ +F F+S+M A KF+  YALK+ D   Y E +   +   AL    GN+  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++P+ K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ ++ EYG  + DI + + Y++++ NPN+ KK  +AR++   IA+ Q +SGYP+++F D AN  +   N  +I MSNLCTEI Q+   SI+N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++ +A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M +++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + P+ E+V+EL     +AIPT +DW +L +D++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y   +       M+Y K A+      +ID+ +  Q H+DQ IS  L++    +TR+L + Y+YA  K   S+YY R +   ++      ECT+C I
  S:     8 KYNHIELNNEVTKRREDGFFSLEKDQEALVAYLE-EVKDKTIFFDTEIERLRYLVDNDFY-FNVFDIYSEADLIEITDYAKSISFNFASYMSASKFFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNAREMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEIKRDISCNLGSLNIVNVMESG-KFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEKSDYANGKYFEFYTTQE---FEPQFEKVRELFD--GMAIPTSEDWKKLQQDVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFL--SPQTMWYYKSAFNTDQMKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE------ECTSCSI 701
>gi|52080344|ref|YP_079135.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus licheniformis ATCC 14580] >gi|52785723|ref|YP_091552.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus licheniformis ATCC 14580] >gi|52003555|gb|AAU23497.1| ribonucleoside-diphosphate reductase (major subunit) [Bacillus licheniformis ATCC 14580] >gi|52348225|gb|AAU40859.1| NrdE [Bacillus licheniformis DSM 13] (700 aa)
Score = 1386, Expect = 6.4e-151, Identities = 290/688 (42%), Positives = 439/688 (63%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIR 707
           +I LN  I +  ++G FQF+ D  AV  Y    I  N   F+ +KEK++YL   +YY+     +Y+   +  +F++A    FRF SFM A KFY  YALK+ D K   E +EDRI   AL F  G+++ A  ++  M+   YQ +TPTFLNAG+K+RGE VSC+LL V D++  I RA    +QLSK GGGV+  L+ LR  G  IK ++N   G++ VMK+L++ F YA+Q+GQRQG+GA YLN FH DI  FLD+K+ +ADE +R+K+LS+GVV+PD    LARE+K   +F P+ + + YG+ + ++ + E Y+ L+ +P + K+ I  RK+ +++A ++ ESGYP+I+F D  N  ++  + +++  SNLC+E+ Q +  S        +++G D+ CNLGSLNI  VM++  +  +TVK A  +L  ++   ++++AP ++  N   +++GLGAMNLHGFLA N I Y+SEEA DF N FF  M +++ + S E AKE G  +  ++ + YA G YF+KY   +   ++PK E+V +L +   + IPTK+DW QL + +K+ GL +S+ + +APTGSISY+ S T S+ PI+  IE R  G   + Y P   +  +N+ YY K AY++ +  ++D+ S  QQHVDQ IS TLFL +  TTRDLN+  +YA +K   ++YY R +
  S:     9 WIQLNNEI-MIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHDLKEKIDYLIKNDYYEEEFLSRYTFEEIKEVFKEAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDKEKAKEFVRMMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFIELAREDKAAYVFYPHTVYKAYGEHLDEMDMNEMYDRLVEDPRVKKEKIHPRKMLEKLAMLRSESGYPYIMFQDNVNNVHANNHISKVKFSNLCSEVLQASQVSSYTDYGQEDEIGLDISCNLGSLNILNVMKN-KSLEQTVKLATDSLTHVSETTNITNAPAVKKANKAMKSIGLGAMNLHGFLAQNNIAYESEEARDFANTFFMMMNFYSIERSAEIAKEKGETYHGYEGSAYATGEYFEKYVTQD---FSPKFEKVAKLFE--GMHIPTKEDWKQLKQFVKEHGLYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGN-SKTYYPMPGLAPSNWFYY-KEAYDMDMFRVVDMISTIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHKGIKTLYYARTK 688
>gi|21282422|ref|NP_645510.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus MW2] >gi|49482988|ref|YP_040212.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485603|ref|YP_042824.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651568|ref|YP_185667.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus COL] >gi|87160290|ref|YP_493419.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus USA300] >gi|161508996|ref|YP_001574655.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168726861|ref|ZP_02759138.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|14329709|emb|CAC40667.1| ribonucleotide-diphosphate reductase alpha chain [Staphylococcus aureus] >gi|21203859|dbj|BAB94558.1| ribonuceloside diphosphate reductase major subunit [Staphylococcus aureus subsp. aureus MW2] >gi|49241117|emb|CAG39795.1| ribonucleoside-diphosphate reductase alpha chain [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244046|emb|CAG42472.1| ribonucleoside-diphosphate reductase alpha chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285754|gb|AAW37848.1| ribonucleoside-diphosphate reductase, alpha subunit [Staphylococcus aureus subsp. aureus COL] >gi|87126264|gb|ABD20778.1| ribonucleoside-diphosphate reductase, alpha subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|160367805|gb|ABX28776.1| ribonuceloside diphosphate reductase subunit alpha [Staphylococcus aureus subsp. aureus USA300_TCH1516] (701 aa)
Score = 1385, Expect = 9.0e-151, Identities = 304/709 (42%), Positives = 443/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    E+G F  E D  A+  YLE E+K     F++  E+L YL   ++Y FNVF  YS + LI I + AK+  F F+S+M A KF+  YALK+ D   Y E +   +   AL    GN+  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++P+ K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ ++ EYG  + DI + + Y++++ NPN+ KK  +AR++   IA+ Q +SGYP+++F D AN  +   N  +I MSNLCTEI Q+   SI+N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++ +A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M +++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + P+ E+V+EL     +AIPT +DW +L +D++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y   +       M+Y K A+      +ID+ +  Q H+DQ IS  L++    +TR+L + Y+YA  K   S+YY R +   ++      ECT+C I
  S:     8 KYNHIELNNEVTKRREDGFFSLEKDQEALVAYLE-EVKDKTIFFDTEIERLRYLVDNDFY-FNVFDIYSEADLIEITDYAKSIPFNFASYMSASKFFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNAREMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEIKRDISCNLGSLNIVNVMESG-KFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEKSDYANGKYFEFYTTQE---FEPQFEKVRELFD--GMAIPTSEDWKKLQQDVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFL--SPQTMWYYKSAFNTDQMKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE------ECTSCSI 701
>gi|82750435|ref|YP_416176.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus aureus RF122] >gi|82655966|emb|CAI80370.1| ribonucelotide diphosphate reductase alpha chain [Staphylococcus aureus RF122] (698 aa)
Score = 1384, Expect = 9.8e-151, Identities = 304/709 (42%), Positives = 443/709 (62%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           K ++I LN  +    E+G F  E D  A+  YLE E+K     F++  E+L YL   ++Y FNVF  YS + LI I + AK+  F F+S+M A KF+  YALK+ D   Y E +   +   AL    GN+  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL V+D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++P+ K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ ++ EYG  + DI + + Y++++ NPN+ KK  +AR++   IA+ Q +SGYP+++F D AN  +   N  +I MSNLCTEI Q+   SI+N     +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++ +A++ +AP +   NS+  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  M +++ + S E AKE G  +++F+ + YA+G YF+ YT  E   + P+ E+V+EL     +AIPT +DW +L +D++++GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y   +       M+Y K A+      +ID+ +  Q H+DQ IS  L++    +TR+L + Y+YA  K   S+YY R +   ++      ECT+C I
  S:     5 KYNHIELNNEVTKRREDGFFSLEKDQEALVAYLE-EVKDKTIFFDTEIERLRYLVDNDFY-FNVFDIYSEADLIEITDYAKSIPFNFASYMSASKFFKDYALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNAREMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYGIEDEIQRDISCNLGSLNIVNVMESG-KFRDSVHSGMDALTVVSDVANIQNAPGVRKANSELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQDFEKSDYANGKYFEFYTTQE---FEPQFEKVRELFD--GMAIPTSEDWKKLQQDVEQYGLYHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFL--SPQTMWYYKSAFNTDQMKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE------ECTSCSI 698
>gi|86156144|gb|ABC86790.1| ribonucleotide reductase alpha subunit [Borrelia turicatae] (691 aa)
Score = 1384, Expect = 1.2e-150, Identities = 311/706 (44%), Positives = 440/706 (62%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++ LN  I +  ++G ++ E DL A+  +L +E+     KF +  E++ YL   + Y+ N ++ YS   ++ I+      NF+F S+M A KFY  YALK  D  TY E +EDRI+  +L    G    AL    EM+  RYQ ATPTFLNAGKK RGE VSC+LL V D++ SI    ++ +QLSK GGGVA  L+N+R  G  I+GI N A GIIPVMK+LED F+YA+Q+GQR+GAGAVYLN FH DI  FLD+K+ NADEK R+++LSLGV++PD  F +A++ K+   F+PY + +  G+ M++I    EY+   ++P I KK +SAR +  +IA +QFESGYP+I++    N  N      +I MSNLCTEI QI TPS++      + +G D+ C LGSLNI  V+   ++F  TV  A++AL S+   AD+ +AP+I   N+   AVGLG MNLHGFL  NKI Y+S EA+DF   FF  + +++ K+S   A++ G  F++F  ++Y +G+YFD Y   +   +TPKT+ +K++    KL  P K DW  L  D++  GL +S+ +AVAPT SISY+ + T SL PIV P+E R  G     Y P   ++  N + + K AY + +  +ID+ S AQ+HVDQ IS  L++T   +TR+L K YIYA NK   S+YY R +   +       EC  C I
  S:     3 HLELNNEIMVL-KDGFYRLEKDLEALSVFL-SEVNSKSLKFKNPNERMHYLIDNDLYE-NFYENYSEEQILEIYNLVSLENFQFKSYMSASKFYKDYALKMNDGNTYLESYEDRIIAVSLFLADGCFDFALKLALEMIKQRYQPATPTFLNAGKKVRGELVSCFLLEVGDSLNSITFNISSAMQLSKIGGGVALNLSNIRARGEEIRGIPNIAKGIIPVMKLLEDGFNYADQMGQRKGAGAVYLNIFHYDIEDFLDTKKINADEKSRVQTLSLGVIIPDKFFDIAKQGKNYYAFAPYSLYKATGRFMNEIDFDLEYDLFASDPRILKKELSARDILIRIARLQFESGYPYIVYQTACNLNNPLKGLGKIKMSNLCTEIFQIQTPSVIGDYGEEDLIGYDISCILGSLNIVNVIN--SDFEHTVDIAMRALTSVVDKADIKNAPSIRKANNDYHAVGLGVMNLHGFLIKNKISYESAEALDFVRTFFMLLNFYSLKSSMNIARDRGCAFKDFNKSEYYNGNYFDMYLSED---FTPKTDVIKQIFSGLKL--PLKSDWESLKRDVQIHGLYHSYRLAVAPTQSISYVQNATTSLMPIVEPVEARVYGN-STTYYPMPYLNRENALLF-KSAYYMDMKKLIDLISEAQRHVDQGISTLLYVTNETSTRELVKLYIYAKNKGLKSLYYTRNKNLSVD------ECILCAI 691
>gi|169827409|ref|YP_001697567.1| ribonucleoside-diphosphate reductase alpha subunit [Lysinibacillus sphaericus C3-41] >gi|168991897|gb|ACA39437.1| Ribonucleoside-diphosphate reductase alpha subunit [Lysinibacillus sphaericus C3-41] (697 aa)
Score = 1380, Expect = 3.5e-150, Identities = 299/707 (42%), Positives = 429/707 (60%)
  Q:    19 SYISLNATI-KLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITK-KYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +Y+ LN  +   +   G  + E D  A  +Y    +    + F  I+EK+ YL  E YY+      Y   F+  +++KA  YNFRF SFM A KFY +YA+KS D +   E +EDRIV  AL   +GN   A   ++ MM   YQ ATPT LN+GKK RGE VSC+ L ++D+M SI       L+LS+ GGGV   LT+LR  G PIK I N+A+G+IPV K+LE+ FSY+NQLGQR G+G VYLN FH DI  F+ SK+ NAD+KIR+ +LS G+++P I F L + +KD+ LFSPYDI + YGK MS+ISI+E Y  LL+NP I K K ++AR+L+ ++ + QFESGYPF +FDD  N+ +   N  R+ MSNLCTEI Q+   S++       + G DV CNLGS++I    +   +F   +  A+  L +++ +  + + P++   N    +VGLG MNLHG L T  I Y S++++ F + F   M Y++ K+S E AKE    F  F+++ YA G YFD+Y    E   +P       L     + I T + W  L +D+ ++GL +S+ +A+APTGSISY+ SCT S+ P    +E+R       +Y   +  + N+++Y    AY++    +ID+ +A+Q+HVDQ ISMTL++T+N TT  L K YIYA+ K   S+YY+R R + L+      EC  C I
  S:     3 TYLKLNNDVLNRYSTTGLLELEKDREATRRYFLEYVNVRLRYFIDIEEKIRYLVDEGYYEKAFIDMYEMDFIKKLYKKAYDYNFRFPSFMSASKFYDSYAMKSRDGEEILEKYEDRIVIIALYLAQGNTVLAERSVEAMMEA-YQPATPTALNSGKKARGELVSCFKLSMDDSMNSIAENIGYCLELSRLGGGVGVNLTDLRPLGDPIKEILNRASGVIPVAKLLENSFSYSNQLGQRNGSGVVYLNIFHADIENFISSKKPNADDKIRLATLSTGIIIPSIFFELMKRDKDIVLFSPYDIFKVYGKRMSEISISEMYYELLDNPKIRKIKRLNARRLYTEVKKAQFESGYPFEIFDDNVNDVHPLKNIGRVKMSNLCTEILQVQETSVITDQDQPNEYGLDVSCNLGSIDIHAASKVN-DFEALIDTAMHLLTNVSQMTHIKNVPSVAKANQLMHSVGLGCMNLHGHLVTEGIMYGSKDSIHFMDRFMEAMNYYSLKSSMEMAKEKAETFYRFEDSDYASGIYFDQYVNKTEEELSPAV-----LKALGNIPIITSKMWGLLKQDVMQYGLFHSYRLAIAPTGSISYIRSCTASISPCTERVEVRDYADSRTIYPMPHLTNENSHLYVE--AYDVDPYDLIDLYAASQKHVDQGISMTLYVTDNWTTEQLAKVYIYAWVKGIKSVYYVRQRLQSLE------ECVACQI 697
>gi|73663295|ref|YP_302076.1| ribonucleotide-diphosphate reductase subunit alpha [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495810|dbj|BAE19131.1| ribonucleoside-diphosphate reductase alpha chain [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (701 aa)
Score = 1364, Expect = 2.5e-148, Identities = 308/712 (43%), Positives = 443/712 (62%)
  Q:    14 IVDKDSY--ISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVY-VPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           I+D+  Y  I LN  +    +NG F  E D  A+E YLE EI+     F++  E+L YL   ++Y F++F KYS + L  I + AK+  F F+S+M A KF+  YALK+     Y E ++  +   AL    G++  A  ++  M+  RYQ ATPTFLNAG+ +RGE VSC+LL  +D++ SI    +T  QLSK GGGVA  L+ LR  G  IKGIK  A G++PV K LE  FSYA+QLGQR GAGAVYLN FH D+ +FLD+K+ NADE +R+ ++S G++VP   F LA+E KD  +F+P+ I +EYG  + DI++ E Y+ L+ NPNI KK   AR++   IA+ Q +SGYP+++F D AN+ ++  +  +I MSNLCTEI Q+   SI+N   T +++  D+ CNLGSLNI  VME G  F  +V   + AL  ++  AD+ +AP +   N +  +VGLG MNLHG+LA NKI Y+SEEA DF N+FF  + Y++ + S E AKE   V+++F+ + YA+G YF+ YT      + PK E+V++L     L IPT +DW  L E ++  GL +++ +A+APT SISY+ + T S+ PIV  IE R  G     Y +P    +    M+Y K A+      +ID+ S  Q H+DQ IS  L++    +TR+L++ Y+YA +K   S+YY R +   ++      ECT+C I
  S:     3 IMDEKKYNHIELNNEVTKRKDNGFFNLEKDQEALEVYLE-EIQDKTIYFDTEIERLRYLVDNDFY-FDLFAKYSEADLQEITDYAKSIPFEFASYMSASKFFKDYALKTNGKSQYLEDYKQHVAIVALYLANGHKATAKQFISAMVEQRYQPATPTFLNAGRARRGELVSCFLLEADDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPVAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTISTGLIVPSKFFDLAKEGKDFHMFAPHTIYKEYGLTLDDINLDEYYDELVANPNIDKKKKDAREMLNTIAQTQLQSGYPYLMFKDNANKVHANSDIGQIKMSNLCTEIFQLQETSIINDYGTEDEIKRDISCNLGSLNIVNVMESG-KFKDSVHTGMDALTVVSDEADIQNAPGVRKANRELHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMLNYYSIERSMEIAKERQEVYKDFEQSDYANGKYFEFYTS---QTFEPKYEKVRKLFD--GLEIPTPEDWKALQEQVETNGLFHAYRLAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPET---MWYYKSAFNTDQMKLIDLISTIQTHIDQGISTILYVNSEISTRELSRLYVYAHHKGLKSLYYTRNKLLSVE------ECTSCSI 701
>gi|164688727|ref|ZP_02212755.1| hypothetical protein CLOBAR_02374 [Clostridium bartlettii DSM 16795] >gi|164602203|gb|EDQ95668.1| hypothetical protein CLOBAR_02374 [Clostridium bartlettii DSM 16795] (698 aa)
Score = 1360, Expect = 6.4e-148, Identities = 299/707 (42%), Positives = 431/707 (60%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADG---SYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +YI LN  + + DENG +Q   D  A++ YLE  I+P  KKF+++ ++L YL   +YY   +   Y    +  I++  +  NF+F S+M A KFY  YALKS D +   E++ED+++  AL  G G  + A    ++++   +Q ATPTFLNAG+ + G+ VSC+L+ VED+ E I  A ++   LSK GGGVA  LT LR  G  IKGIK  A G++ V K+LE  FSY NQ+G RQGAGAVYLN  HPD    LDSK+ NADEKIR+ +LS+G ++PD    LA +N+    F P+ I ++YG  +  I + E Y+ L N+  I KK I+ R+L  +IA+ Q ESGYP+++F D ANE+++  +  +I MSNLC EI Q  TPS +         G+D+ CNLGSLNIA VM D  +  KT+  AI+AL  ++   ++   PTI+ GN  + ++GLGAMNLHG+L    I Y S+E  +F ++FF  M Y+A K S   A E G  F  F+ ++YA G     F KY  C +++  P +E+V +L +   + IPTK+DW +L + +K  G+ N++L A+APT SISY+ + T S+ PI   IE+R  G    +Y   +  + N  M Y + AY I +  +ID+ +  Q H+DQ IS TLF+T++ TTRD+ + YIYA  K   S+YY R +       E+  EC  C +
  S:     2 NYIELNNQVIIRDENGKYQLNKDKEALKSYLEDYIEPKMKKFDNLNDRLNYLVENDYYSKEILDLYDQYVIDVIYDFIRAKNFKFQSYMSASKFYQNYALKSNDGEEILENYEDKVLIVALTLGNGEPKLAKDIAEKLINQEFQPATPTFLNAGRARGGKMVSCFLVNVEDSCEGISYAVSSANHLSKIGGGVALNLTRLRASGESIKGIKGAAGGVMGVAKLLEQSFSYFNQMGARQGAGAVYLNVLHPDFETLLDSKKINADEKIRLTTLSIGAIIPDKFMELAEKNEKCYAFYPHSIYQKYGVHLDGIKMDEWYDKLANDDEIEKKEINPRELLTRIAQTQQESGYPYVVFIDSANEQHTLKDVGMIKMSNLCCEIFQYQTPSDIKGYGQVSDWGQDISCNLGSLNIANVM-DNKDIEKTIDVAIRALTYVSDNTNIEEVPTIKKGNDSSHSIGLGAMNLHGYLVREDIIYTSKEGREFADVFFAMMRYYAIKTSMNIAIEKGETFNGFEKSEYAKGPESELFKKY--CTKDF-LPTSEKVSKLFE--GINIPTKEDWTELLQQVKNNGIYNAYLTAIAPTQSISYVQNSTSSVMPITEQIEVRTYGDSTTIYPMPFLTNEN--MLYYQSAYRIDMLDLIDMVAIIQGHIDQGISTTLFVTDDKTTRDIARYYIYAHKKGLKSLYYTRTKM------ERNNECLVCSV 698
>gi|75758222|ref|ZP_00738347.1| Ribonucleoside-diphosphate reductase alpha chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74494276|gb|EAO57367.1| Ribonucleoside-diphosphate reductase alpha chain [Bacillus thuringiensis serovar israelensis ATCC 35646] (694 aa)
Score = 1347, Expect = 2.4e-146, Identities = 296/707 (41%), Positives = 437/707 (61%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           S+++LN  + +  ++G +Q   D  A+E +L  E+K    +F SI +K++YL   NYY +NVF +Y+   +  I+E A T+ F F S+M A KFY  Y+L+S D K Y E +EDR    AL    GN + AL Y++++M   YQ ATPT+LN+GK + GE VSC+LL ++D++ SI    +   QLSK GGG+A  L+ LR     IKGI+N A+G++PVMK++ED FSY NQLGQR GAGA YLN FH D+++FLDSK+ NADEK RI+SLS+G+V P   F LA +NK+M LF+P  + + YG  + D+ + E+Y+ L+ NP + K+   ++AR++  +IA +Q ESGYP+ +    ANE++   +   + MSNLCTEI Q    S++N     + +  D+ C LGSLNI  VME+  +  + V   ++ L  +   + + +AP ++  N+   +VGLG MNLHGFLA N I Y+SE+A DF  +FF  + YH+ + S E AKE G  FE F+ ++YA G+YF+KY   E   + P++E+VK+L +   + IPT  DW +L + +++ GL +S+ +A+AP  S  Y+ + TPS+ PIV  +E R   K    Y P   +    +  Y K AYE+    +ID+ +  Q HVDQ IS  L +T   +TRDL + YIYA  K   S+YY R     ++      EC  C +
  S:     2 SHVALNNEVGIL-KDGFYQLAKDKEALEVFL-AEVKTKQLEFASILDKIKYLIEHNYY-YNVFGEYTEEEVQRIYEAAYTHKFEFQSYMAATKFYKDYSLRSDDKKIYLEDYEDRAAIVALYLASGNTKKALRYVNQIMKQNYQPATPTYLNSGKARAGELVSCFLLEMDDSLNSINYNLSVAKQLSKIGGGIAINLSKLRGRTEAIKGIENAASGVLPVMKLMEDSFSYINQLGQRPGAGAAYLNIFHWDLIEFLDSKKVNADEKTRIQSLSIGLVTPRKFFQLAEQNKEMYLFAPATVYKAYGVHLDDMDLDEKYDELVANPMVRKRKLDLTAREMLVKIATIQLESGYPYFMNKTNANEQHPLKDLGGVKMSNLCTEIFQYMETSVINDYNIADWIKNDISCVLGSLNIVNVMEN-KDVKEAVHTGMEMLTDVTDKSCIENAPGVKKANATLHSVGLGTMNLHGFLAKNFIPYESEDAKDFARVFFAMLNYHSIEKSTEIAKERGVSFEGFEKSEYAKGTYFEKYLTTE---FLPQSEKVKKLFE--GIQIPTTADWERLMKQVQRDGLYHSYRLAIAPNQSSGYVQNATPSVMPIVDKVETRSTDK-ATTYYPMPYLSKQTFFSY-KSAYEMDQMKVIDLIAEIQPHVDQGISCILHVTNGTSTRDLARYYIYAEKKGLKSLYYTRTSNSTIE------ECIACAV 694
>gi|10957414|ref|NP_051640.1| ribonucleoside-diphosphate reductase, alpha chain [Deinococcus radiodurans R1] >gi|6460843|gb|AAF12547.1|AE001826_16 ribonucleoside-diphosphate reductase, alpha chain [Deinococcus radiodurans R1] (702 aa)
Score = 1331, Expect = 1.6e-144, Identities = 279/687 (40%), Positives = 414/687 (60%)
  Q:    39 ENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD-ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLR-VEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNT--DLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++D  A++ Y + ++ PN   F+ ++EK+ YL     +D  +F++YSS  +  +FEKA  Y FRF +FMGA KFY+ YA  + D   + E +EDR+   AL   R    D AL  +  ++   +  ATPT +N+GK   G  VSC+LL+   DN++SI +  +   +LSK GGG+    +NLR  G  ++GI+N   G++ V K+L+++  YA+Q GQR GAGAVYL+  H D    L++K+   DE  R+K+LS+G  +PDI     R  +D+  F P+   +E G+  + I  T+EY+ L +NPNI KK +SAR+L + IA  Q ESGYP++LF+  AN  N   N   I MSNLC+EI Q  TPS  +       +++G DV CNL SL I + M  G + G+ V  AI+ LD++A    +   P ++  N + R++GLGAM LH FLA  ++ Y S EA++F ++FF  + YHA KAS E A++TGFVF  F+ ++Y  G +F +Y    E  + P+   V  L + + L  PT+ DW QL EDIK  GLA+S +MA+APTGSISY+S  + S+ PI   +E R   K   +Y P   +  +   YY + AY++    ++D  +AAQ+HVDQ IS TLFL  +ATTR L   Y+YA+     ++YY R+R+  ++D      C +CV+
  S:    27 QHDTDALQAYFQEKVNPNTVFFHDLREKIRYLTEHGLWDARLFERYSSEDVRQVFEKAYGYKFRFKAFMGAYKFYSEYAGMTPDRSRWLERYEDRLSITAL--ARSERVDEALELVHHLVNQTFTPATPTLMNSGKANTGRLVSCFLLQDCTDNLDSITKTLSFVAELSKGGGGIGVEASNLRARGESLRGIQNVTKGVLGVAKMLDNMLRYADQAGQRPGAGAVYLSVMHADFSDLLNAKKIATDEDARLKTLSIGATIPDIFMEKVRCGEDIYQFYPHSFFQETGREFTSIDWTKEYQALADNPNIRKKRVSARRLLEDIAVTQGESGYPYLLFEGNANRANPIPNVGTIKMSNLCSEILQPTTPSYFHPYGQEHRDRIGLDVSCNLASLVIEQTMH-GGDLGRVVGAAIRMLDNVARSTSVHEVPAVKRANDEMRSIGLGAMGLHSFLAGKELIYGSPEALEFVDVFFAAVHYHARKASMEIARDTGFVFSGFEGSRYQSGEHFAQYL---ERDFAPRRPEVAALFEGHTL--PTRADWEQLVEDIKTHGLAHSFVMAIAPTGSISYVSHASASIMPITEKVETRTSNKARTIY-PMPHLSEDTEWYYEE-AYDMDQRRVLDTVAAAQKHVDQGISCTLFLPASATTRTLQSYYLYAYRLGIKTLYYTRLRKTNVQD------CLSCVV 702
>gi|169187245|ref|ZP_02847405.1| ribonucleoside-diphosphate reductase, alpha subunit [Paenibacillus sp. JDR-2] >gi|169006077|gb|EDS52928.1| ribonucleoside-diphosphate reductase, alpha subunit [Paenibacillus sp. JDR-2] (684 aa)
Score = 1316, Expect = 8.1e-143, Identities = 285/693 (41%), Positives = 432/693 (62%)
  Q:    33 NGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYI-SARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +G +Q + D  AV  ++E E++    KF S++EKL+YL   ++Y+ NV+ +Y+   + ++F   ++  F+F S+M   KFY  YA+K+ D   Y E + DR+   AL  G G+   AL   + M+  R Q ATPTFLNAGK +RGE VSC+LL ++D++ SI     T +QLSK GGGVA  L+ LR  G  IKG++  A G++PV+K++ED FSYA+Q+GQR+G+GA Y N F  DI++FLD K+ NADEK RIK+LS+G+++P+  + LA +N+ + +F P+ + + Y K + D+ +   YE LL N  + KK + +AR +  +IA +Q ESGYP+I+    AN  ++  +  ++ MSNLCTEI Q+   S +N     + +  D+ CNL SLNI  VME      ++V   I+AL +++ ++++ +AP +   N +  +VGLGAMNL+GF A NKI Y+S+EA +F + FF  M Y++ + S E AKE G  F++F  ++YA G+YF +Y + +   + P ++ VKEL +   + IP+ QDW  L E ++K GL +++ +A+APT SISY+ + T S+ PIV  IE R        Y P   +  +NY YY K AY I    +ID+    QQHVDQ IS  L +  N TTR+L + YIYA  K   S+YY R ++  ++      ECT+C +
  S:     6 DGFYQLDKDKEAVAAFME-EVEAKSVKFGSLREKLDYLIENDFYE-NVYDQYTYEQIEAVFTLTESSGFQFESYMAISKFYKDYAMKTNDKSKYLEQYPDRVAIVALNLGEGDGAKALRIAEAMIEQRLQPATPTFLNAGKSRRGEMVSCFLLEMDDSLNSINYVLGTCMQLSKIGGGVAVNLSKLRGRGEAIKGVEGAAKGVMPVLKLMEDAFSYADQMGQRKGSGAGYYNIFGWDIIEFLDCKKINADEKTRIKTLSIGLIIPNKFYELAAKNETLYVFGPHSVHKAYDKHLDDMDMDVMYEELLANDKVVKKAVMNARDMMTKIASIQLESGYPYIMNKSNANRVHALKDIGQVKMSNLCTEIFQVQETSTINDYGMDDVIRRDISCNLASLNIVNVMER-KKLKESVHVGIEALTTVSDVSEIDNAPGVRKANEELHSVGLGAMNLNGFFAKNKIAYESDEAKEFASAFFMMMNYYSIEKSMEIAKERGASFKDFDRSEYAKGTYFTRYIETD---FRPASDSVKELFE--GMEIPSPQDWADLKEKVQKNGLYHAYRLAIAPTQSISYIQNSTSSVMPIVEHIETRTYAN-STTYYPMPYLAQDNYFYY-KSAYNIDQFKLIDLIWEIQQHVDQGISTVLHVNSNVTTRELARFYIYAAQKGLKSLYYTRTKRLSVE------ECTSCAV 684
>gi|149277656|ref|ZP_01883796.1| ribonucleotide-diphosphate reductase alpha subunit [Pedobacter sp. BAL39] >gi|149231344|gb|EDM36723.1| ribonucleotide-diphosphate reductase alpha subunit [Pedobacter sp. BAL39] (696 aa)
Score = 1312, Expect = 2.3e-142, Identities = 288/706 (40%), Positives = 431/706 (61%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNN--RIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I +  E+  F    D  AV  Y    +  N   F ++KEK++YL  + YY  + ++ Y+   +  ++       FRF SFM A KF+ +YAL+    + + E +EDR+V  AL  G+GN   A  Y + ++   YQ ATPTFLN+GKK+ GE VSC+L  + DN+  IG A  + ++LS  GGGV++ ++ +R  G  IK ++N+A G++P+MKILED FSYANQLGQR GAGAVYLN FH DI +FLD K+ N DEK+RIKSLS+GV+VPD    LA +++   LF P+ + + YGK + ++ + E YE LL N  + KK I+AR L  +IA+ Q ESGYP++ F   AN K  AL +   +  SNLCTEI Q++  S +      +Q+   + CNLGSLNIA VME+     + V  A+++L  ++ L +++  P+++  N +  +VGLGAMNLHGFL  N I Y+S+EA+DF N+FF  + +++ ++S E AKE    F  F+ ++YA+G+YF +Y   +     P  +++ +L +   +AIPT +DW QL  ++K+FGL +++ +A+AP  S SY+ + T S+ P+V  IE+R+ G     Y P   +D +NY +Y K AY++    ++ + S  Q+HVDQ IS  L       TRD+ K YIYA      S+YY R R+  +       EC +C +
  S:     6 WILLNNEI-MTKEDDEFSLHKDKEAVRSYFLDYVNKNTVFFYTLKEKIDYLIEQEYY-IDFYQWYTFEQMEEVYNMVYAKKFRFQSFMSAFKFFQSYALRDDSGEKFLERYEDRVVAVALFLGQGNVDHAKAYAELLINQEYQPATPTFLNSGKKRSGELVSCFLDEIGDNLNGIGYAIDSAMKLSSIGGGVSFNISKIRGRGESIKDVENRAGGVLPIMKILEDTFSYANQLGQRPGAGAVYLNVFHTDIEEFLDCKKINVDEKVRIKSLSIGVIVPDKFMELAEKDEACYLFQPHTVYKAYGKYLDEMDMDEMYEELLTNSAVKKKKINARHLMVKIAQTQKESGYPYLFFKGNAN-KGHALKDIGNVKFSNLCTEIMQVSEVSDIEIYGREDQIKYGISCNLGSLNIATVMEN-KRIKEAVTTAMRSLTVVSDLTNIAMVPSVQKANKELHSVGLGAMNLHGFLTKNFIMYESKEALDFCNVFFMMVNFYSIQSSMEIAKEKKETFVGFEKSEYANGNYFSQYIAKD---ILPVNDKIAKLFE--GMAIPTAEDWKQLMANVKEFGLYHAYRLAIAPNQSTSYIMNATASVMPVVDVIEVREYGD-STTYYPMPYLDNDNYFFY-KSAYDMDQKNVLRLISVIQKHVDQGISTILHTNTKDNTRDIAKYYIYAHKMGLKSLYYTRTRKASID------ECVSCSV 696
>gi|162448129|ref|YP_001621261.1| ribonucleoside-diphosphate reductase, alpha chain [Acholeplasma laidlawii PG-8A] >gi|161986236|gb|ABX81885.1| ribonucleoside-diphosphate reductase, alpha chain [Acholeplasma laidlawii PG-8A] (700 aa)
Score = 1308, Expect = 7.2e-142, Identities = 298/706 (42%), Positives = 429/706 (60%)
  Q:    20 YISLNATIKLFDENGNFQ-FENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEE--YENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTY----EQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++ LN  I   DENG  +    D  A + Y   E+    + F+S++EKLE+L   +YY+     KY+   + +I++ A    FRF ++MGA KFY  YALK    K Y E +EDR+  NAL    G+   A   +  +++  +  ATPT LN GK +RGE+VSC+LL   D++  I R +   +QLSK GGGV+  LTNLR  G  IKGI N + G++ V+K+L++ F YA+Q+GQR GAGAVYLN FH DI  FL +K+ NAD+ IR K+LS+GVV+PD    LAR+NKDM LF P+ +  +YGK  +DISI  +  Y+ L +NP + K+ ++ RK+   IA++Q ESGYP+I+F D  N+ N  L+  +  SNLCTEI Q   P+I +    Y    +++G D+ CNL S ++  +M+      +TV  A+  ++S+++  D+   P +   N  NR+VG G M  HG++A N I Y S+E +D  ++FF  + Y++   S E AKETG  F  F+ +KYADGSYFD   Q       PKT++VKEL K   + IPT  DW+QL ED+   GL NSH +AVAP GSI Y+ S TPSL PI   +E R  G   + Y P   ++   +MY  + AY +    +ID+ + AQ+HVDQ IS  L +T + TTR+L K Y+YA  +   ++YY R ++       K+ EC +C +
  S:    11 WVVLNNQIT--DENGEIKDISKDKAAAKSYFLNEVNKRTQFFHSLEEKLEFLVENDYYEKEFLAKYTMEQIQTIYDIAYAAKFRFPTYMGAFKFYNDYALKDRTGKNYLERYEDRLAVNALYHANGDFDKARNLIRLLISQDFTPATPTLLNTGKSKRGEFVSCFLLEAGDSLNDISRISEFSMQLSKVGGGVSINLTNLRAKGEAIKGIPNVSKGVVGVVKLLDNNFRYADQMGQRTGAGAVYLNVFHADIEDFLATKKLNADDDIRAKTLSMGVVIPDKFMELARDNKDMWLFYPHTVFEQYGKDFADISIDMDHWYDILADNPLVRKRKVNPRKILDMIAQLQGESGYPYIMFSDNVNKAN-PLDMPVKFSNLCTEILQ---PTITSHYGDYGANNDEIGMDISCNLASGHMGNMMKHNT-IKETVFGAMDVMNSVSNQTDIKHVPAVAKANRLNRSVGFGIMGHHGYIAENYIMYGSDENIDLIDVFFNIVNYYSLVHSMEKAKETGEKFHRFEKSKYADGSYFDGRGQI-----LPKTDKVKELFK--NVYIPTDDDWLQLKEDVMTHGLYNSHRLAVAPNGSIGYVMSATPSLTPIKQLVEERTYGN-SKTYYPMPAVEKAAFMY--ETAYRMDTYRLIDVIATAQKHVDQGISFELCITSDITTRELQKYYLYAHYQGIKTLYYTRTQK------LKIEECESCAV 700
>gi|171853533|emb|CAM11391.1| Ribonucleotide reductase, alpha subunit [Candidatus Phytoplasma australiense] (856 aa)
Score = 1291, Expect = 6.1e-140, Identities = 285/696 (40%), Positives = 430/696 (61%)
  Q:    28 KLFDENGNFQ-FENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEE--YENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILN--TDLTYEQ---LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ++ DENGN +    D  A+  +L  E+KP  K F+++KEKL +L    YY+ +   +Y+   +  I++ A    FRFS+FMGA KFY  YALKS D K Y E +EDR+  NAL   +G+ + A   +  ++   +  ATPT LNAGKK RGE+VSC+LL   D++  I R     +QLSK GGGV+  +TNLR  G  IKGIK    G++ V K+L+  F YA+Q+GQR GAGAVYL+ FH DI  FL +K+ NADE +R+K+LSLGV+VP+    LAR+N+ M  F P+ +  EY K  +DI++  +  Y+ L++NP + KK I  R+L + IA +Q ESGYP+++F D  N+ N++ + ++  SNLCTEI Q   P+I +  TD  + Q   +G DV CNL S +++ ++ +     +TV  A++ +++++   +++  P +   N  NR+VG G M  HGFLA N I + SEE  D  ++FF  + Y++   S + AK+TG  F  F+ + YADGSYF    +       PKT+++K++     + +P+++DW QL +D+++FGL NSH +AVAP G+I Y+   TPSL PI   +E R  G   + Y P   +   ++MY    AY++    +ID+ + AQ+HVDQ IS  L +T + TTR+L + Y+YA +K   ++YY R ++       K+ EC  C
  S:   172 QIIDENGNIKDLNKDQEALTSFLLEEVKPKLKHFDTLKEKLTFLQTNEYYETDFLSQYNEQQIKDIYKIAYQKQFRFSTFMGAFKFYNDYALKSRDKKYYLETYEDRLCVNALYHAQGDFEIAKRLIKSLINQDFTPATPTLLNAGKKHRGEFVSCFLLEAGDSLNDIARINEFSMQLSKIGGGVSINITNLRAKGESIKGIKGVCKGVVGVCKLLDHSFRYADQMGQRTGAGAVYLSVFHADIEDFLSTKKLNADEDVRVKTLSLGVIVPNKMIELARKNEVMYTFYPHTVFLEYEKNFADIAVNMDYWYDILVSNPKVRKKAIQPRQLLELIARMQGESGYPYLMFCDNVNQNNTS-HLQVKFSNLCTEILQ---PTITSHYTDYNHTQEDKIGMDVSCNLASGHMSNMINNNT-IKETVFMAMEVMNTVSMKTNINYVPAVAKANRLNRSVGFGIMGHHGFLAQNYIAFGSEENKDLIDVFFNAINYYSLLHSCQKAKKTGQKFYLFEKSHYADGSYFKGRGEI-----LPKTDKIKKMFA--NIPLPSEKDWQQLKKDVQQFGLFNSHRLAVAPNGTIGYIMGTTPSLTPIKQLVEERTYGN-SKTYCPMPGLKETSFMYVT--AYKMNKYQLIDVIATAQKHVDQGISFELGITSDITTRELQRYYLYAHHKGIKTLYYTRTQK------LKVDECEAC 854
>gi|39938540|ref|NP_950306.1| ribonucleotide reductase alpha subunit [Onion yellows phytoplasma OY-M] >gi|39721649|dbj|BAD04139.1| ribonucleotide reductase alpha subunit [Onion yellows phytoplasma OY-M] (769 aa)
Score = 1291, Expect = 7.2e-140, Identities = 285/698 (40%), Positives = 425/698 (60%)
  Q:    26 TIKLFDENGNFQ-FENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEE--YENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQ-----LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           T ++ DE GN +    D  A++ +L+  + P  K+F +++EKL +L    YY+    +KY+ S +  I++ A   NF F +FMGA KFY  YALK+ D + Y E +EDR+  NAL   +G+ + A   +  ++   +  ATPT LN GKK RGE+VSC+LL   D++  I R     +QLSK GGGV+  +TNLR  G  IKGIK    G++ V K+L+  F YA+Q+G R GAGAVYLN FH DI+ FL +K+ +ADE +R+K+LSLGVVVP+    LAR N+ M  F P+ +  EYGK  +DI++  +  Y+ L+ NP + KK I+ R+L + IA +Q ESGYP+++F D  N+ N++ + ++  SNLCTEI Q   P+I +    Y Q     +G DV CNL S ++  ++ +     +TV  A++ ++ ++   ++S  P +   N  NR+VG G M  HGFLA N I + SEE  D  ++FF  + +++   S   AK TG  F  F+ +KYADGSYFD   +       PKT ++K++ +   + +PT++DW QL +D+ +FGL NSH +AVAP GSI Y+   TPSL P+   +E R  G   + Y P   +   ++MY    AY++    +ID+ + AQ+HVDQ IS  L +T + TTR+L K Y+YA +KK  ++YY R ++       K+ EC  C
  S:    83 TNQIIDEQGNIKDLNKDKEALQSFLQEGVLPKLKRFATLQEKLTFLQENEYYESAFLQKYTHSQIKEIYQIAYQKNFTFPTFMGAFKFYHDYALKTRDKQHYLETYEDRLSVNALYHAKGDFEIAKRLIVSLINQDFTPATPTLLNTGKKHRGEFVSCFLLEAGDSLNDIARINEFSMQLSKIGGGVSINITNLRAKGESIKGIKGVCKGVVGVCKLLDHSFRYADQIGLRTGAGAVYLNVFHSDIIDFLSTKKLSADEDVRVKTLSLGVVVPNKMIELARNNEVMYTFFPHTVFLEYGKNFADIAVDMDYWYDILVANPKVQKKAINPRQLLELIAHMQGESGYPYLMFCDNTNQANTS-DLKVKFSNLCTEILQ---PTITSHYKDYHQTQQDEIGMDVSCNLASGHMGNMITNN-TIQETVFMAMEVMNCVSENTNISYVPAVAKANFINRSVGFGIMGHHGFLAQNYIAFGSEENKDLIDVFFNAVNFYSLLHSCNKAKTTGKKFYRFEQSKYADGSYFDNRGEI-----LPKTAKIKKMFQ--NITLPTQKDWHQLKQDVMQFGLYNSHRLAVAPNGSIGYIMGATPSLTPVKQLVEERTYGN-SKTYCPMPALKQTSFMYTT--AYKMNKYDLIDVIAIAQKHVDQGISFELGITSDITTRELQKYYLYAHHKKIKTLYYTRTQK------LKIDECEAC 767
>gi|85057305|ref|YP_456221.1| ribonucleoside-diphosphate reductase alpha chain [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789410|gb|ABC65142.1| ribonucleoside-diphosphate reductase alpha chain [Aster yellows witches'-broom phytoplasma AYWB] (845 aa)
Score = 1283, Expect = 6.2e-139, Identities = 283/696 (40%), Positives = 422/696 (60%)
  Q:    28 KLFDENGNFQ-FENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEE--YENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQ-----LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ++ DE G  +    D  A++ +L+  + P  K+F ++++KL +L    YY+    +KY+ S +  I++ A   N  F +FMGA KFY  YALK+ D + Y E +EDR+  NAL   +G+   A   +  ++   +  ATPT LN GKK RGE+VSC+LL   D++  I R     +QLSK GGGV+  +TNLR  G  IKGIK    G++ V K+L+  F YA+Q+GQR GAGAVYLN FH DI+ FL +K+ +ADE +R+K+LSLGVVVP+    LAR+N+ M  F P+ +  EYGK  +DI++     Y+ L+ NP + KK I+ R+L + IA++Q ESGYP+++F D  N+ N++ + ++  SNLCTEI Q   P+I +    Y Q     +G DV CNL S ++  ++ +     +TV  A++ ++ ++   ++S  P +   N  NR+VG G M  HGFLA N I + SEE  D  ++FF  + +++   S   AK TG  F  FK +KYADGSYF+   +       PKT ++K++ +   + +PT+ DW QL +D+ KFGL NSH +A+AP GSI Y+   TPSL P+   +E R  G   + Y P   +   ++MY    AY+I    +ID+ + AQ+HVDQ IS  L +T + TTR+L K Y+YA +KK  ++YY R ++       K+ EC  C
  S:   161 QIIDEQGKIKDLNKDKEALQSFLQEGVAPKLKRFATLQDKLTFLQENEYYESTFLQKYNYSQIKEIYQIAYQKNLTFPTFMGAFKFYHDYALKTRDKQHYLETYEDRLSINALYHAKGDFAIAKRLIVSLINQDFTPATPTLLNTGKKHRGEFVSCFLLEAGDSLNDIARINEFSMQLSKIGGGVSINITNLRAKGESIKGIKGVCKGVVGVCKLLDHSFRYADQMGQRTGAGAVYLNVFHADIIDFLSTKKLSADEDVRVKTLSLGVVVPNKMIELARKNEVMYTFFPHTVFLEYGKNFADIAVDMSYWYDILIVNPKVQKKAINPRQLLELIAQMQGESGYPYLMFCDNTNQANTS-DLKVKFSNLCTEILQ---PTITSHYKDYHQTQQDEIGMDVSCNLASGHMGNMITNNT-IQETVFMAMEVMNCVSENTNISYVPAVAKANFLNRSVGFGIMGHHGFLAQNYIAFGSEENKDLIDVFFNAINFYSLLHSCNKAKTTGKKFYRFKKSKYADGSYFNNRGEI-----LPKTNKIKKMFQ--NITLPTQSDWNQLKQDVMKFGLYNSHRLAIAPNGSIGYIMGATPSLTPVKQLVEERTYGN-SKTYCPMPALKQASFMYTT--AYKINKYDLIDVIAIAQKHVDQGISFELGITSDITTRELQKYYLYAHHKKIKTLYYTRTQK------LKIDECEAC 843
>gi|94985874|ref|YP_605238.1| ribonucleoside-diphosphate reductase, alpha subunit [Deinococcus geothermalis DSM 11300] >gi|94556155|gb|ABF46069.1| Ribonucleoside-diphosphate reductase, alpha subunit [Deinococcus geothermalis DSM 11300] (649 aa)
Score = 1261, Expect = 1.8e-136, Identities = 257/651 (39%), Positives = 386/651 (59%)
  Q:    75 YYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLR-VEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNT--DLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLA-----IPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++D  +  +Y    + ++F +A ++ FRF SFMGA KFY  YA K+ D   Y E +EDR+   AL    GN + ALT +D ++   +  ATPT +N+GK   G   SC+LL+   D+++SI +       LSK GGGV   L+NLR  G  ++ ++    G   V K+ + +F YA+Q GQRQGA  V LN  HPD  + L  K+   DE  R+K+LS+  V+PD+     R++KD+    P   ++  G+  +DI    EY +++ NPNI K+ +SAR+L Q+IA  Q ESGYP++LF   AN  N   N   + M+NLC+EI Q   PS  +   +   +++G DV CNL SL+I   ++ G + G  V+ AI  LD +A   +++  P +   N + R++GLGAM LHG LA + I Y S EA+ F ++FF  + +HA +AS E A++TGFVF  F+ ++Y  G YF  YT+ E        E  ++L  E + A     +PT++DW QL  DI+++GLA+SH+MA+APTGSISY+++ T S+ PI   +E R  GK G+   P   ++     +Y + AY++ +  +ID  +  Q+HVDQ IS TLF+  N TT DL + YI A+ K   S+YY+R R+  ++      EC  C +
  S:     6 FWDGEMLARYRPEEVKAVFNRAYSHRFRFQSFMGAQKFYAEYATKTPDGSRYLERYEDRMSMVALARAGGNAELALTLVDHLVRQTFVPATPTLMNSGKANTGRLTSCFLLQDCTDSLDSIMKTQHFAADLSKNGGGVGIDLSNLRARGESLRHLQGVTKGAAAVAKLFDVLFRYADQAGQRQGAAVVNLNVMHPDFQELLAGKKIATDEDARLKTLSICAVIPDVFMQAVRDDKDVYQVYPRSYEQATGRIFTDIDWDTEYASIVENPNIRKRRVSARQLLQEIALTQGESGYPYLLFTGNANRANPVPNVGTVKMTNLCSEIMQPTLPSSFHPYGEEARDEIGLDVSCNLASLHIGNALKSG-DLGGVVRAAISMLDDVAQSTNITEVPAVARANREMRSIGLGAMGLHGHLAEHGIAYGSPEALAFCDLFFEAVHFHARRASMELARDTGFVFAGFQGSRYQSGEYFAPYTERER-------EPAQDLAPEVRAALQGAWLPTREDWRQLVSDIQRYGLAHSHVMAIAPTGSISYVANATASVMPITERVETRTSGK-GKTIYPMPGLNEQTEWFYEE-AYDMDMRRVIDTVATIQRHVDQGISCTLFVRSNVTTADLARLYISAYRKGLKSLYYLRQRRATVQ------ECVACAV 649
>gi|194246585|ref|YP_002004224.1| Ribonucleotide reductase, alpha subunit [Candidatus Phytoplasma mali] >gi|193806942|emb|CAP18374.1| Ribonucleotide reductase, alpha subunit [Candidatus Phytoplasma mali] (830 aa)
Score = 1248, Expect = 6.0e-135, Identities = 299/716 (41%), Positives = 434/716 (60%)
  Q:     8 NNKNNIIVDKDSYISLNATIKLFDENGNFQ-FENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEE--YENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQ-----LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N + N+I     +I LN   ++ DENGN +    D  A+E Y + EIKP  K F S+K K++YL   NYY+ + F  Y+   + +I++ A    F+F+SFMG  KFY  YALK+ +   Y E +EDR+V NAL    GN   A   +  ++   +  ATPT LN+GKK RGE+VSC+L+   D++  I R     +QLSK GGGV+  L+NLR  G  IK   N   G++ V K+L+  F YA+Q+GQR GAGAVYLN FH DI  FL++K+ NADE +R+K+LSLGVV+PD    LA+ N+ M +F P+ +  EYG+  +DISI  +  Y+ L+ N  I KK I+ R L   IA++Q ESGYP+I++ D  N KN+ LN  I  SNLCTEI Q   P+I +    Y++     +G D+ CNL S ++  ++++ +   +TV  A++ ++S+A   D++  P +   N  NR+VG G M  H F+A N I++ SEE +D  ++FF  + Y++   S + AK TG  F NF  +KYADGSYF+   +       PK  +VK + K  KL  P+ +DW +L  ++ K+GL NSH +AVAP GSI Y+ S TPSL PI   IE R  G   + Y P   ++  ++MY  + AY+I    +ID+ + AQ+H+DQ IS  L +T + TTR+L K Y+YA  +   ++YY R ++       K+ EC  C
  S:   131 NGQKNVI---PKWIMLNN--QVIDENGNIKDLTKDQEALEIYFKEEIKPKLKYFYSLKAKIDYLLENNYYEKDFFNHYTYEQIKTIYQIAYAEKFQFASFMGIFKFYNDYALKNRNKTKYLETYEDRLVVNALYHAHGNFILAKKLIKSLIQQNFTPATPTLLNSGKKYRGEFVSCFLIEGGDSLNDIARIFEFSMQLSKIGGGVSINLSNLRAKGETIKKNANVCKGVVGVCKLLDHGFRYADQMGQRNGAGAVYLNVFHADIKDFLNTKKLNADEDVRVKTLSLGVVIPDKMLELAKNNEMMYIFYPHTVFLEYGQNFADISINMDYWYDILVKNSKIKKKIINPRNLLDLIAQLQGESGYPYIMYCDNVN-KNNMLNLPIKFSNLCTEILQ---PTITSHYADYDKREEDRIGMDISCNLSSGHMGNMIKNNS-IKETVFMAMEVMNSVALNTDIAYVPGVAKANRLNRSVGFGIMGHHEFIAKNFIFFGSEEDLDLIDVFFNAVNYYSLLHSMQKAKTTGQKFFNFSKSKYADGSYFNNRGEI-----LPKNIKVKNIFKHIKL--PSNKDWTELKTNVIKYGLYNSHRLAVAPNGSIGYIMSTTPSLTPIKQLIEERTYGN-SKTYFPTPGLEQFSFMY--ETAYKINKYRLIDVIATAQKHIDQGISFELGITSDITTRELQKYYLYAHYQGIKTLYYTRTQK------LKVNECEAC 828
>gi|118476920|ref|YP_894071.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus thuringiensis str. Al Hakam] >gi|118416145|gb|ABK84564.1| ribonucleoside-diphosphate reductase class Ib alpha subunit [Bacillus thuringiensis str. Al Hakam] (575 aa)
Score = 1207, Expect = 3.4e-130, Identities = 263/578 (45%), Positives = 377/578 (65%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAP 597
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   +   ++P TE+V++L     + IPTK+DW QL   + + GL N+ L   AP
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGAYFEKYETID---YSPVTEKVQQLFA--GIHIPTKEDWNQLKRQVMEHGLYNA-LTCSAP 573
>gi|196046537|ref|ZP_03113762.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) [Bacillus cereus 03BB108] >gi|196022721|gb|EDX61403.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) [Bacillus cereus 03BB108] (563 aa)
Score = 1206, Expect = 5.4e-130, Identities = 259/566 (45%), Positives = 372/566 (65%)
  Q:    32 ENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAP 597
           ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   +   ++P TE+V++L     + IPTK+DW QL   + + GL N+ L   AP
  S:     2 QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGAYFEKYETID---YSPVTEKVQQLFA--GIHIPTKEDWNQLKRQVMEHGLYNA-LTCSAP 561
>gi|169178353|ref|ZP_02839764.1| Ribonucleoside-diphosphate reductase [Arthrobacter chlorophenolicus A6] >gi|169013783|gb|EDS60376.1| Ribonucleoside-diphosphate reductase [Arthrobacter chlorophenolicus A6] (420 aa)
Score = 1203, Expect = 1.0e-129, Identities = 224/393 (56%), Positives = 295/393 (75%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYE 412
           Y  LNA + L+  NG  QF  D  A  +Y    +  N   F+ ++EKLEYL   +YY+     +Y+ +F+  +F +A    FRF +F+GA KFYT+Y LK+FD K + E +EDR+   AL   RGNEQ AL  +DE++ GR+Q ATPTFLNAGKKQRGE VSC+LLR+EDNMESIGR+  + LQLSKRGGGVA+ LTN+RE GAPIK I+NQ++G+IPVMK+LED FSYANQLG RQGAGAVYL+A HPDI +FLD+KRENADEKIRIK+LSLGVV+PDI F LA+++ DM LFSPYD+++ YG P SD+S+TE+Y  ++++  I K  I AR+ FQ +AE+QFESGYP+I+F+D  N  N  ++ +IIMSNLC+EI Q++ P+  + DL+Y+
  S:    16 YHELNAMLNLYGPNGEIQFGADREAAHQYFLQHVNNNTVFFHDLEEKLEYLVKNDYYERETLDQYTMNFIRDLFNRAYKKKFRFETFLGAFKFYTSYTLKTFDGKRFLERYEDRVCMVALHLARGNEQLALQMVDEIIDGRFQPATPTFLNAGKKQRGELVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAFALTNIREVGAPIKQIENQSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKDDDMYLFSPYDVEKVYGMPFSDVSVTEKYYEMVDDSRIKKTKIKAREFFQTLAEIQFESGYPYIMFEDTVNRAN-PIDGKIIMSNLCSEILQVSQPTTYHDDLSYD 407
>gi|56807758|ref|ZP_00365618.1| COG0209: Ribonucleotide reductase, alpha subunit [Streptococcus pyogenes M49 591] (522 aa)
Score = 1194, Expect = 1.1e-128, Identities = 244/517 (47%), Positives = 351/517 (67%)
  Q:   209 GGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-------------TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL--FECTTCVI 725
            GV   L+NLRE GAPIKG    A+G++PVMK+ ED FSY+NQLGQRQGAG VYLN FHPDI+ FL +K+ENADEK+R+K+LSLG+ VPD  + LAR+N+DM LFSPY++++EYG P + + IT  Y+ L+ NP ITK  I AR L  +I+++Q ESGYP+I+  D AN+ N  ++ +IIMSNLC+EI Q+ TPS++N    + ++G D+ CNLGS NI  +M    +FG+++K   +AL  +   + + + PTI++GNS+    GLGAM LH +LA + I Y S E+++FT+++F  + Y     SN  A+E    F  F+N+KYA+GSYFDKY      ++ PK++ VK+L K++   IP   DW  L + ++K GL + + +AVAP GSISY++ C+ S+ PI   IE R+E K+G++Y PA  +  +   YY   AY++ +  +ID+ +AA +HVDQ +S+TLFL                 TTRDL+    YAFNK   S+YYIR   +   D E++   +C +CVI
  S:     2 AGVGITLSNLREAGAPIKGYAGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGITVPDKFYELARKNEDMYLFSPYNVEKEYGIPFNYLDITNMYDELVANPKITKTKIKARDLETEISKLQQESGYPYIINIDTANKAN-PIDGKIIMSNLCSEILQVQTPSLINDAQEFVEMGTDISCNLGSTNILNMMTS-PDFGRSIKTMTRALTFVTDSSSIEAVPTIKHGNSQAHTFGLGAMGLHSYLAQHHIEYGSPESIEFTDIYFMLLNYWTLVESNNIARERQTTFVGFENSKYANGSYFDKYVT---GHFVPKSDLVKDLFKDH--FIPQASDWEALRDAVQKDGLYHQNRLAVAPNGSISYINDCSASIHPITQRIEERQEKKIGKIYYPANGLSTDTIPYYTS-AYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPMELYEWKTQSKQTTRDLSILRNYAFNKGIKSMYYIRTFTD---DGEEVGANQCESCVI 522
>gi|48696468|ref|YP_024510.1| putative ribonucleotide reductase large subunit [Staphylococcus phage K] >gi|37729162|gb|AAO47529.1| ORF80 [Staphylococcus phage K] >gi|119658117|gb|ABL87152.1| putative ribonucleotide reductase large subunit [Staphylococcus phage 812] (704 aa)
Score = 1115, Expect = 1.8e-119, Identities = 268/706 (37%), Positives = 395/706 (55%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKT---YFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQ--LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I   D+NG  +   D  A+++YL+  I+ N +KFNS  E++  L  E  YD  +F     + +  + + A ++NF+F SFM   KFY +YA K +D      + E +E   V  AL   + +   A   L ++M   +Q +TPT+ N+G+  RGE  SCYL  V+D++ES+     +    S  GGGVA  LT +R  GAP++   N + G+I   K +E   S  +Q G RQG+GAVYLN FH DIL  L SK+ NA E +R+  LS+GV +P+    L +E K    F  YDI + YGK + +++I E Y+ LLNN +I K    AR++   IA+ Q ESGYP++ + D AN+ +   N  ++ MSNLCTEI+Q+   S +       Q  +  DV C LGSLN+  V+E G    ++V    +AL  +  + DL   P+++  N   RA+GLG+MNLHG LA N I Y S EA+D  N  +  + + + K S   AKETG  F+ F+ + YA G YF +Y + E N   PKT++ K++L   K+ IPT+ DW +L + +K  GL N +  A APT SISY+ + T S+ P+ S IE R+ G +   Y   Y   +  + Y  + AY+I    II+  +  Q+H DQA+S  L++     T  L   Y YA+ +   S+YY R R+        + EC TC +
  S:     7 WIELNNEITQLDDNGKNKLYKDQEALDEYLKY-IEDNTRKFNSEVERIRVLTKEGTYD-KIFDNVPDTIIDEMTKLAYSFNFKFPSFMAGQKFYESYASKQYDENKKPIFVEDYEQHNVRVALYLFQNDYVKARELLVQLMEQTFQPSTPTYNNSGQANRGELSSCYLFVVDDSIESLNFVEDSVANASSNGGGVAIDLTRIRPKGAPVRNRPNSSKGVIAFAKAIEHKVSIYDQGGVRQGSGAVYLNIFHNDILDLLSSKKINASESVRLDKLSIGVTIPNKFMELVKEGKPFYTFDTYDINKMYGKYLDELNIDEWYDKLLNNDSIGKVKHDAREVMTDIAKTQLESGYPYVFYIDNANDNHPLKNLGKVKMSNLCTEISQLQEVSEIYPYSYSNQNVINRDVVCTLGSLNLVNVVEKGL-LNESVDIGTRALTKVTDIMDLPYLPSVQKANDDIRAIGLGSMNLHGLLAKNMISYGSREALDLVNSLYSAINFQSIKTSMLMAKETGKPFKGFEKSDYATGEYFVRYIR-ESN--QPKTDKAKKVLD--KVYIPTQDDWDELAKAVKVHGLYNGYRKAEAPTQSISYVQNATSSIMPVPSAIENRQYGDMETYYPMPYLSPITQFFYEGETAYKIDNKRIINTSAVVQKHTDQAVSTILYVESEIPTNKLVSLYYYAWEQGLKSLYYTRSRK------LSVIECETCSV 704
>gi|66394955|ref|YP_240947.1| ORF006 [Staphylococcus phage G1] >gi|62636977|gb|AAX92088.1| ORF006 [Bacteriophage G1] (704 aa)
Score = 1111, Expect = 4.8e-119, Identities = 267/706 (37%), Positives = 395/706 (55%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKT---YFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQ--LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  I   D+NG  +   D  A+++YL+  I+ N +KFNS  E++  L  E  YD  +F     + +  + + A ++NF+F SFM   KFY +YA K +D      + E +E   V  AL   + +   A   L ++M   +Q +TPT+ N+G+  RGE  SCYL  V+D++ES+     +    S  GGGVA  LT +R  GAP++   N + G+I   K +E   S  +Q G RQG+GAVYLN FH DIL  L SK+ NA E +R+  LS+GV +P+    L +E K    F  YDI + YGK + +++I E Y+ LL+N +I K    AR++   IA+ Q ESGYP++ + D AN+ +   N  ++ MSNLCTEI+Q+   S +       Q  +  DV C LGSLN+  V+E G    ++V    +AL  +  + DL   P+++  N   RA+GLG+MNLHG LA N I Y S EA+D  N  +  + + + K S   AKETG  F+ F+ + YA G YF +Y + E N   PKT++ K++L   K+ IPT+ DW +L + +K  GL N +  A APT SISY+ + T S+ P+ S IE R+ G +   Y   Y   +  + Y  + AY+I    II+  +  Q+H DQA+S  L++     T  L   Y YA+ +   S+YY R R+        + EC TC +
  S:     7 WIELNNEITQLDDNGKNKLYKDQEALDEYLKY-IEDNTRKFNSEVERIRVLTKEGTYD-KIFDNVPDTIIDEMTKLAYSFNFKFPSFMAGQKFYESYASKQYDENKKPIFVEDYEQHNVRVALYLFQNDYVKARELLVQLMEQTFQPSTPTYNNSGQANRGELSSCYLFVVDDSIESLNFVEDSVANASSNGGGVAIDLTRIRPKGAPVRNRPNSSKGVIAFAKAIEHKVSIYDQGGVRQGSGAVYLNIFHNDILDLLSSKKINASESVRLDKLSIGVTIPNKFMELVKEGKPFYTFDTYDINKVYGKYLDELNIDEWYDKLLDNDSIGKVKHDAREVMTDIAKTQLESGYPYVFYIDNANDNHPLKNLGKVKMSNLCTEISQLQEVSEIYPYSYSNQNVINRDVVCTLGSLNLVNVVEKGL-LNESVDIGTRALTKVTDIMDLPYLPSVQKANDDIRAIGLGSMNLHGLLAKNMISYGSREALDLVNSLYSAINFQSIKTSMLMAKETGKPFKGFEKSDYATGEYFVRYIR-ESN--QPKTDKAKKVLN--KVYIPTQDDWDELAKAVKVHGLYNGYRKAEAPTQSISYVQNATSSIMPVPSAIENRQYGDMETYYPMPYLSPITQFFYEGETAYKIDNKRIINTSAVVQKHTDQAVSTILYVESEIPTNKLVSLYYYAWEQGLKSLYYTRSRK------LSVIECETCSV 704
>gi|19881199|gb|AAM00816.1|AF485080_1 large subunit ribonucleotide reductase [Staphylococcus phage Twort] (705 aa)
Score = 1104, Expect = 3.5e-118, Identities = 262/706 (37%), Positives = 409/706 (57%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVE---KYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFD---NKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDN-MESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTY--EQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVP-AYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +I LN  +   DENG  +   D  A+E   KY+E     N + F++  E++  L  E  YD  VF     + +  + + A ++NF+F SFM   KFY +YA+  +D   N  + E +E   V  AL   + +   A   L ++M    Q ATP +LN+G  +RGE  SCYL  V+D+ +ESI   T +  Q SK  GG A  LT LR  G  + G+ N + G+IP  K +E   SY NQ G+R+G+   YLN FHPDI +F  SK+ NA +K+R+ +LS+GV +P+    L +E+K    F+ YD++++YG  +++I+++E Y+  +N+ +I K+    R +   IA  Q ESGYP++ + D AN+ +      ++ MSNLC E+TQ+   S +   L    + +G DV C LGSLN+  V+E G    ++V   I++L  +  L ++   P+++  N + RA+GLGAMN HG LA N + Y S E++D  N  F  + Y++ K+S E AKETG VF+ FK ++Y  G  F  Y Q       P+T++ K++L+  K+ IPT++DW  L++D+K++G+ N +L  +APT SISY+ + T S+ P+ SPIE R+ G +   Y+P  +   +  + Y ++ AY++    II+  +  Q+HVDQAIS  L++     T  L   Y YA+ K   S+YY R        + K+ EC +C +
  S:     7 WIDLNNEVTQLDENGKNKLYKDKEALEEDSKYIEK----NTRNFDNEVERVRTLTKEGTYD-KVFDSIPDTIIEEMTKLAYSFNFQFQSFMACQKFYESYAVTQYDKDDNPIFVEDYEQHNVREALYLFQDDYVKAREMLIQLMEQTLQPATPVYLNSGLGKRGELSSCYLFIVDDDTIESINFITDSVRQASKNAGGCAVDLTRLRPRGTEVNGVPNASKGVIPFAKNIEQSVSYFNQGGKREGSAVCYLNIFHPDIHEFSSSKKINASDKVRLDTLSIGVTIPNKFMELLKEDKYYYTFNVYDVKQKYGFTLNEINMSEYYDIFVNDDDIRKEKYYTRDIMTDIARTQLESGYPYVFYIDNANDNHPLKKLGKVQMSNLCCEVTQLQEVSDIFPYLQSHNDTIGNDVVCTLGSLNLVNVVEKGL-LKESVDSGIRSLSKVTDLMNVPFLPSVQKANDELRAIGLGAMNWHGLLAKNMLSYGSRESLDIANSLFSAIRYYSIKSSMELAKETGKVFKGFKESEYYTGEVFSSYIQKSHE---PRTKKAKKVLE--KVYIPTEEDWNSLSKDVKEYGMYNGYLNNLAPTQSISYVQNATSSIMPVPSPIENRRYGNMD-TYIPMPFMSPITQFFYESETAYKLDNKRIINTSAVIQKHVDQAISTILYVESEIPTNKLVSLYYYAWEKGLKSLYYTR------SQTLKVIECESCSV 705
>gi|157310980|ref|YP_001468976.1| putivate ribonucleotide reductase [Corynebacterium phage P1201] >gi|95832128|gb|ABF57528.1| putivate ribonucleotide reductase [Corynebacterium phage P1201] (865 aa)
Score = 1047, Expect = 1.4e-111, Identities = 213/385 (55%), Positives = 272/385 (70%)
  Q:    17 KDSYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLE-NYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLC-TEITQINT 401
           KD+Y  LNA +KL D+ G  Q   D  +V  Y    +  N   F+S++EK+++L  E   +D +V  +Y    L  + ++A  + FRF ++MGA+KFY +YALK+ D K Y+E +EDR+V  A+ +    E  A + +D ++ G +Q ATPTFLNAG    G+ VSC++L V+D M SIGR     LQLSKRGGGV    +NLRE GAPIKG + QA+G+IPVMKILED FSY+NQLG RQGAGAVYLNA HPDIL FLD+KRENADEKIRIK+LSLGV+VPD+ F LA+E++ MALFSPYDI + YGK +S+ S+TE Y+  L +  I K +I ARKLFQ IAEVQFESGYP+++FDD AN  N A N  RI  SNLC T  TQI T
  S:     3 KDTYSDLNAEVKLLDQQGKPQLHKDKDSVRAYFLEHVNKNTVFFHSLEEKVDHLTEEVQLWDKDVVLRYGFEDLKRLMKQAYGHKFRFKTYMGALKFYNSYALKTNDGKRYYERYEDRVVLTAIHYSEDFEH-AESLVDLIIKGIFQPATPTFLNAGLLDAGKPVSCFILDVQDTMGSIGRIVQDSLQLSKRGGGVGIGFSNLREAGAPIKGREGQASGVIPVMKILEDSFSYSNQLGARQGAGAVYLNAHHPDILAFLDTKRENADEKIRIKTLSLGVIVPDVTFRLAKESEPMALFSPYDINKVYGKSLSEFSVTEMYDTWLKDDRIAKTFIDARKLFQTIAEVQFESGYPYLMFDDAANRGNPAPNIGRIKSSNLCVTGDTQILT 389
Score = 567, Expect = 6.7e-56, Identities = 129/355 (36%), Positives = 203/355 (57%)
  Q:   371 LFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVME-DGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLA-IPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++D      +S + N ++  N C+EI Q ++PS  + D  + + G D+ CNLGSLN+A++   D  +F   VK A K L+ +A   ++ S+PT+  GN ++RA+GLG MNLHG L    + Y+S+EA D+   +   + +    AS + A+E G  F      K A+GS +        +      +R+       + + +    +W++L E  +  G+ N +L A+ PTGSISY++  T S+ P+ SP+E+RKEGK+GRVY P Y +  N  +     AY IG NPIID+ + A   VDQ +S+TLF  + ATTRD+N+A IYA  K   S+YYIR   + ++ +E +  C +C +
  S:   518 VYDPTVENGHSVIYNGLVTGN-CSEIFQPSSPSEFSEDSFFTKTGRDISCNLGSLNVARLSALDTDDFHTAVKDAYKFLNQVAVQTEIGSSPTVVRGNRESRAIGLGQMNLHGALIELGLDYNSQEARDWFEWYMMRVTFSVISASVDKAEEMGSGF------KGAEGSRWGDIISGHRDRAMALIDRITASGNAMENSDVAWSYEWLRLLERFRLHGIYNQNLQAIPPTGSISYINHATASIHPVTSPVEVRKEGKLGRVYYPQYGV-TNENVESIDSAYAIGPNPIIDMYAVASPWVDQGMSLTLFFPDTATTRDINRAQIYAHKKGLKSLYYIRTSAKSVEGTE-VEGCLSCAL 865
>gi|152974879|ref|YP_001374396.1| ribonucleoside-diphosphate reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152023631|gb|ABS21401.1| Ribonucleoside-diphosphate reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] (462 aa)
Score = 942, Expect = 1.9e-99, Identities = 204/472 (43%), Positives = 306/472 (64%)
  Q:   254 QRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           QR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NPN+ KK   +SAR +  +IA +Q ESGYP+++F   AN+++   N   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S   AKE G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E+++K+GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K AY++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     2 QRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPNVKKKSLDLSARDMLIKIAMIQLESGYPYLMFKSNANQQHPLKNIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTVIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFVRTFFMMLNYYSIEKSMGIAKEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIYIPTKEDWTSLKEEVQKYGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSAYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 462
>gi|163939260|ref|YP_001644144.1| ribonucleoside-diphosphate reductase [Bacillus weihenstephanensis KBAB4] >gi|163861457|gb|ABY42516.1| Ribonucleoside-diphosphate reductase [Bacillus weihenstephanensis KBAB4] (462 aa)
Score = 929, Expect = 6.4e-98, Identities = 202/472 (42%), Positives = 303/472 (64%)
  Q:   254 QRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           QR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+S EA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   E   ++P TE++++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     2 QRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVFKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTEDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESAEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKIQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEVQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 462
>gi|67008230|emb|CAH18520.1| ribonucleoside-diphosphate reductase alpha chain [Rhodobacteraceae bacterium 198] (340 aa)
Score = 872, Expect = 2.6e-91, Identities = 166/338 (49%), Positives = 234/338 (69%)
  Q:   386 RIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           RI MSNLC+EI Q+NT S    DL+Y Q+G D+ CNLGS+NIA+ M DG +   TV  AI+AL++++ ++ + S P+I  GN +  A+GLG MNLHG+LA  +IYY S E +DFTN++F T+ +HA  ASN  A+E G  F+ F+++ YADGS+F KY    +  W P+T+RV+EL +   + +P+++DW  L + +K+ GL N +L AV PTGSISY++  T S+ PI + IEIRKEGK+GRVY PA  +   N  YY + AY+IG   IID  +AA QHVDQ +S+TLF    A+TRD+N+A IYA+ K   +IYYIR+RQ+ L+ +E +  C +C
  S:     7 RISMSNLCSEILQVNTASEFTDDLSYAQMGTDISCNLGSMNIARTM-DGGDLAGTVGTAIRALNAVSEMSAIDSVPSIRKGNDEGHAIGLGQMNLHGYLARERIYYGSAEGIDFTNIYFCTVLFHALSASNALAQEIGTRFKGFEDSTYADGSFFAKYV---DRDWLPETDRVRELFEGAGIPVPSREDWSALCDKVKEHGLYNRNLQAVPPTGSISYINYSTSSIHPITAKIEIRKEGKIGRVYYPAPYMTNENLEYY-RDAYDIGPEAIIDTYAAATQHVDQGLSLTLFFPAEASTRDINRAQIYAWKKGIKTIYYIRLRQQALEGTE-VEGCVSC 338
>gi|52143986|ref|YP_082841.1| ribonucleoside-diphosphate reductase, alpha subunit, N-terminal region [Bacillus cereus E33L] >gi|166982001|ref|ZP_02253448.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus cereus AH187] >gi|51977455|gb|AAU19005.1| ribonucleoside-diphosphate reductase, alpha subunit, N-terminal region [Bacillus cereus E33L] (376 aa)
Score = 847, Expect = 2.2e-88, Identities = 180/374 (48%), Positives = 251/374 (67%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLC 393
           +I LN  I    ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLC
  S:     3 HIELNNEITQM-QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLC 376
>gi|47566240|ref|ZP_00237268.1| ribonucleotide-diphosphate reductase alpha chain [Bacillus cereus G9241] >gi|47556793|gb|EAL15124.1| ribonucleotide-diphosphate reductase alpha chain [Bacillus cereus G9241] (364 aa)
Score = 845, Expect = 3.6e-88, Identities = 176/362 (48%), Positives = 246/362 (67%)
  Q:    32 ENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLC 393
           ++G +Q   D  A+E ++E E + N   FNS+ E++EY+   +YY +NV  +Y+   +  ++  A   NF F S+M A KFY  YALK+ D K Y E +EDR+   +L  GRG+   A  +   ++   YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLC
  S:     2 QDGFYQLHKDKEALEVFME-EARENTVHFNSVAERMEYMKEHDYY-YNVLDEYNLEEVEEVYNIAYGENFEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKQFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLC 364
>gi|49477195|ref|YP_035576.1| ribonucleoside-diphosphate reductase alpha chain, C-terminal region [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65318722|ref|ZP_00391681.1| COG0209: Ribonucleotide reductase, alpha subunit [Bacillus anthracis str. A2012] >gi|165870442|ref|ZP_02215097.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0488] >gi|166992000|ref|ZP_02258460.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus cereus AH820] >gi|167634290|ref|ZP_02392611.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0442] >gi|167639300|ref|ZP_02397572.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0193] >gi|170686704|ref|ZP_02877924.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0465] >gi|170706204|ref|ZP_02896665.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0389] >gi|177651433|ref|ZP_02934222.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0174] >gi|190568016|ref|ZP_03020926.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis Tsiankovskii-I] >gi|196035391|ref|ZP_03102796.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus cereus W] >gi|49328751|gb|AAT59397.1| ribonucleoside-diphosphate reductase alpha chain, C-terminal region [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|164713937|gb|EDR19459.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0488] >gi|167512739|gb|EDR88113.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0193] >gi|167530178|gb|EDR92904.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0442] >gi|170128738|gb|EDS97604.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0389] >gi|170669227|gb|EDT19970.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0465] >gi|172082711|gb|EDT67774.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. A0174] >gi|190560750|gb|EDV14725.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis Tsiankovskii-I] >gi|195992068|gb|EDX56031.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus cereus W] (440 aa)
Score = 841, Expect = 9.0e-88, Identities = 187/450 (41%), Positives = 284/450 (63%)
  Q:   276 SKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+SEEA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     2 TKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESEEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 440
>gi|49184286|ref|YP_027538.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. Sterne] >gi|49178213|gb|AAT53589.1| ribonucleoside-diphosphate reductase, alpha subunit, group I intron-containing [Bacillus anthracis str. Sterne] (440 aa)
Score = 838, Expect = 2.4e-87, Identities = 186/450 (41%), Positives = 283/450 (62%)
  Q:   276 SKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           +K+ N DEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLCTEI Q+   S +N   T + +  D+ CNLGSLNI  VME+     + V   ++AL +++ +  + +APT++  N +  +VGLGAMNLHG+LA NKI Y+SEEA +F   FF  + Y++ + S E AKE G  F++F  + YA+G+YF+KY   E   ++P TE+V++L +   + IPTK+DW  L E ++K GL NS+ +A+APT SISY+ + T S+ PIVS IE R        Y P   +  + + YY K +Y++    +ID+ +  Q+H+DQ IS  L++  + +TR+L + YIYA  K   S+YY R R+  ++      EC  C +
  S:     2 TKKINVDEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLCTEIFQLQETSEINDYGTDDIIRRDINCNLGSLNIVNVMEN-KEIREAVHAGMEALTAVSDMTIIPNAPTVKKANDELHSVGLGAMNLHGYLAKNKIAYESEEAKEFARTFFMMLNYYSIEKSMEIAKEKGETFKDFDKSDYANGTYFEKY---ETTDYSPVTEKVQQLFE--GIHIPTKEDWTSLKEQVQKNGLYNSYRLAIAPTQSISYVQNATSSVMPIVSQIESRTYAN-ATTYYPMPYLSKDTFWYY-KSSYDMNQFKLIDLIAEIQEHIDQGISTILYVNSDISTRELARYYIYAHKKGLKSLYYTRTRKLSVE------ECVACTV 440
>gi|9630286|ref|NP_046713.1| ribunucleotide reductase large subunit [Bacillus phage SPBc2] >gi|50812254|ref|NP_389888.2| hypothetical protein BSU20060 [Bacillus subtilis subsp. subtilis str. 168] >gi|3025639|gb|AAC13134.1| ribunucleotide reductase large subunit [Bacteriophage SPBc2] >gi|32468777|emb|CAB13898.2| yosN [Bacillus subtilis subsp. subtilis str. 168] (1084 aa)
Score = 836, Expect = 3.9e-87, Identities = 177/398 (44%), Positives = 255/398 (64%)
  Q:    19 SYISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGE 416
           ++I LN  I +  ++G +QFE D  AV  Y    I  N   F+ +KEKL+YL   +YY+     KY+   + SI++ A +Y FRF SFM A KFY  YALK+ D     E +EDR+   AL    G+ + A+  +  MM   YQ ATPTFLNAG+K+RGE VSC+LL V D++  I RA    +QLSK GGGVA  L  LR  G  IK ++N   G++ VMK+L++ F YA+Q+GQRQG+GAVYL+ FHPDI  FLD+K+ +ADE +R+K+LS+GVVVPD    LARE+KD  +F P+ + +EYG+ + ++ I E Y+ L+ NP + K   +ARKL +Q+A ++ ESGYP+I+F D  N+ +   + +++  SNLC     +   ++L T+  YE+  +
  S:     7 NWIKLNNEI-MIQKDGKYQFEKDKEAVHSYFVDYINQNTVFFHDLKEKLDYLIKNDYYEEEFLSKYTFEQIKSIYKIAYSYKFRFPSFMSAFKFYNDYALKTNDKTKILERYEDRVSIVALYCADGDYEKAVEEVHTMMKQEYQPATPTFLNAGRKRRGEMVSCFLLEVGDSLNDISRAIDISMQLSKLGGGVALNLNKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAVYLSVFHPDITDFLDTKKISADEDVRVKTLSIGVVVPDKFIELAREDKDYYMFYPHSVYKEYGQYLDELDINEMYDELVENPRVRKAKGNARKLLEQLAILRSESGYPYIMFADNVNKVHPNEHISKVKFSNLC-----VTGETLLLTENGYEKAAD 399
Score = 607, Expect = 1.5e-60, Identities = 133/355 (37%), Positives = 210/355 (59%)
  Q:   371 LFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++D    + +S + N I+  N C+E+ Q +  S+       +++G D+ CNLGS+NI  VM +  +   TV+ AI +L ++    ++ +AP +   N+  R++GLG MNLHGFLA N I Y+SEEA DF N +F  + +++ + S E A+ETG  +  F  + Y  G YF+KY     N ++P+ E+VK+L  +    IP  QDW++L ED+ K+GL +S+  A+APTGSISY+ S T  + PI+  IE R  G   + Y P   +   N+ +Y K AY++ +  ++D+ +  QQHVDQ IS TLFL +  TTRDLN+  +YA ++   ++YY R +    +       C +CV+
  S:   745 VYDTTQEDYHSLIFNGIVTGN-CSEVLQSSQVSVYTDYDKEDEIGLDISCNLGSMNIVNVMSN-QSIASTVRIAIDSLTTVTRKTNIVNAPAVARANTLMRSIGLGQMNLHGFLAQNNIAYESEEAKDFANTYFMMVNFYSLQRSMEIARETGETYYKFDGSTYKSGEYFEKYVT---NDYSPQYEKVKKLFGDQH--IPNIQDWMKLKEDVMKYGLYHSYRQAIAPTGSISYVQSSTAGVMPIMERIEERTYGN-SKTYYPMPGLSAQNWFFY-KEAYDMDMFKVVDLIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTLYYARTKDTTQEG------CLSCVV 1084
>gi|194015491|ref|ZP_03054107.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) [Bacillus pumilus ATCC 7061] >gi|194012895|gb|EDW22461.1| ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) [Bacillus pumilus ATCC 7061] (417 aa)
Score = 794, Expect = 2.6e-82, Identities = 169/412 (41%), Positives = 259/412 (62%)
  Q:   296 VPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN--NRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIR 707
           +PD    LARE++   +F P+ + + YG  + ++ I   Y+ L+NNP + K+ I+ R+L +++A ++ ESGYP+++F D  N ++ ALN  +R+  SNLC+E+ Q +T S        + +G D+ CNLGSLNIA VM  G +    VK A+ AL  ++   ++ +AP +   N + R++GLGAMNLHG+LA N I Y+SEEA DF N+FF T+ Y     SNE A+ETG  FE ++ + YA G YFDKY    E  + PKT++V+ L K+  + IPT  +W  L++++   GL +++ +A+AP GSISY+ S T S+ PI+  IE R  G   + Y P   +   N+ +Y K AY++ +  ++D+ +  QQHVDQ IS TLFL +  TTRDLN+  +YA +K   ++YY R +
  S:     1 MPDKFIELAREDRPAYVFYPHTVYKAYGTHLDEMDIGAMYDELVNNPAVRKERINPRQLLEKMAVLRSESGYPYMMFQDNVNREH-ALNHISRVKFSNLCSEVLQASTVSEYTDYGEPDDIGLDISCNLGSLNIANVMA-GGSIENAVKLAVDALTVVSESTNIKNAPAVAKANREMRSIGLGAMNLHGYLAQNGIAYESEEARDFANVFFATVNYWTLVRSNELAQETGTTFEGYEGSTYASGEYFDKYL---EGDYRPKTDKVRALFKD--IVIPTPLEWQVLSDNVNLHGLYHAYRLAIAPNGSISYVQSATASVMPIMERIEERTYGN-SKTYYPMPGLSPQNWFFY-KEAYDMDMFKVVDMIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHKGIKTLYYARTK 405
>gi|57867420|ref|YP_189078.1| truncated ribonucleoside-diphosphate reductase 2, alpha subunit [Staphylococcus epidermidis RP62A] >gi|57638078|gb|AAW54866.1| truncated ribonucleoside-diphosphate reductase 2, alpha subunit [Staphylococcus epidermidis RP62A] (969 aa)
Score = 771, Expect = 1.4e-79, Identities = 171/374 (45%), Positives = 234/374 (62%)
  Q:    20 YISLNATIKLFDENGNFQFENDLLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKP--MSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNN--RIIMSNLC 393
           +I  N  I   DE G      D  A++ YLE  IK   K+F++   +L YL  E+YY  +VFK YS   L+ + + A ++ F F SFM A KFY TYALK+ D   + E FE   V  +L    G+   A  Y+        Q ATPT+LNAG+KQRGE  SCYL  ++D + SI    +   Q SK  GGVA  LT LR  GA +KG+KN   GI+PV K++E   SYA+QLGQR GAGA YLN FH D+++ L++K+ NADE  R+ +LS+G++VP + F LA+E+KD+ +F PY IQ E+GK   + DI+I + Y+  + N N+ K  I+AR++   IA++Q +SGYP+I++ D AN KN ALN    I MSNLC
  S:     4 WIEKNNEIMRRDELGQLSLSKDKEAIKLYLE-HIKSKTKQFSNQIARLRYLVEEDYY-IDVFKDYSEETLLELLDYAYSFGFEFQSFMAASKFYDTYALKTRDKSQWLEDFEQHNVIVSLYLAGGDVDLAKRYIKAHTLQTVQTATPTYLNAGRKQRGELASCYLFTMDDTLNSINFIRSQVSQASKIAGGVAVNLTRLRGRGATLKGVKNVGKGIVPVAKLIEGEVSYADQLGQRAGAGAAYLNIFHSDVIELLNTKKVNADEDTRLATLSIGLIVPSLFFDLAKEDKDLYMFEPYSIQEEFGKDVILDDININDWYDKFVENENVIKHKINAREMLNLIAQIQLQSGYPYIMYKDNAN-KNHALNELGEIKMSNLC 378
Score = 297, Expect = 1.3e-24, Identities = 81/227 (35%), Positives = 127/227 (55%)
  Q:   371 LFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYAD------GSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAP 597
           ++D    + +S + N I+  N CTEI Q    S +      ++LG+D+ CNL SLN+ K +E+     ++++  ++AL  +A+ + +   PT+   N  NRAVGLG M+ H   A NKI Y SEE++D  N++   M Y++   S + A E    F  F  T Y        G YF K  +  +N   P T +VKE+ K   + IPTK+DW +L  ++ K GL NS+ +++AP
  S:   741 VYDTTQEDYHSLIFNGIVTGN-CTEIFQYMHVSDIKDYYEPDELGQDIICNLASLNMVKSIEEKEIE-ESIRTGMRALTFVANNSRIEHLPTVHKANKNNRAVGLGVMSFHSMCAKNKIRYGSEESLDLLNVYCMMMDYYSLDESMKIAVERNDKFYGFDQTDYKAKDGKEFGEYFYKNNRVTKNV-EPITPKVKEIFK--GIYIPTKEDWQRLAREVDKNGLYNSYRLSIAP 968
>gi|149182582|ref|ZP_01861053.1| ribonucleotide-diphosphate reductase alpha subunit [Bacillus sp. SG-1] >gi|148849718|gb|EDL63897.1| ribonucleotide-diphosphate reductase alpha subunit [Bacillus sp. SG-1] (746 aa)
Score = 768, Expect = 2.8e-79, Identities = 213/666 (31%), Positives = 349/666 (52%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNAL-LFGRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILN-------TDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIEN--GNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           K + S  E +  L     YD  + +KYS   + S+            +++G +     Y  KS     + E  ++R +  A+ L     E+  LT + E    ++  Y   ATPT  NAGK   G+  SC++  VED++ SI  + T    LSK GGG+   L  +R  G+ IKG K  ++GIIP MK L +     +QLGQRQGA AVYL+ +H DI  FLDSK  N DE+ R   L  GV +PD+      +  D  LF P+++++  G  + D         S  E+Y   + +P ++ + + A +LF+ I   Q E+G P++ + D  N  N+  +  +I  SNLCTEITQ  + +++        T +TY++ G+ V CNL SL++AK ++DG    + +  A++ LD++    D++  P ++    N + R +GLG    H  LA   I ++SEEA+++ +  +  +A+   KAS   AKE G  +  F  +++A GSYF+K      +Y +P+                    W++L E++K+ G+ N +LMAVAP+ S S ++  T S+ P+   +E  +E K  ++ V A  +  +   YY K AY I  +  I   +  Q+H+DQ+IS  L++  +   + L   +++A+     + YY+R       D     +C +C
  S:    95 KGYGSFYEMMAQLEEMGIYDTRLLQKYSRDEIDSLERIINPERDGLFTYIGIVTLAERYLAKSHAGH-FIELPQERFMIIAMTLLADEPEEKRLTLIQEAYWALSNLYMTVATPTLANAGKSY-GQLSSCFIDTVEDDLRSIYDSNTDVSTLSKNGGGIGIYLGKIRSRGSDIKGFKGVSSGIIPWMKQLNNTAVSVDQLGQRQGAIAVYLDVWHKDIFPFLDSKLNNGDERQRTHDLFTGVCLPDLFMEQVEKRGDWYLFDPHEVRKVMGFSLEDHYDEQPGQGSFREKYWACVFHPELSHQTVPAIELFKSIMISQLETGTPYMFYRDTVNRFNANQHKGMIYCSNLCTEITQNMSATVMEEERVEDGTIITYKKPGDYVVCNLSSLSLAKAVQDGV-LKEVISIAVRMLDNV---IDINDIPVLQAQLTNERYRGIGLGTYGWHHLLALKGIKWESEEALEYCDSLYEDIAFFTIKASAALAKEKG-AYPYFTGSEWAAGSYFEK-----RDYTSPR--------------------WLELKEEVKEHGVRNGYLMAVAPSSSTSLIAGSTASIDPVFR-LEYSEEKKDYKIPVTAPDLSPHTTWYY-KTAYNIDQHWSIKQNAKRQRHIDQSISFNLYVRNDIKAKALLDIHLHAWKAGLKTTYYVRSTSNAEID-----DCESC 744
>gi|56419446|ref|YP_146764.1| ribonucleotide-diphosphate reductase subunit alpha [Geobacillus kaustophilus HTA426] >gi|56379288|dbj|BAD75196.1| ribonucleoside-diphosphate reductase alpha subunit [Geobacillus kaustophilus HTA426] (785 aa)
Score = 757, Expect = 4.9e-78, Identities = 192/560 (34%), Positives = 304/560 (54%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNR----IIMSNLCTEITQINTPSILNTDLTYEQL-------GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG--NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPI--EIRKEGKVGRVYVPAYKIDVN-NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NAGK   G+  SC++  V+D+++ I  + T    LSK GGG+   L  +R  G+ IKG K  ++G+IP MK L +     +QLGQR+GA +VYL+ +H DI  FLD++  N DE++R   L  GV +PD+      +  D  LF P+++++  G  + D         S  E+Y   +N P ++K+ + A ++ + I   Q ESG PF+ + D  N +N    NR    I  SNLCTEI Q  +P+++      + +       G+ V CNL S+N+A+ + DG    + +   ++ LD++    DL++ P ++ G  N K RAVGLG    H  LA   I ++SEEAV + +  + T+AY A +AS E AKE G  +  F  + +  G+YF++       Y     +   EL            DW +L +D+ ++G+ N ++MA+AP  S S ++  T S+ PI   +  E +K+ K+  V VP    D+N    +Y K AY I     I   +A Q+H+DQAIS   ++      ++L   ++ A+     + YY+R        S  + EC +C
  S:   242 ATPTLANAGKSY-GQLSSCFVDTVDDSLQGIYDSNTDIANLSKSGGGIGVYLGKIRSRGSDIKGFKGVSSGVIPWMKQLNNTAVSVDQLGQRKGAISVYLDVWHKDIFAFLDARLNNGDERLRTHDLFTGVCIPDLFMEQVEQRGDWYLFDPHEVRKVMGFSLEDFYDEEKGCGSFREKYWQCVNEPRLSKEKVPAIEVMKSIMRSQLESGTPFMFYRDEVNRQNP---NRHLGMIYCSNLCTEIAQNQSPTVMKRQYVKDGMIIIEKIPGDFVVCNLSSINLARAVTDGV-LARLIPIQMRMLDNV---IDLNNIPVLQAGLTNEKYRAVGLGTFGWHHLLALKGIRWESEEAVRYADELYETIAYLAIQASMELAKEKG-SYPAFPGSDWQTGAYFER-----RGY-----QSHGEL------------DWDRLKQDVARYGMRNGYIMAIAPNASTSIIAGSTASIDPIFLKVYAEEKKDYKI-PVTVP----DLNEQTTWYYKSAYHIDQRWSIKQNAARQRHIDQAISFNFYVMNTIKAKELLDLHLTAWKSGLKTTYYVR------STSGTIDECDSC 783
>gi|138894465|ref|YP_001124918.1| ribonucleotide-diphosphate reductase subunit alpha [Geobacillus thermodenitrificans NG80-2] >gi|134265978|gb|ABO66173.1| Ribonucleoside-diphosphate reductase alpha subunit [Geobacillus thermodenitrificans NG80-2] (785 aa)
Score = 742, Expect = 2.9e-76, Identities = 192/560 (34%), Positives = 307/560 (54%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNR----IIMSNLCTEITQINTPSILNTD------LTYEQL-GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG--NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPI--EIRKEGKVGRVYVPAYKIDVN-NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NAGK   G+  SC++  V+D++++I  + T    LSK GGG+   L  +R  G+ I+G K  ++G+IP MK L +     +QLGQR+GA +VYL+ +H DI  FLD++  N DE++R   L  GV +PD+      +  D  LF P+++++  G  + D         S  E+Y   +N+  ++K+ + A ++ + I   Q ESG PF+ + D  N +N    NR    I  SNLCTEI Q  +P++          +  E++ G+ V CNL S+N+A+ + DG  F + +   ++ LD++    DL++ P ++    N K RAVGLG    H  LA   I ++SEEAV +T+  + T+AY A +AS E AKE G  +  F  + +  G+YF++                    + YK     ++DW +L  ++ ++G+ N +LMAVAP  S S ++  T S+ PI   +  E +K+ K+  V VP    D+N    +Y K AY I     I   +A Q+H+DQAIS   ++      ++L + ++ A+     + YY+R        S  + EC  C
  S:   242 ATPTLANAGKSY-GQLSSCFVDTVDDSLQAIYDSNTDIANLSKSGGGIGVYLGKIRSRGSDIRGFKGVSSGVIPWMKQLNNTAVSVDQLGQRKGAISVYLDVWHKDIFAFLDARLNNGDERLRTHDLFTGVCIPDLFMEQVEQRGDWYLFDPHEVRKVMGFSLEDFYDEEKGRGSFREKYWQCVNDSRLSKEKVPAIEVMKSIMRSQLESGTPFMFYRDEVNRQNP---NRHLGMIYCSNLCTEIAQNQSPTVTKQQYVKDGTIIIEKIPGDFVVCNLSSINLARAVTDGV-FERLIPIQLRMLDNV---IDLNNIPVLQASLTNKKYRAVGLGTFGWHHLLALKGIRWESEEAVRYTDELYETIAYLAIQASMELAKEKG-SYPGFSGSDWQTGAYFER--------------------RGYKNH--GERDWDRLKREVARYGMRNGYLMAVAPNASTSIIAGSTASIDPIFRKVYAEEKKDYKI-PVTVP----DLNEQTTWYYKSAYYIDQRWSIRQNAARQRHIDQAISFNFYVMNTIKAKELLELHLTAWKSGLKTTYYVR------STSGTMEECDAC 783
>gi|171325516|ref|ZP_02914019.1| ribonucleoside-diphosphate reductase, alpha subunit [Geobacillus sp. WCH70] >gi|171088494|gb|EDT34842.1| ribonucleoside-diphosphate reductase, alpha subunit [Geobacillus sp. WCH70] (761 aa)
Score = 741, Expect = 4.5e-76, Identities = 208/666 (31%), Positives = 341/666 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKN-SALNNRIIMSNLCTEITQINTPSILNTDLT------YEQL-GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG--NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDK--YTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPI--EIRKEGKVGRVYVPAYKIDVN-NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           +++ S+ E +  L  +  YD ++   YS   +  + +       +  +++G       Y  + +D   Y    E  ++    L  +  +    T++ E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T    LSK GGG+   L  +R  G+ I+G K  ++G+IP MK L +     +QLGQR+GA +VYL+ +H DI  FLD+K  N DE++R   L  GV +PD+      +  D  LF P+++++  G  + D         S  E+Y   +    ++K+ + A ++ + I   Q ESG PF+ + D  N KN +A    I  SNLCTEI Q  +P+++    T       E++ G+ V CNL S+N+A+ + D     + +   ++ LD++    DL++ P ++    N K RAVGLG    H  LA   I ++S+EAV++ +  +  +AY A KAS E AKE G  +  F  + +  G+YFDK  Y + EE                         DW  L E + K G+ N ++MA+AP  S S ++  T S+ PI   +  E +K+ K+  V VP    D+N    +Y K AY I  +  I   +A Q+H+DQAIS   ++      ++L   ++ A+     + YY+R        S  + EC +C
  S:   108 QRYGSLYELITTLVSKGVYDRSLLDNYSKEEINELGKLIDPDKDKLFTYIGLRTLADRYLARDYDRNLYELPQERFLIIAMTLMAKEPKHRRFTFIQEAYWALSNLYMTVATPTLANAGKSY-GQLSSCFIDTVDDSLQGIYDSNTDIANLSKSGGGIGVYLGKIRSRGSDIRGFKGVSSGVIPWMKQLNNTAVSVDQLGQRKGAISVYLDVWHKDIFAFLDAKLNNGDERMRTHDLFTGVCIPDLFMEQVEKRGDWYLFDPHEVRKVMGFSLEDFYDEEKGSGSFREKYWQCVQEERLSKEKVPAIEIMKSIMRSQLESGTPFMFYRDEVNRKNPNAHLGMIYCSNLCTEIAQNQSPTVVEKQYTKDGKIIIEKIPGDFVVCNLSSINLARAVTDDV-LERLIPIQMRMLDNV---IDLNNIPVLQAKFTNQKYRAVGLGTFGWHHLLALKGIRWESDEAVEYADKLYEKIAYLAIKASMELAKEKG-SYPAFPGSDWQTGAYFDKRGYHRTEEF------------------------DWDALKEQVAKHGMRNGYVMAIAPNASTSIIAGSTASIDPIFLKVYAEEKKDYKI-PVTVP----DLNAETTWYYKSAYHIDQHWSIKQNAARQRHIDQAISFNFYVLNTIKAKELLDLHLTAWKSGLKTTYYVR------STSSTIDECESC 759
>gi|196247936|ref|ZP_03146638.1| ribonucleoside-diphosphate reductase, alpha subunit [Geobacillus sp. G11MC16] >gi|196212720|gb|EDY07477.1| ribonucleoside-diphosphate reductase, alpha subunit [Geobacillus sp. G11MC16] (760 aa)
Score = 739, Expect = 7.3e-76, Identities = 191/560 (34%), Positives = 304/560 (54%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNR----IIMSNLCTEITQINTPSILNTD------LTYEQL-GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG--NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPI--EIRKEGKVGRVYVPAYKIDVN-NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NAGK   G+  SC++  V+D++++I  + T    LSK GGG+   L  +R  G+ I+G K  ++G+IP MK L +     +QLGQR+GA +VYL+ +H DI  FLD++  N DE++R   L  GV +PD+      +  D  LF P+++++  G  + D         S  E+Y   +N P ++K+ + A ++ + I   Q ESG PF+ + D  N +N    NR    I  SNLCTEI Q  +P++          +  E++ G+ V CNL S+N+A+ + DG    + +   ++ LD++    DL++ P ++    N K RAVGLG    H  LA   I ++SEEAV +T+  + T+AY   +AS E AKE G  +  F  + +  G+YF++                    + YK     ++DW +L  ++ ++G+ N +LMAVAP  S S ++  T S+ PI   +  E +K+ K+  V VP    D+N    +Y K AY I     I   +A Q H+DQAIS   ++      ++L + ++ A+     + YY+R        S  + EC  C
  S:   217 ATPTLANAGKSY-GQLSSCFVDTVDDSLQAIYDSNTDIANLSKSGGGIGVYLGKIRSRGSDIRGFKGVSSGVIPWMKQLNNTAVSVDQLGQRKGAISVYLDVWHKDIFAFLDARLNNGDERLRTHDLFTGVCIPDLFMEQVEQRGDWYLFDPHEVRKVMGFSLEDFYDEEKGRGSFREKYWQCVNEPRLSKEKVPAIEVMKSIMRSQLESGTPFMFYRDEVNRQNP---NRHLGMIYCSNLCTEIAQNQSPTVTKQQYVKDGTIIIEKIPGDFVVCNLSSINLARAVTDGV-LERLIPIQLRMLDNV---IDLNNIPVLQASLTNKKYRAVGLGTFGWHHLLALKGIRWESEEAVRYTDELYETIAYLVIQASMELAKEKG-SYPGFSGSDWQTGAYFER--------------------RGYKNH--GERDWDRLKREVARYGMRNGYLMAVAPNASTSIIAGSTASIDPIFRKVYAEEKKDYKI-PVTVP----DLNEQTTWYYKSAYYIDQRWSIRQNAARQHHIDQAISFNFYVMNTIKAKELLELHLTAWKSGLKTTYYVR------STSGTMEECDAC 758
>gi|124521172|ref|ZP_01696165.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus coagulans 36D1] >gi|124497008|gb|EAY44580.1| ribonucleoside-diphosphate reductase, alpha subunit [Bacillus coagulans 36D1] (744 aa)
Score = 717, Expect = 2.6e-73, Identities = 198/665 (29%), Positives = 338/665 (50%)
  Q:    59 KFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDA-LTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYEQ--------LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAP--TIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           K+ S  + +  L  +  Y   +  KY+   + ++            ++ G     T Y    F+   Y E  ++R +  A+   +  +Q+  + ++ E    ++  Y   ATPT  NAGK   G+  SC++  V D+++SI  + T   QLSK GGG+   +  +R  G+ IKG    ++G++P +K L +     +QLG R+GA  VYL+ +H DI  FLD K  N D+++R + +  GV +PD       +  D  +F P++++   G  + D         S  E+YE  ++    +K+ + A ++ ++I   Q E+G PF+ + D  N +N   +  II  SNLCTEI Q  +P+ L  +   E+         G+ V CNL S+N+ K + DG    + ++  ++ LD   H+ D+++ P   ++  N K RAVGLG    H  LA   I +++E AV++ +  +  +AY+A K+S E A+E G  +  F  +K++ G+YF                      K Y     T + W+ L E++KK+GL N +LMAVAP  + S ++  T S+ P+  P  + +E K  R  V A  +D   Y  Y + AY++     +   +A Q+H+DQ+IS   ++  N   + L   ++ A+     + YY+R        S ++ EC  C
  S:    93 KYGSFYDLIRQLVEKGIYSPKLLDKYTKQEIETLGRLIDPEKDLLFTYPGLYTLVTRYLASDFEKHVY-ELPQERWMVIAMYLMQDEQQETRMEHVKEAYWALSNLYMTVATPTLANAGKTH-GQLSSCFIDTVADSLQSIYDSNTDIAQLSKNGGGIGVYMGKIRGRGSAIKGFPGMSSGVVPWIKQLNNTAVSVDQLGTRKGAITVYLDVWHRDIEDFLDLKLNNGDDRLRARDIYTGVCIPDYFMEQVEKRGDWYVFDPHEVKEVMGFALEDFYDEEKGKGSWREKYEACIHADLRSKRKVPAIEIMKRIMRSQLETGAPFMFYRDEVNRQNPNSHKGIIYCSNLCTEIAQNQSPTELIEEWIKEENVIVKKYRSGDYVVCNLSSINLGKAVPDGV-LERLIRIQVRMLD---HVIDVNTLPIKQVQITNKKYRAVGLGTFGWHHLLALEGIEWETEAAVEYADKLYENIAYYAIKSSMELAREKG-SYPAFPGSKWSTGAYFTG--------------------KGY-----TSERWLALAEEVKKYGLRNGYLMAVAPNATTSIIAGSTASIDPVFQPYYM-EEKKDYRFPVTAPDLDHRTYNIYRRSAYKLDQRWSVRQNAARQKHIDQSISFNFYVPYNIRAQVLLDLHLQAWKSGLKTTYYVR------STSNEVEECEWC 742
>gi|15613064|ref|NP_241367.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus halodurans C-125] >gi|10173114|dbj|BAB04220.1| ribonucleoside-diphosphate reductase alpha subunit [Bacillus halodurans C-125] (726 aa)
Score = 712, Expect = 8.5e-73, Identities = 207/689 (30%), Positives = 348/689 (50%)
  Q:    27 IKLFDENGNFQFENDLLAVEKYLE------TEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNAL-LFGRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTD-------LTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE 715
           +K  DE    Q E   +    YLE       E +   K +    E +E L  +  Y+ ++  +Y+   +  + E          +++G       Y  + +D +T  E  ++R +  A+ L  +      L+ + E    ++  Y   ATPTF NAGK   G+  SC++  V+D++  I  + T    +SK GGG+   L  +R  G+ IK  +N ++G++P MK L +V    +QLGQRQGA AVYL+ +H DI  FLD+K  N DE+ R   L   V +PD+         +  LF P++I+++ G  + D         +  E YE  +NNP++++  + A ++ ++I   Q E+G PF+ + D AN  N   +  ++  SNLCTEI Q  +P+ +  +       L  +Q G+ V CNL SL++A+V+ED     + +   ++ LD++  +  +      E  N K RA+GLG    H  LA   I ++SEEA+ + +  + T+ Y   +AS + A+E G  +  F  + +  G YF++                    ++Y     T   W +L E +K+ GL N +L+AVAP  + + +   T S+ PI     + +E K  R+ V A  +      YY K AY I     I    A Q+HVDQ+IS  L+++     ++L + ++ A+ +   + YY+R     ++D E
  S:    39 MKAMDEISAEQPEWTFITARIYLEELYNSVKEQRGLAKPYTQFYELIEVLVDKGIYEKDLLNRYTKEEINELGEHLNQEKDELFTYIGLKTLADRYLARLYD-RTLMELPQERFMVIAMSLMKKEVNSQRLSLVKEAYWALSNLYMTVATPTFANAGKAV-GQLSSCFIDTVDDSLRGIFDSCTDAATVSKSGGGLGIYLGKIRAKGSSIKNYQNVSSGVLPWMKQLNNVAVSVDQLGQRQGAIAVYLDIWHKDIFSFLDAKLNNGDERQRTHDLFTAVSLPDLFMEAVEARDNWYLFDPHEIRQKMGFSLEDSYDEQKGSGTFRERYEACVNNPDLSRTEVPAIEIMKRIMISQLETGSPFMYYRDEANRMNPNKHEGMVYGSNLCTEIIQNMSPTTVVEEKTEDGKILITKQPGDYVVCNLSSLSLARVVEDDV-LERLIPIQVRMLDNVIDVNRI-EVKQAEQTNQKYRAIGLGTYGWHHLLAKKGIAWESEEAIRYADELYETINYLTIQASMKLAEEKG-AYPMFGGSDWETGEYFER--------------------RQY-----TTDKWTELAEQVKEKGLRNGYLLAVAPNATTALIGGTTASIDPIFQKTYV-EEKKNYRIPVTAPDLSPETTWYY-KSAYHIDQTWSIRQNGARQRHVDQSISFNLYVSNTIRAKELLELHLLAWKEGLKTTYYLRSTSMEIEDCE 722
>gi|167461831|ref|ZP_02326920.1| ribonucleotide-diphosphate reductase subunit alpha [Paenibacillus larvae subsp. larvae BRL-230010] (761 aa)
Score = 700, Expect = 2.4e-71, Identities = 174/560 (31%), Positives = 297/560 (53%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLT------YEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NAGK + G+  SC++  V+D+++ I  + T   +LSK GGG+   +  +R  G+ I+G K +++G++P ++ L +     +QLG R+G+ AVYL+ +H DIL FLD K  N DE++R   +  GV +PD+      +  +  LF P+++++  G  + D+        S   +YE  +NNP +++  + A  + ++I   Q E+G P++ + D  N  N   +  +I  SNLCTEI Q ++  +++  +L        +Q G+ V CNL S+++A+ + DG    + +   I+ LD++  +  +   P     N + RA+GLG   LH  LA  KI ++SEEAV +    +  +++ A +AS E A+E G  +  F+ + +  G YF+                    LK YK      ++W +L +  K+ G+ N +LMAVAP GS S ++  T S+ PI   I   +E    ++  PA  +      YY K A+ I  +  I   SA Q+H+DQ  S  L++  +   +   + ++ A+     + YY+R R   ++D      C  C
  S:   221 ATPTLSNAGKARAGQLSSCFIDTVDDSLQGIYDSNTDIARLSKMGGGIGVYMGKVRSRGSDIRGYKGKSSGVLPWIRQLNNTAVSVDQLGTRKGSIAVYLDVWHKDILSFLDLKLNNGDERLRAHDIFPGVCIPDLFMEAVEQRGEFHLFDPHEVRQVMGYSLEDLYDEKVGEGSFRTKYEECVNNPQLSRTTVQAIDIMKRILISQLETGTPYMFYRDTVNRANPNKHKGMIYSSNLCTEIMQNMSATTLIEEELNDGEIVIRKQAGDFVVCNLSSIHLARAVPDGV-LERLIPVQIRMLDNVIDINRI-EVPQATYTNKRYRAIGLGTFGLHHLLALKKIQWESEEAVVYNEALYERISFLAIQASMELAREKG-AYPLFEGSGWETGEYFE--------------------LKGYK-----SEEWKKLQQQTKENGMRNGYLMAVAPNGSTSIIAGSTASIDPIYDLISY-EEKTTYKIANPAPDLSPQTIWYY-KTAFHIDQHWSIRQASARQRHIDQGQSFNLYVKPDIKAKQFLELHLDAWRSGLKASYYVRSRAVEVED------CVVC 760
>gi|89097913|ref|ZP_01170800.1| ribonucleotide-diphosphate reductase alpha subunit [Bacillus sp. NRRL B-14911] >gi|89087415|gb|EAR66529.1| ribonucleotide-diphosphate reductase alpha subunit [Bacillus sp. NRRL B-14911] (769 aa)
Score = 699, Expect = 3.0e-71, Identities = 197/615 (32%), Positives = 315/615 (51%)
  Q:   109 AMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDA-LTYLDE---MMTGRYQ-AATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNR----IIMSNLCTEITQINTPSILNTD------LTYEQL-GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIEN--GNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPI--EIRKEGKVGRVYVPAYKIDVNNY-MYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           A+K      L     K  FE  ++R +  ++   R   ++  L+ + E    ++  Y  AATPT  NAGK   G+  SC++  V+D+++ I  + T    LSK GGG+   L  +R  G+ IKG K  ++G++P MK L +     +QLGQR+GA +VYL+ +H DI  FLDSK  N DE+ R   L  GV +PD+         D  LF P++++   G  + D         S   +YE  + NP ++K+ + A  + ++I   Q E+G PF+ + D  N KN    NR    I  +NLCTEI Q  + +I          +  E++ G+ V CNL S+N+A+   D     + +   ++ LD++    DL++ P ++    N K RA+GLG    H  LA  K+ +++EEAV   +  +  +A+   KAS   A E G  +  FK + +  G YF                      + Y  ++ +  DW  L + ++K G+ N +LMAVAP  S S ++  +PS+ PI      E +K+ K     +P    D+N +  +Y K AY I  +  I   S  Q+H+DQAIS  L++  N   ++L   ++ A+     + YY+R        S    +C +C
  S:   165 AVKMLADRYLSRDKKKRLFELPQERFMIISMTLNRSEPKERRLSLIKESYWALSNLYMTAATPTLSNAGKNW-GQLSSCFIDTVDDSLQGIYDSNTDIANLSKNGGGIGVYLGKIRSRGSDIKGFKGASSGVLPWMKQLNNTAVSVDQLGQRKGAVSVYLDIWHKDIFSFLDSKLNNGDERYRTHDLFTGVCLPDLFMETVEARGDWHLFDPHEVRSVMGFSLEDFYDEKPGAGSFRVKYEECVANPRLSKQKVPAIDIMKRIMISQLETGTPFMFYRDEVNRKNP---NRHLGMIYCTNLCTEIVQNQSATITKDQREEDGRIIIEKIPGDFVVCNLSSINLARAAADHV-LERLIPIQVRMLDNV---IDLNTIPVLQGVATNRKYRAIGLGTFGWHHLLALKKLRWENEEAVRLADELYEKIAFLTIKASMNLAMEKG-SYPGFKGSDWHSGEYFTS--------------------RGYS-SLDSVHDWDSLMQAVRKNGIRNGYLMAVAPNASTSIIAGSSPSIDPIFRKFYSEEKKDYK-----IPVTAPDLNEHTTWYYKSAYVIDQHWSILQNSKRQKHIDQAISFNLYVQNNIKAKELLDLHLSAWKNGLKTTYYVR------STSSDFEDCDSC 767
>gi|188578921|ref|YP_001915850.1| ribonucleoside-diphosphate reductase, alpha subunit [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188523373|gb|ACD61318.1| ribonucleoside-diphosphate reductase, alpha subunit [Xanthomonas oryzae pv. oryzae PXO99A] (832 aa)
Score = 691, Expect = 2.7e-70, Identities = 194/648 (29%), Positives = 337/648 (52%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ ++YS   LI   +  +    +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G+ +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   + + V +PD+         D  LF P++++R  G  + D           S   +YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + + +G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     +   +  Q+HVDQ+IS   ++        L   ++ A+ +   + YY+R
  S:   163 QKYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKMIEPERDKLFAYNGLYLLATRY-LATDSSRGVFELPQERWLTIALYLMQDEIGTGKGSRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRLRAHDVFISVCIPDLFMEAVERRGDWYLFDPHEVKRVKGWYLQDFYDEKKGDANSSFRRKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNAKEAEDYSDELYERINYLTIQASMELAKEKG-TYSVFRGSDWHNGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLDTWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 818
>gi|16804194|ref|NP_465679.1| ribonucleotide-diphosphate reductase subunit alpha [Listeria monocytogenes EGD-e] >gi|46908388|ref|YP_014777.1| ribonucleotide-diphosphate reductase subunit alpha [Listeria monocytogenes str. 4b F2365] >gi|47091824|ref|ZP_00229619.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes str. 4b H7858] >gi|47095729|ref|ZP_00233335.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153168049|ref|ZP_01928080.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes FSL N1-017] >gi|153175420|ref|ZP_01930778.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes FSL N3-165] >gi|153185139|ref|ZP_01935766.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes J0161] >gi|153191695|ref|ZP_01938867.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes J2818] >gi|153197096|ref|ZP_01941395.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes 10403S] >gi|153203256|ref|ZP_01944579.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes HPB2262] >gi|16411625|emb|CAD00233.1| lmo2155 [Listeria monocytogenes] >gi|46881659|gb|AAT04954.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes str. 4b F2365] >gi|47015872|gb|EAL06799.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes str. 1/2a F6854] >gi|47019835|gb|EAL10573.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes str. 4b H7858] >gi|126942353|gb|EBA20094.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes J0161] >gi|127633551|gb|EBA22963.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes 10403S] >gi|127764937|gb|EBA25292.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes J2818] >gi|133726475|gb|EBA28173.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes FSL N1-017] >gi|133729339|gb|EBA31037.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes FSL N3-165] >gi|133734751|gb|EBA36449.1| ribonucleoside-diphosphate reductase, alpha subunit [Listeria monocytogenes HPB2262] (763 aa)
Score = 690, Expect = 3.0e-70, Identities = 194/630 (30%), Positives = 328/630 (52%)
  Q:    76 YDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDE----MMTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS-----ILNTD--LTYEQLGEDVCCNLGSLNIAK-VMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           Y  N+ K YS   LI+  +       +  ++ G     T Y L +   +  +E  ++R +  AL   +   ++    L E     ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  GA I+G+K  + G+IP +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PDI         +  LF P++++ + G  + D         +  E+YE L+ +  I+KK + A  + ++I   Q E+G PF+ + D  N  N   +  ++  SNLCTEI Q  +P+     I++ D  +  +Q G+ V CNL S+N+ + V+ +     + ++  ++ LD++  L +L   P     N K R++GLG    H  LA   I +DSEEA  + +  +  + Y A +ASN+ A+E G  ++ FK + +  G YF +      NY +P                    +W +L +++ + GL N++L+AVAP  S + ++  T S+ PI S     +E K  R  V A  ++++ Y YY KGAY++     +      Q+HVDQ++S   ++        L + ++ A+N+   + YY+R
  S:   128 YSGNILKNYSKEDLIAAGKLIDPEKDKLFTYNGLYLLATRY-LATDSERNVYELPQERWLTIALYLMQNEPKEKRMKLVEEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSTGAAIRGVKGASGGVIPWIKQLNNTAVSVDQLGQRKGAIAVYLDVFHKDIESFLDLRLNNGDQRLRAHDVFTAVCIPDIFMEAVERRGEWYLFDPHEVKAKKGWYLQDFYDESKGEGTFREKYEELVADETISKKIVKAIDIMKRIMMSQLETGNPFMFYRDEVNRMNPNKHEGMVYSSNLCTEIMQNMSPTKMIQEIISGDQIVITKQAGDFVVCNLSSVNLGRAVVAEEGTLERLIEVEVRMLDNVIDLNEL-PVPQATITNQKYRSIGLGTFGWHHLLALKNIAWDSEEAEKYADELYEQINYLAIRASNKLAQEKG-AYKVFKGSDWNTGEYFAR-----RNYNSP--------------------EWQELAKEVAEKGLRNAYLVAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDYRRPVIAPDLNLSTYPYYEKGAYKVDQFASVRQNGRRQRHVDQSLSFNFYVPSGIKASKLLELHMTAWNEGLKTTYYVR 749
>gi|116873588|ref|YP_850369.1| ribonucleotide-diphosphate reductase subunit alpha [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742466|emb|CAK21590.1| nrdA [Listeria welshimeri serovar 6b str. SLCC5334] (764 aa)
Score = 688, Expect = 5.0e-70, Identities = 194/630 (30%), Positives = 327/630 (51%)
  Q:    76 YDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDE----MMTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS-----ILNTD--LTYEQLGEDVCCNLGSLNIAKVM--EDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           Y  N+ K YS   LI   +       +  ++ G     T Y L +   +  +E  ++R +  AL   +   ++    L E     ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  GA I+G+K  + G+IP +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PDI         +  LF P++++ + G  + D         +  E+YE L+ +  I+KK + A  + ++I   Q E+G PF+ + D  N  N   +  ++  SNLCTEI Q  +P+     I++ D  +  +Q G+ V CNL S+N+ + +  E+     + ++  ++ LD++  L +L   P     N K R++GLG    H  LA   I +DSEEA  + +  +  + Y A +ASN+ A+E G  ++ FK + +  G YF +      NY +P                    +W +L +++ + GL N++L+AVAP  S + ++  T S+ PI S     +E K  R  V A  ++++ Y YY KGAY++     +      Q+HVDQ++S   ++        L + ++ A+N+   + YY+R
  S:   128 YSGNILKNYSKEDLIVAGKLIDPEKDKLFTYNGLYLLATRY-LATDSERNVYELPQERWLTIALYLMQNEPKEKRMKLVEEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSTGAAIRGVKGASGGVIPWIKQLNNTAVSVDQLGQRKGAIAVYLDVFHKDIESFLDLRLNNGDQRLRAHDVFTAVCIPDIFMEAVERRGEWYLFDPHEVKAKKGWYLQDFYDESKGIGTFREKYEELVADETISKKIVKAIDIMKRIMMSQLETGNPFMFYRDEVNRMNPNKHEGMVYSSNLCTEIMQNMSPTKMIQEIISGDQIVITKQAGDFVVCNLSSVNLGRAVLAEEEGTLERLIEVEVRMLDNVIDLNEL-PVPQATITNQKYRSIGLGTFGWHHLLALKNIAWDSEEAEKYADELYEQINYLAIRASNKLAQEKG-AYKVFKGSDWNTGEYFAR-----RNYNSP--------------------EWQELAKEVAEKGLRNAYLVAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDYRRPVIAPDLNLSTYPYYEKGAYKVDQFASVRQNGRRQRHVDQSLSFNFYVPSGIKASKLLELHMTAWNEGLKTTYYVR 750
>gi|58424691|gb|AAW73728.1| ribonucleoside-diphosphate reductase alpha chain [Xanthomonas oryzae pv. oryzae KACC10331] (839 aa)
Score = 688, Expect = 5.3e-70, Identities = 194/648 (29%), Positives = 336/648 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ ++YS   LI   +  +    +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G+ +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PD+         D  LF P++++R  G  + D           S   +YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + + +G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     +   +  Q+HVDQ+IS   ++        L   ++ A+ +   + YY+R
  S:   170 QKYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKMIEPERDKLFAYNGLYLLATRY-LATDSSRGVFELPQERWLTIALYLMQDEIGTGKGSRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRVKGWYLQDFYDEKKGDANSSFRRKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNAKEAEDYSDELYERINYLTIQASMELAKEKG-TYSVFRGSDWHNGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLDTWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 825
>gi|84622096|ref|YP_449468.1| ribonucleotide-diphosphate reductase subunit alpha [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|161899022|ref|YP_199113.2| ribonucleotide-diphosphate reductase subunit alpha [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84366036|dbj|BAE67194.1| ribonucleoside-diphosphate reductase alpha chain [Xanthomonas oryzae pv. oryzae MAFF 311018] (832 aa)
Score = 688, Expect = 5.5e-70, Identities = 194/648 (29%), Positives = 336/648 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ ++YS   LI   +  +    +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G+ +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PD+         D  LF P++++R  G  + D           S   +YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + + +G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     +   +  Q+HVDQ+IS   ++        L   ++ A+ +   + YY+R
  S:   163 QKYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKMIEPERDKLFAYNGLYLLATRY-LATDSSRGVFELPQERWLTIALYLMQDEIGTGKGSRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRVKGWYLQDFYDEKKGDANSSFRRKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNAKEAEDYSDELYERINYLTIQASMELAKEKG-TYSVFRGSDWHNGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLDTWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 818
>gi|166710316|ref|ZP_02241523.1| ribonucleotide-diphosphate reductase subunit alpha [Xanthomonas oryzae pv. oryzicola BLS256] (832 aa)
Score = 687, Expect = 7.2e-70, Identities = 194/648 (29%), Positives = 336/648 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ ++YS   LI   +  +    +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G+ +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PD+         D  LF P++++R  G  + D           S   +YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + + +G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     +   +  Q+HVDQ+IS   ++        L   ++ A+ +   + YY+R
  S:   163 QKYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKMIEPERDKLFAYNGLYLLATRY-LATDSSRGVFELPQERWLTIALYLMQDEIGNGKGSRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRIKGWYLQDFYDEKKGDANSSFRRKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNAKEAEDYSDELYERINYLTIQASMELAKEKG-TYSVFRGSDWHNGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLDTWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 818
>gi|192808027|ref|ZP_03036704.1| ribonucleoside-diphosphate reductase, alpha subunit [Geobacillus sp. Y412MC10] >gi|192803447|gb|EDV79950.1| ribonucleoside-diphosphate reductase, alpha subunit [Geobacillus sp. Y412MC10] (777 aa)
Score = 686, Expect = 8.4e-70, Identities = 190/618 (30%), Positives = 325/618 (52%)
  Q:   106 FMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDA-LTYLDEM---MTGRYQ-AATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQR------EYGKPM----------SDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKN-SALNNRIIMSNLCTEITQINTPSIL----------NTDLTYEQL-GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFD--KYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ++G +     Y    FD +   E  ++R +  A+        D  L  + E    M+  Y  AATPT  NAGKK  G+  SC++  V+D++E I  + T   +LSK GGG+   L  +R  G+ I+G KN ++G+IP ++ L +     +QLG R+GA AVYL+ FH DIL FLD K  N DE++R   +  GV +PD+        ++ +LF P+++++      E G+P+           +    ++Y   + NP + +  + A  + ++I + Q E+G P++ + D  N  N ++ +  I  SNLCTEI Q  +P+++           T +   ++ G+ V CNL S+++A+ +  G    + V   ++ LD++  + ++      +  NS+ RAVGLG   LH  LA   I ++S+EAV + +  +  + Y   K+S E AKE G  +  FK + +  G YF    YT                   E++    T + W +L ++++  G+ N+ L A+AP GS S ++  T S+ P+   +   +E    +V  PA  +      YY K A+ I  +  I + +A Q+HVDQA S  L++  +    +  + +++A+     S YY+R R   ++      EC +C
  S:   152 YIGLLTLAERYLANDFDGRV-MELPQERYMVIAMFLMHNEPADKRLDLVKEAYWAMSNLYMTAATPTMSNAGKKVAGQLSSCFIDTVDDSLEGIFDSNTDIARLSKMGGGIGVYLGKVRARGSDIRGHKNTSSGVIPWIRQLNNTAVSVDQLGTRKGAIAVYLDVFHKDILSFLDLKLNNGDERMRAHDVFHGVCLPDLFMEAVEAREEWSLFCPHEVKKIMGWKDENGRPLGLEDFYDHTQGEGEFRQKYAEAVANPLLPRITVQAIDIMKRIMKSQLETGTPYMFYRDTVNRANPNSAHGMIYSSNLCTEIMQNQSPTVVEQEELVTKDGQTRIVISKIPGDFVVCNLNSIHLARAVPAGV-LERLVPIQVRMLDNVIDINNIEVLQA-QYTNSQYRAVGLGTFGLHHLLALEGIRWESDEAVAYNDNLYEHINYLLVKSSMELAKEKGH-YPKFKGSDWESGEYFTFRGYTD-----------------GEHEGKFVTTEQWRELQQEVQANGVRNAWLFAIAPNGSTSIIAGSTASIDPLYELLSY-EEKTTYKVANPAPDLSEKTIWYY-KTAFLIDQHWSIKMAAARQRHVDQAQSFNLYVRPDIRASEFLELHLHAWKAGIKSTYYVRSRALTIE------ECESC 775
>gi|16801323|ref|NP_471591.1| ribonucleotide-diphosphate reductase subunit alpha [Listeria innocua Clip11262] >gi|16414771|emb|CAC97487.1| lin2259 [Listeria innocua] (763 aa)
Score = 686, Expect = 9.1e-70, Identities = 192/630 (30%), Positives = 328/630 (52%)
  Q:    76 YDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDE----MMTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS-----ILNTD--LTYEQLGEDVCCNLGSLNIAK-VMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           Y  N+ K YS   LI+  +       +  ++ G     T Y L +   +  +E  ++R +  AL   +   ++    L E     ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  GA I+G+K  + G+IP +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PDI         +  LF P++++ + G  + D         +  E+Y+ L+ +  I+KK + A  + +++   Q E+G PF+ + D  N  N   +  ++  SNLCTEI Q  +P+     I++ D  +  +Q G+ V CNL S+N+ + V+ +     + ++  ++ LD++  L +L   P     N K R++GLG    H  LA   I +DSEEA  + +  +  + Y A +ASN+ A+E G  ++ FK + +  G YF +      NY +P                    +W +L +++ + GL N++L+AVAP  S + ++  T S+ PI S     +E K  R  V A  ++++ Y YY KGAY++     +      Q+HVDQ++S   ++        L + ++ A+N+   + YY+R
  S:   128 YSGNILKNYSKEDLIAAGKLIDPEKDKLFTYNGLYLLATRY-LATDSERNVYELPQERWLTIALYLMQNEPKEKRMKLVEEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSTGAAIRGVKGASGGVIPWIKQLNNTAVSVDQLGQRKGAIAVYLDVFHKDIESFLDLRLNNGDQRLRAHDVFTAVCIPDIFMEAVERRGEWYLFDPHEVKAKKGWYLQDFYDESKGEGTFREKYDELVADETISKKIVKAIDIMKRVMMSQLETGNPFMFYRDEVNRMNPNKHEGMVYSSNLCTEIMQNMSPTKMIQEIISGDQIVITKQAGDFVVCNLSSVNLGRAVVAEEGTLERLIEVEVRMLDNVIDLNEL-PVPQATITNQKYRSIGLGTFGWHHLLALKNIAWDSEEAEKYADELYEQINYLAIRASNKLAQEKG-AYKVFKGSDWNTGEYFAR-----RNYNSP--------------------EWQELAKEVAEKGLRNAYLVAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDYRRPVIAPDLNLSTYPYYEKGAYKVDQFASVRQNGRRQRHVDQSLSFNFYVPSGIKASKLLELHMTAWNEGLKTTYYVR 749
>gi|78049717|ref|YP_365892.1| ribonucleotide-diphosphate reductase subunit alpha [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78038147|emb|CAJ25892.1| ribonucleoside-diphosphate reductase alpha chain [Xanthomonas campestris pv. vesicatoria str. 85-10] (832 aa)
Score = 686, Expect = 9.7e-70, Identities = 194/648 (29%), Positives = 335/648 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ ++YS   LI   +  +    +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G+ +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PD+         D  LF P++++R  G  + D           S   +YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + + +G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + +  + YY KGAY++     +   +  Q+HVDQ+IS   ++        L   ++ A+ +   + YY+R
  S:   163 QKYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKMIEPERDKLFAYNGLYLLATRY-LATDSSRGVFELPQERWLTIALYLMQDEIGTGKGSRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRIKGWYLQDFYDEKKGDANGSFRRKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKSIHWNAKEAEDYSDELYERINYLTIQASMELAKEKG-TYSVFRGSDWHNGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLETWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 818
>gi|21244792|ref|NP_644374.1| ribonucleotide-diphosphate reductase subunit alpha [Xanthomonas axonopodis pv. citri str. 306] >gi|21110490|gb|AAM38910.1| ribonucleoside-diphosphate reductase alpha chain [Xanthomonas axonopodis pv. citri str. 306] (832 aa)
Score = 686, Expect = 1.0e-69, Identities = 194/648 (29%), Positives = 335/648 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ ++YS   LI   +  +    +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G+ +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PD+         D  LF P++++R  G  + D           S   +YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + + +G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + +  + YY KGAY++     +   +  Q+HVDQ+IS   ++        L   ++ A+ +   + YY+R
  S:   163 QKYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKMIEPERDKLFAYNGLYLLATRY-LATDSSRGVFELPQERWLTIALYLMQDEIGTGKGSRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRIKGWYLQDFFDEKKGDANGSFRRKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKSIHWNAKEAEDYSDELYERINYLTIQASMELAKEKG-TYSVFRGSDWHNGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLETWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 818
>gi|71276517|ref|ZP_00652792.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Dixon] >gi|71900742|ref|ZP_00682864.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] >gi|170729740|ref|YP_001775173.1| ribonucleoside-diphosphate reductase [Xylella fastidiosa M12] >gi|71162694|gb|EAO12421.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Dixon] >gi|71729512|gb|EAO31621.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] >gi|167964533|gb|ACA11543.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa M12] (830 aa)
Score = 676, Expect = 1.3e-68, Identities = 194/648 (29%), Positives = 330/648 (50%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM---SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAKVMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ + YS   LI   +       +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G  +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ +H DI  FLD +  N D+++R   +   V +PD+         D  LF PY+++R  G  + D           S   +YE+++ +  I++K + A  +F++I   Q E+G PF+ + D  N KN   N  + M   SNLCTEI Q  TP+ L       N  +T +  G+ V CNL S+N+ + +   A+        + +   ++ LD++  L +L   P     N K RA+GLG    H  LA   I+++S+EA  ++++ +  + Y   +AS E AKE G  +  F  + +  G YF        +Y +P+                    W++L   +   G+ N++++AVAP  S + ++  T S+ P+ S     +E K  R  V A  + ++ + YY KGAY++     I   +  Q+HVDQ++S   ++        L   ++ A+ +   + YY+R
  S:   164 QKYGSFVGLQESLADRNIYSNDILRSYSKEELIEAGQMIDPERDKLFTYNGLYLLATRY-LATDASRGVFELPQERWLTIALYLMQDEYGPGKGGRERRMQLVGEAYWALSNLYMTVATPTLGNAGKIN-GQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGSMIRGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIWHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPYEVKRVKGWYLQDFYDEKRGDPNGSFRRKYEDVVADERISRKTVKAIDIFKRIMVSQLETGNPFMFYRDEVNRKNP--NKHVGMVYSSNLCTEILQNMTPTRLIQEMISGNQIVTTKHAGDFVVCNLSSINLGRAITVQADLLGADVLERLIPIQVRMLDNVIDL-NLLPVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNSQEAEQYSDVLYERINYLTIRASMELAKEKG-TYAVFPGSDWQTGEYFRA-----RDYNSPQ--------------------WLELAAQVAVNGVRNAYMVAVAPNMSTAQIAGSTASIDPVYSAF-YYEEKKDYRRPVAAPGLSLDTWPYYEKGAYKLDQFASIRQNARRQRHVDQSLSFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 816
>gi|28198392|ref|NP_778706.1| ribonucleotide-diphosphate reductase subunit alpha [Xylella fastidiosa Temecula1] >gi|182681035|ref|YP_001829195.1| ribonucleoside-diphosphate reductase, alpha subunit [Xylella fastidiosa M23] >gi|28056462|gb|AAO28355.1| ribonucleoside-diphosphate reductase alpha chain [Xylella fastidiosa Temecula1] >gi|182631145|gb|ACB91921.1| ribonucleoside-diphosphate reductase, alpha subunit [Xylella fastidiosa M23] (830 aa)
Score = 674, Expect = 2.1e-68, Identities = 195/648 (30%), Positives = 329/648 (50%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM---SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAKVMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ + YS   LI   +       +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G  +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ +H DI  FLD +  N D+++R   +   V +PD+         D  LF PY+++R  G  + D           S   +YE+++ +  I++K + A  +F++I   Q E+G PF+ + D  N KN   N  + M   SNLCTEI Q  TP+ L       N  +T +  G+ V CNL S+N+ + +   A+        + +   ++ LD++  L +L   P     N K RA+GLG    H  LA   I+++S+EA  +++  +  + Y   +AS E AKE G  +  F  + +  G YF        +Y +P+                    W++L   +   G+ N++++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     I   +  Q+HVDQ++S   ++        L   ++ A+ +   + YY+R
  S:   164 QKYGSFVGLQESLADRNIYSNDILRSYSKEELIEAGQMIDPERDKLFTYNGLYLLATRY-LATDTSRGVFELPQERWLTIALYLMQDEYGPGKGGRERRMQLVGEAYWALSNLYMTVATPTLGNAGKIN-GQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGSMIRGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIWHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPYEVKRVKGWYLQDFYDEKRGDPNGSFRRKYEDVVADERISRKTVKAIDIFKRIMVSQLETGNPFMFYRDEVNRKNP--NKHVGMVYSSNLCTEILQNMTPTRLIQEMISGNQIVTTKHAGDFVVCNLSSINLGRAITVQADLLGADVLERLIPIQVRMLDNVIDL-NLLPVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNSQEAEQYSDALYERINYLTIRASMELAKEKG-TYAVFPGSDWQTGEYFRA-----RDYNSPQ--------------------WLELAAQVAVNGVRNAYMVAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDYRRPVVAPGLSLDTWPYYEKGAYKLDQFASIRQNARRQRHVDQSLSFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 816
>gi|188993573|ref|YP_001905583.1| Ribonucleoside-diphosphate reductase alpha chain [Xanthomonas campestris pv. campestris] >gi|167735333|emb|CAP53547.1| Ribonucleoside-diphosphate reductase alpha chain [Xanthomonas campestris pv. campestris] (827 aa)
Score = 670, Expect = 7.8e-68, Identities = 192/648 (29%), Positives = 332/648 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNE--QDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ K YS   LI   +          ++ G     T Y L + +++  FE  ++R +  AL   +  +  +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PD+         D  LF P++++R  G  + D           S  ++YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + +  G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     +   +  Q+H+DQ+IS   ++        L   ++ A+ +   + YY+R
  S:   163 QKYGSFVGLQESLADRNVYSNDILKSYSKEELIEAGKMIAPERDTLFAYNGLYLLATRY-LATDNSRGVFELPQERWLTIALYLMQDEKPRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIESFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRIKGWYLQDFYDEKKGDANSSFRKKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNAKEAEDYSDELYERINYLTVQASMELAKEKG-TYSVFRGSDWHTGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLDTWPYYEKGAYKVDQFASVRQNARRQRHIDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 813
>gi|21233408|ref|NP_639325.1| ribonucleotide-diphosphate reductase subunit alpha [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66770373|ref|YP_245135.1| ribonucleotide-diphosphate reductase subunit alpha [Xanthomonas campestris pv. campestris str. 8004] >gi|21115248|gb|AAM43207.1| ribonucleoside-diphosphate reductase alpha chain [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575705|gb|AAY51115.1| ribonucleoside-diphosphate reductase alpha chain [Xanthomonas campestris pv. campestris str. 8004] (827 aa)
Score = 669, Expect = 8.4e-68, Identities = 192/648 (29%), Positives = 332/648 (51%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNE--QDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAK---VMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ K YS   LI   +          ++ G     T Y L + +++  FE  ++R +  AL   +  +  +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ FH DI  FLD +  N D+++R   +   V +PD+         D  LF P++++R  G  + D           S  ++YE ++ +  IT+K + A ++F++I   Q E+G PF+ + D  N KN   +  ++  SNLCTEI Q  +P+ +       N  +T ++ G+ V CNL S+N+ +   V  D A+        + +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I+++++EA D+++  +  + Y   +AS E AKE G  +  F+ + +  G YF        +Y +P+                    W++L+  +   G+ N+ ++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     +   +  Q+H+DQ+IS   ++        L   ++ A+ +   + YY+R
  S:   163 QKYGSFVGLQESLADRNVYSNDILKSYSKEELIEAGKMIAPERDTLFAYNGLYLLATRY-LATDNSRGVFELPQERWLTIALYLMQDEKPRERRMQLVGEAYWALSNLYMTVATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIESFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRIKGWYLQDFYDEKKGDANSSFRKKYEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNLCTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGADVLERLIPIQVRMLDNVIDLNQL-PVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNAKEAEDYSDELYERINYLTVQASMELAKEKG-TYSVFRGSDWHTGEYFRA-----RDYNSPQ--------------------WLELSAQVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLDTWPYYEKGAYKVDQFASVRQNARRQRHIDQSISFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 813
>gi|71901121|ref|ZP_00683228.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] >gi|71729126|gb|EAO31250.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] (830 aa)
Score = 669, Expect = 9.0e-68, Identities = 195/648 (30%), Positives = 328/648 (50%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM---SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAKVMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ + YS   LI   +       +  ++ G     T Y L +  +   FE  ++R +  AL         G+G  +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ +H DI  FLD +  N D+++R   +   V +PD+         D  LF PY+++R  G  + D           S   +YE+++ +  I++K + A  +F++I   Q E+G PF+ + D  N KN   N  + M   SNLCTEI Q  TP+ L       N  +T +  G+ V CNL S+N+ + +   A+        + +   ++ LD++  L +L   P     N K RA+GLG    H  LA   I+++S+EA  +++  +  + Y   +AS E AKE G  +  F  + +  G YF        +Y +P+                    W++L   +   G+ N++++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     I   +  Q+HVDQ++S   ++        L   ++ A+ +   + YY+R
  S:   164 QKYGSFVGLQESLADRNIYSNDILRSYSKEELIEAGQMIDPERDKLFTYNGLYLLATRY-LATDASCGVFELPQERWLTIALYLMQDEYGPGKGGRERRMQLVGEAYWALSNLYMTVATPTLGNAGKIN-GQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGSMIRGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIWHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPYEVKRVKGWYLQDFYDEKRGDPNGSFRRKYEDVVADERISRKTVKAIDIFKRIMVSQLETGNPFMFYRDEVNRKNP--NKHVGMVYSSNLCTEILQNMTPTRLIQEMISGNQIVTTKHAGDFVVCNLSSINLGRAITVQADLLGADVLERLIPIQVRMLDNVIDL-NLLPVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNSQEAEQYSDALYERINYLTIRASMELAKEKG-TYAVFPGSDWQTGEYFRA-----RDYNSPQ--------------------WLELAAQVAVNGVRNAYMVAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDYRRPVVAPGLSLDTWPYYEKGAYKLDQFASIRQNARRQRHVDQSLSFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 816
>gi|15837798|ref|NP_298486.1| ribonucleotide-diphosphate reductase subunit alpha [Xylella fastidiosa 9a5c] >gi|9106168|gb|AAF84006.1|AE003954_3 ribonucleoside-diphosphate reductase alpha chain [Xylella fastidiosa 9a5c] (830 aa)
Score = 667, Expect = 1.5e-67, Identities = 195/648 (30%), Positives = 328/648 (50%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF-------GRGNEQDALTYLDEM---MTGRYQA-ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI----------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM---SNLCTEITQINTPSIL-------NTDLTYEQLGEDVCCNLGSLNIAKVMEDGAN------FGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +K+ S     E L   N Y  ++ + YS   LI   +       +  ++ G     T Y L +  ++  FE  ++R +  AL         G+G  +  +  + E    ++  Y   ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  G+ I+G+ N + G++P +K L +     +QLGQR+GA AVYL+ +H DI  FLD +  N D+++R   +   V +PD+         D  LF PY+++   G  + D           S   +YE+++ +  I++K + A  +F++I   Q E+G PF+ + D  N KN   N  + M   SNLCTEI Q  TP+ L       N  +T +Q G+ V CNL S+N+ + +   A+        + +   ++ LD++  L +L   P     N K RA+GLG    H  LA   I+++S EA  +++  +  + Y   +AS E AKE G  +  F  + +  G YF        +Y +P+                    W++L   +   G+ N++++AVAP  S + ++  T S+ PI S     +E K  R  V A  + ++ + YY KGAY++     I   +  Q+HVDQ++S   ++        L   ++ A+ +   + YY+R
  S:   164 QKYGSFVGLQESLADRNIYSNDILRSYSKEELIEAGQMIDPERDKLFTYNGLYLLATRY-LATDASRGVFELPQERWLTIALYLMQDEYGPGKGGRERRMQLVGEAYWALSNLYMTVATPTLGNAGKIN-GQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGSMIRGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIWHRDIEAFLDLRLNNGDQRLRAHDVFTSVCIPDLFMEAVERRGDWYLFDPYEVKCVKGWYLQDFYDEKRGDPNGSFRRKYEDVVADERISRKTVKAIDIFKRIMVSQLETGNPFMFYRDEVNRKNP--NKHVGMVYSSNLCTEILQNMTPTRLIQEMISGNQIVTTKQAGDFVVCNLSSINLGRAITVQADLLGADVLERLIPIQVRMLDNVIDL-NLLPVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNSPEAEQYSDALYERINYLTIRASMELAKEKG-TYAVFPGSDWQTGEYFRA-----RDYNSPQ--------------------WLELAAQVAVNGVRNAYMVAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDYRRPVVAPGLSLDTWPYYEKGAYKLDQFASIRQNARRQRHVDQSLSFNFYVPSTIRASTLLDLHMTAWREGLKTTYYVR 816
>gi|118442856|ref|YP_878439.1| ribonucleoside-diphosphate reductase alpha subunit [Clostridium novyi NT] >gi|118133312|gb|ABK60356.1| ribonucleoside-diphosphate reductase alpha subunit [Clostridium novyi NT] (764 aa)
Score = 666, Expect = 1.8e-67, Identities = 218/711 (30%), Positives = 349/711 (49%)
  Q:    13 IIVDKDSYISLNATIKLFDENGNFQF-ENDLLAVEKYLETEIKPNFKKFN-----SIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF----GRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSIL-----------NTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG--NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNY-MYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           I +DK++Y   N+  K    N N+Q+    LLA + Y E +I  N+  F      S+ +KL  + L   Y   + + YS   +  + E  +       ++ G       Y +K F N    E  ++R +  A+      G+     A  + D M   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +   +  +R   + I+G KN + G+IP +K+  D     +QLG+R+G  ++ L+ +H DI  FLD K  N D++ +   +   V +PDI        ++ +LF PY IQ+  G  + D          T+ Y     N N+ +  +S   + ++I +   E+G PFI F D  N  N   +  +I  SNLC EI Q  + S L           N  ++  + G+ V CNL S+N++KV  D     +++   I+ LD++  L  L   P  E+   + K RA+GLG    H +LA+NKI ++SEE +   +  F  +AY A KAS E AKE G  +  F+ +++  G YF++     E                          W +L EDI K+G+ N ++MAVAPTGS S +++ T  + P+     I  E K G  + P    D+NN   +Y K A+ I     I  C+  Q+H+DQ+ S  L++T     +D+   Y  ++ +   +IYY+R        S ++ EC++C
  S:    69 IYIDKNNYD--NSPSK--KTNINWQYVAARLLAFDLYKEAKINRNYSHFGYGDFLSLVKKLVNMGLYGKY---LIENYSDEEIKELSEYIEPKRDELFNYEGLKLLNDRYLIKGF-NGEILELPQERFMVIAMHLAIPEGKNRVYFAKKFYDLMSKLKMTVATPTLGNAGTPFY-QLSSCFISVVGDNLWSIYDVNQKFAQVSKHGGALGIYMGKIRALNSEIRGHKNASGGVIPWIKLYNDTAVAVDQLGKRKGGASITLDIWHKDIYDFLDLKTNNGDDRRKAHDIFTSVSIPDIFMKRLLNRENWSLFDPYTIQKLMGYKLEDYFDDEENKEFTKRYLECEANENLPRDTVSCLDVMKKIMKSAVETGAPFIFFRDTVNRANPNKHKGMIYSSNLCHEIAQNMSESELISEEVTDKNGFNEVVSRIKSGDMVTCNLNSINLSKVSRD--ELKESIPLQIRMLDNVISLNRL---PVKESAITSDKYRAIGLGTSGYHQYLASNKIKWESEEHIKEVDSLFEDIAYEAIKASMELAKEKG-AYAEFEGSEWQSGKYFERRGYNSER-------------------------WNKLREDIAKYGIRNGYIMAVAPTGSTSNIANTTAGIDPVFKKFFI--EEKKGS-FTPKTAPDLNNENFWYYKEAHTINQEWSIKACAVRQKHIDQSQSFNLYITPEVKAKDILNMYTESWRQGIKTIYYVR------NKSIEMDECSSC 762
>gi|168164366|ref|ZP_02599599.1| ribonucleotide-diphosphate reductase subunit alpha [Bacillus cereus H3081.97] (250 aa)
Score = 665, Expect = 2.5e-67, Identities = 131/233 (56%), Positives = 174/233 (74%)
  Q:   161 YQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKY--ISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLC 393
           YQ ATPTFLNAG+ +RGE VSC+LL ++D++ SIG    T +QLSK GGGVA  L+ LR  G  IKGI N A+G++PVMK+LED FSYANQLGQR+GAGAVYLN FH DI++FLD+K+ NADEK RI+SLS+G++VP   F LA +N+   +F+PY + +EYGK + DI I E Y+ L++NP + KK   ISAR +  +IA +Q ESGYP+++F   AN ++   +   + MSNLC
  S:    15 YQPATPTFLNAGRSRRGEMVSCFLLEMDDSLNSIGFNINTAMQLSKIGGGVALNLSKLRARGEQIKGIDNAASGVVPVMKLLEDSFSYANQLGQRKGAGAVYLNIFHWDIIEFLDTKKINADEKSRIQSLSIGIIVPSKFFELAEKNEPFHVFAPYTVYKEYGKHLDDIDIDEMYDELMSNPKVKKKPLDISARDMLIKIAMIQLESGYPYLMFKSNANNQHPLKDIGTVKMSNLC 250
>gi|167462364|ref|ZP_02327453.1| ribonucleotide-diphosphate reductase subunit alpha [Paenibacillus larvae subsp. larvae BRL-230010] (729 aa)
Score = 655, Expect = 4.0e-66, Identities = 191/665 (28%), Positives = 328/665 (49%)
  Q:    59 KFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQA--------ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKN-SALNNRIIMSNLCTEITQINTPSIL---NTD-----LTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHL-ADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDV------NNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           K+      ++ L  +  Y  ++ + YS   +     + +    +  +++G       Y  KS+D + Y E  ++R +  A+       +D   +  +++   Y A        ATPT  NAG    G+  SC++  V+D++ SI  + T    LSK GGG+   +  LR  G+ IKG K  ++G+IP ++ L +     +QLG+R+G+ AVYL+ +H DIL FLD K  N DE++R   +  GV +PD+     R+  D  LF P++++R  G  + D         S  ++YE  +++P + K  + A ++ + I + Q E+G P++ + D AN  N +     I  +NLCTEI Q  +P+++    TD     +T ++ G+ V CNL S+N+ +  E      + +   ++ LD++  + AD          N K RA+GLG    H  LA   I ++SE+A  F N  +  +AY   +AS   A E G  +  ++ + ++ G YF K+      +   K   +               DW  L +++  +G+ N +LMAVAP  S + +   T  + PI       ++ K        YKI V       + M+  K A+ I     I   +A Q+H+DQ +S  L++      +DL   ++ A+     S YY+R        + ++ EC  C
  S:    68 KYGDFYALIKTLSTQGIYSPDILRLYSKDEINEFGREIEPERDKLFNYIGLKTLADRYLAKSYDGEVY-ELPQERFMIIAMTLMMYERED---HRADLVKEAYWALSNLYMTVATPTLANAGL-SFGQLSSCFIDIVDDSLRSIYDSNTDVAMLSKNGGGIGVYVGKLRARGSDIKGFKGVSSGVIPWVRQLNNTAVSVDQLGRRKGSIAVYLDVWHKDILAFLDLKLNNGDERLRAHDIFPGVCIPDLFMESVRDRGDWYLFDPHEVRRIMGYSLEDFYDEEKGEGSFRQKYEECVDSPELAKVRVPAIEIMKSIMKSQLETGTPYMFYRDEANRMNPNGHAGMIYCTNLCTEIMQNMSPTVVVEEETDRDGNIITTKEPGDFVVCNLSSINLTRAYE---VLDRLIPIQVRMLDNVIDINADKIEVQQAVVTNRKYRAIGLGTFGWHHLLAVRGIQWESEDAATFANELYEKIAYLTIRASCMLAAEKG-PYPAYEVSDWSTGDYFIKHGYARPGFLEMKKGDL--------------TDWEDLADNVTIYGIRNGYLMAVAPNMSTAKIGGSTDGIDPIFMRTYSEEKSK--------YKIPVTVPDLTTSTMWLYKSAFNIDQTWSIRQNAARQRHIDQGVSFNLYVPNGVKAKDLLGLHMLAWESGLKSTYYLR------SATTEIEECEAC 727
>gi|163781847|ref|ZP_02176847.1| ribonucleotide reductase alpha chain [Hydrogenivirga sp. 128-5-R1-1] >gi|159883067|gb|EDP76571.1| ribonucleotide reductase alpha chain [Hydrogenivirga sp. 128-5-R1-1] (767 aa)
Score = 646, Expect = 4.2e-65, Identities = 175/562 (31%), Positives = 297/562 (52%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQR-EYGKPMSDI----SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSI-LNTDLTYE--------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLT-ENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ATPT +NA ++   +  SC++L V+D++  I        Q+SK  GG+   +  LR  GAPI+  K  ++GIIPV+K++ DV +Y +QLG R+G+ ++ L+ +H DIL FL+ K    DE+ +   +   + +PD+     +  +   L  PY  +    GK + D+       E        P   KK + A +L++++  V FE+G P++ F D AN  N   +  ++  SNLC EI Q  +P+  L  +L  E        + G+ V CNLGS+N+ KV        + V   ++ LD++  + +  + P  E  N + RA+G+G  N H  L  N + ++SE+ + F +  F  + ++A K S E AKE G  +  F+ + ++ G +F +           K E ++E  KE    +P    W  L ED+++ G+ NS+L+A+ PTGS S +   TPS+ PI +  +  KE  +  + +P    +++ + ++ K AY I    ++   +  Q+ +DQA S+ LF+  E      L+K Y  A+     +IYY+R +   + D E   EC +C +
  S:   217 ATPTLMNA-RRPFTQLSSCFILTVDDDLYDIFDNVQKAAQISKHAGGLGIYIGKLRATGAPIRKFKGASSGIIPVVKVINDVMTYVDQLGMRKGSASITLDIWHKDILDFLEVKTNAGDERKKAHDIHPAISIPDLFMKRVKNREKWTLLDPYYTKNVRDGKNLEDLWGEAFEEEYERLEKELPEDAKKEVDAFELWKRLLTVAFETGEPYLFFRDHANRINPNKHAGMVYSSNLCHEIVQNMSPTKHLGKELDPETGEIVHRKKSGDVVVCNLGSVNLGKVYTK-ETMEQVVPKLVRLLDNVIEM-NYYAIPEAEYTNKRYRAIGIGVSNYHYCLVKNGVNWESEDHLKFADKLFELLGFYAIKGSMELAKERG-KYRLFEGSDWSRGIFFGR-----------KAEELEENSKENGNDLP----WKDLAEDVRENGIRNSYLLALMPTGSTSLILGATPSVDPIFA--KYYKEENMSGI-LPQVPPEIDRFFWHYKSAYNIDQEWVVRAAAVRQKWIDQAQSLNLFIDPEKIDGPTLSKIYQLAWELGLKTIYYLRSKS--ITDIE---ECESCAV 767
>gi|194366072|ref|YP_002028682.1| ribonucleoside-diphosphate reductase, alpha subunit [Stenotrophomonas maltophilia R551-3] >gi|194348876|gb|ACF51999.1| ribonucleoside-diphosphate reductase, alpha subunit [Stenotrophomonas maltophilia R551-3] (787 aa)
Score = 643, Expect = 1.0e-64, Identities = 169/542 (31%), Positives = 279/542 (51%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS-----ILNTD--LTYEQLGEDVCCNLGSLNIAKVMEDGANFGKT------VKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  GAPI+G+ N + G++P +K L +     +QLGQR+GA AVYL+ +H DI  F+D +  N D+++R   +   V VPD+         D  LF P+++++  G  + D         S  + Y  L+ +  I+++ + A  LF++I   Q E+G PF+ + D  N +N   +  +I  SNLCTEI Q  +P+     I++ D  +T  + G+ V CNL S+N+ + +    +   T      +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I ++S++A    +  +  + +   +AS + AKE G  +  F  + + +G YF                      ++Y  A      W  L  ++   GL N  L+AVAP  S + ++  T S+ PI S     +E K  R  V A  + +  + YY KGAY++     +   +  Q+HVDQ+IS  L++        L + ++ A+ +   + YY+R
  S:   239 ATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGAPIRGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAVAVYLDIWHRDIEAFMDLRLNNGDQRLRAHDVFTSVCVPDLFMEAVERRADWYLFDPHEVKQAKGWYLQDFYDEKRGSGSFRDRYAELVADERISRRTVKAIDLFKRIMLSQLETGNPFLFYRDEVNRRNPNKHAGMIYSSNLCTEILQNMSPTRMIQEIVSGDQIVTTRRAGDFVVCNLSSINLGRAISAPDDLLATDVLERLIPIQVRMLDNVIDLNAL-PVPQATITNHKYRAIGLGTFGWHHLLAQQSIQWESQDAEQLADRLYERINFLTIQASAQLAKEKG-SYPMFAGSDWHNGRYFSD--------------------RDYSGAA-----WDSLAREVATHGLRNGWLLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLETWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNLYVPSTIRASTLLELHLSAWREGLKTTYYVR 773
>gi|23100544|ref|NP_694011.1| ribonucleotide-diphosphate reductase alpha subunit [Oceanobacillus iheyensis HTE831] >gi|22778777|dbj|BAC15045.1| ribonucleoside-diphosphate reductase alpha subunit [Oceanobacillus iheyensis HTE831] (744 aa)
Score = 642, Expect = 1.1e-64, Identities = 170/560 (30%), Positives = 291/560 (51%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNS-ALNNRIIMSNLCTEITQINTPSIL--------NTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAP--TIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NAGK   G+  SC++  V+D+++SI  + +   +LSK GGG+   +  +R  G+ IKG K  ++G++P +K L +     +QLG R+GA A+YL+ +H DI  FLD K  N D+++R   +  GV +PD          D  LF P+++++  G  + D         S    YE  + N  ++K+ + A ++ +++ + Q ESG PF+ + D  N +N+ A    I  SNLCTEITQ  +P+          NT +   + G+ V CNL S+N+ + +++     + +   ++ LD++    D+++ P    E  N K RA+GLG    H  LA   I ++S+EAV + +  +  +AY   ++S E +KE G  +  ++ +K+  G YFD+                    K Y     T   W +L  ++K+ G+ N +LMAVAP  + + ++  T S+ PI   +   +E K  ++ V A ++D + Y  Y + AY +     +   +  Q+H+DQ+IS   ++        L   +  A+ +   + YY+R        S  + EC  C
  S:   202 ATPTLTNAGKTH-GQLSSCFIDTVDDSLQSIYDSNSDIAKLSKNGGGIGVYMGKIRARGSSIKGFKGMSSGVVPWIKQLNNTAVSVDQLGTRKGAIAIYLDVWHQDIESFLDLKLNNGDDRMRAHDIFTGVCLPDYFMEQVENRGDWYLFDPHEVRQVMGYSLEDFYDEQKGSGSFRTRYEECIANEALSKRKVPAIEIMKRLMKSQLESGTPFMFYRDEVNRQNANAHEGLIYCSNLCTEITQNQSPTEFVEEFLENENTIVKKFKSGDYVVCNLSSVNLGRAVKNDV-LERLIPIQVRMLDNV---IDINTLPIKQAEITNRKYRAIGLGTFGWHHLLALKGIAWESDEAVAYADELYEKIAYLTIQSSMELSKEKGH-YPVYEGSKWQTGEYFDQ--------------------KGY-----TGNKWDELKAEVKQHGMRNGYLMAVAPNSTTAMIAGSTASIDPIFQ-VFYYEEKKDFKIPVTAPELDHHTYNVYRRSAYIVDQRFSVKQNAKRQKHIDQSISFNFYVPNTIKASVLLDLHTQAWREGLKTTYYVR------STSNDIEECEWC 742
>gi|190574753|ref|YP_001972598.1| putative ribonucleoside-diphosphate reductase 2 alpha chain [Stenotrophomonas maltophilia K279a] >gi|190012675|emb|CAQ46303.1| putative ribonucleoside-diphosphate reductase 2 alpha chain [Stenotrophomonas maltophilia K279a] (828 aa)
Score = 639, Expect = 2.4e-64, Identities = 169/542 (31%), Positives = 278/542 (51%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS-----ILNTD--LTYEQLGEDVCCNLGSLNIAKVMEDGANFGKT------VKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           ATPT  NAGK   G+  SC++  V+D+++ I  + T   ++SK GGGV   L  +R  GAPI+G+ N + G++P +K L +     +QLGQR+GA AVYL+ +H DI  F+D +  N D+++R   +   V VPD+         D  LF P+++++  G  + D         S    Y  L+ +  I+++ + A  LF++I   Q E+G PF+ + D  N +N   +  +I  SNLCTEI Q  +P+     I++ D  +T  + G+ V CNL S+N+ + +    +   T      +   ++ LD++  L  L   P     N K RA+GLG    H  LA   I ++S +A +  +  +  + +   +AS + AKE G  +  F  + + +G YF                      ++Y  A      W  L  ++   GL N  L+AVAP  S + ++  T S+ PI S     +E K  R  V A  + +  + YY KGAY++     +   +  Q+HVDQ+IS  L++        L + ++ A+ +   + YY+R
  S:   280 ATPTLANAGKVG-GQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGAPIRGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAVAVYLDIWHRDIEAFMDLRLNNGDQRLRAHDVFTSVCVPDLFMEAVERRADWYLFDPHEVKQAKGWYLQDFYDEKRGAGSFRLRYAELVADERISRRTVKAIDLFKRIMLSQLETGNPFLFYRDEVNRRNPNKHAGMIYSSNLCTEILQNMSPTRMIQEIVSGDQIVTTRRAGDFVVCNLSSINLGRAISAPDDLLATDVLERLIPIQVRMLDNVIDLNAL-PVPQATITNRKYRAIGLGTFGWHHLLAQQAIQWESPDAEELADRLYERINFLTIQASAQLAKEKG-SYPMFAGSDWHNGRYFRD--------------------RDYSGAA-----WDSLAREVATHGLRNGWLLAVAPNMSTAQIAGSTASIDPIYSAF-YYEEKKDFRRPVAAPGLSLETWPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNLYVPSTIRASTLLELHLSAWREGLKTTYYVR 814
>gi|109947415|ref|YP_664643.1| ribonucleotide-diphosphate reductase subunit alpha [Helicobacter acinonychis str. Sheeba] >gi|109714636|emb|CAJ99644.1| ribonucleoside-diphosphate reductase alpha chain [Helicobacter acinonychis str. Sheeba] (788 aa)
Score = 637, Expect = 4.3e-64, Identities = 207/642 (32%), Positives = 331/642 (51%)
  Q:    82 KKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTY----------EQL----------------------------------GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQ-DWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL---FECTTC 723
           +K+   FL S  +  + + F   +++G    Y  Y LK  +N  Y       +  +  +F   NEQ+    AL + + +       ATPT  NA +  + +  SCY+    DN+E I  +      LSK GGG+ +  + +R  G+ I G KN + G IP +KI  DV    +QLG R+GA AVYL  +H D+++F+D ++ + DE+ R   L   + V D+      E+    LF PY   D+   YG+      +  EYE    +P I K+YI+A+ L+++I    FE+G PF+ F D AN  N   +  II  SNLCTEI Q   P+     + Y          +QL                                  G+   CNL S+N++K+  +  +  + V   ++ LD++    DL+  P   ++  N +NRA+GLG M     LA +KI + S+E ++  +     ++YHA   S   AKE G V+++F+N++++ G +             P  +  KE LK  +  +     DW  L E +K FG+ N +LMA+APT SIS L   T +++PI    +  +E   G + V    + V  + +Y   AY+I    +I   +  Q+ +DQ  S+ +FL  ENA+ + L++ Y  A+     S YY+R     + +   L    EC  C
  S:   118 EKFDLEFLNSQIKPERDFQF---NYLGIKTLYDRYLLKDANN--YPIELPQHMFMSIAMFLAQNEQEPNKIALEFYEVLSKFEAMCATPTLANA-RTTKHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIGSYIDGYKNASAGTIPFLKIANDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFPALWVCDLFMKRVLEDAIWTLFDPYECKDLSELYGQEFEKRYL--EYE---KDPKIIKEYINAKDLWKKILMNYFEAGLPFLAFKDNANRCNPNAHTGIIRSSNLCTEIFQNTAPNHYYMQIEYTDGTMDFFEEKQLVTTDSNITKCANKLTSTDILKGKQIYIATKIAKDGQTAVCNLASINLSKINTE-EDIKRVVPIMVRLLDNV---IDLNFYPNRKVKATNLQNRAIGLGVMGEAQMLAEHKIAWGSKEHLEKIDALMEQISYHAIDTSVNLAKEKG-VYKDFENSEWSKGIF-------------PIDKANKEALKLTEKGLFNYACDWQGLREKVKTFGMRNGYLMAIAPTSSISILVGTTQTIEPIYKK-KWFEENLSGLIPVVVPNLSVETWNFYTS-AYDIDAKDLIRAAAVRQKWIDQGQSINVFLRVENASGKTLHEIYTLAWKLGLKSTYYLRSESPSIDEKSVLDRSVECHNC 787
>gi|182419342|ref|ZP_02950594.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium butyricum 5521] >gi|182376673|gb|EDT74245.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium butyricum 5521] (743 aa)
Score = 633, Expect = 1.3e-63, Identities = 184/575 (32%), Positives = 302/575 (52%)
  Q:   149 ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLAREN--KDMALFSPYDIQREYGKPMSDI---SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ------INTPSILNTD---LTYEQL--GEDVCCNLGSL---NIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           A  + D + + +   ATPT  NA +K   +  SC++  VED++E I ++     Q+SK GGG+   +  +R  G+ I+G K  + GIIP +K+  D     +QLG R G+ A++L+A+H DI +FL  +  N D++ +   +  G+  PD+ + LA  N   D  +  P++I+   G  + D       E+Y   +N+  I K+ +S + + + I +   E+G PF  + D  N+ N   +N II  SNLCTEI Q      IN   I+N D   +  + +  G+ V CNL S+   NI    E+  ++   V+  I+A+D++  L +  S P  E  N K RA+GLG    H  LA N+I++  E+  DF +  +  + Y+A KAS + AKE G  +  FK + + +G YF+                    L+ YK      + W  L ++IK+ G+ N +L+AVAP GS + ++  +  + P+++   + +E K   +   A  ++ +NY YY   AY I     + +    Q+H+DQ  S  L++T N T R +   YI A      SIYY+R +      S ++ EC +C
  S:   185 AKRFYDVLSSLKATMATPTMSNA-RKPFYQLSSCFIDTVEDSLEGIYKSLDNFAQVSKFGGGMGIYMGKVRALGSSIRGFKGASGGIIPWVKLFNDTAVAVDQLGVRNGSVAIWLDAWHKDIPEFLQIRTNNGDDRKKAHDVFPGLCYPDLFWKLAENNIDSDWYMMCPHEIKEIKGYSLEDFYGDEWEEKYYECVNDERIEKRVMSVKDIVRLIIKSAAETGAPFAFYRDTVNKMNPNKHNGIIYSSNLCTEIMQNMSPMEINKSEIINEDGSCIVTQNIIPGDFVVCNLSSVVLGNIDVCSEEEVDY--VVETQIRAMDNVIDL-NYYSVPFAEVTNKKYRAIGLGTSGYHHMLANNRIHWTEEKHKDFADEVYERINYYAVKASMKIAKEKG-AYNLFKESDWDNGDYFE--------------------LRGYK-----DEKWCALRKEIKENGMRNGYLLAVAPNGSTATIAGTSEGIDPVMARFYL-EEKKGSIIPKTAPNLNDDNYWYY-NPAYNIDQAWSVQMNGIRQRHIDQGQSFNLYITNNYTMRQIMNLYIEACKCGVKSIYYVRSK------SLEVTECESC 741
>gi|51891460|ref|YP_074151.1| ribonucleoside-diphosphate reductase alpha subunit [Symbiobacterium thermophilum IAM 14863] >gi|51855149|dbj|BAD39307.1| ribonucleoside-diphosphate reductase alpha subunit [Symbiobacterium thermophilum IAM 14863] (782 aa)
Score = 633, Expect = 1.3e-63, Identities = 187/619 (30%), Positives = 307/619 (49%)
  Q:   105 SFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALT----YLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDISITEEYE-------NLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS--ILNTD----LTYE-QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVY-VPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           +++G +     Y +K F  +   E  ++R +  A+      E D +T    + D +       ATPTF NA      +  SC++  V+D+++SI     +  Q+SK GGG+   +  LR  G+ I+G K  A G+IP ++   D     +QLG R+GA +++L+ +H +I +FL  K  N D+++R   +  GV VPD       ++ D  LF P++++ E G  + D +  EE+E          +   +    + AR++ + + + Q+E+G PF+ F D  N  N   +  ++  SNLCTEI Q  +P+  I  TD    +TY  Q G+ V CNL S+N++KV  +     + V  AI+ LD++  L +    P  +  N K RA+GLG    H  LA   I+++SE+ +   +  F  + Y+A K S E A E G  +   K + +  G YF                     L+ Y+        W  L     + GL N++L+A+APT S S L   T S+ PI     +  EGK  +V  + A  +    Y+YY K A++I     I      Q+H+DQ+ S  L++  +   RD    Y+ A+     ++YY+R R   + ++    EC  C
  S:   181 TYVGLLHLADRYLIKGFHGEI-LELPQERYMHIAMHLA-SVESDRVTWAKRFYDVLSRQEMTVATPTFRNAATPLP-QLSSCFIDTVDDSLQSIYDTNQSFAQVSKHGGGMGIYIGKLRARGSAIRGRKGAAAGVIPWVRNYNDTAVAVDQLGARKGAVSIWLDVWHKEIFEFLALKLNNGDDRMRAHDIFPGVCVPDAFMRAVEQDADWHLFCPHEVRTEMGFSLED-AWGEEWERRYRLCVEAAHADKLDATVVRARQVAKAMLKSQYETGGPFLFFRDTVNRLNPNKHAGMVYCSNLCTEIAQNQSPTRLIEKTDDGEVITYRWQPGDFVVCNLASINLSKVHTE-EKIAEVVPLAIRMLDNVIDL-NFYPVPQAKITNKKYRAIGLGVHGYHQMLAELGIHWESEDHLRKADEVFELLNYYAVKTSIELAAEKG-CYPLCKGSDWETGEYF--------------------ALRGYE-----SDRWQALRRQAAEVGLRNAYLLAIAPTSSTSLLCGTTASVDPIYD--RVYNEGKKDQVIPLAAPGLSPKTYLYY-KPAHQIDQTWSIRAAGVRQRHIDQSQSFNLYIRPDIKGRDFLNLYMQAWKNGLKTVYYVRSRSLEVTEA----ECEAC 780
>gi|15605686|ref|NP_213062.1| ribonucleotide reductase alpha chain [Aquifex aeolicus VF5] >gi|6225952|sp|O66503|RIR1_AQUAE Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) >gi|2982838|gb|AAC06460.1| ribonucleotide reductase alpha chain [Aquifex aeolicus VF5] (801 aa)
Score = 631, Expect = 2.3e-63, Identities = 184/577 (31%), Positives = 313/577 (54%)
  Q:   149 ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY-----------DIQREYGKPM--------------SDI--------SITEEYENLL-----NNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIMS-NLCTEITQINTPS-----ILNTD---LTYEQLGEDV-CCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLT-ENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           A  + D +   +   ATPT +NA ++   +  SC++L V+D++  I         +SK  GG+   L  +R  GAPI+  K  ++G+IPV+K++ D  +Y +QLG R+G+ ++ L+ +H DIL FL+ K    DE+ +   +   V +PD+     +  +D  L  PY           D + +  KP+               DI           EE+E        N P+  KK +++ +L++++  V FE+G P+I F D AN KN   +  ++ S NLC EI Q  +PS     +L+ +   +TY++   D+  CNLGS+N+ KV  +     + +   ++ LD++  + +  + P  E  N + RA+G+G  N H  L  N I ++SEE + F +  F  +A++A K S E AKE G  ++ F  + ++ G  F +             E ++E  ++    +P    W +L E+IKK+G+ N++L+A+ PTGS S +   TPS+ PI +     KE  +  + +P    +V+ + ++ K AY I     I   +  Q+ +DQA S+ LF+  +N     L++ Y  A+     +IYY+R R  +  D E   EC  C +
  S:   203 AKKFYDVLSEHKVTVATPTLMNA-RRPFTQLSSCFVLTVDDDLFDIFDNVKKAGMISKFAGGLGVYLGKIRATGAPIRKFKGASSGVIPVVKLINDTMTYVDQLGMRKGSASITLDIWHKDILDFLEVKTNVGDERKKAHDIHPAVSIPDLFMKRLKNREDWTLIDPYWARQYITRKIYDGKYKEVKPLPGSHYYVGIKEDGTQDILEPKGLEDFYGEEFEKWYLELEENLPSYAKKKVNSFELWKRLLTVAFETGEPYIFFRDEANRKNPNKHTGMVYSSNLCHEIVQTMSPSKHEKPVLDPETGEITYKKEAGDLPVCNLGSVNLGKVHTE-EEIKEVLPLLVRMLDNVIEM-NFYAIPEAEYTNKRYRAIGIGVSNYHYCLVKNGIKWESEEHLKFADKLFELIAFYALKGSLELAKERG-RYKLFDGSNWSKGILFGR-----------SVEEIEENSRQNGNNLP----WRELAEEIKKYGIRNAYLLALMPTGSTSLILGATPSIDPIFA--RFYKEENMSGI-LPQVPPEVDRFYWHYKTAYTIDHEWTIRAAAVRQKWIDQAQSLNLFVDPQNIDGPRLSRLYELAWELGLKTIYYLRSRSAM--DIE---ECEACSV 801
>gi|172058303|ref|YP_001814763.1| ribonucleoside-diphosphate reductase, alpha subunit [Exiguobacterium sibiricum 255-15] >gi|171990824|gb|ACB61746.1| ribonucleoside-diphosphate reductase, alpha subunit [Exiguobacterium sibiricum 255-15] (755 aa)
Score = 631, Expect = 2.5e-63, Identities = 179/560 (31%), Positives = 289/560 (51%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI--------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYE-------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPI--EIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NAGK   G+  SC++  V+D++  I  + T    LSK GGG+   +  +R  G+ IKG K  ++G+IP MK L +     +QLG RQG+ AVYL+ +H DIL+FLD+K  N DE++R   L  GV +PD          D  LF P++I+   G  + D         S TE+Y   +N P +++  + A  L ++    Q E+G P++ F D  N  N   +  +I  SNLC+EI Q  +P+ +  + T +         G+ V CNL S+ +A+ + +     + +   ++ LD++  L  +   P  +  N K RAVGLG    H  LA   I ++S EAV + +  +  +AY    AS + AKE G  +  F+ +++  G Y  +                    + YK     + +W +L  DI   G+ N++LMAVAP  S + ++  T S+ PI   +  E +K  K+  V VP    + N   ++ K A+EI     I   ++ Q+H+DQAIS  L++  +   ++L + ++ A+     +IYY R        + ++ EC +C
  S:   212 ATPTLSNAGKSY-GQLSSCFIDTVDDSLRGIYDSNTDVATLSKGGGGIGVYMGKIRSRGSDIKGFKGVSSGVIPWMKQLNNTAVSVDQLGMRQGSIAVYLDIWHKDILEFLDAKLNNGDERLRTHDLFTGVSLPDHFMRTVEARGDWYLFDPHEIRTVMGFSLEDSFDETEQGGSFTEKYTACVNEPRLSRTKVPAIDLVKRYMRSQLETGTPYMFFRDAVNRANPNKHAGMIYSSNLCSEIMQNMSPTTVTEEYTEDGKIIITKTPGDFVVCNLSSIALARAVRENV-LERLIPIQMRMLDNVIDLNTI-DVPQAQITNQKYRAVGLGTFGWHHLLALEGIRWESVEAVQYADRLYEKIAYLTIDASMQLAKEKG-AYRLFEGSEWQTGEYIAR--------------------RHYKTT--PELNWDRLQADITAHGMRNAYLMAVAPNSSTAIIAGSTASIDPIYKKVYAEEKKNYKI-PVTVPDLTPETN---WFYKSAFEIDQLWSIRQNASRQRHIDQAISFNLYVKNSVKAKELLEMHMEAWQLGMKTIYYTR------STTVEIDECESC 753
>gi|149194866|ref|ZP_01871960.1| ribonucleotide-diphosphate reductase alpha subunit [Caminibacter mediatlanticus TB-2] >gi|149135025|gb|EDM23507.1| ribonucleotide-diphosphate reductase alpha subunit [Caminibacter mediatlanticus TB-2] (813 aa)
Score = 626, Expect = 8.3e-63, Identities = 192/557 (34%), Positives = 302/557 (54%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYEQLGED-----------------------------------------------VCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSY-FDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-TENATTRDLNKAYIYAFNKKCVSIYYIR-----IRQEVLKDSEKLFEC 720
           ATPT  NA +  R +  SCY+  + DN+E I         LSK GGG+ +  + +R  G+ I   KN A G+IP +KI  D+    +QLG R+GA AVY+  +H DIL FLD K+ + +E+ R   L   + +PD+      E+    LF PY   D+   YG+      I  EYE   N  +ITK+ + A++L+++I    +E+G PF+ F D AN++N   ++ II  SNLCTEI Q   P+     +T+E   E+                                                 CNL S+N++KV        + V  AI+ LD++    DL+  P    ++ N KNRA+GLGAM     LA  +I++ S+E +   +  F  ++Y A K S E A+E G  +  F+ ++++ G    D              E  K+L+ E  L    + DW  L E +KK G+ N +LMA+APT SIS L+  T +++P+    +  +E   G + V    +  + YM+Y   AYE+    ++   +  Q+ +DQ  S+ +F+ T+ A+ R LN+ Y+  +     S YY+R     +++EV+  S + F C
  S:   222 ATPTLSNA-RTTRHQLSSCYVGSMNDNIEGIFDDYKEMALLSKFGGGIGWDFSKIRALGSFIDNHKNAAGGVIPWLKITNDIAIAVDQLGTRKGAIAVYIEPWHMDILDFLDLKKNSGEERRRAHDLFPALWIPDLFMKRVEEDGLWTLFDPYETGDLTNLYGEEFEKKYI--EYE---NREDITKRKVKAKELWKKILLEYYETGNPFLCFKDNANKRNQNDHSGIIRSSNLCTEIFQNTEPNHYKVKVTFEDGSEEYFNEDDDVKVSLGDVEVVVKGKKITSLHYINGKKVYIVEKVPFDGKTAVCNLASVNLSKV-NTPEKIAEVVPIAIRMLDNV---IDLNYYPVRKTKDTNLKNRAIGLGAMGEAQLLAERQIFWGSDEHLKLIDEIFEGISYWAIKTSAELAEEKG-AYPEFEGSRWSKGILPIDT-----------ANEEAKKLV-ERDLFSAMQYDWKSLREKVKK-GMRNGYLMAIAPTSSISILTGTTQTIEPVYKR-KWYEENLSGLIPVVVPNLSADTYMFYTP-AYELDQRILVKAAAIRQKWIDQGQSLNIFITTDKASGRYLNEIYMLGWKLGLKSFYYLRSQSPEVKEEVMDRSVECFGC 812
>gi|163761840|ref|ZP_02168906.1| Ribonucleoside-diphosphate reductase [Bacillus selenitireducens MLS10] >gi|160357467|gb|EDP84114.1| Ribonucleoside-diphosphate reductase [Bacillus selenitireducens MLS10] (735 aa)
Score = 622, Expect = 2.3e-62, Identities = 173/560 (30%), Positives = 289/560 (51%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILK-FLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMA-------LFSPYDIQREYGKPMSDIS---------------ITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKN------SALNNRIIMSNLCTEITQINTPSILNTDLTYEQ--------LGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIE--NGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NAGK   G+  SC++  V+D+++ I        +LSK GGG+      +R  G+ IKG K  ++G+IP ++ L +     +QLGQRQGA AVYL+ FH DI+  FLD K  N DE+ +   +  GV +PD+      E  +         +F P+++++  G    D +                TE+YE  +++P + ++   A  +  ++   Q E+G P+  + D  N +N            I  SNLCTEI Q  +PS++  +   E+         G+ V CNL S+N+     D     + +   ++ LD++    DL+  P  +    NS+ RAVGLG    H +LA N+I+++S+EAV   +  + T+AY A +AS   A+E G  +  FK +++  G YF++                    + Y     T  +W  L + + + G+ N  +MAVAP  S + +   T  + P+ + +E  +E K  +  V A ++D N Y YY K  + +     I   +A Q+H+DQ +S  L++      ++L   ++ A+ +   + YYIR   +     E++  C  C
  S:   172 ATPTLANAGKSH-GQLSSCFIDTVDDSLDGIYLNNWDIARLSKDGGGIGVYYGKVRALGSDIKGFKGNSSGVIPWIRQLNNTAVSVDQLGQRQGAIAVYLDVFHKDIMNGFLDLKTNNGDERRKAHDIFTGVCLPDLFMKKLEETDENGRSIGEWHVFCPHEVKQIMGWKDKDGNPLGLEDFFDEADRPYFTEKYEEAVHHPLLPRETYRAMDIMARMMVSQLETGTPYFFYRDEVNRQNPNKIAGEPGRTTIYSSNLCTEIAQNMSPSVITKEYETEEGDQVIVRKPGDFVVCNLSSVNLGNA-GDPDILKRLIPIQMRMLDNV---IDLNQLPVQQARRTNSRYRAVGLGTFGWHHYLAKNQIHWESDEAVQEADRLYETIAYLAIEASAALAREKG-AYPAFKGSEWESGRYFER--------------------RGY-----TSANWQTLKKTVSESGVRNGWMMAVAPNSSTAKIGGSTDGIDPLYA-VEFAEEKKNFKFLVTAPELDHNTYPYYQKTRHTLDQTWSIRQNAARQKHIDQGVSFNLYVHHAIRAKELLSLHLEAWKQGLKTTYYIRSTSQ-----EEIESCDVC 733
>gi|187778604|ref|ZP_02995077.1| hypothetical protein CLOSPO_02199 [Clostridium sporogenes ATCC 15579] >gi|187772229|gb|EDU36031.1| hypothetical protein CLOSPO_02199 [Clostridium sporogenes ATCC 15579] (763 aa)
Score = 622, Expect = 2.6e-62, Identities = 206/691 (29%), Positives = 345/691 (49%)
  Q:    33 NGNFQF-ENDLLAVEKYLETEIKPNFKKFNS----------IKEKL--EYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNA--LLFGRGNEQ--DALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLTYE----------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIEN--GNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVN--NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N N+Q+    LL  + Y E +I  ++  F            +K KL  EYL +ENY D  +  K  S +++   E+ + +N+        +K      L    N    E  ++R +  A  L    G+++   A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +   +  +R   + I+G KN + G++P +++  D     +QLG+R+G  ++ L+ +H DI  FLD K  N D++ +   +   V +PD+      + +  +LF PY +++     + D          T+ Y     N NI +  + A  + +++ +   E+G PFI F D  N  N   +  +I  SNLC EI Q ++   ++  ++  E          + G+ V CNL S+N++KV ++  +F K +   I+ LD++  L  L   P  E    + K RA+GLG    H FL  NKI ++S+E +   +  +  +AY A KAS E AKE G  +  FK +++  G YF++     E                          W QL  DIK++G+ N ++ A+APTGS S +++ T  + P+     +  E K G  + P    D+N  N+ YY K A+ I     I  C+A Q+H+DQA S  L++T     +++   Y+ ++ +   +IYY+R        S ++ ECT+C
  S:    84 NANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYELVKKLVKMKLYGEYL-IENYSDEEI--KELSKYIVP--ERDELFNYE------GLKLLNDRYLIKGHNGEVLELPQERFMTIAMHLAIPEGDKKIFYAKGFYDILSELKVTVATPTLGNAGTPFY-QLSSCFISTVGDNLWSIYDVNQKFAQVSKHGGALGIYMGKIRALNSEIRGHKNASGGVVPWIRLYNDTAVAVDQLGKRKGGASITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMERLEKREQWSLFDPYMVEKIMDYKLEDYFDDVDCKEFTKRYLECEKNINIPRNTVPALDIMKKLMKSAVETGTPFIFFRDTVNIANPNKHKGMIYSSNLCHEIAQNMSESELVEEEIIDENGYSEVVQRIKAGDMVTCNLNSINLSKVEKE--DFSKCIPLQIRMLDNVISLNKL---PVKEARVTSDKYRAIGLGTSGYHHFLVNNKIRWESDEHIKVADEIYEEIAYTAIKASMELAKEKG-SYPAFKGSEWETGKYFERRGYNSEK-------------------------WQQLQSDIKRYGMRNGYITAIAPTGSTSNIANTTAGIDPVFKKFFM--EEKKGS-FTPKTAPDLNEENFWYY-KEAHTIDQQWSIKACAARQKHIDQAQSFNLYITPEIKAKEILNMYMESWKQGVKTIYYVR------NKSLEMDECTSC 761
>gi|42525857|ref|NP_970955.1| ribonucleotide-diphosphate reductase subunit alpha [Treponema denticola ATCC 35405] >gi|41815907|gb|AAS10836.1| ribonucleoside-diphosphate reductase, alpha subunit [Treponema denticola ATCC 35405] (845 aa)
Score = 621, Expect = 3.4e-62, Identities = 205/682 (30%), Positives = 339/682 (49%)
  Q:    42 LLAVEKYLETEIKPNFKKFNSIKEKLEYLFLENYYDFNVFKKYSSSFL---ISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYL----DEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARE--NKDMALFSPYDIQREYGKPMSDISITE---EYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDL------------TYEQLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSP--IEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           +L  +  L+TE++   ++ +S  EK++YL  E  Y   + + YS   L    S   + +   F +S+    ++ Y  +      +    E  ++  +  AL      +   L ++    D   T +   ATPT  NA +K   +  SC++  V D+++ I R+     ++SK GGG+      +R  G+PI+G    A GII  +K+  D     +QLG RQG+ AVYL+ +H DI +FL  +  N D++++   +   V  PD+ +   R+  N    L  P++I +  G  + D    E    Y++ + +  I K+ I  ++L + I +   E+G PF    D AN+ N+  +  +I  SNLCTEI+Q N   I + ++            T    G+ V CNL SL +  + + D       V  A++ALD++  L +    P  +  NS+ R++GLGA   H  LA N I ++SEE ++F +  F  + Y A KAS++ AKE G  +  F+ + +  G YF K    +EN                         W  LTE++K  G+ N++L+AVAPT S S ++  T  + PI++   +E +K   + RV   A  +    Y  Y K A+ I     I      Q+H+DQA S+ L++T   T   +   Y+ A+ +   SIYY+R R      S ++ EC +C
  S:   179 MLQFKLKLKTELEK--RQIHSFYEKIKYLENEGLYGTYICEAYSRDELEEAASFINEERNKLFTYSALDLLLRRYVIHT----HSNIVLESPQEMFLGIALHLAMKEKLKRLEWVRRFYDMTSTLKVTMATPTLSNA-RKPYHQLSSCFIDTVPDSLDGIYRSIDNFAKVSKFGGGMGLYFGKVRAVGSPIRGFMGAAGGIIRWIKLANDTAVAVDQLGVRQGSVAVYLDVWHKDIPEFLQLRTNNGDDRMKAHDVFPAVCYPDLFWKTVRDDINSSWHLMCPHEILKTKGYALEDFYGEEWEKRYKDCVADSRINKREIPIKELVRLILKSAVETGTPFAFNRDHANKTNTNPHKGMIYCSNLCTEISQ-NMSGIKHKNIEIKTEDGDTVVATTTIPGDFVVCNLASLVLGNIDVNDEQEIDTIVSSAVRALDNVIDL-NFYPIPYAQITNSRYRSIGLGASGYHHALAKNGIAWESEEHLNFADKVFERINYAAIKASSQIAKEKG-SYSYFEGSDWQTGEYFKKRNYVDEN-------------------------WKALTEEVKSNGMRNAYLLAVAPTSSTSIIAGTTAGVDPIMNKYFLEEKKGSLMPRV---APSLSPETYWLY-KNAHHIEQGWSIRAAGLRQRHIDQAQSVNLYITNEFTFSKVLSLYVKAWEEGLKSIYYVRSR------SLEVEECESC 843
>gi|15645304|ref|NP_207474.1| ribonucleotide-diphosphate reductase subunit alpha [Helicobacter pylori 26695] >gi|2500207|sp|P55982|RIR1_HELPY Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) >gi|2313806|gb|AAD14884.1| ribonucleoside-diphosphate reductase 1 alpha subunit (nrdA) [Helicobacter pylori 26695] (788 aa)
Score = 619, Expect = 5.0e-62, Identities = 205/642 (31%), Positives = 329/642 (51%)
  Q:    82 KKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS-----ILNTDLTYE---------------------------------------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQ-DWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL---FECTTC 723
           +K+   FL S  +  + + F   +++G    Y  Y LK  +N          +  +  +F   NEQ+    AL + + +       ATPT  NA +  + +  SCY+    DN+E I  +      LSK GGG+ +  + +R  G+ I G KN + G IP +KI  DV    +QLG R+GA AVYL  +H D+++F+D ++ + DE+ R   L   + V D+      E+    LF PY   D+   YG+      +  EYE    +P I K+YI+A+ L+++I    FE+G PF+ F D AN  N   +  II  SNLCTEI Q   P+     I  TD T E                                       + G+   CNL S+N++K+  +  +  + V   ++ LD++    DL+  P   ++  N +NRA+GLG M     LA ++I + S+E ++  +     ++YHA   S   AKE G V+++F+N++++ G +             P  +   E LK  +  +     DW  L E +K  G+ N +LMA+APT SIS L   T +++PI    +  +E   G + V    ++V  + +Y   AY+I    +I   +  Q+ +DQ  S+ +FL  ENA+ + L+  Y  A+     S YY+R     + +   L    EC  C
  S:   118 EKFDLEFLNSQIKPERDFQF---NYLGIKTLYDRYLLKDANNNPI--ELPQHMFMSIAMFLAQNEQEPNKIALEFYEVLSKFEAMCATPTLANA-RTTKHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIGSYIDGHKNASAGTIPFLKIANDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFPALWVCDLFLKRVLEDAMWTLFDPYECKDLTELYGQDFEKRYL--EYE---KDPKIIKEYINAKDLWKKILMNYFEAGLPFLAFKDNANRCNPNAHAGIIRSSNLCTEIFQNTAPNHYYMQIEYTDGTIEFFEEKELVTTDSNITKCANKLTSTDILKGKPIYIATKVAKDGQTAVCNLASINLSKINTE-EDIKRVVPIMVRLLDNV---IDLNFYPNRKVKATNLQNRAIGLGVMGEAQMLAEHQIAWGSKEHLEKIDALMEQISYHAIDTSANLAKEKG-VYKDFENSEWSKGIF-------------PIDKANNEALKLTEKGLFNHACDWQGLREKVKANGMRNGYLMAIAPTSSISILVGTTQTIEPIYKK-KWFEENLSGLIPVVVPNLNVETWNFYTS-AYDIDAKDLIKAAAVRQKWIDQGQSLNVFLRIENASGKTLHDIYTLAWKLGLKSTYYLRSESPSIDEKSVLDRSVECFNC 787
>gi|168186577|ref|ZP_02621212.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum C str. Eklund] >gi|169295443|gb|EDS77576.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum C str. Eklund] (764 aa)
Score = 618, Expect = 7.1e-62, Identities = 203/711 (28%), Positives = 344/711 (48%)
  Q:    13 IIVDKDSYISLNATIKLFDENGNFQF-ENDLLAVEKYLETEIKPNFKKFNS-----IKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF----GRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-----------INTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG--NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNN-YMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           I +DK+++ ++++       N N+Q+    LLA + Y E +I  ++  F       + ++L  + L   Y   + + YS   +  + +  +       ++ G       Y +K F N    E  ++R +  A+      G+     A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +   +  +R   + I+G KN + G+IP +K+  D     +QLG+R+G  A+ L+ +H DI  FLD K  N D++ +   +   V +PDI        +  +LF PY + +  G  + D          T+ Y     N N+ +  +S   + ++I +   E+G PFI F D  N  N   +  +I  SNLC EI Q               +  N  ++  + G+ V CNL S+N++KV  +     + +   I+ LD++  L  L   P  E+   + K RA+GLG    H +LA N+I ++SEE +   +  F  +AY + KAS E AKE G  +  F+ +++  G YF++     E                          W +L +D+ K+G+ N ++MAVAPTGS S +++ T  + P+     I  E K G  + P    D+NN   +Y K A+ I     I  C+  Q+H+DQ+ S  L++T +   +D+   Y  ++ +   +IYYIR        S ++ EC++C
  S:    69 IYIDKNNHDNISSK----KTNINWQYVAARLLAFDLYKEAKINRDYNYFGYGDFLYLVKRLVNIGLYGKY---LIENYSDEEIKELSDYIEPKRDELFNYEGLKLLNDRYLIKGF-NGEILELPQERFMVIAMHLAIPEGKNKIYYAKKFYDLISKLKMTVATPTLGNAGTPFY-QLSSCFISVVGDNLWSIYDVNQKFSQVSKHGGALGIYIGKVRALNSEIRGHKNASGGVIPWIKLYNDTAVAVDQLGKRKGGAAITLDIWHKDIYDFLDLKTNNGDDRRKAHDIFTSVSIPDIFMTRLLNRESWSLFDPYMVHKLMGYKLEDYFDDEDNKEFTKRYLECEANKNLQRDTVSCLDIMKKIMKSAVETGTPFIFFRDTVNRANPNKHRGMIYSSNLCHEIAQNMSESELISEESTYKNGFNEVVSRVRSGDMVTCNLNSINLSKVSRE--ELKEAIPLQIRMLDNVISLNKL---PVKESSITSDKYRAIGLGTSGYHQYLAKNRIKWESEEHIKEVDALFEDIAYESIKASMELAKEKG-AYPEFEGSEWQSGKYFERRGYNSER-------------------------WSKLRDDVAKYGIRNGYIMAVAPTGSTSNIANTTAGIDPVFKKFFI--EEKKGS-FTPKTAPDLNNDNFWYYKEAHTINQEWSIKACAVRQKHIDQSQSFNLYITPDIKAKDILDMYTESWRQGIKTIYYIR------NKSIEMNECSSC 762
>gi|148380774|ref|YP_001255315.1| ribonucleoside-diphosphate reductase 2 alpha chain [Clostridium botulinum A str. ATCC 3502] >gi|153930834|ref|YP_001385058.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum A str. ATCC 19397] >gi|148290258|emb|CAL84377.1| ribonucleoside-diphosphate reductase 2 alpha chain [Clostridium botulinum A str. ATCC 3502] >gi|152926878|gb|ABS32378.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum A str. ATCC 19397] (763 aa)
Score = 618, Expect = 8.2e-62, Identities = 202/691 (29%), Positives = 346/691 (50%)
  Q:    33 NGNFQF-ENDLLAVEKYLETEIKPNF------------KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNA--LLFGRGNEQ--DALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLT----YEQL------GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVN--NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N N+Q+    LL  + Y E +I  ++            KK   IK   EYL ++NY D  +  K  + +++   E+ + +N+        +K      L   +N    E  ++R +  A  L    G+++   A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +      +R   + I+G KN + G++P +++  D     +QLG+R+G  A+ L+ +H DI  FLD K  N D++ +   +   V +PD+      + +  +LF PY +++  G  + D          T +Y     N NI +  +    + +++ +   E+G PFI F D  N+ N   +  +I  SNLC EI Q ++   +L  ++     Y ++      G+ V CNL S+N++KV ++   F + + + I+ LD++  L  L      +  + K RA+GLG    H FLA NKI ++S+E +   +  +  +AY A K+S E AKE G  +  FK++++  G YF++     E                          W +L  +IKK+G+ N ++ A+APTGS S +++ T  + P+     +  E K G  + P    D+N  N+ YY K A+ I     I  C+  Q+H+DQA S  L++T     +++   YI ++ +   +IYY+R        S ++ ECT+C
  S:    84 NANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYQLVKKLVKIKLYGEYL-IQNYSDEEI--KELAKYIVP--ERDELFNYE------GLKLLNDRYLIKGNNGEILELPQERFMTIAMHLAIPEGDKKVFYAKKFYDLLSELKVTVATPTLGNAGTPFY-QLSSCFISVVGDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGHKNASGGVVPWIRLYNDTAVAVDQLGKRKGGAAITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMKRLEKRESWSLFDPYIVEKIMGYKLEDYFDDEDRKEFTNKYLECERNTNIPRDTVPTLDIMKKLMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESRLLEEEIIDGNGYSEIVQRVKAGDMVTCNLNSINLSKVKKE--EFNECIPFQIRMLDNVISLNKL-PVKEAKVTSDKYRAIGLGTSGYHHFLANNKIRWESDEHIKVADEIYEEIAYIAIKSSMELAKEKG-SYPAFKDSEWETGKYFERRGYNSER-------------------------WKKLQSNIKKYGMRNGYITAIAPTGSTSNIANTTAGIDPVFKKFFM--EEKKGS-FTPKTAPDLNEENFWYY-KEAHTIDQQWSIKACAVRQKHIDQAQSFNLYITPEIKAKEILNMYIESWKQGVKTIYYVR------NKSLEMDECTSC 761
>gi|15611688|ref|NP_223339.1| ribonucleotide-diphosphate reductase subunit alpha [Helicobacter pylori J99] >gi|7388069|sp|Q9ZLF9|RIR1_HELPJ Ribonucleoside-diphosphate reductase subunit alpha (Ribonucleotide reductase) >gi|4155174|gb|AAD06201.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 ALPHA CHAIN [Helicobacter pylori J99] (788 aa)
Score = 617, Expect = 1.1e-61, Identities = 204/642 (31%), Positives = 331/642 (51%)
  Q:    82 KKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS--------------------ILNTD---------LTYEQL---------------GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQ-DWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL---FECTTC 723
           +K+   FL S  +  + + F   +++G    Y  Y LK  +N          +  +  +F   NEQ+    AL + + +       ATPT  NA +  + +  SCY+    DN+E I  +      LSK GGG+ +  + +R  G+ I G KN + G IP +KI  DV    +QLG R+GA AVYL  +H D+++F+D ++ + DE+ R   L   + V D+      E+    LF PY   D+   YG+      +  EYE    +P I K+YI+A+ L+++I    FE+G PF+ F D AN  N   +  II  SNLCTEI Q   P+                    ++ TD         LT   +               G+   CNL S+N++K+  +  +  + V   ++ LD++    DL+  P   ++  N +NRA+GLG M     LA ++I + S+E ++  +     ++YHA   S   AKE G V+++F+N++++ G +             P  +   E LK  +  +     DW  L E +K  G+ N +LMA+APT SIS L   T +++PI    +  +E   G + V    ++V  + +Y   AY+I    +I   +  Q+ +DQ  S+ +FL  ENA+ + L++ Y  A+     S YY+R     + +   L    EC  C
  S:   118 EKFDLEFLNSQIKPERDFQF---NYLGIKTLYDRYLLKDANNHPI--ELPQHMFMSIAMFLAQNEQELNKIALEFYEVLSKFEAMCATPTLANA-RTTKHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIGSYIDGHKNASAGTIPFLKIANDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFPALWVCDLFMKRVLEDAMWTLFDPYECKDLTELYGQDFEKRYL--EYE---KDPKIIKEYINAKDLWKKILMNYFEAGLPFLAFKDNANRCNPNAHAGIIRSSNLCTEIFQNTAPNHYYMQIEYTDGAIEFFEEKELVTTDSNITKCANKLTSTDILKGKKIYIATKVAKDGQTAVCNLASINLSKINTE-EDIKRVVPIMVRLLDNV---IDLNFYPNRKVKATNLQNRAIGLGVMGEAQMLAEHQIAWGSKEHLEKIDALMEQISYHAIDTSANLAKEKG-VYKDFENSEWSKGIF-------------PIDKANNEALKLTEKGLFNHACDWQGLREKVKANGMRNGYLMAIAPTSSISILVGTTQTIEPIYKK-KWFEENLSGLIPVVVPNLNVETWNFYTS-AYDIDAKDLIKAAAVRQKWIDQGQSINVFLRIENASGKTLHEIYTLAWKLGLKSTYYLRSESPSIDEKSVLDRSVECFNC 787
>gi|150015086|ref|YP_001307340.1| ribonucleotide-diphosphate reductase subunit alpha [Clostridium beijerinckii NCIMB 8052] >gi|149901551|gb|ABR32384.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium beijerinckii NCIMB 8052] (743 aa)
Score = 616, Expect = 1.1e-61, Identities = 180/575 (31%), Positives = 294/575 (51%)
  Q:   149 ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMA--LFSPYDIQREYGKPMSDI---SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTP------SILNTDLTYEQL-----GEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           A  + D + + +   ATPT  NA +K   +  SC++  VED++E I ++     ++SK GGG+   +  +R  G+PI+G K  + G+IP +K+  D     +QLG R G+ A++L+A+H DI +FL  +  N D++ +   +  G+  PD+ + LA  + D    +  P++I+   G  + D       E+Y   +++  I K+ +S + L + I +   E+G PF  + D+ N+ N   +N +I  SNLCTEI Q  +P       IL+    Y  +     G+ V CNL S+ +  + + +       V+  I+A+D++  L +  S P  E  N K RA+GLG    H  L  NKI++  EE   F +  +  + Y+A KAS   +KE GF +E FK + +  G YF                     L+ Y  A      W +L E + +FG  N +L+AVAP GS + ++  T  + PI++   + +E K   +   A  +  +NY YY   AY I     + +    Q+H+DQ  S  L++T + T R +   YI A      SIYY+R +      S ++ EC TC
  S:   185 AKRFYDVLSSLKATMATPTMSNA-RKPFYQLSSCFIDSVEDSLEGIYKSLDNFAKVSKFGGGMGIYMGKIRALGSPIRGFKGASGGVIPWVKLFNDTAIAVDQLGVRNGSVAIWLDAWHKDIPEFLQIRTNNGDDRKKAHDVFPGICYPDLFWRLAENDIDANWHMMCPHEIKNIKGYALEDFYGEQWEEKYYECVSDERIEKRVMSVKDLVRLIIKSAVETGAPFAFYRDMTNKMNPNKHNGMIYSSNLCTEIMQNMSPMKIQKSQILSDKDEYAVVEKIIPGDFVVCNLSSVVLGNIDVCNDEEVEYVVETQIRAMDNVIDL-NYYSVPFAEITNKKYRAIGLGTSGYHHMLVNNKIHWTEEEHKSFVDKIYEKINYYAIKASMNISKEKGF-YELFKGSDWDTGEYFR--------------------LRNYNSA-----KWNELKELVHEFGTRNGYLIAVAPNGSTATIAGTTEGIDPIMARFYL-EEKKGSIIPKTAPNLSEDNYWYY-NSAYNIEQMWCVKMNGIRQRHIDQGQSFNLYITSSYTMRQIMNLYIEACKCGVKSIYYVRSK------SLEVTECETC 741
>gi|108563087|ref|YP_627403.1| ribonucleotide-diphosphate reductase subunit alpha [Helicobacter pylori HPAG1] >gi|107836860|gb|ABF84729.1| ribonucleoside-diphosphate reductase 1 alpha subunit [Helicobacter pylori HPAG1] (788 aa)
Score = 616, Expect = 1.2e-61, Identities = 204/642 (31%), Positives = 330/642 (51%)
  Q:    82 KKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS--------------------ILNTD---------LTYEQL---------------GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQ-DWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL---FECTTC 723
           +K+   FL S  +  + + F   +++G    Y  Y LK  +N          +  +  +F   NEQ+    AL + + +       ATPT  NA +  + +  SCY+    DN+E I  +      LSK GGG+ +  + +R  G+ I G KN + G IP +KI  DV    +QLG R+GA AVYL  +H D+++F+D ++ + DE+ R   L   + V D+      E+    LF PY   D+   YG+      +  EYE    +P I K+YI+A+ L+++I    FE+G PF+ F D AN  N   +  II  SNLCTEI Q   P+                    ++ TD         LT   +               G+   CNL S+N++K+  +  +  + V   ++ LD++    DL+  P   ++  N +NRA+GLG M     LA ++I + S+E ++  +     ++YHA   S   AKE G V+++F+N++++ G +             P  +   E LK  +  +     DW  L E +K  G+ N +LMA+APT SIS L   T +++PI    +  +E   G + V    ++V  + +Y   AY+I    +I   +  Q+ +DQ  S+ +FL  ENA+ + L+  Y  A+     S YY+R     + +   L    EC  C
  S:   118 EKFDLEFLNSQIKPERDFQF---NYLGIKTLYDRYLLKDANNNPI--ELPQHMFMSIAMFLAQNEQEPNKIALEFYEVLSKFEAMCATPTLANA-RTTKHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIGSYIDGHKNASAGTIPFLKIANDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFPALWVCDLFLKRVLEDAMWTLFDPYECKDLTELYGQDFEKRYL--EYE---KDPKIIKEYINAKDLWKKILMNYFEAGLPFLAFKDNANRCNPNAHAGIIRSSNLCTEIFQNTAPNHYYMQIEYTDGAIDFFEEKELVTTDSNITKCANKLTSTDILKGKPIYIATKVAKDGQTAVCNLASINLSKINTE-EDIKRVVPIMVRLLDNV---IDLNFYPNRKVKATNLQNRAIGLGVMGEAQMLAEHQIAWGSKEHLEKIDALMEQISYHAIDTSANLAKEKG-VYKDFENSEWSKGIF-------------PIDKANNEALKLTEKGLFNHACDWQGLREKVKANGMRNGYLMAIAPTSSISILVGTTQTIEPIYKK-KWFEENLSGLIPVVVPNLNVETWNFYTS-AYDIDAKDLIKAAAVRQKWIDQGQSINVFLRIENASGKTLHDIYTLAWKLGLKSTYYLRSESPSIDEKSVLDRSVECFNC 787
>gi|34558071|ref|NP_907886.1| ribonucleotide-diphosphate reductase subunit alpha [Wolinella succinogenes DSM 1740] >gi|34483789|emb|CAE10786.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN [Wolinella succinogenes] (788 aa)
Score = 616, Expect = 1.4e-61, Identities = 195/619 (31%), Positives = 320/619 (51%)
  Q:   105 SFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTP--------------------SILNTDLTYE------------------------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLT-ENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDS--EKLFECTTC 723
           +++G    Y  Y +K   NK         +  +  +F   NE++    A+ + D +      AATPT  NA +  R +  SCY+    DN+E I         LSK GGG+ +  + +R  G+ I G KN A G++P +KI  DV    +QLG R+GA +VYL  +H DI  F+D K+ + +E+ R   L   + +PD+      E+    L  P+   D+   +G+      +  EYE +     I K+ I A++L++++    FE G PF+ F D AN  N   +  II  SNLCTEI Q   P                    +I+ TD   E                        Q G+   CNL S+N++K+     +  + V  A++ LD++    DL+  P   ++  N + RA+GLG M     LA +KI + S+E ++  +     ++YHA KAS+  AKE G ++ +F+ + ++ G +       E           K+L+    L   T  DW  L E +K+ G+ N +LMA+APT SIS L   T +++PI    +  +E   G + V A  + +  + +Y + AY++  N +I   S  Q+ +DQ  S  +F++ + A+ + LN  Y+ A+     S YY+R +    +++  ++  EC  C
  S:   138 NYLGIKTLYDRYLIKDRSNKPI--ELPQHMFMSIAMFLAQNEREPNEWAVKFYDLLSRFEVMAATPTLSNA-RTPRHQLSSCYIGSTPDNIEGIFDGYKEMALLSKYGGGIGWDYSKVRGLGSYIDGHKNAAGGVVPFLKITNDVAIAVDQLGTRKGAISVYLEPWHTDIFDFIDLKKNSGEERRRAHDLFPALWIPDLFMKRVEEDGAWTLLDPHECQDLTNLHGEAFEKRYL--EYECM---EGIIKETIRAKELWKKVLTSYFEIGSPFLCFKDNANRLNPNAHKGIIRSSNLCTEIFQNTEPNHYLIQVEYEDGSSERFEEHAIITTDTGVEKRANKITSMDSLQGKKVFIAERIAQEGKTAVCNLASINLSKIHTQ-EDIERVVPIAVRMLDNV---IDLNFYPNKKVKRTNLETRAIGLGVMGEAQMLAESKIVWGSQEHLERIDEIMEQVSYHAIKASSTLAKEKG-IYPDFEGSNWSKGIFPIDLANSE----------AKKLVDRGGL-FGTDCDWDSLREQVKRDGMRNGYLMAIAPTSSISILVGTTQTIEPIYKR-KWFEENLSGLIPVVAPNLSLETWNFY-QSAYDLDQNLLIKAASIRQKWIDQGQSTNIFISLDKASGKYLNDIYVNAWKLGLKSTYYLRSQSPQAEENTMDRSIECEGC 787
>gi|188590737|ref|YP_001919719.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188501018|gb|ACD54154.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum E3 str. Alaska E43] (741 aa)
Score = 616, Expect = 1.4e-61, Identities = 175/560 (31%), Positives = 292/560 (52%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLAREN--KDMALFSPYDIQREYGKPMSDISITE---EYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ------INTPSILNTDLTYE-----QLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NA +K   +  SC++  V+D++E I ++     ++SK GGG+   +  +R  G+PI+G K  + G+IP +K+  D     +QLG R G+ A++L+A+H DI +FL  +  N D++ +   +  GV  PD+ + LA EN   D  +  P++I+   G  + D    E   +Y   + +  I K+ I  + L + I +   E+G PF  F D AN+ N   +N +I  SNLCTEI Q      +N  +I+  +  Y      + G+ V CNL SL +  + + +       V+  I+A+D++  L +  S P  E  N + R +GLG    H  LA NKI++  E+   F +  +  + Y++ KAS   +KE G  +E F+ + + +G+YF+                    L++Y       + WI L E +K FG+ N +L+AVAP GS + ++  +  + PI++   + +E K   +   A  +  +NY YY   AY +     +++    Q+H+DQ  S  L++T   T R +   YI A      SIYY+R +      S ++ EC +C
  S:   198 ATPTMSNA-RKPFYQLSSCFVDTVDDSLEGIYKSLDNFAKVSKFGGGMGIYIGKIRSLGSPIRGFKGASGGVIPWVKLFNDTAIAVDQLGVRNGSVAIWLDAWHKDIPEFLQIRTNNGDDRKKAHDVFPGVCYPDLFWKLAEENVDNDWYMMCPHEIKNTKGYCLEDFYGEEWEAKYFECVEDDRIEKRSIKIKDLVRLIIKSAAETGAPFAFFRDSANKMNPNKHNGMIYSSNLCTEIMQNMSAMKVNGDTIIKENDKYSVVQNIEAGDFVVCNLSSLVLGNIDVLNDEELEYVVETQIRAMDNVIDL-NYYSVPFAEITNKRYRGIGLGTSGYHHMLANNKIHWTEEKHRTFVDKVYERINYYSIKASMNLSKEKG-KYELFEGSDWDNGNYFE--------------------LRDY-----NDEKWIDLKESVKSFGMRNGYLIAVAPNGSTATIAGTSEGIDPIMARFYL-EEKKGSIIPKTAPNLSEDNYWYY-NTAYNLEQGWCVEMNGVRQRHIDQGQSFNLYITTQYTMRQIMNLYIKACKCGVKSIYYVRSK------SLEVTECESC 739
>gi|167760515|ref|ZP_02432642.1| hypothetical protein CLOSCI_02889 [Clostridium scindens ATCC 35704] >gi|167661881|gb|EDS06011.1| hypothetical protein CLOSCI_02889 [Clostridium scindens ATCC 35704] (843 aa)
Score = 615, Expect = 1.5e-61, Identities = 200/675 (29%), Positives = 328/675 (48%)
  Q:    49 LETEIKPNFKK--FNSIKEKLEYLFLENYYDFNVFKKYSS---SFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLAREN--KDMALFSPYDIQREYGKPMSDI---SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYEQL------------GEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSP--IEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
            E +++ N ++       +KL YL  +  Y   + K Y       L+   E  + + F +S     +  Y     K    ++  E F    +  A+   +  E     + D +   +   ATPT  NA +K   +  SC++  V D+++ I R+     ++SK GGG+      +R  G+ I+G +  A G+I  +++  D     +QLG RQGA AVYL+ +H D+ +FL  +  N D++++   +   V  PD  +  AR+N   D  L  P++I    G  + D       E Y++ + +  I K+ I  + + + I +   E+G PF    D  N  N   +  II  SNLCTEI Q N  +I   +   E++            GE V CNL SL++ ++ + D        + A++ALD++  L +    P     N K R +GLG    H  LA ++I ++SEE ++F    F  + Y A KAS+  A+E G  +E F+ + + +GSYF                              T   W +L  ++ ++GL N +L+AVAPT S S ++  T  L PI+S   +E +K G + RV   A ++ ++N+ YY K A+ I     +  C   Q+H+DQA SM L++T   T R +   YI A+ +   +IYYIR +      S ++ EC  C
  S:   180 FEQKLEKNMRRCHIECFYDKLAYLTEQGLYGDYILKAYDRDEIERLVLFIEPKRNHLFTYSGLELLLGRYVIRTGKGVPMESPQEMFLGIAMHLAMKEKKDRESWVKRFYDMLSQLKVTMATPTLSNA-RKPYHQLSSCFIDTVPDSLDGIYRSIDNFAKVSKFGGGMGMYFGKVRASGSAIRGFEGAAGGVIRWIRLANDTAVAVDQLGMRQGAVAVYLDVWHRDLPEFLGLRTNNGDDRMKAHDVFPAVCYPDYFWKGARDNIEGDWYLMCPHEILTVKGYALEDYFGEDWEERYQDCVRDSRIQKRVIPIKDIIRLIIKSAVETGTPFTFNRDTVNRANPNSHKGIIYCSNLCTEIAQ-NMSAIEQVEQKIEEIDGETVVVTVTKPGEFVVCNLASLSLGRLELADEEEIAYITESAVRALDNVIDL-NFFPVPYARINNRKYRPIGLGVSGYHHMLAKHEIAWESEEHLEFVEKVFADIHYAAIKASSRIAREKG-SYEYFEGSGWQNGSYFADRGL-------------------------TDGRWEELRAEVAEYGLRNGYLLAVAPTSSTSIIAGTTAGLDPIMSRYFLEEKKNGLMPRV---APELSMDNFWYY-KNAHYIDQYWSVRACGVRQRHIDQAQSMNLYITNEYTFRKVLDLYILAWEEGVKTIYYIRSK------SLEVEECEVC 841
>gi|188527475|ref|YP_001910162.1| ribonucleotide-diphosphate reductase subunit alpha [Helicobacter pylori Shi470] >gi|188143715|gb|ACD48132.1| ribonucleotide-diphosphate reductase subunit alpha [Helicobacter pylori Shi470] (788 aa)
Score = 612, Expect = 3.4e-61, Identities = 201/642 (31%), Positives = 328/642 (51%)
  Q:    82 KKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTY----------EQL----------------------------------GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQ-DWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFL-TENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKL---FECTTC 723
           +K+   FL    +  + + F   +++G    Y  Y LK  +N          +  +  +F   NEQ+    AL + + +       ATPT  NA +  + +  SCY+    DN+E I  +      LSK GGG+ +  + +R  G+ I G KN + G IP +KI  DV    +QLG R+GA AVYL  +H D+++F+D ++ + DE+ R   L   + V D+      E+    LF PY   D+   YG+      +  EYE    +P I K+YI+A+ L+++I    FE+G PF+ F D AN  N   +  II  SNLCTEI Q   P+     + Y          +QL                                  G+   CNL S+N++K+  +  +  + V   ++ LD++    DL+  P   ++  N +NRA+GLG M     LA ++I + S+E ++  +     ++YHA   S   AKE G V+++F+N++++ G +             P  +   E LK  +  +     DW  L E +K  G+ N +LMA+APT SIS L   T +++PI    +  +E   G + V    +++  + +Y   AY+I    +I   +  Q+ +DQ  S+ +FL  ENA+ + L++ Y  A+     S YY+R     + +   L    EC  C
  S:   118 EKFDLEFLNGQIKPERDFQF---NYLGIKTLYDRYLLKDANNNPI--ELPQHMFMSIAMFLAQNEQEPNKIALEFYEVLSKFEAMCATPTLANA-RTTKHQLSSCYIGSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIGSYIDGHKNASAGTIPFLKIANDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFPALWVCDLFMKRVLEDAMWTLFDPYECKDLTELYGQDFEKRYL--EYE---KDPKIIKEYINAKDLWKKILMNYFEAGLPFLAFKDNANRCNPNAHAGIIRSSNLCTEIFQNTAPNHYRMQIEYTDGAIEFFEEKQLVTTDNNITKCANKLTSTDTLKGKQIYIATKVAKDGQTAVCNLASINLSKINTE-EDIKRVVPIMVRLLDNV---IDLNFYPNRKVKATNLQNRAIGLGVMGEAQMLAEHQIAWGSKEHLEKIDALMEQISYHAIDTSANLAKEKG-VYKDFENSEWSKGIF-------------PIDKANNEALKLTEKGLFNHACDWQGLREKVKANGMRNGYLMAIAPTSSISILVGTTQTIEPIYKK-KWFEENLSGLIPVVVPNLNLETWNFYTS-AYDIDAKDLIKAAAVRQKWIDQGQSINVFLRIENASGKTLHEIYTLAWKLGLKSTYYLRSESPSIDEKSVLDRSVECFNC 787
>gi|170754701|ref|YP_001782420.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum B1 str. Okra] >gi|169119913|gb|ACA43749.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum B1 str. Okra] (763 aa)
Score = 612, Expect = 3.8e-61, Identities = 201/691 (29%), Positives = 345/691 (49%)
  Q:    33 NGNFQF-ENDLLAVEKYLETEIKPNF------------KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNA--LLFGRGNEQ--DALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLT----YEQL------GEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVN--NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N N+Q+    LL  + Y E +I  ++            KK   IK   EYL ++NY D  +  K  + +++   E+ + +N+        +K      L    N    E  ++R +  A  L    G+++   A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +      +R   + I+G KN + G++P +++  D     +QLG+R+G  A+ L+ +H DI  FLD K  N D++ +   +   V +PD+      + +  +LF PY +++  G  + D          T +Y     N NI +  +    + +++ +   E+G PFI F D  N+ N   +  +I  SNLC EI Q ++   +L  ++     Y ++      G+ V CNL S+N++KV ++   F + + + I+ LD++  L  L      +  + K RA+GLG    H FLA NKI ++S+E +   +  +  +AY A K+S E AKE G  +  FK++++  G YF++     E                          W +L  +IKK+G+ N ++ A+APTGS S +++ T  + P+     +  E K G  + P    D+N  N+ YY K A+ I     I  C+  Q+H+DQA S  L++T     +++   Y+ ++ +   +IYY+R        S ++ ECT+C
  S:    84 NANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYELVKKLVKIKLYGEYL-IQNYSDEEI--KELAKYIVP--ERDELFNYE------GLKLLNDRYLIKGHNGEILELPQERFMTIAMHLAIPEGDKKVFYAKKFYDILSELKVTVATPTLGNAGTPFY-QLSSCFISVVGDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGHKNASGGVVPWIRLYNDTAVAVDQLGKRKGGAAITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMKRLEKRESWSLFDPYIVEKIMGYKLEDYFDDEDRREFTNKYLECERNTNIPRDTVPTLDIMKKLMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESRLLEEEIIDGNGYSEIVQRVKAGDMVTCNLNSINLSKVKKE--EFNECIPFQIRMLDNVISLNKL-PVKEAKVTSDKYRAIGLGTSGYHHFLANNKIRWESDEHIKVADEIYEEIAYIAIKSSMELAKEKG-SYPAFKDSEWETGKYFERRGYNSER-------------------------WKKLQSNIKKYGMRNGYITAIAPTGSTSNIANTTAGIDPVFKKFFM--EEKKGS-FTPKTAPDLNEENFWYY-KEAHTIDQQWSIKACAVRQKHIDQAQSFNLYITPEIKAKEILNMYMESWKQGVKTIYYVR------NKSLEMDECTSC 761
>gi|153939013|ref|YP_001392092.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum F str. Langeland] >gi|152934909|gb|ABS40407.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum F str. Langeland] (763 aa)
Score = 611, Expect = 4.2e-61, Identities = 201/691 (29%), Positives = 342/691 (49%)
  Q:    33 NGNFQF-ENDLLAVEKYLETEIKPNF------------KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNA--LLFGRGNEQ--DALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYE-----------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVN--NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N N+Q+    LL  + Y E +I  ++            KK   IK   EYL ++NY D  +  K  + +++   E+ + +N+        +K      L    N    E  ++R +  A  L    G+++   A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +      +R   + I+G KN + G++P +++  D     +QLG+R+G  A+ L+ +H DI  FLD K  N D++ +   +   V +PD+      + +  +LF PY +++  G  + D          T +Y     N NI +  +    + +++ +   E+G PFI F D  N+ N   +  +I  SNLC EI Q  + S L  +   +           + G+ V CNL S+N++KV ++   F + + + I+ LD++  L  L      +  + K RA+GLG    H FLA NKI ++S+E +   +  +  +AY A K+S E AKE G  +  FK++++  G YF++     E                          W +L  +IKK+G+ N ++ A+APTGS S +++ T  + P+     +  E K G  + P    D+N  N+ YY K A+ I     I  C+  Q+H+DQA S  L++T     +++   Y+ ++ +   +IYY+R        S ++ ECT+C
  S:    84 NANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYELVKKLVKIKLYGEYL-IQNYSDEEI--KELAKYIVP--ERDELFNYE------GLKLLNDRYLIKGHNGEILELPQERFMTIAMHLAIPEGDKKVFYAKKFYDLLSELKVTVATPTLGNAGTPFY-QLSSCFISVVGDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGHKNASGGVVPWIRLYNDTAVAVDQLGKRKGGAAITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMKRLEKRESWSLFDPYIVEKIMGYKLEDYFDDEDRREFTNKYLECERNTNIPRDTVPTLDIMKKLMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESRLLEEEIIDGNGYPEVVQRVKAGDMVTCNLNSINLSKVKKE--EFNECIPFQIRMLDNVISLNKL-PVKEAKVTSDKYRAIGLGTSGYHHFLANNKIRWESDEHIKVADEIYEEIAYIAIKSSMELAKEKG-SYPAFKDSEWETGKYFERRGYNSER-------------------------WKKLQSNIKKYGMRNGYITAIAPTGSTSNIANTTAGIDPVFKKFFM--EEKKGS-FTPKTAPDLNEENFWYY-KEAHTIDQQWSIKACAVRQKHIDQAQSFNLYITPEIKAKEILNMYMESWKQGVKTIYYVR------NKSLEMDECTSC 761
>gi|168179223|ref|ZP_02613887.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum NCTC 2916] >gi|182669564|gb|EDT81540.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum NCTC 2916] (763 aa)
Score = 611, Expect = 4.4e-61, Identities = 201/691 (29%), Positives = 343/691 (49%)
  Q:    33 NGNFQF-ENDLLAVEKYLETEIKPNFKKFNS----------IKEKL--EYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNA--LLFGRGNEQ--DALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLTYE----------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVN--NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N N+Q+    LL  + Y E +I  ++  F            +K KL  EYL ++NY D  +  K  + +++   E+ + +N+        +K      L    N    E  ++R +  A  L    G+++   A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +      +R   + I+G KN + G++P +++  D     +QLG+R+G  A+ L+ +H DI  FLD K  N D++ +   +   V +PD+      + +  +LF PY +++  G  + D          T +Y     N NI +  +    + +++ +   E+G PFI F D  N+ N   +  +I  SNLC EI Q ++   +L  ++  E          + G+ V CNL S+N++KV ++   F + +   I+ LD++  L  L      +  + K RA+GLG    H FLA NKI ++S+E +   +  +  +AY A K+S E AKE G  +  FK +++  G YF++     E                          W +L  +IKK+G+ N ++ A+APTGS S +++ T  + P+     +  E K G  + P    D+N  N+ YY K A+ I     I  C+  Q+H+DQA S  L++T     +++   Y+ ++ +   +IYY+R        S ++ ECT+C
  S:    84 NANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYELVKKLVKMKLYGEYL-IQNYSDEEI--KELAKYIVP--ERDELFNYE------GLKLLNDRYLIKGHNGEILELPQERFMTIAMHLAIPEGDKKVFYAKKFYDLLSELKVTVATPTLGNAGTPFY-QLSSCFISVVGDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGHKNASGGVVPWIRLYNDTAVAVDQLGKRKGGAAITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMKRLEKRESWSLFDPYIVEKIMGYKLEDYFDDEDCREFTNKYLECERNTNIPRDTVPTLDIMKKLMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESQLLEEEIIDENGYPEVVQRVKAGDMVTCNLNSINLSKVKKE--EFSECIPLQIRMLDNVISLNKL-PVKEAKVTSDKYRAIGLGTSGYHHFLANNKIRWESDEHIKVADEIYEEIAYTAIKSSMELAKEKG-SYPAFKGSEWETGKYFERRGYNSER-------------------------WKKLQSNIKKYGMRNGYITAIAPTGSTSNIANTTAGIDPVFKKFFM--EEKKGS-FTPKTAPDLNEENFWYY-KEAHTIDQQWSIKACAVRQKHIDQAQSFNLYITPEIKAKEILNMYMESWKQGVKTIYYVR------NKSLEMDECTSC 761
>gi|2708498|gb|AAB92484.1| ribonucleotide reductase homolog [Bacillus subtilis] (661 aa)
Score = 610, Expect = 6.3e-61, Identities = 133/355 (37%), Positives = 210/355 (59%)
  Q:   371 LFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++D    + +S + N I+  N C+E+ Q +  S+       +++G D+ CNLGS+NI  VM +  +   TV+ AI +L ++    ++ +AP +   N+  R++GLG MNLHGFLA N I Y+SEEA DF N +F  + +++ + S E A+ETG  +  F  + Y  G YF+KY     N ++P+ E+VK+L  +    IP  QDW++L ED+ K+GL +S+  A+APTGSISY+ S T  + PI+  IE R  G   + Y P   +   N+ +Y K AY++ +  ++D+ +  QQHVDQ IS TLFL +  TTRDLN+  +YA ++   ++YY R +    +       C +CV+
  S:   322 VYDTTQEDYHSLIFNGIVTGN-CSEVLQSSQVSVYTDYDKEDEIGLDISCNLGSMNIVNVMSN-QSIASTVRIAIDSLTTVTRKTNIVNAPAVARANTLMRSIGLGQMNLHGFLAQNNIAYESEEAKDFANTYFMMVNFYSLQRSMEIARETGETYYKFDGSTYKSGEYFEKYVT---NDYSPQYEKVKKLFGDQH--IPNIQDWMKLKEDVMKYGLYHSYRQAIAPTGSISYVQSSTAGVMPIMERIEERTYGN-SKTYYPMPGLSAQNWFFY-KEAYDMDMFKVVDLIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTLYYARTKDTTQEG------CLSCVV 661
>gi|92112800|ref|YP_572728.1| ribonucleotide-diphosphate reductase subunit alpha [Chromohalobacter salexigens DSM 3043] >gi|91795890|gb|ABE58029.1| Ribonucleoside-diphosphate reductase [Chromohalobacter salexigens DSM 3043] (976 aa)
Score = 610, Expect = 6.7e-61, Identities = 179/593 (30%), Positives = 311/593 (52%)
  Q:   113 YTTYALKSFDNKTYFEHFEDRIVCNALLFGRG------NEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITK-KYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGA----NFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSY-FDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKID------------VNNYMYY-----------------AKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +T   L++  ++ +  H + R     ++F R       NE D    A+ + + + +  Y A+TPT  NAG  QR +  SCYL  V D ++ I  A      LSK  GG+    T +R  G+ IKG   ++ G++P +K++ D     NQ G+R+GA   YL  +H D+ +FL+ ++   D++ R   ++    VPD+      ++++  LFSP    D+   YG          EYE +  N  +   K + A+ L++++  + FE+G+P+I F D  N ++   +  ++  SNLCTEIT       LNT        E   CNLGS+N+A+ + DG        KTVK A++ LD++  + +  + P   N N K+R VGLG M     L    I Y S++AV F +     ++YHA +AS++ A E G  +++F+ + ++ G    D   +  E       ER  + +   ++   T QDW +L + + + G+ NS++MA+APT +IS +   T S++P    + ++         V AY ++            +N+  YY                    A+E+    +++  +  Q+ +DQA S+ L++    + + L+  Y  A+ +   + YY+R
  S:   281 FTYLGLQTLYDRYFLHHDDVRYELPQVMFMRVAMGLALNEDDPEARAIEFYELLSSFDYMASTPTLFNAGT-QRSQLSSCYLTTVPDQLDGIYSAIRDNALLSKWAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDVEEFLELRKNTGDDRRRTHDMNTANWVPDLFMKRVFDDEEWTLFSPSTCPDLHDLYGAAFE--KRYAEYEEMTRNGQLKLFKRVKAKDLWRKMLSMLFETGHPWITFKDPCNLRSPQNHAGVVHSSNLCTEIT-------LNTSAD-----EIAVCNLGSVNLAQHIVDGQLDGDKLKKTVKTAVRMLDNVIDI-NYYAVPQARNSNFKHRPVGLGLMGFQDALYQLGIAYASDDAVTFADTSMELISYHAIEASSDLATERG-RYQSFEGSLWSKGVLPIDSIAKLAE-------ERGADYI---EVDTSTTQDWARLRDKVTRQGMRNSNVMAIAPTATISNICGVTQSIEPTYQNLFVKSNLSGEFTVVNAYMVNDLKARGLWDEVMINDLKYYDGSVQPIDRIPDDLKARYASAFEVEPKWLVEAAARRQKWIDQAQSLNLYIA-GVSGKKLDVTYRMAWFRGLKTTYYLR 894
>gi|170758616|ref|YP_001788132.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169405605|gb|ACA54016.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum A3 str. Loch Maree] (763 aa)
Score = 609, Expect = 7.4e-61, Identities = 201/691 (29%), Positives = 342/691 (49%)
  Q:    33 NGNFQF-ENDLLAVEKYLETEIKPNFKKFNS----------IKEKL--EYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNA--LLFGRGNEQ--DALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYE-----------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVN--NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N N+Q+    LL  + Y E +I  ++  F            +K KL  EYL ++NY D  +  K  + +++   E+ + +N+        +K      L    N    E  ++R +  A  L    G+++   A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +      +R   + I+G KN + G++P +++  D     +QLG+R+G  A+ L+ +H DI  FLD K  N D++ +   +   V +PD+      + +  +LF PY +++  G  + D          T +Y     N NI +  +    + +++ +   E+G PFI F D  N+ N   +  +I  SNLC EI Q  + S L  +   +           + G+ V CNL S+N++KV ++   F + +   I+ LD++  L  L      +  + K RA+GLG    H FLA NKI ++S+E +   +  +  +AY A K+S E AKE G  +  FK++++  G YF++     E                          W +L  +IKK+G+ N ++ A+APTGS S +++ T  + P+     +  E K G  + P    D+N  N+ YY K A+ I     I  C+  Q+H+DQA S  L++T     +++   Y+ ++ +   +IYY+R        S ++ ECT+C
  S:    84 NANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYELVKKLVKTKLYGEYL-IQNYSDEEI--KELAKYIVP--ERDELFNYE------GLKLLNDRYLIKGHNGEILELPQERFMTIAMHLAIPEGDKKVFYAKKFYDLLSELKVTVATPTLGNAGTTFY-QLSSCFISVVGDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGHKNASGGVVPWIRLYNDTAVAVDQLGKRKGGAAITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMKRLEKRESWSLFDPYIVEKIMGYKLEDYFDDEDRREFTNKYLECERNTNIPRDTVPTLDIMKKLMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESQLLEEKIIDDNGYPEVVQRVKAGDMVTCNLNSINLSKVKKE--EFSECIPLQIRMLDNVISLNKL-PVKEAKVTSDKYRAIGLGTSGYHHFLANNKIRWESDEHIKVADEIYEEIAYIAIKSSMELAKEKG-SYPAFKDSEWETGKYFERRGYNSER-------------------------WKKLQSNIKKYGMRNGYITAIAPTGSTSNIANTTAGIDPVFKKFFM--EEKKGS-FTPKTAPDLNEENFWYY-KEAHTIDQQWSIKACAVRQKHIDQAQSFNLYITPEIKAKEILNMYMESWKQGVKTIYYVR------NKSLEMDECTSC 761
>gi|7475800|pir||A69927 ribonucleoside-diphosphate reductase (alph) homolog yosO - Bacillus subtilis (786 aa)
Score = 609, Expect = 7.7e-61, Identities = 133/355 (37%), Positives = 210/355 (59%)
  Q:   371 LFDDIANEKNSALNNRIIMSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTCVI 725
           ++D    + +S + N I+  N C+E+ Q +  S+       +++G D+ CNLGS+NI  VM +  +   TV+ AI +L ++    ++ +AP +   N+  R++GLG MNLHGFLA N I Y+SEEA DF N +F  + +++ + S E A+ETG  +  F  + Y  G YF+KY     N ++P+ E+VK+L  +    IP  QDW++L ED+ K+GL +S+  A+APTGSISY+ S T  + PI+  IE R  G   + Y P   +   N+ +Y K AY++ +  ++D+ +  QQHVDQ IS TLFL +  TTRDLN+  +YA ++   ++YY R +    +       C +CV+
  S:   447 VYDTTQEDYHSLIFNGIVTGN-CSEVLQSSQVSVYTDYDKEDEIGLDISCNLGSMNIVNVMSN-QSIASTVRIAIDSLTTVTRKTNIVNAPAVARANTLMRSIGLGQMNLHGFLAQNNIAYESEEAKDFANTYFMMVNFYSLQRSMEIARETGETYYKFDGSTYKSGEYFEKYVT---NDYSPQYEKVKKLFGDQH--IPNIQDWMKLKEDVMKYGLYHSYRQAIAPTGSISYVQSSTAGVMPIMERIEERTYGN-SKTYYPMPGLSAQNWFFY-KEAYDMDMFKVVDLIATIQQHVDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTLYYARTKDTTQEG------CLSCVV 786
Score = 159, Expect = 1.2e-08, Identities = 35/105 (33%), Positives = 65/105 (61%)
  Q:   312 LFSPYDIQREYGKPMSDISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALN-NRIIMSNLCTEITQINTPSILNTDLTYEQLGE 416
           +F P+ + +EYG+ + ++ I E Y+ L+ NP + K   +ARKL +Q+A ++ ESGYP+I+F D  N+ +   + +++  SNLC     +   ++L T+  YE+  +
  S:     1 MFYPHSVYKEYGQYLDELDINEMYDELVENPRVRKAKGNARKLLEQLAILRSESGYPYIMFADNVNKVHPNEHISKVKFSNLC-----VTGETLLLTENGYEKAAD 101
>gi|168184458|ref|ZP_02619122.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum Bf] >gi|182672445|gb|EDT84406.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum Bf] (763 aa)
Score = 609, Expect = 9.1e-61, Identities = 201/691 (29%), Positives = 344/691 (49%)
  Q:    33 NGNFQF-ENDLLAVEKYLETEIKPNFKKFNS----------IKEKL--EYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNA--LLFGRGNEQ--DALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDIQREYGKPMSDI-------SITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLTYE----------QLGEDVCCNLGSLNIAKVMEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVN--NYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           N N+Q+    LL  + Y E +I  ++  F            +K KL  EYL ++NY D  +  K  + +++   E+ + +N+        +K      L    N    E  ++R +  A  L    G+++   A  + D +   +   ATPT  NAG     +  SC++  V DN+ SI        Q+SK GG +      +R   + I+G KN + G++P +++  D     +QLG+R+G  A+ L+ +H DI  FLD K  N D++ +   +   V +PD+      + +  +LF PY +++  G  + D          T +Y     N NI +  +    + +++ +   E+G PFI F D  N+ N   +  +I  SNLC EI Q ++   +L  ++  E          + G+ V CNL S+N++KV ++   F + +   I+ LD++  L  L      +  + K RA+GLG    H FLA NKI ++S+E +   +  +  +AY A ++S E AKE G  +  FK +++  G YF++     E                          W +L  +IKK+G+ N ++ A+APTGS S +++ T  + P+     +  E K G  + P    D+N  N+ YY K A+ I     I  C+  Q+H+DQA S  L++T     +++   Y+ ++ +   +IYY+R R      S ++ ECT+C
  S:    84 NANWQYVAARLLCFDLYKEAKISRHYNSFGYGDYYELVKKLVKMKLYGEYL-IQNYSDEEI--KELAKYIVP--ERDELFNYE------GLKLLNDRYLIKGHNGEILELPQERFMTIAMHLAIPEGDKKVFYAKKFYDLLSELKVTVATPTLGNAGTPFY-QLSSCFISVVGDNLWSIYDVNQKFAQVSKHGGALGIYTGKIRALNSEIRGHKNASGGVVPWIRLYNDTAVAVDQLGKRKGGAAITLDIWHKDIFDFLDLKTNNGDDRRKAHDIFPSVSIPDLFMKRLEKRESWSLFDPYIVEKIMGYKLEDYFDDEDCREFTNKYLECERNTNIPRDTVPTLDIMKKLMKSAVETGTPFIFFRDTVNKANPNKHKGMIYSSNLCHEIAQNMSESQLLEEEIIDENGYPEVVQRVKAGDMVTCNLNSINLSKVKKE--EFSECIPLQIRMLDNVISLNKL-PVKEAKVTSDKYRAIGLGTSGYHHFLANNKISWESDEHIKVADEIYEEIAYIAIESSMELAKEKG-SYPAFKGSEWETGKYFERRGYNSER-------------------------WKKLQSNIKKYGMRNGYITAIAPTGSTSNIANTTAGIDPVFKKFFM--EEKKGS-FTPKTAPDLNEENFWYY-KEAHTIDQQWSIKACAVRQKHIDQAQSFNLYITPEIKAKEILNMYMESWRQGVKTIYYVRNR------SLEMDECTSC 761
>gi|126664353|ref|ZP_01735337.1| Ribonucleotide reductase, alpha subunit [Marinobacter sp. ELB17] >gi|126630679|gb|EBA01293.1| Ribonucleotide reductase, alpha subunit [Marinobacter sp. ELB17] (929 aa)
Score = 608, Expect = 1.0e-60, Identities = 188/580 (32%), Positives = 305/580 (52%)
  Q:   126 YFEHF-EDRIVCNALLFGRG------NEQD----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPY---DIQREYGKPMSDISITEEYENLLNNPNITK-KYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDG----ANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPK------TERVKELLKEYKLAIPT--KQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQP----------------IVSPIEIRK---EGKVGRVYVPAYK-----------IDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           YF H+ EDR+    + F R        E D    A+ + D + +  Y ++TPT  N+G +   +  SCYL  V+D++E+I  +      LSK  GG+    T +R  GA IKG   Q+ G++P +K++ D     NQ G+R+GA   YL ++H DI +FL+ ++   DE+ R   ++    VPD+     R+++D  LFSP    D+   YG    +    + YE L     I   K I A++L++++  V FE+G+P+I F D  N ++   +  ++  SNLCTEIT       LNT        E   CNLGS+N+A  + +G        +TV  A++ LD++  + +  + P   N N K+R VGLG M     L   ++ Y S +AV+F ++    ++Y A +AS   A E G                   Y   E + W+ K       ER+K    E  L++ T  + DW  + + I K G+ NS++MA+APT +IS +   + S++P                +V+P  +R    EG    V V   K           I       YA  A+EI    +++  S  Q+ +DQ  S+ L++ +  + + L++ Y  A+ +   + YY+R
  S:   295 YFLHWKEDRLELPQVFFMRVAMGLSLREDDPNSRAIEFYDLLSSFDYMSSTPTLFNSGTRH-SQLSSCYLTTVDDDLEAIYGSIRDNAMLSKWAGGLGNDWTPVRAMGARIKGTNGQSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMRQDRDWTLFSPNDAPDLHDLYGNAFRE--RYQHYEALAAEGKIELFKTIPAKQLWRKMLTVLFETGHPWITFKDPCNLRSPQQHKGVVHSSNLCTEIT-------LNTSAD-----EIAVCNLGSVNLAAHINNGELDVKRLERTVDTAVRMLDNVIDI-NFYAVPQARNSNLKHRPVGLGLMGFQDALYALRLSYTSPQAVEFADVAMEQLSYFAIRASARLAAERG------------------AYESYEGSLWSQKILPIDSIERLKAARLEGDLSVNTDSRLDWAPVRDLIAKHGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSNLSGEFTVVNPSLVRDLKAEGLWDNVMVNDLKYYDGSVQQIERIPTELKSRYAT-AFEIDARWLVEAASRRQKWLDQGQSLNLYMAQ-PSGKKLDELYQLAWERGLKTTYYLR 896
>gi|160937687|ref|ZP_02085047.1| hypothetical protein CLOBOL_02577 [Clostridium bolteae ATCC BAA-613] >gi|158439332|gb|EDP17084.1| hypothetical protein CLOBOL_02577 [Clostridium bolteae ATCC BAA-613] (748 aa)
Score = 608, Expect = 1.2e-60, Identities = 176/567 (31%), Positives = 286/567 (50%)
  Q:   157 MTGRYQA--ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLAREN--KDMALFSPYDIQREYGKPMSDIS---ITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTP------SILNTD-----LTYEQLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG--NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSP--IEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           M  R Q   ATPT  NA +K   +  SC++  V D++E I R+     Q+SK GGG+      +R  G+ I+G +  A G+I  +K++ D     +QLG RQGA AVYL+A+H D+ +FL  +  N D++++   +   V  PD+ + +A EN  +D  L  P++I+   G  + D       E Y + + +  I+K+ +  + + + I +   E+G PFI   D  N  N   +  II  SNLCTEI Q  +P       +L  +     +   + G+ V CNL SL +  + ++D          A++ALD++    DL+  P    G  N   R +GLG    H  LA + I ++SEE + F +  F  + Y A +AS   A E G  +  F+ +++  G+YF+K                              ++W +L E + + G+ N++L+AVAPT S S LS  T  L P++    +E +K   + RV   A  +    +  Y  G Y +     +      Q+H+DQA S+ L++T + T R L   YI A+     ++YY+R +      S ++ EC +C
  S:   196 MLSRMQVTMATPTLSNA-RKPYHQLSSCFIDTVPDSLEGIYRSVDNFAQVSKFGGGMGLYFGKVRATGSRIRGFEGAAGGVIRWIKLVNDTAVAVDQLGMRQGAAAVYLDAWHKDLPEFLQLRTNNGDDRMKAHDIFPAVCFPDLFWKMAEENLDQDWHLMCPHEIRTVKGYCLEDCYGELWEERYLDCVGDDRISKRTVLLKDVVRLIIKSAVETGTPFIFNRDTVNRANPNSHRGIIYCSNLCTEIAQNMSPIESVSTQVLEVNGETAVVQTTRPGDFVVCNLASLCLGAIDVDDPDEVEYIAASAVRALDNV---IDLNFYPLAYAGITNQNYRGIGLGVSGYHHMLAKHGIRWESEEHLVFADQVFERIHYAAVRASANLAAEKG-CYRYFEGSEWQTGAYFEKRGL-------------------------VSREWKELAEQVAEHGMRNAYLLAVAPTSSTSILSGTTAGLDPVMKRFYLEEKKNAILPRV---APDLTPRTFWLYKSG-YTMDQTWTVRAAGVRQRHIDQAQSVNLYITNDYTMRQLLNLYILAWESGVKTLYYVRSK------SLEVEECESC 746
>gi|187933383|ref|YP_001884519.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum B str. Eklund 17B] >gi|187721536|gb|ACD22757.1| ribonucleoside-diphosphate reductase, alpha subunit [Clostridium botulinum B str. Eklund 17B] (741 aa)
Score = 607, Expect = 1.5e-60, Identities = 173/560 (30%), Positives = 292/560 (52%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLAREN--KDMALFSPYDIQREYGKPMSDISITE---EYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ------INTPSILNTDLTYE-----QLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NA +K   +  SC++  V+D++E I ++     ++SK GGG+   +  +R  G+PI+G K  + G+IP +K+  D     +QLG R G+ A++L+A+H DI +FL  +  N D++ +   +  GV  PD+ + LA EN   D  +  P++I+   G  + D    E   +Y   + +  I K+ I  + L + I +   E+G PF  F D AN+ N   +  +I  SNLCTEI Q      +N  +I+  +  Y      + G+ V CNL SL +  + + +       V+  I+A+D++  L +  S P  E  N + R +GLG    H  LA NKI++  E+   F +  +  + Y++ KAS   +KE G  +E F+ + + +G+YF+                    L++Y       + WI L +++K FG+ N +L+AVAP GS + ++  +  + PI++   + +E K   +   A  +  +NY YY   AY +     +++    Q+H+DQ  S  L++T   T R +   YI A      SIYY+R +      S ++ EC +C
  S:   198 ATPTMSNA-RKPFYQLSSCFVDTVDDSLEGIYKSLDNFAKVSKFGGGMGIYIGKIRSLGSPIRGFKGASGGVIPWVKLFNDTAIAVDQLGVRNGSVAIWLDAWHKDIPEFLQIRTNNGDDRKKAHDVFPGVCYPDLFWKLAEENVDNDWYMMCPHEIKNAKGYSLEDFYGEEWETKYFECVEDDRIEKRSIKIKDLVRLIIKSAAETGAPFAFFRDNANKMNPNKHKGMIYSSNLCTEIMQNMSAMKVNGDTIIKENDKYNVVQNIEAGDFVVCNLSSLVLGNIDVLNDEELECVVETQIRAMDNVIDL-NYYSVPFAEITNKRYRGIGLGTSGYHHMLANNKIHWTEEKHRTFVDKVYEKINYYSIKASMNLSKEKG-KYELFEGSDWDNGNYFE--------------------LRDY-----NDEKWIDLKQEVKSFGMRNGYLIAVAPNGSTATIAGTSEGIDPIMARFYL-EEKKGSIIPKTAPNLSEDNYWYY-NTAYNLEQGWCVEMNGIRQRHIDQGQSFNLYITTQYTMRQIMNLYIKACKCGVKSIYYVRSK------SLEVTECESC 739
>gi|29840534|ref|NP_829640.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila caviae GPIC] >gi|29834883|gb|AAP05518.1| ribonucleoside-diphosphate reductase, alpha subunit [Chlamydophila caviae GPIC] (1044 aa)
Score = 606, Expect = 1.8e-60, Identities = 196/625 (31%), Positives = 314/625 (50%)
  Q:    81 FKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLF------------GRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDI---QREYGKPMSDISITEEYENLLNNPNIT-KKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDG----ANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYK------LAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRK----EGKVGRVY-------VPAYKIDVNNYMYYAKG------------------AYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
            K+Y    L    + ++   F   S+MG    Y            YF   E R +  A +F            G      A+T+ + + T RY  ATPT  N+G +   +  SCYL  V+D++  I +  +    LSK  GG+    T +R  G+ IKG   ++ G+IP +K+  D     NQ G+R+GA  VYL  +H D   FL+ ++   DE+ R   ++    +PD+ F    +     LFSP D+      YG       + EEYE  ++N  I   K I A  L++++  + +E+G+P++ F D +N + +  +  ++  SNLCTEI       +LN         E   CNLGS+N+ + +E+G        +T+  AI+ LD+I  L +    P   N N  +RAVGLG M     L    I Y S+EAV+F +     +AY+A  +S+  AKE G  + ++K +K+ D  Y    T               ELLKEY+      +    ++DW  + E IK +G+ NSH MA+APT +IS +   T S++P    + ++     E  +  VY       +  +  D+ + + Y  G                  A+EI    +I+  S  Q+ +D   S+ L+L+E    + L+  Y+ A+ K   + YY+R
  S:   356 LKEYDLDALAEALDISRDRQF---SYMGVQNLY----------DRYFNQHEGRRLETAQIFWMRISMGLALNEGEDKTSWAITFYNLLSTFRYTPATPTLFNSGMRH-SQLSSCYLSTVQDDLAHIYKVISDNAMLSKWAGGIGNDWTGVRAIGSLIKGTNGKSQGVIPFIKVANDTAIAVNQGGKRKGAMCVYLEIWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLDQKGTWTLFSPDDVPGLHEAYGFEFD--KLYEEYERKIDNGEIKLYKKIPAEDLWRKMLSMLYETGHPWLTFKDPSNIRGAQDHAGVVRCSNLCTEI-------LLNCSEN-----ETAVCNLGSVNLVEHIENGDINEKKLAETISIAIRILDNIIDL-NFYPTPEAANANLSHRAVGLGQMGFQDALYKLNISYASQEAVEFADKSAELIAYYAILSSSLLAKERG-TYSSYKGSKW-DRGYLPLDTV--------------ELLKEYRGEENVLMDTSCRKDWTPVREAIKAYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPNVYLIEQLKKLGIWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRRQKWIDMGQSLNLYLSE-PNGKKLSAMYLTAWKKGLKTTYYLR 990
>gi|89898044|ref|YP_515154.1| ribonucleotide-diphosphate reductase subunit alpha [Chlamydophila felis Fe/C-56] >gi|89331416|dbj|BAE81009.1| ribonucleoside-diphosphate reductase alpha chain [Chlamydophila felis Fe/C-56] (1045 aa)
Score = 605, Expect = 2.2e-60, Identities = 200/638 (31%), Positives = 330/638 (51%)
  Q:    68 EYLFLENYYDFNV-FKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTY--FEHFEDRIVCN-ALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDI---QREYGKPMSDISITEEYENLLNNPNIT-KKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDG----ANFGKTVKYAIKALDSIAHLADLSSAPTIE--NGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPT--KQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEIRK----EGKVGRVY-------VPAYKIDVNNYMYYAKG------------------AYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           +Y+   + Y  N   K+Y    L    + ++ + F   S+MG    Y  Y L  ++ +     + F  R+    AL  G      A+T+ + + + RY  ATPT  N+G +   +  SCYL  V+D++  I +  +    LSK  GG+    T +R  G+ IKG   ++ G+IP +K+  D     NQ G+R+GA  VYL  +H D   FL+ ++   DE+ R   ++    +PD+ F    +     LFSP D+      YG       + EEYE  ++   I   K I A  L++++  + +E+G+P+I F D +N +++  +  ++  SNLCTEI       +LN+  +     E   CNLGS+N+ + +++G       G+T+  AI+ LD++    D++  PT E  N N  +RAVGLG M     L    I Y S EAV+F +     +AY+A  +S+  AKE G  + ++K +K+ D  Y    T           E +KE   E KL + T  ++DW  + E IK +G+ NSH MA+APT +IS +   T S++P    + ++     E  +  VY       +  +  D+ + + Y  G                  A+EI    +I+  S  Q+ +D   S+ L+L+E    + L+  Y+ A+ K   + YY+R
  S:   343 QYILDGDQYRLNPRLKEYDLDALAEALDISRDHQF---SYMGVQTLYDRY-LNQYEGRRLETTQIFWMRVSMGLALNEGEDKTSWAITFYNLLSSFRYTPATPTLFNSGMRH-SQLSSCYLSTVQDDLAHIYKVISDNAMLSKWAGGIGNDWTGVRATGSLIKGTNGKSHGVIPFIKVANDTAVAVNQGGKRKGATCVYLETWHLDYEDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQKGTWTLFSPDDVPGLHEAYGFEFD--KLYEEYERKVDTGEIKLYKKIPAEDLWRKMLSMLYETGHPWITFKDPSNIRSAQDHAGVVRCSNLCTEI-------LLNSSES-----ETAVCNLGSVNLVEHIKNGDIDEEMLGETISIAIRILDNV---IDINFYPTQEAANANLTHRAVGLGMMGFQDALYKLNISYASPEAVEFADKSSELIAYYALLSSSLLAKERG-TYSSYKGSKW-DRGYLPIDT----------IELLKEYRGEDKLLMDTSCRKDWAPVREAIKSYGMRNSHTMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPNVYLIEKLKQLGLWDADMLDDLKYFDGSLLEIERIPDDLKKIFLTAFEIEPEWLIECASRRQKWLDMGQSVNLYLSE-PNGKKLSAMYLTAWKKGLKTTYYLR 991
>gi|15896522|ref|NP_349871.1| ribonucleotide-diphosphate reductase subunit alpha [Clostridium acetobutylicum ATCC 824] >gi|15026353|gb|AAK81211.1|AE007823_5 Ribonucleotide reductase alpha subunit [Clostridium acetobutylicum ATCC 824] (743 aa)
Score = 603, Expect = 4.4e-60, Identities = 185/652 (28%), Positives = 326/652 (50%)
  Q:    72 LENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQD-----ALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMA--LFSPYDIQREYGKPMSDISITE---EYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLTYE----------QLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSPIEI-RKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           LENY   ++++      L S  +K + + F +S   G       Y +++F+ K   E  +   +  A+      +Q+     A  + D + + +   ATPT  NA +K   +  SC++  V+D+++ I ++      +SK GGG+      +R  GA I+G K  + G++P +K+  D     +QLG R G+ AV+L+A+H D+ +F+  +  N D++ +   +  GV  PD+ + LA E+ D    +  P++I+   G  + D    E    Y + +N+P I K+ +S + + + I +   E+G PF  + D AN  N   +  +I  SNLCTEI Q ++   IL  ++  E          + G+ V CNL S+ +  V + D       ++  I+A+D++  L +  S P  E  N + R +GLG    H  L  N++ + S++  +FT+  +  + Y+A +AS   AK+ G  +E F+ + + +GSYF         Y +PK                    W  L   IKK+G+ N ++MAVAP GS + ++  +  + P+++   +  K+G +     P   +   N+ +Y   AY I     + I    Q+H+DQ+ S  L++T + T R +   YI A+     SIYY+R +   + D      C +C
  S:   113 LENYSKEDIYE------LESFIKKDRDFLFTYS---GIKLLSERYLIQNFERKV-LELPQQMFMGIAMHLAVPEKQENRVYWAKRFYDVLSSLKATMATPTMSNA-RKPFYQLSSCFIDTVDDSLKGIYKSLDNFANVSKYGGGMGVYFGKVRSMGASIRGFKGASGGVVPWVKLFNDTAIAVDQLGVRNGSVAVWLDAWHKDLPEFMQLRTNNGDDRKKAHDVFPGVCYPDLFWRLAEEDIDANWYMMCPHEIKLVKGYSLEDYYGEEWEKRYFDCVNDPRIDKRMMSVKDIVRLIIKSAAETGTPFAFYRDAANRMNPNKHKGMIYSSNLCTEIMQNMSAMDILEDEIIDENGDKIIVQKAKSGDFVVCNLSSIVLGNVDVNDDEELQYVIETQIRAMDNVIDL-NYYSVPFAEVTNKRYRGIGLGTSGYHHMLTNNRVVWTSDDHFEFTDRVYEKINYYAIQASMNIAKDKG-RYEYFEGSDWENGSYFKL-----RGYNSPK--------------------WKALIAKIKKYGMRNGYIMAVAPNGSTATIAGTSEGVDPVMARFWMEEKKGSITPKIAP--NLSRENFWFY-NSAYNIDQKLCVKINGIRQRHIDQSQSFNLYITTDYTMRQIMNLYIEAYKSGVKSIYYVRSKSLTVGD------CDSC 741
>gi|160942849|ref|ZP_02090089.1| hypothetical protein FAEPRAM212_00326 [Faecalibacterium prausnitzii M21/2] >gi|158445901|gb|EDP22904.1| hypothetical protein FAEPRAM212_00326 [Faecalibacterium prausnitzii M21/2] (847 aa)
Score = 600, Expect = 7.9e-60, Identities = 180/560 (32%), Positives = 295/560 (52%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMA--LFSPYDIQREYGKPMSDISITE---EYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKN-SALNNRIIMSNLCTEITQINTP-----SILNTD------LTYEQLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENG---NSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSP--IEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NA +K   +  SC++  V D+++ I R+     ++SK GGG+      +R  G+ I+G +  A G+I  ++++ D     +QLG RQGA AVYL+A+H D+ +FL  +  N D++++   +   V  PD+ + LA EN D    L  P++I    G  + D   TE    Y + +N+P I K+ ++ + + + +     E+G PF    D  N  N +     I  SNLCTEI Q   P     + ++T+      +T  + GE V CNL SL++  + +ED A   +TV+ AI+ALD++    DL+  P +E     N K R++GLG    H  LA   I+++S+E + FT+  F  + Y A KA    A+E G  +  F+ + +  G+YF+K                    + Y     T + W  L + +   G+ N++L+AVAPT S S LS  +  + PI+    +E +K   + RV   A ++ ++ + YY K A+ I  +  +      Q+H+DQA SM L++T + + R + + Y+ A+     +IYY+R          K  E  TC
  S:   304 ATPTMSNA-RKPYHQLSSCFVDTVPDSLDGIYRSLDNFAKVSKFGGGMGMYFGKVRAAGSTIRGFQGAAGGVIRWIRLVNDTAVAVDQLGMRQGAVAVYLDAWHRDLPEFLQLRTNNGDDRMKAHDVFPAVCYPDLFWRLAEENIDAPWHLMCPHEILTVKGYALEDYWGTEWEKRYLDCVNDPRIEKRSVTVKDIVRLVLRSAVETGTPFAFNRDSVNHMNPNGHTGMIYCSNLCTEIAQNMAPIEHISTEVHTENGDTIVVTATRPGEFVVCNLASLSLGNLPVEDEAYMERTVETAIRALDNV---IDLNFYP-LEYARLTNQKYRSIGLGVSGYHHMLAKRGIHWESDEHLAFTDAVFELINYAAVKADTALAREKG-RYALFEGSDWQTGAYFEK--------------------RGY-----TSEKWRALAKTVAVQGMRNAYLLAVAPTSSTSILSGTSAGIDPIMKKFFLEEKKGSMLPRV---APELSMDTWWYY-KAAHLIDQSWSVRAAGLRQRHIDQAQSMNLYITNDYSMRQVLRLYLEAWRAGVKTIYYVR---------SKALEVETC 842
>gi|120556761|ref|YP_961112.1| ribonucleotide-diphosphate reductase subunit alpha [Marinobacter aquaeolei VT8] >gi|120326610|gb|ABM20925.1| ribonucleoside-diphosphate reductase, alpha subunit [Marinobacter aquaeolei VT8] (949 aa)
Score = 600, Expect = 8.5e-60, Identities = 189/600 (31%), Positives = 305/600 (50%)
  Q:   106 FMGAMKFYTTYALKSFDNKTYFEH---FEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMALFSPYDI---QREYGKPMSDISITEEYENLLNNPNITK-KYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRII-MSNLCTEITQINTPSILNTDLTYEQLGEDVCCNLGSLNIAKVMEDG----ANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSY-FDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQP----------------IVSPIEIRK---EGKVGRVYVPAYK-----------IDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIR 705
           F+G    Y  Y L    NK   E    F  R+     L        A+ + + + +  Y A+TPT  N+G +   +  SCYL  V D++E I  A      LSK  GG+    T +R  G+ IKG   Q+ G++P +K++ D     NQ G+R+GA   YL ++H DI +FL+ ++   DE+ R   ++    VPD+     RE+++  LFSP D+      YG    +    + YE L     I   K I A++L++++  V FE+G+P+I F D  N ++   +  ++  SNLCTEIT       LNT        E   CNLGS+N+A  ++DG        +TV  A++ LD++  + +  + P   N N K+R VGLG M     L    + Y S EAV+F ++    ++Y A +AS   A E G  ++ ++ + ++ G    D     ++N       R  +L     L   ++ DW  + E I K G+ NS++MA+APT +IS +   + S++P                +V+P  +R    EG    V V   K           I       YA  A+EI    +++  +  Q+ +DQA S+ L++ E  + + L+  Y  A+ +   + YY+R
  S:   306 FLGLQTLYDRYFLHW--NKARLELPQVFFMRVAMGLALREDDPNARAIEFYELLSSFDYMASTPTLFNSGTRH-SQLSSCYLTTVGDDLEGIYGAIRDNALLSKWAGGLGNDWTPVRALGSHIKGTNGQSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLESWHLDIEEFLELRKNTGDERRRTHDMNTANWVPDLLIERMREDREWTLFSPSDVPDLHDLYGNAFRE--RYQHYEALAEQGKIKLFKKIPAKQLWRKMLTVLFETGHPWITFKDPCNLRSPQQHQGVVHSSNLCTEIT-------LNTSAD-----EIAVCNLGSVNLAAHIKDGELDVTRLERTVNTAVRMLDNVIDI-NFYAVPQARNSNLKHRPVGLGLMGFQDALYQLGLPYSSPEAVEFADVAMEQLSYFALRASATLAGERG-AYDTYEGSLWSQGILPMDSVGLLKDN------RRDGDL----SLNTNSRLDWTPVRELIAKNGMRNSNVMAIAPTATISNIVGVSQSIEPAYQNLFVKSNLSGEFTVVNPSLVRDLKAEGLWDNVMVNDLKYFDGSVQQIDRIPAELKARYAT-AFEIDPRWLVEAAARRQKWLDQAQSLNLYMAE-PSGKKLDALYQLAWERGLKTTYYLR 917
>gi|167748342|ref|ZP_02420469.1| hypothetical protein ANACAC_03086 [Anaerostipes caccae DSM 14662] >gi|167652334|gb|EDR96463.1| hypothetical protein ANACAC_03086 [Anaerostipes caccae DSM 14662] (763 aa)
Score = 598, Expect = 1.5e-59, Identities = 195/667 (29%), Positives = 325/667 (48%)
  Q:    49 LETEIKPNFKKFN--SIKEKLEYLFLENYYDFNVFKKYSSS---FLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMA--LFSPYDIQREYGKPMSD---ISITEEYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQINTPS--------ILNTD---LTYEQLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSP--IEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSE 715
            E+ +K N +++   +  EK+  L  +N Y   + K Y+        S     +   F +S     +  Y     +    +T  E F    +  A+       Q    + D +   +   ATPT  NA +K   +  SC++  V D+++ I R+  +  ++SK GGG+      +R  G+ I+G +  A G+I  +++  D     +QLG RQGA AVYL+ +H D+ +FL  +  N DE+++   +   V  PD  +  AR+N + +  L  P++I    G  + D      TE+Y + + +  I+K+ I  + + + I +   E+G PF    D  N  N   +  II  SNLCTEI Q  + S        ++  +   +T  + G+ V CNL SL++  + + D        + A++ALD++  L +    P  E  + + R VGLG    H  LA +KI ++SEE + F    F  + Y A  AS++ ++E G  +  F  + +  G YF                R ++L         TK  W  L + IKK GL N +L+A APT S S ++  T  L P+++   +E +K G + RV   A ++ +  + YY K A+ I     +  C   Q+H+DQA SM L++T   T R +   YI A+ +   +IYY R +   ++D E
  S:   100 FESVVKNNLEEYQIRNFYEKIVVLSQQNLYGDYILKNYAEDEIHLFSSWIRPERNSLFHYSGLELLLSRYVIRDRQGNPLETPQEMFMGIAMHLAMKETEDRNQWVKRFYDMLSLLQVTMATPTLSNA-RKPYHQLSSCFIDTVPDSLDGIYRSIDSFAKVSKFGGGMGLYFGKVRASGSSIRGFEGAAGGVIRWIRLANDTAVAVDQLGMRQGAVAVYLDVWHRDLPEFLSLRTNNGDERMKAHDVFPAVCYPDYFWEQARDNIEGSWYLMCPHEILTVKGYALEDCYGTEWTEKYLDCVLDERISKRVIPIKDIVRMIIKSAAETGTPFTFNRDHVNRANPNRHKGIIYCSNLCTEIAQNMSASGQIEQKIEMIGGEEVVVTVTKPGDFVVCNLASLSLGNLCVTDYEQLSYVTESAVRALDNVIDL-NFFPVPYAEINSKRYRPVGLGVSGYHHMLAKHKIQWESEEHLKFAEKVFSDIHYAALAASSKISEEKG-SYPYFPGSDWQTGDYF----------------RKRDL---------TKGRWKALEDRIKKHGLRNGYLLAAAPTSSTSIIAGTTAGLDPVMNRYFLEEKKYGLIPRV---APELSMETFWYY-KNAHYIDQTWSVKACGVRQRHIDQAQSMNLYITNEYTFRKVLDLYILAWEQGVKTIYYTRSKSLEVEDCE 759
>gi|169825013|ref|YP_001692624.1| ribonucleoside-diphosphate reductase alpha subunit [Finegoldia magna ATCC 29328] >gi|167831818|dbj|BAG08734.1| ribonucleoside-diphosphate reductase alpha subunit [Finegoldia magna ATCC 29328] (842 aa)
Score = 596, Expect = 2.7e-59, Identities = 180/570 (31%), Positives = 295/570 (51%)
  Q:   154 DEMMTGRYQAATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMA--LFSPYDIQREYGKPMSDISITE---EYENLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-----------INTPSILNTDLTYEQLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPT--IENGNSKNRAVGLGAMNLHGFLATNKIYY-DSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSP--IEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           D +   +   ATPT  NA +K   +  SC++  V D +E I R+     Q+SK GGG+      +R  G+ I+G +  A G+I  +K+  D     +QLG RQG+ AVYL+ +H DIL+FL  +  N D++++   +   V  PD+ + + R++ D    +F P++I  + G  + D    E    Y   + + +I+++ I  + L + I +   E+G PF    D  N  N   +  +I  SNLCTEI Q           I T    +  +T  + G+ V CNL SL +  + + +     + V+ A++ LD++    DL+  P    +  N K R +GLG    H  L  N I Y D E+ ++F +  +  + Y+A KASN+ AKE G  +E F+ + + +G YF                     L++Y       + W +L  DIKK G+ N +LMAVAPTGS S ++  T ++ P++S   +E +K   V RV   A  +    +  Y + A+E+  N  +D  S  Q+H+DQ  S+ +++T + T R +   Y+ A+ K   SIYY+R +   ++D      C +C
  S:   288 DNLSKLKVTVATPTMSNA-RKPFNQLSSCFIDTVPDTLEGIYRSINNFAQVSKHGGGMGLYFGKVRANGSDIRGFQGVAGGVIRWIKLANDTAVAVDQLGVRQGSVAVYLDVWHKDILEFLQLRTNNGDDRMKAHDVFPSVCYPDLFWKMVRDDIDGTWYMFDPHEISVKKGYNLEDYYGDEWEKRYNECVLDESISRRSIKVKDLVRLIIKSWTETGTPFTFNRDTVNRMNPNKHKGMIYSSNLCTEIMQNMSEIHSISENIETEDGDDIIVTKTKPGDFVVCNLASLVLGNIDVNNDEELEEVVETAVRGLDNV---IDLNFYPLEYAKYTNKKYRPIGLGTSGYHHCLVKNNIMYSDVEKHLEFADKLYEKINYYAIKASNKIAKEKG-SYEYFEGSDWENGEYFK--------------------LRDY-----NSEKWNELYHDIKKNGMRNGYLMAVAPTGSTSIIAGTTAAVDPVMSRYFLEEKKGTIVPRV---APGLSPQTFWLY-ENAHELDQNITVDATSIRQRHIDQGQSVNIYITTDYTMRTILNIYVRAWEKGIKSIYYVRSKSLEVED------CDSC 840
>gi|153814164|ref|ZP_01966832.1| hypothetical protein RUMTOR_00373 [Ruminococcus torques ATCC 27756] >gi|145848560|gb|EDK25478.1| hypothetical protein RUMTOR_00373 [Ruminococcus torques ATCC 27756] (761 aa)
Score = 596, Expect = 2.9e-59, Identities = 176/560 (31%), Positives = 291/560 (51%)
  Q:   164 ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLAREN--KDMALFSPYDIQREYGKPMSDISITEEYE----NLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKNSALNNRIIM-SNLCTEITQ-INTPSILNTDLTYE----------QLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIVSP--IEIRKEGKVGRVYVPAYKIDVNNYMYYAKGAYEIGVNPIIDICSAAQQHVDQAISMTLFLTENATTRDLNKAYIYAFNKKCVSIYYIRIRQEVLKDSEKLFECTTC 723
           ATPT  NA +K   +  SC++  V D+++ I R+      +SK GGG+      +R  G+ I+G +  A G+I  ++I+ D     +QLG R GA AVYL+A+H D+ +FL  +  N DE+++   +   V  PD+ + +A EN  +D  L  P++I       + D S  EE+E    + +++  I K+ +  + L + I +   E+G PF    D  N  N   +  +I  SNLCTEI Q ++  S + T +  E          + GE V CNL SL++  + + D A   K V+  ++ALD++  L +    P  +  N   R++GLG    H  LA NKI + SEE + F +  F  + Y A +AS++ AKE G  +  F+ + +  G+YF+K   C +                         +W +L E + + G+ N++L+A+APT S S ++  T  + P+++   +E +K   + RV   A  +    Y YY   A+ I  N  +  C   Q+HVDQA SM  ++T + T R +   Y+ A+     ++YY+R +      S ++ EC +C
  S:   218 ATPTLANA-RKPFHQLSSCFIDTVPDSLKGIFRSIDNFAMVSKYGGGMGLYFGKVRASGSMIRGFEGAAGGVIRWVRIVNDTAVAVDQLGVRAGAVAVYLDAWHRDLPEFLQLRTNNGDERMKAHDVFPAVCYPDLFWKMAGENLDQDWYLMCPHEIMTVKEYCLED-SFGEEWERRYWDCVHDARIKKRTVLLKDLIRLIIKSAAETGTPFAFNRDTVNRANPNPHKGMIYCSNLCTEIAQNMSAISTVETKIQTEDKDTVVVNTTKAGEFVVCNLASLSLGNLPVNDPAYVRKVVRTVVRALDNVIDL-NFYPVPYAKITNHTYRSIGLGVSGYHHMLAKNKIKWQSEEHLAFVDKLFEQINYAAIEASSDYAKEKG-SYRYFEGSDWESGAYFEKRGYCSD-------------------------EWKELREKVHRQGMRNAYLLAIAPTSSTSIIAGTTAGIDPVMNKYFLEEKKGSMLPRV---APDLSPETYWYYIN-AHHIDQNWSVRACGVRQRHVDQAQSMNFYITNDYTMRQVLNLYLKAWECGVKTVYYVRSK------SLEVEECESC 759
>gi|154505111|ref|ZP_02041849.1| hypothetical protein RUMGNA_02624 [Ruminococcus gnavus ATCC 29149] >gi|153794590|gb|EDN77010.1| hypothetical protein RUMGNA_02624 [Ruminococcus gnavus ATCC 29149] (763 aa)
Score = 595, Expect = 3.0e-59, Identities = 193/666 (28%), Positives = 329/666 (49%)
  Q:    58 KKFNSIKEKLEYLFLENYYDFNVFKKYSSSFLISIFEKAKTYNFRFSSFMGAMKFYTTYALKSFDNKTYFEHFEDRIVCNALLFGRGNEQDALTYLDEM--MTGRYQA--ATPTFLNAGKKQRGEYVSCYLLRVEDNMESIGRATTTGLQLSKRGGGVAYCLTNLREFGAPIKGIKNQATGIIPVMKILEDVFSYANQLGQRQGAGAVYLNAFHPDILKFLDSKRENADEKIRIKSLSLGVVVPDIAFHLARENKDMA--LFSPYDIQREYGKPMSDISITEEYE----NLLNNPNITKKYISARKLFQQIAEVQFESGYPFILFDDIANEKN-SALNNRIIMSNLCTEITQ-----------INTPSILNTDLTYEQLGEDVCCNLGSLNIAKV-MEDGANFGKTVKYAIKALDSIAHLADLSSAPTIENGNSKNRAVGLGAMNLHGFLATNKIYYDSEEAVDFTNMFFYTMAYHAYKASNETAKETGFVFENFKNTKYADGSYFDKYTQCEENYWTPKTERVKELLKEYKLAIPTKQDWIQLTEDIKKFGLANSHLMAVAPTGSISYLSSCTPSLQPIV