>gi|26553539|ref|NP_757473.1| ribonucleotide reductase stimulatory protein [Mycoplasma penetrans HF-2] >gi|38258131|sp|Q8EWW3|NRDI_MYCPE Protein nrdI >gi|26453545|dbj|BAC43877.1| ribonucleotide reductase [Mycoplasma penetrans HF-2] (149 aa)
Score = 736, Expect = 9.9e-77, Identities = 149/149 (100%), Positives = 149/149 (100%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
           MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF
  S:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
>gi|15887422|ref|NP_353103.1| ribonucleotide reductase stimulatory protein [Agrobacterium tumefaciens str. C58] >gi|23821893|sp|Q8UJ69|NRDI_AGRT5 Protein nrdI >gi|15154933|gb|AAK85888.1| NrdI protein involved in ribonucleotide reduction [Agrobacterium tumefaciens str. C58] (132 aa)
Score = 379, Expect = 2.9e-35, Identities = 74/140 (52%), Positives = 92/140 (65%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVYYSS+S NTHRF+LKL  +  RLP+          E  +P V+ P++L+TPTY GG    KGAVPKPV +FLN P NRN  + VIA+GNTNF   +  AGDI+S+K  +PFLY+FELLGT  DV NV      FW +
  S:     3 LIVYYSSRSENTHRFLLKLERRLFRLPLGA--------EEDVPQVSEPYVLVTPTYGGG--GTKGAVPKPVIRFLNEPSNRNLIRGVIAAGNTNFGAAFASAGDIVSRKCAVPFLYRFELLGTEEDVANVKHGLERFWTR 132
>gi|71893572|ref|YP_279018.1| ribonucleotide reductase stimulatory protein [Mycoplasma hyopneumoniae J] >gi|72080561|ref|YP_287619.1| ribonucleotide reductase stimulatory protein [Mycoplasma hyopneumoniae 7448] >gi|71851699|gb|AAZ44307.1| ribonucleoprotein NrdI [Mycoplasma hyopneumoniae J] >gi|71913685|gb|AAZ53596.1| ribonucleoprotein NrdI [Mycoplasma hyopneumoniae 7448] (150 aa)
Score = 378, Expect = 3.4e-35, Identities = 80/140 (57%), Positives = 97/140 (69%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           F+VY+SS SNNTHRF+ KLN +  R+P+E   E           V+  ++L  PTY+GG G   GAVPK V KFLNN  NR  CKAVIASGNTNF DT+ +AG IISQKL++PFLY FELLGTN DV+ V +I  +FW K
  S:    20 FVVYFSSISNNTHRFVEKLNFEKARIPVEIDQEL---------VVDKDYVLFCPTYSGGKGLRSGAVPKQVIKFLNNEQNRRFCKAVIASGNTNFGDTFALAGTIISQKLKVPFLYSFELLGTNDDVKKVRQILEDFWGK 150
>gi|54020060|ref|YP_115671.1| ribonucleotide reductase stimulatory protein [Mycoplasma hyopneumoniae 232] >gi|53987233|gb|AAV27434.1| ribonucleotide reductase [Mycoplasma hyopneumoniae 232] (157 aa)
Score = 378, Expect = 3.4e-35, Identities = 80/140 (57%), Positives = 97/140 (69%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           F+VY+SS SNNTHRF+ KLN +  R+P+E   E           V+  ++L  PTY+GG G   GAVPK V KFLNN  NR  CKAVIASGNTNF DT+ +AG IISQKL++PFLY FELLGTN DV+ V +I  +FW K
  S:    27 FVVYFSSISNNTHRFVEKLNFEKARIPVEIDQEL---------VVDKDYVLFCPTYSGGKGLRSGAVPKQVIKFLNNEQNRRFCKAVIASGNTNFGDTFALAGTIISQKLKVPFLYSFELLGTNDDVKKVRQILEDFWGK 157
>gi|195977666|ref|YP_002122910.1| ribonucleotide reduction protein NrdI [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974371|gb|ACG61897.1| ribonucleotide reduction protein NrdI [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (136 aa)
Score = 365, Expect = 1.2e-33, Identities = 75/135 (55%), Positives = 91/135 (67%)
  Q:     5 RFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           R  +VY+SS+SNNTHRF+ KL+ K LR+PI    EP          V+  +IL+ PTYA G    KGAVPK V  FLNN  NR +CK VI+SGNTNF DT+ IAG II+QKLQ+P L++FELLGT  DV  V  I
  S:     4 RVMLVYFSSRSNNTHRFVQKLDAKALRIPIS--GEP--------LLVDEDYILIVPTYAAGGSDSKGAVPKQVIHFLNNANNRRHCKGVISSGNTNFGDTFAIAGPIIAQKLQVPLLHQFELLGTQRDVLKVQAI 128
>gi|50122258|ref|YP_051425.1| ribonucleotide reductase stimulatory protein [Pectobacterium atrosepticum SCRI1043] >gi|67460809|sp|Q6D1W1|NRDI_ERWCT Protein nrdI >gi|49612784|emb|CAG76234.1| NrdI protein [Erwinia carotovora subsp. atroseptica SCRI1043] (135 aa)
Score = 363, Expect = 1.9e-33, Identities = 71/139 (51%), Positives = 93/139 (66%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS+S NTHRF+ +++   LR+PI          E     V+ P+IL+ P+Y GG    KGAVP+ V  FLN+P NR   + VIA+GNTNF   YCIAGDII+QK Q+P+LY+FELLGT  DV NV K   EFW++
  S:     4 LVYFSSQSENTHRFICRVDLPALRIPIAT--------EQPALKVDRPYILVVPSYGGG--STKGAVPRQVIIFLNDPHNRAYLRGVIAAGNTNFGAAYCIAGDIIAQKCQVPYLYRFELLGTAEDVANVRKGVTEFWQQ 132
>gi|83319863|ref|YP_424094.1| ribonucleotide reductase stimulatory protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123535969|sp|Q2ST19|NRDI_MYCCT Protein nrdI >gi|83283749|gb|ABC01681.1| nrdI protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (157 aa)
Score = 362, Expect = 2.4e-33, Identities = 77/142 (54%), Positives = 101/142 (71%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           F+VY+SS SNNTHRF+ KL  + LR+P E        +E  I +V+  ++L+TPTY+GG   ++GAVPK V KFLNN  NR+ C+ VI+SGNTNF DT+ IAG IIS+KL +PFLY+FELLGT  DV  + +I  +FWE  N
  S:    21 FVVYFSSISNNTHRFIQKLEIENLRIPYE--------IEQSI-SVDRDYVLVTPTYSGGGEYVEGAVPKQVIKFLNNKQNRSFCRGVISSGNTNFGDTFGIAGPIISKKLNVPFLYQFELLGTQHDVSQIKQILFKFWEDGN 153
>gi|42561373|ref|NP_975824.1| ribonucleotide reductase stimulatory protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81400417|sp|Q6MSC4|NRDI_MYCMS Protein nrdI >gi|42492871|emb|CAE77466.1| Ribonucleotide reductase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (157 aa)
Score = 361, Expect = 3.9e-33, Identities = 77/142 (54%), Positives = 100/142 (70%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           F+VY+SS SNNTHRF+ KL  + +R+P E        L+  I +VN  ++L+TPTY+GG   ++GAVPK V KFLNN  NR+ C+ VI+SGNTNF DT+ IAG IIS+KL +PFLY+FELLGT  DV  + +I   FWE  N
  S:    21 FVVYFSSISNNTHRFIQKLEIENIRIPYE--------LDQSI-SVNRDYVLVTPTYSGGGEYVEGAVPKQVIKFLNNKENRSFCRGVISSGNTNFGDTFGIAGPIISKKLNVPFLYQFELLGTQHDVSQIKQILFRFWEDGN 153
>gi|188159074|ref|ZP_02512096.2| ribonucleotide reductase stimulatory protein [Mycoplasma mycoides subsp. mycoides LC str. GM12] (157 aa)
Score = 359, Expect = 5.8e-33, Identities = 77/142 (54%), Positives = 101/142 (71%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           F+VY+SS SNNTHRF+ KL  + +R+P E        L+  I +VN  ++L+TPTY+GG   ++GAVPK V KFLNN  NR+ C+ VI+SGNTNF DT+ IAG IIS+KL +PFLY+FELLGT  DV  + +I  +FWE  N
  S:    21 FVVYFSSISNNTHRFIQKLEIENIRIPYE--------LDQSI-SVNRDYVLVTPTYSGGGEYVEGAVPKQVIKFLNNKENRSFCRGVISSGNTNFGDTFGIAGPIISKKLNVPFLYQFELLGTQYDVSQIKQILLKFWEDGN 153
>gi|111023401|ref|YP_706373.1| ribonucleotide reductase stimulatory protein [Rhodococcus sp. RHA1] >gi|123045480|sp|Q0S2M1|NRDI_RHOSR Protein nrdI >gi|110822931|gb|ABG98215.1| NrdI protein [Rhodococcus sp. RHA1] (158 aa)
Score = 356, Expect = 1.2e-32, Identities = 68/138 (49%), Positives = 93/138 (67%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGG---LGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           +VY+SS S NTHRF+ +L     R+PI  ++   E+ E        P++L+ PTY GG   +G+    VPKPV +FLNN  NR+  +AVIA+GNTNF ++YC AG+IISQK  +P+LY+FEL+GT  DVE V     EFW+
  S:     4 LVYFSSASENTHRFVQRLGLPATRIPIHDREGTFEVRE--------PYVLIVPTYGGGTTAMGRDTSYVPKPVIRFLNNTHNRSLIRAVIAAGNTNFGESYCFAGNIISQKCHVPYLYRFELMGTAEDVERVRAGLGEFWD 136
>gi|77961615|ref|ZP_00825448.1| COG1780: Protein involved in ribonucleotide reduction [Yersinia mollaretii ATCC 43969] (141 aa)
Score = 356, Expect = 1.2e-32, Identities = 73/141 (51%), Positives = 91/141 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S NTHRF+ KL    +R+PI    E           V  P+ILL P+Y GG     GAVP  V +FLN+P NR+  + VIA+GNTNF D YC+AG IISQK Q+P+LY+FELLGT  DV NV K   EFW++ N
  S:    11 LVYFSSSSENTHRFVGKLELPAIRIPIAGAREKLR--------VEQPYILLVPSYGGG--SPVGAVPTQVIRFLNDPHNRSLIRGVIAAGNTNFGDAYCLAGKIISQKCQVPYLYRFELLGTAEDVANVRKGVTEFWQRQN 141
>gi|154508380|ref|ZP_02044022.1| hypothetical protein ACTODO_00877 [Actinomyces odontolyticus ATCC 17982] >gi|153798014|gb|EDN80434.1| hypothetical protein ACTODO_00877 [Actinomyces odontolyticus ATCC 17982] (138 aa)
Score = 355, Expect = 1.9e-32, Identities = 71/139 (51%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS + NT RF+ KL     R+P+  KDEP  + +         ++L+ PTY GG   LKGAVPK V KFLN+P NR  C+ VI+SGNTNF   YCIAGDII+ KL +P +YKFELLGT  DV  V +   +FW+K
  S:     4 VVYFSSATGNTRRFVEKLGLPAARIPLLPKDEPLRVTDE--------YVLIVPTYGGG--NLKGAVPKQVIKFLNDPDNRALCRGVISSGNTNFGKAYCIAGDIIAAKLGVPHMYKFELLGTPEDVSRVREGLEQFWQK 132
>gi|123441279|ref|YP_001005266.1| ribonucleotide reductase stimulatory protein [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166233935|sp|A1JKB8|NRDI_YERE8 Protein nrdI >gi|122088240|emb|CAL11029.1| NrdI protein homologue [Yersinia enterocolitica subsp. enterocolitica 8081] (134 aa)
Score = 353, Expect = 2.6e-32, Identities = 73/141 (51%), Positives = 91/141 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S NTHRF+ KL    +R+PI    E           V  P+ILL P+Y GG     GAVP  V +FLN+P NR+  + VIA+GNTNF D YC+AG IISQK Q+P+LY+FELLGT  DV NV K   EFW++ N
  S:     4 LVYFSSSSQNTHRFVEKLELPAIRIPIAGTREKLR--------VEQPYILLVPSYGGG--SPVGAVPIQVIRFLNDPHNRSLIRGVIAAGNTNFGDAYCLAGKIISQKCQVPYLYRFELLGTAEDVVNVRKGVTEFWQRQN 134
>gi|108811299|ref|YP_647066.1| ribonucleotide reductase stimulatory protein [Yersinia pestis Nepal516] >gi|145598904|ref|YP_001162980.1| ribonucleotide reductase stimulatory protein [Yersinia pestis Pestoides F] >gi|108774947|gb|ABG17466.1| NrdI-like protein [Yersinia pestis Nepal516] >gi|145210600|gb|ABP40007.1| NrdI-like protein [Yersinia pestis Pestoides F] (160 aa)
Score = 353, Expect = 2.6e-32, Identities = 71/141 (50%), Positives = 90/141 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S N+HRF+ KL    +R+PI    E           V  P+ILL P+Y GG     GAVP  V +FLN+  NR+  + VIA+GNTNF D YC+AGDIIS K Q+P+LY+FELLGT  DV NV K   EFW++ N
  S:    30 LVYFSSSSENSHRFVEKLQLPAIRIPIAGAREKLR--------VEQPYILLVPSYGGG--SPVGAVPIQVIRFLNDVHNRSLIRGVIAAGNTNFGDAYCLAGDIISHKCQVPYLYRFELLGTAEDVANVRKGVTEFWQRQN 160
>gi|45442237|ref|NP_993776.1| ribonucleotide reductase stimulatory protein [Yersinia pestis biovar Microtus str. 91001] >gi|108808372|ref|YP_652288.1| ribonucleotide reductase stimulatory protein [Yersinia pestis Antiqua] >gi|45437101|gb|AAS62653.1| NrdI protein homologue [Yersinia pestis biovar Microtus str. 91001] >gi|108780285|gb|ABG14343.1| NrdI-like protein [Yersinia pestis Antiqua] (148 aa)
Score = 351, Expect = 4.3e-32, Identities = 71/141 (50%), Positives = 90/141 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S N+HRF+ KL    +R+PI    E           V  P+ILL P+Y GG     GAVP  V +FLN+  NR+  + VIA+GNTNF D YC+AGDIIS K Q+P+LY+FELLGT  DV NV K   EFW++ N
  S:    18 LVYFSSSSENSHRFVEKLQLPAIRIPIAGAREKLR--------VEQPYILLVPSYGGG--SPVGAVPIQVIRFLNDVHNRSLIRGVIAAGNTNFGDAYCLAGDIISHKCQVPYLYRFELLGTAEDVANVRKGVTEFWQRQN 148
>gi|71903001|ref|YP_279804.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS6180] >gi|123640414|sp|Q48V07|NRDI_STRPM Protein nrdI >gi|71802096|gb|AAX71449.1| hypothetical protein M28_Spy0335 [Streptococcus pyogenes MGAS6180] (162 aa)
Score = 351, Expect = 4.5e-32, Identities = 73/134 (54%), Positives = 93/134 (69%)
  Q:     6 FFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
             IVY+SSKSNNTHRF+ KL     R+P++ +  P E        V+  ++L+ PTYA G    KGAVPK V +FLNNP NR +CK VI+SGNTNF DT+ +AG IISQKLQ+P L++FELLGT +DV+ V  I
  S:     4 LIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNR--PLE--------VSTHYLLIVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKLQVPLLHQFELLGTATDVKKVQAI 127
>gi|19745564|ref|NP_606700.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS8232] >gi|21909838|ref|NP_664106.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS315] >gi|28896467|ref|NP_802817.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes SSI-1] >gi|50913719|ref|YP_059691.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS10394] >gi|94987982|ref|YP_596083.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS9429] >gi|94991864|ref|YP_599963.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS2096] >gi|139474321|ref|YP_001129037.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes str. Manfredo] >gi|166233930|sp|Q1JD89|NRDI_STRPB Protein nrdI >gi|166233931|sp|Q1JN60|NRDI_STRPC Protein nrdI >gi|166233934|sp|A2RG55|NRDI_STRPG Protein nrdI >gi|54037909|sp|P65551|NRDI_STRP8 Protein nrdI >gi|54041664|sp|P65550|NRDI_STRP3 Protein nrdI >gi|73921260|sp|Q5XDK5|NRDI_STRP6 Protein nrdI >gi|19747687|gb|AAL97199.1| putative ribonucleotide reductase [Streptococcus pyogenes MGAS8232] >gi|21904024|gb|AAM78909.1| putative ribonucleotide reductase [Streptococcus pyogenes MGAS315] >gi|28811718|dbj|BAC64650.1| putative ribonucleotide reductase (NrdI protein) [Streptococcus pyogenes SSI-1] >gi|50902793|gb|AAT86508.1| NrdI [Streptococcus pyogenes MGAS10394] >gi|94541490|gb|ABF31539.1| NrdI protein [Streptococcus pyogenes MGAS9429] >gi|94545372|gb|ABF35419.1| NrdI protein [Streptococcus pyogenes MGAS2096] >gi|134272568|emb|CAM30834.1| NrdI protein [Streptococcus pyogenes str. Manfredo] (162 aa)
Score = 351, Expect = 4.5e-32, Identities = 73/134 (54%), Positives = 93/134 (69%)
  Q:     6 FFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
             IVY+SSKSNNTHRF+ KL     R+P++ +  P E        V+  ++L+ PTYA G    KGAVPK V +FLNNP NR +CK VI+SGNTNF DT+ +AG IISQKLQ+P L++FELLGT +DV+ V  I
  S:     4 LIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNR--PLE--------VSTHYLLIVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKLQVPLLHQFELLGTATDVKKVQAI 127
>gi|77973118|ref|ZP_00828670.1| COG1780: Protein involved in ribonucleotide reduction [Yersinia frederiksenii ATCC 33641] (141 aa)
Score = 351, Expect = 4.9e-32, Identities = 71/139 (51%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+ +L    +R+PI    E   I          P+ILL P+Y GG     GAVP  V +FLN+P NR+  + VIA+GNTNF D YC+AG IISQK Q+P+LY+FELLGT  DV NV K   EFW++
  S:    11 LVYFSSSSENTHRFVGRLELPAIRIPIAGAREKLRI--------EQPYILLVPSYGGG--SPVGAVPIQVIRFLNDPHNRSLIRGVIAAGNTNFGDAYCLAGKIISQKCQVPYLYRFELLGTAEDVANVRKGVTEFWQR 139
>gi|56807593|ref|ZP_00365502.1| COG1780: Protein involved in ribonucleotide reduction [Streptococcus pyogenes M49 591] (162 aa)
Score = 351, Expect = 5.1e-32, Identities = 73/134 (54%), Positives = 93/134 (69%)
  Q:     6 FFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
             IVY+SSKSNNTHRF+ KL     R+P++ +  P E        V+  ++L+ PTYA G    KGAVPK V +FLNNP NR +CK VI+SGNTNF DT+ +AG IISQKLQ+P L++FELLGT +DV+ V  I
  S:     4 LIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNR--PLE--------VSTHYLLIVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKLQVPLLHQFELLGTATDVKKVQAI 127
>gi|116253997|ref|YP_769835.1| ribonucleotide reductase stimulatory protein [Rhizobium leguminosarum bv. viciae 3841] >gi|166233928|sp|Q1MBD4|NRDI_RHIL3 Protein nrdI >gi|115258645|emb|CAK09749.1| putative ribonucleotide reductase protein [Rhizobium leguminosarum bv. viciae 3841] (135 aa)
Score = 350, Expect = 6.5e-32, Identities = 69/143 (48%), Positives = 92/143 (64%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
            IVYYSS+S NTHRF+ KL  +  R+P         I E        PF+L+ PTY+G  GK  GAVPK V +FLN+  NR + + VIA+GN+NF +TY +AGD++SQK Q+P+LY+FELLGT +DV NV      FW + + 
  S:     3 LIVYYSSRSENTHRFVAKLGLRAARIPPSGAAGAFHIRE--------PFVLIVPTYSGDGGK--GAVPKQVIRFLNDAENRGHIRGVIAAGNSNFGETYGLAGDVVSQKCQVPYLYRFELLGTEADVANVKHGMERFWTREHL 135
>gi|94993746|ref|YP_601844.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS10750] >gi|166233933|sp|Q1J861|NRDI_STRPF Protein nrdI >gi|94547254|gb|ABF37300.1| NrdI protein [Streptococcus pyogenes MGAS10750] (144 aa)
Score = 349, Expect = 7.7e-32, Identities = 73/134 (54%), Positives = 93/134 (69%)
  Q:     6 FFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
             IVY+SSKSNNTHRF+ KL     R+P++ +  P E        V+  ++L+ PTYA G    KGAVPK V +FLNNP NR +CK VI+SGNTNF DT+ +AG IISQKLQ+P L++FELLGT +DV+ V  I
  S:     4 LIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNR--PLE--------VSTHYLLIVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKLQVPLLHQFELLGTATDVKKVQAI 127
>gi|162419879|ref|YP_001607867.1| ribonucleotide reductase stimulatory protein [Yersinia pestis Angola] >gi|165925286|ref|ZP_02221118.1| nrdI protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939929|ref|ZP_02228467.1| nrdI protein [Yersinia pestis biovar Orientalis str. IP275] >gi|166008601|ref|ZP_02229499.1| nrdI protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212524|ref|ZP_02238559.1| nrdI protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399304|ref|ZP_02304828.1| nrdI protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421329|ref|ZP_02313082.1| nrdI protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423334|ref|ZP_02315087.1| nrdI protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|162352694|gb|ABX86642.1| nrdI protein [Yersinia pestis Angola] >gi|165912148|gb|EDR30787.1| nrdI protein [Yersinia pestis biovar Orientalis str. IP275] >gi|165922893|gb|EDR40044.1| nrdI protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992983|gb|EDR45284.1| nrdI protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206455|gb|EDR50935.1| nrdI protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960818|gb|EDR56839.1| nrdI protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051808|gb|EDR63216.1| nrdI protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057504|gb|EDR67250.1| nrdI protein [Yersinia pestis biovar Mediaevalis str. K1973002] (141 aa)
Score = 349, Expect = 8.3e-32, Identities = 71/141 (50%), Positives = 90/141 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S N+HRF+ KL    +R+PI    E           V  P+ILL P+Y GG     GAVP  V +FLN+  NR+  + VIA+GNTNF D YC+AGDIIS K Q+P+LY+FELLGT  DV NV K   EFW++ N
  S:    11 LVYFSSSSENSHRFVEKLQLPAIRIPIAGAREKLR--------VEQPYILLVPSYGGG--SPVGAVPIQVIRFLNDVHNRSLIRGVIAAGNTNFGDAYCLAGDIISHKCQVPYLYRFELLGTAEDVANVRKGVTEFWQRQN 141
>gi|161508076|ref|YP_001578043.1| hypothetical protein lhv_1899 [Lactobacillus helveticus DPC 4571] >gi|160349065|gb|ABX27739.1| hypothetical protein lhv_1899 [Lactobacillus helveticus DPC 4571] (141 aa)
Score = 348, Expect = 9.9e-32, Identities = 76/146 (52%), Positives = 99/146 (67%)
  Q:     3 NKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +K+  +VYYSS SNNT RF+ KL+C  +R+PI+          SK  +V+  +IL+TPTY+GG G   GAVPK V  FLN   NR  C  VIASGNTNF +++ +AGD+IS+KL +P+LYKFELLGT  DV NV KI  +  E N+
  S:     6 SKKPLVVYYSSTSNNTARFVEKLDCNSIRIPIKL---------SKEISVSEEYILITPTYSGGHGT-TGAVPKQVIHFLNKLANRQKCIGVIASGNTNFGNSFALAGDVISKKLHVPYLYKFELLGTTEDVNNVNKIIADAGEDND 141
>gi|16122859|ref|NP_406172.1| ribonucleotide reductase stimulatory protein [Yersinia pestis CO92] >gi|51597271|ref|YP_071462.1| ribonucleotide reductase stimulatory protein [Yersinia pseudotuberculosis IP 32953] >gi|149365455|ref|ZP_01887490.1| protein that stimulates ribonucleotide reduction [Yersinia pestis CA88-4125] >gi|153949694|ref|YP_001400045.1| ribonucleotide reductase stimulatory protein [Yersinia pseudotuberculosis IP 31758] >gi|167468722|ref|ZP_02333426.1| ribonucleotide reductase stimulatory protein [Yersinia pestis FV-1] >gi|170023364|ref|YP_001719869.1| NrdI protein [Yersinia pseudotuberculosis YPIII] >gi|186896375|ref|YP_001873487.1| NrdI protein [Yersinia pseudotuberculosis PB1/+] >gi|167016347|sp|A7FFL7|NRDI_YERP3 Protein nrdI >gi|20177998|sp|Q8ZDC6|NRDI_YERPE Protein nrdI >gi|73921261|sp|Q667N6|NRDI_YERPS Protein nrdI >gi|51590553|emb|CAH22194.1| NrdI protein homologue [Yersinia pseudotuberculosis IP 32953] >gi|115348338|emb|CAL21271.1| NrdI protein homologue [Yersinia pestis CO92] >gi|149291868|gb|EDM41942.1| protein that stimulates ribonucleotide reduction [Yersinia pestis CA88-4125] >gi|152961189|gb|ABS48650.1| nrdI protein [Yersinia pseudotuberculosis IP 31758] >gi|169749898|gb|ACA67416.1| NrdI protein [Yersinia pseudotuberculosis YPIII] >gi|186699401|gb|ACC90030.1| NrdI protein [Yersinia pseudotuberculosis PB1/+] (134 aa)
Score = 348, Expect = 1.0e-31, Identities = 71/141 (50%), Positives = 90/141 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S N+HRF+ KL    +R+PI    E           V  P+ILL P+Y GG     GAVP  V +FLN+  NR+  + VIA+GNTNF D YC+AGDIIS K Q+P+LY+FELLGT  DV NV K   EFW++ N
  S:     4 LVYFSSSSENSHRFVEKLQLPAIRIPIAGAREKLR--------VEQPYILLVPSYGGG--SPVGAVPIQVIRFLNDVHNRSLIRGVIAAGNTNFGDAYCLAGDIISHKCQVPYLYRFELLGTAEDVANVRKGVTEFWQRQN 134
>gi|167362065|ref|ZP_02296617.1| NrdI protein [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167071098|gb|EDR75022.1| NrdI protein [Rhizobium leguminosarum bv. trifolii WSM1325] (137 aa)
Score = 347, Expect = 1.3e-31, Identities = 68/140 (48%), Positives = 91/140 (65%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVYYSS+S NTHRF+ KL  +  R+P    D            +  PF+L+ PTY+G  GK  GAVPK V +FLN+  NR + + VIA+GN+NF +TY +AGD+IS+K Q+P+LY+FELLGT +DV NV      FW +
  S:     3 LIVYYSSRSENTHRFVAKLGLRAARIPPNGADAFH---------IREPFVLIVPTYSGDGGK--GAVPKQVIRFLNDTENRGHIRGVIAAGNSNFGETYGLAGDVISKKCQVPYLYRFELLGTEADVANVKHGMERFWTR 131
>gi|94989856|ref|YP_597956.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS10270] >gi|166233932|sp|Q1JIB1|NRDI_STRPD Protein nrdI >gi|94543364|gb|ABF33412.1| NrdI protein [Streptococcus pyogenes MGAS10270] (162 aa)
Score = 347, Expect = 1.4e-31, Identities = 72/134 (53%), Positives = 93/134 (69%)
  Q:     6 FFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
             IVY+SSKSNNTHRF+ KL     R+P++ +  P E        V+  ++L+ PTYA G    KGAVPK V +FLNNP NR +CK VI+SGNTNF DT+ +AG IIS+KLQ+P L++FELLGT +DV+ V  I
  S:     4 LIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNR--PLE--------VSTHYLLIVPTYAAGGSDAKGAVPKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISRKLQVPLLHQFELLGTATDVKKVQAI 127
>gi|12045085|ref|NP_072896.1| ribonucleotide reductase stimulatory protein [Mycoplasma genitalium G37] >gi|1351518|sp|P47472|NRDI_MYCGE Protein nrdI >gi|3844833|gb|AAC71451.1| nrdI protein [Mycoplasma genitalium G37] >gi|166078694|gb|ABY79312.1| nrdI protein [synthetic Mycoplasma genitalium JCVI-1.0] (153 aa)
Score = 347, Expect = 1.5e-31, Identities = 74/142 (52%), Positives = 102/142 (71%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           FIVY+SS SNNTHRF+ KL  +  R+P++       I +S   TV++ ++L+ PTY+GG  +++GAVPK V +FLNN  NR  C+ VIASGNTNF DT+C+AG +IS+KL +P LY+FELLGT +DVE   KI   F++ +N
  S:    21 FIVYFSSISNNTHRFIEKLGFQHKRIPVD-------ITQSI--TVSNEYVLICPTYSGGGNQVEGAVPKQVIQFLNNKHNRELCRGVIASGNTNFGDTFCLAGTVISKKLNVPLLYQFELLGTKNDVEQTQKIIANFFQNSN 153
>gi|77957734|ref|ZP_00821782.1| COG1780: Protein involved in ribonucleotide reduction [Yersinia bercovieri ATCC 43970] (141 aa)
Score = 346, Expect = 1.7e-31, Identities = 72/141 (51%), Positives = 91/141 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S NTHRF+ KL    +R+PI            K+  V  P+ILL P+Y GG     G VP  V +FLN+P NR+  + VIA+GNTNF D YC+AG IISQK Q+P+LY+FELLGT  DV NV K   EFW++ N
  S:    11 LVYFSSSSQNTHRFIGKLELPAIRIPIAGA-------RGKL-RVEQPYILLVPSYGGG--SPVGTVPIQVIRFLNDPHNRSLIRGVIAAGNTNFGDAYCLAGKIISQKCQVPYLYRFELLGTAEDVANVRKGVTEFWQRQN 141
>gi|17989276|ref|NP_541909.1| ribonucleotide reductase stimulatory protein [Brucella melitensis 16M] >gi|23500070|ref|NP_699510.1| ribonucleotide reductase stimulatory protein [Brucella suis 1330] >gi|62317765|ref|YP_223618.1| ribonucleotide reductase stimulatory protein [Brucella abortus bv. 1 str. 9-941] >gi|83269751|ref|YP_419042.1| ribonucleotide reductase stimulatory protein [Brucella melitensis biovar Abortus 2308] >gi|148558734|ref|YP_001257346.1| ribonucleotide reductase stimulatory protein [Brucella ovis ATCC 25840] >gi|161620388|ref|YP_001594274.1| ribonucleotide reductase stimulatory protein [Brucella canis ATCC 23365] >gi|163844496|ref|YP_001622151.1| ribonucleotide reductase stimulatory protein [Brucella suis ATCC 23445] >gi|189023017|ref|YP_001932758.1| NrdI protein [Brucella abortus S19] >gi|123545748|sp|Q2YJZ2|NRDI_BRUA2 Protein nrdI >gi|166233914|sp|A5VU41|NRDI_BRUO2 Protein nrdI >gi|189030483|sp|A9ME65|NRDI_BRUC2 Protein nrdI >gi|189030484|sp|A9WY13|NRDI_BRUSI Protein nrdI >gi|54037907|sp|P65547|NRDI_BRUSU Protein nrdI >gi|54041662|sp|P65546|NRDI_BRUME Protein nrdI >gi|73921254|sp|Q577C7|NRDI_BRUAB Protein nrdI >gi|17985139|gb|AAL54173.1| NRDI PROTEIN [Brucella melitensis 16M] >gi|23463661|gb|AAN33515.1| nrdI protein [Brucella suis 1330] >gi|62197958|gb|AAX76257.1| NrdI [Brucella abortus biovar 1 str. 9-941] >gi|82940025|emb|CAJ13056.1| NrdI protein [Brucella melitensis biovar Abortus 2308] >gi|148370019|gb|ABQ62891.1| NrdI protein [Brucella ovis ATCC 25840] >gi|161337199|gb|ABX63503.1| nrdI protein [Brucella canis ATCC 23365] >gi|163675219|gb|ABY39329.1| nrdI protein [Brucella suis ATCC 23445] >gi|189021591|gb|ACD74312.1| NrdI protein [Brucella abortus S19] (135 aa)
Score = 345, Expect = 2.2e-31, Identities = 68/140 (48%), Positives = 90/140 (64%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVY+SS+S NTHRF+ +L  +  R+P+E          S    V  PF+L+TPTY GG    KGAVP PV +FLN+  NR   + VIA+GN+NF + +CIAG+IIS K  +P+LY+FELLGT  DV NV     +FW +
  S:     3 LIVYFSSRSGNTHRFVERLGVRSSRIPLEA---------SGALQVREPFVLVTPTYGGG--STKGAVPNPVIRFLNDADNRALIRGVIAAGNSNFGEAFCIAGNIISAKCGVPYLYRFELLGTAEDVGNVRNGMEQFWTR 131
>gi|50365346|ref|YP_053771.1| ribonucleotide reductase stimulatory protein [Mesoplasma florum L1] >gi|81391758|sp|Q6F0T6|NRDI_MESFL Protein nrdI >gi|50363902|gb|AAT75887.1| ribonucleotide reductase [Mesoplasma florum L1] (151 aa)
Score = 344, Expect = 3.4e-31, Identities = 73/139 (52%), Positives = 97/139 (69%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS SNNTHRF+ KL+ K  R+P E ++E +         V+  ++L+TPTY+GG     GAVPK V KFLN   NRN C+ VIASGNTNF +T+ +AG I+S+KL +P LY+FELLGT +DVE + +I  EFW K
  S:    22 VVYFSSISNNTHRFIQKLSVKNSRIPYELEEEIN---------VDSDYVLITPTYSGGGEFTSGAVPKQVIKFLNKENNRNYCRGVIASGNTNFGNTFAMAGPILSKKLNVPLLYQFELLGTQNDVEKINEILKEFWGK 151
>gi|15674553|ref|NP_268727.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes M1 GAS] >gi|71910161|ref|YP_281711.1| ribonucleotide reductase stimulatory protein [Streptococcus pyogenes MGAS5005] >gi|20178008|sp|Q9A176|NRDI_STRP1 Protein nrdI >gi|13621659|gb|AAK33448.1| putative ribonucleotide reductase (NrdI protein) [Streptococcus pyogenes M1 GAS] >gi|71852943|gb|AAZ50966.1| hypothetical protein M5005_Spy0348 [Streptococcus pyogenes MGAS5005] (162 aa)
Score = 343, Expect = 3.7e-31, Identities = 72/134 (53%), Positives = 92/134 (68%)
  Q:     6 FFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
             IVY+SSKSNNTHRF+ KL     R+P++ +  P E        V+  ++L+ PTYA G    KGAV K V +FLNNP NR +CK VI+SGNTNF DT+ +AG IISQKLQ+P L++FELLGT +DV+ V  I
  S:     4 LIIVYFSSKSNNTHRFVQKLGLPAQRIPVDNR--PLE--------VSTHYLLIVPTYAAGGSDAKGAVSKQVIRFLNNPNNRKHCKGVISSGNTNFGDTFALAGPIISQKLQVPLLHQFELLGTATDVKKVQAI 127
>gi|77977848|ref|ZP_00833287.1| COG1780: Protein involved in ribonucleotide reduction [Yersinia intermedia ATCC 29909] (134 aa)
Score = 343, Expect = 4.5e-31, Identities = 71/141 (50%), Positives = 91/141 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S NTHRF+ KL    +R+PI            K+  +  P+ILL P+Y GG     GAVP  V +FLN+P NR+  + VIA+GNTNF D YC+AG IISQK Q+P+LY+FELLGT  DV NV     EFW++ N
  S:     4 LVYFSSSSENTHRFVKKLALPAIRIPIAGA-------RGKL-QLEQPYILLVPSYGGG--SPIGAVPIQVIRFLNDPHNRSLIRGVIAAGNTNFGDAYCLAGKIISQKCQVPYLYRFELLGTAEDVANVRMGVTEFWQRQN 134
>gi|86359307|ref|YP_471199.1| ribonucleotide reductase stimulatory protein [Rhizobium etli CFN 42] >gi|123510684|sp|Q2K3W4|NRDI_RHIEC Protein nrdI >gi|86283409|gb|ABC92472.1| ribonucleotide reductase protein [Rhizobium etli CFN 42] (134 aa)
Score = 343, Expect = 4.7e-31, Identities = 66/143 (46%), Positives = 90/143 (62%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
            IVYYSS+S NTHRF+ +L  +  R+P    D            +  PF+L+ PTY+GG GK  GAVPK V +FLN+  NR + + VIA+GN+NF +TY +AGD+IS+K Q+P+LY+FEL+GT  DV  V      FW +   
  S:     3 LIVYYSSRSENTHRFVARLGLRAARIPASGADAFH---------IREPFVLVVPTYSGGDGK--GAVPKQVIRFLNDAENRGHIRGVIAAGNSNFGETYGLAGDVISRKCQVPYLYRFELIGTAEDVAKVKHGLERFWTRQQL 134
>gi|169196017|ref|ZP_02855389.1| NrdI protein [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169092609|gb|EDS71318.1| NrdI protein [Rhizobium leguminosarum bv. trifolii WSM2304] (134 aa)
Score = 341, Expect = 6.4e-31, Identities = 66/143 (46%), Positives = 90/143 (62%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
            IVYYSS+S NTHRF+ +L  +  R+P    D            +  PF+L+ PTY+ G GK  GAVPK V +FLN+  NR + + VIA+GN+NF +TY +AGD+ISQK ++P+LY+FEL+GT  DV NV      FW +   
  S:     3 LIVYYSSRSENTHRFVARLGLRAARIPAGGADAFH---------IREPFVLVVPTYSDGDGK--GAVPKQVIRFLNDAENRGHIRGVIAAGNSNFGETYGLAGDVISQKCRVPYLYRFELIGTEEDVANVKHGMERFWTREQL 134
>gi|153010276|ref|YP_001371490.1| ribonucleotide reductase stimulatory protein [Ochrobactrum anthropi ATCC 49188] >gi|166233926|sp|A6X357|NRDI_OCHA4 Protein nrdI >gi|151562164|gb|ABS15661.1| NrdI protein [Ochrobactrum anthropi ATCC 49188] (135 aa)
Score = 339, Expect = 1.1e-30, Identities = 67/140 (47%), Positives = 93/140 (66%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVY+SS+S NTHRF+ +L  +  R+P++          S    V  PF+++TPTY GG  K  GAVPKPV +FLN+  NR+  + VIA+GN+NF + +CIAG+IIS K Q+P+LY+FELLGT+ D+ NV      FW +
  S:     3 LIVYFSSRSENTHRFVERLGMRSNRIPMDG---------SGGLQVREPFVIVTPTYGGGGSK--GAVPKPVIRFLNDESNRSFIRGVIAAGNSNFGEAFCIAGNIISAKCQVPYLYRFELLGTDEDIGNVKNGMERFWTR 131
>gi|76787554|ref|YP_329137.1| ribonucleotide reductase stimulatory protein [Streptococcus agalactiae A909] >gi|77406066|ref|ZP_00783142.1| nrdI protein [Streptococcus agalactiae H36B] >gi|76562611|gb|ABA45195.1| nrdI protein [Streptococcus agalactiae A909] >gi|77175346|gb|EAO78139.1| nrdI protein [Streptococcus agalactiae H36B] (137 aa)
Score = 339, Expect = 1.2e-30, Identities = 72/140 (51%), Positives = 92/140 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKN 147
           +VY+SSKSNNTHRF+ KL C   R+P     +   IL      V   +IL+ PTYAGG    KGAVPK V +FLN   NR +C+ VI+SGNTNF DTY IAG II++KL +P L++FELLGT  DV  V ++  +F  K+
  S:     7 VVYFSSKSNNTHRFVQKLGCSNQRIP----SDGSSIL------VTEDYILIVPTYAGGGDDTKGAVPKQVVQFLNVRQNREHCQGVISSGNTNFGDTYAIAGPIIARKLNVPLLHQFELLGTQEDVTRVKELLCQFTRKD 136
>gi|16761588|ref|NP_457205.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143068|ref|NP_806410.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|20177997|sp|Q8Z4E6|NRDI_SALTI Protein nrdI >gi|25306986|pir||AF0841 NrdI protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16503889|emb|CAD05917.1| NrdI protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138701|gb|AAO70270.1| NrdI protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (136 aa)
Score = 339, Expect = 1.3e-30, Identities = 63/140 (45%), Positives = 92/140 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKN 147
           +VY+SS S NTHRFM +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV K  NEFW+++
  S:     4 LVYFSSSSENTHRFMQRLGLPATRIPLNERERIQ---------VDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDNVRKGVNEFWQQS 132
>gi|161615701|ref|YP_001589666.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|168228480|ref|ZP_02653711.1| hypothetical protein Sententeric_22094 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168238721|ref|ZP_02663779.1| hypothetical protein Senteenterica_21238 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168244603|ref|ZP_02669535.1| hypothetical protein Senterienterica_23390 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168464074|ref|ZP_02697991.1| NrdI protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|194447727|ref|YP_002046769.1| NrdI protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194738058|ref|YP_002115762.1| NrdI protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189030488|sp|A9N099|NRDI_SALPB Protein nrdI >gi|161365065|gb|ABX68833.1| hypothetical protein SPAB_03486 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194406031|gb|ACF66250.1| NrdI protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194713560|gb|ACF92781.1| NrdI protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195633678|gb|EDX52092.1| NrdI protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] (136 aa)
Score = 338, Expect = 1.5e-30, Identities = 63/139 (45%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRFM +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV K  NEFW++
  S:     4 LVYFSSSSENTHRFMQRLGLPATRIPLNERERIQ---------VDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDNVRKGVNEFWQQ 131
>gi|16766117|ref|NP_461732.1| ribonucleotide reductase stimulatory protein [Salmonella typhimurium LT2] >gi|62181310|ref|YP_217727.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167552695|ref|ZP_02346447.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167992527|ref|ZP_02573625.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168219122|ref|ZP_02644354.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168822879|ref|ZP_02834879.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|2498674|sp|Q56109|NRDI_SALTY Protein nrdI >gi|73921256|sp|Q57KW6|NRDI_SALCH Protein nrdI >gi|1050838|emb|CAA51698.1| nrdI [Salmonella typhimurium] >gi|16421355|gb|AAL21691.1| stimulates ribonucleotide reduction [Salmonella typhimurium LT2] >gi|62128943|gb|AAX66646.1| stimulates ribonucleotide reduction [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (136 aa)
Score = 338, Expect = 1.5e-30, Identities = 63/139 (45%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRFM +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV K  NEFW++
  S:     4 LVYFSSSSENTHRFMQRLGLPATRIPLNERERIQ---------VDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDNVRKGVNEFWQQ 131
>gi|22536602|ref|NP_687453.1| ribonucleotide reductase stimulatory protein [Streptococcus agalactiae 2603V/R] >gi|76798644|ref|ZP_00780870.1| nrdI protein [Streptococcus agalactiae 18RS21] >gi|77407671|ref|ZP_00784426.1| nrdI protein [Streptococcus agalactiae COH1] >gi|77414139|ref|ZP_00790305.1| nrdI protein [Streptococcus agalactiae 515] >gi|22533439|gb|AAM99325.1|AE014211_2 nrdI protein [Streptococcus agalactiae 2603V/R] >gi|76586009|gb|EAO62541.1| nrdI protein [Streptococcus agalactiae 18RS21] >gi|77159809|gb|EAO70954.1| nrdI protein [Streptococcus agalactiae 515] >gi|77173670|gb|EAO76784.1| nrdI protein [Streptococcus agalactiae COH1] (137 aa)
Score = 338, Expect = 1.7e-30, Identities = 72/140 (51%), Positives = 92/140 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKN 147
           +VY+SSKSNNTHRF+ KL C   R+P     +   IL      V   +IL+ PTYAGG    KGAVPK V +FLN   NR +C+ VI+SGNTNF DTY IAG II++KL +P L++FELLGT  DV  V ++  +F  K+
  S:     7 VVYFSSKSNNTHRFVQKLACSNQRIP----SDGSSIL------VTEDYILIVPTYAGGGDDTKGAVPKQVVQFLNVRQNREHCQGVISSGNTNFGDTYAIAGPIIARKLNVPLLHQFELLGTQEDVTRVKELLCQFTRKD 136
>gi|168262086|ref|ZP_02684059.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|194445189|ref|YP_002042051.1| NrdI protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194403852|gb|ACF64074.1| NrdI protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] (136 aa)
Score = 337, Expect = 1.9e-30, Identities = 63/139 (45%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRFM +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV K  NEFW++
  S:     4 LVYFSSSSENTHRFMQRLGLPATRIPLNERERI---------RVDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDNVRKGVNEFWQQ 131
>gi|167544313|ref|ZP_02339884.1| hypothetical protein Sentent_13613 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167558098|ref|ZP_02351108.1| hypothetical protein Sententeri_14808 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (136 aa)
Score = 337, Expect = 1.9e-30, Identities = 63/139 (45%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRFM +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV K  NEFW++
  S:     4 LVYFSSSSENTHRFMQRLGLPATRIPLNERERI---------RVDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDNVRKGVNEFWQQ 131
>gi|146312795|ref|YP_001177869.1| ribonucleotide reductase stimulatory protein [Enterobacter sp. 638] >gi|167016345|sp|A4WDN8|NRDI_ENT38 Protein nrdI >gi|145319671|gb|ABP61818.1| NrdI protein [Enterobacter sp. 638] (136 aa)
Score = 337, Expect = 2.1e-30, Identities = 64/139 (46%), Positives = 92/139 (66%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NT RF+ ++    +R+P+ +++            V+ P+IL+ P+Y GG     GAVP+ V +FLN+P NR   + VIA+GN NF D +C AGD+ISQK  +P+LY+FEL+GT  DVENV K  NEFW++
  S:     4 LVYFSSSSENTLRFIERVGLPAVRIPLNERERIQ---------VDEPYILVVPSYGGG--GTAGAVPRQVIRFLNDPHNRALIRGVIAAGNRNFGDAFCRAGDLISQKCGVPYLYRFELMGTQQDVENVRKGVNEFWQR 131
>gi|54026279|ref|YP_120521.1| ribonucleotide reductase stimulatory protein [Nocardia farcinica IFM 10152] >gi|54017787|dbj|BAD59157.1| hypothetical protein [Nocardia farcinica IFM 10152] (169 aa)
Score = 336, Expect = 2.4e-30, Identities = 67/139 (48%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGA------VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+ KL     R+P+   D            V  P++L+ PTY GG   L GA      VP+ V KFLN+P NR+  + VIA+GNTNF DTYC AG++IS+K  +P+LY+FEL+GT  DVE V +    FW++
  S:    23 LVYFSSASENTHRFVEKLGLPATRIPLHTADSL---------RVGEPYVLIVPTYGGGRHVLGGARSDKEFVPRQVAKFLNDPHNRSLLRGVIAAGNTNFGDTYCYAGEVISRKCGVPYLYRFELMGTAQDVERVREGLGLFWQQ 158
>gi|190893563|ref|YP_001980105.1| ribonucleotide reductase protein [Rhizobium etli CIAT 652] >gi|190698842|gb|ACE92927.1| ribonucleotide reductase protein [Rhizobium etli CIAT 652] (134 aa)
Score = 336, Expect = 2.5e-30, Identities = 65/143 (45%), Positives = 89/143 (62%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
            IVYYSS+S NTHRF+ +L  +  R+P    D            +  PF+L+ PTY+ G GK  GAVPK V + LN+  NR + + VIA+GN+NF +TY +AGD+IS+K Q+P+LY+FEL+GT  DV NV      FW +   
  S:     3 LIVYYSSRSENTHRFVARLGLRAARIPASGADAFH---------IREPFVLVVPTYSSGDGK--GAVPKQVIRCLNDAENRKHIRGVIAAGNSNFGETYGLAGDVISRKCQVPYLYRFELMGTEEDVANVKHGMERFWTREQL 134
>gi|168476631|ref|ZP_02705654.1| hypothetical protein Salmoentericaenterica_18411 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (136 aa)
Score = 336, Expect = 2.7e-30, Identities = 62/139 (44%), Positives = 92/139 (66%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS+S NTHRF+ +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV K  NEFW++
  S:     4 LVYFSSRSENTHRFIQRLGLPATRIPLNERERIQ---------VDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDNVRKGVNEFWQQ 131
>gi|194681802|emb|CAR41041.1| NrdI protein [Proteus mirabilis HI4320] (134 aa)
Score = 336, Expect = 2.7e-30, Identities = 70/137 (51%), Positives = 90/137 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           ++Y+SS+S N HRF+ KLN +  R+   ++DEP +           PF+LL PTY GG   +KGAVPK V +FLN P NR   + VIASGNTNF   Y +AGDII+QK Q+PFLY+FELLGT  DV+ V    + FW
  S:     7 LIYFSSRSENCHRFVQKLNLQATRI---KEDEPLQ--------ATQPFVLLCPTYGGG--GVKGAVPKAVIQFLNIPENRQLIRGVIASGNTNFGSAYGLAGDIIAQKCQVPFLYRFELLGTPEDVKRVKTGLSTFW 130
>gi|15829011|ref|NP_326371.1| ribonucleotide reductase stimulatory protein [Mycoplasma pulmonis UAB CTIP] >gi|20178005|sp|Q98Q29|NRDI_MYCPU Protein nrdI >gi|14089955|emb|CAC13713.1| RIBONUCLEOPROTEIN NRDI [Mycoplasma pulmonis] (151 aa)
Score = 335, Expect = 3.2e-30, Identities = 71/141 (50%), Positives = 97/141 (68%)
  Q:     5 RFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           + F+VY+SS SNNTHRF+ KLN + LR+P+  ++            V+  +++  PTY+GG    +GAVPK V KFLNN  NR+ C+ VIASGNTNF +T+ IAG I+S+KL +P LY+FELLGT+ DV+NV  I   FW+
  S:    19 QVFVVYFSSISNNTHRFIQKLNYENLRIPVNMEESV---------FVDKDYVIFVPTYSGGGEFTQGAVPKQVIKFLNNEKNRSFCRGVIASGNTNFGNTFAIAGPILSKKLNVPLLYQFELLGTSEDVKNVQNILETFWK 150
>gi|56414765|ref|YP_151840.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|73921257|sp|Q5PF04|NRDI_SALPA Protein nrdI >gi|56129022|gb|AAV78528.1| NrdI protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (136 aa)
Score = 335, Expect = 3.6e-30, Identities = 62/139 (44%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRFM +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV +  NEFW++
  S:     4 LVYFSSSSENTHRFMQRLGLPATRIPLNERERI---------RVDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKYGVPWLYRFELMGTQRDIDNVRRGVNEFWQQ 131
>gi|188533086|ref|YP_001906883.1| Protein NrdI [Erwinia tasmaniensis] >gi|188028128|emb|CAO95985.1| Protein NrdI [Erwinia tasmaniensis] (136 aa)
Score = 335, Expect = 3.9e-30, Identities = 62/139 (44%), Positives = 93/139 (66%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+++LN    R+P++          S+   V+ P+IL+ P+Y GG     GAVPK V +FLN+  NR   + VIA+GN NF + +C+AGDII++K  +P+LY+FEL+GT+ D+ N+ K   EFW++
  S:     4 LVYFSSLSENTHRFIVRLNLPARRIPLDS---------SQQLQVSEPYILVVPSYGGG--TRHGAVPKQVIQFLNDINNRQLIRGVIAAGNRNFGEAFCLAGDIIARKCHVPYLYRFELMGTSDDIANIYKGVTEFWQR 131
>gi|163842200|ref|YP_001626605.1| NrdI [Renibacterium salmoninarum ATCC 33209] >gi|162955676|gb|ABY25191.1| NrdI [Renibacterium salmoninarum ATCC 33209] (146 aa)
Score = 334, Expect = 4.1e-30, Identities = 66/139 (47%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           ++Y+SS S NTHRF+ KL+    RLP++ +DE  +  E        PF+L+ PTY G  G   GAVPK V KFLN   NR+  + VIA+GNTNF +TYC+AGDII+ K ++P LY+FEL+GT  DV+   +   +FW +
  S:    13 VIYFSSVSGNTHRFVDKLDVGAARLPVKTQDETLKATE--------PFVLVLPTYGGETGH--GAVPKQVIKFLNVAENRSLIRGVIAAGNTNFGETYCLAGDIIATKCKVPLLYQFELMGTPEDVDRFHQGLEQFWTR 141
>gi|168233767|ref|ZP_02658825.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194470351|ref|ZP_03076335.1| NrdI protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194456715|gb|EDX45554.1| NrdI protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (136 aa)
Score = 333, Expect = 5.3e-30, Identities = 62/139 (44%), Positives = 91/139 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+ +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D++NV K  NEFW++
  S:     4 LVYFSSSSENTHRFIQRLGLPATRIPLNERERIQ---------VDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDNVRKGVNEFWQQ 131
>gi|157371957|ref|YP_001479946.1| ribonucleotide reductase stimulatory protein [Serratia proteamaculans 568] >gi|167016346|sp|A8GI78|NRDI_SERP5 Protein nrdI >gi|157323721|gb|ABV42818.1| NrdI protein [Serratia proteamaculans 568] (134 aa)
Score = 333, Expect = 6.7e-30, Identities = 69/141 (48%), Positives = 91/141 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +VY+SS S NTHRF+ KL+   +R+PI           SK+  +  P+IL+ P+Y GG     GAVP  V +FLN+P NR   + VIA+GNTNF   Y IAGDII++K Q+PFLY+FELLGT  DV NV +    FW++ N
  S:     4 LVYFSSSSENTHRFVEKLSLPAMRIPIAGA-------RSKL-LMETPYILIVPSYGGG--SAVGAVPIQVIRFLNDPQNRAFLRGVIAAGNTNFGAAYGIAGDIIAKKCQVPFLYRFELLGTTQDVANVRQGVTAFWQRQN 134
>gi|157148212|ref|YP_001455531.1| ribonucleotide reductase stimulatory protein [Citrobacter koseri ATCC BAA-895] >gi|166233915|sp|A8ANN2|NRDI_CITK8 Protein nrdI >gi|157085417|gb|ABV15095.1| hypothetical protein CKO_04023 [Citrobacter koseri ATCC BAA-895] (136 aa)
Score = 331, Expect = 1.1e-29, Identities = 63/139 (45%), Positives = 92/139 (66%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRFM +L    +R+P+ +++            V+ P+IL+ P+Y GG     GAVP+ V +FLN+  NR   + VIASGN NF + Y  AG++ISQK  +P+LY+FEL+GT SD++NV K  +EFW++
  S:     4 LVYFSSSSENTHRFMQRLGLPAIRIPLNERERI---------RVDEPYILVVPSYGGG--GTAGAVPRQVIRFLNDEHNRALIRGVIASGNRNFGEAYGRAGEVISQKCGVPWLYRFELMGTQSDIDNVRKGVSEFWQR 131
>gi|161502144|ref|YP_001569256.1| ribonucleotide reductase stimulatory protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189030487|sp|A9MG06|NRDI_SALAR Protein nrdI >gi|160863491|gb|ABX20114.1| hypothetical protein SARI_00167 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (136 aa)
Score = 330, Expect = 1.5e-29, Identities = 62/139 (44%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRFM +L     R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF D +  AGD+I+QK  +P+LY+FEL+GT  D+++V K  NEFW +
  S:     4 LVYFSSSSENTHRFMQRLGLPATRIPLNERERI---------RVDEPYILVVPSYGGG--GMAGAVPRQVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDHVRKGVNEFWRQ 131
>gi|169178352|ref|ZP_02839763.1| NrdI protein [Arthrobacter chlorophenolicus A6] >gi|169013782|gb|EDS60375.1| NrdI protein [Arthrobacter chlorophenolicus A6] (179 aa)
Score = 329, Expect = 1.6e-29, Identities = 65/139 (46%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           ++Y+SS S NT RF+ KL  +  R+P+  KD P  +L ++      PF+L+ PTY G  G+  G+VPK V +FLNNP NR   + VI +GNTNF D YC+A DII+ K Q+P LY+FEL+GT  DV  V +  + FW +
  S:    45 LIYFSSTSENTGRFVAKLGREVARIPLYAKDAP--LLAAR------PFVLVVPTYGGTGGE--GSVPKQVIRFLNNPQNRQLLRGVIGAGNTNFGDNYCLAADIIAAKCQVPHLYRFELMGTPEDVTRVNQGLDTFWTR 173
>gi|183598097|ref|ZP_02959590.1| hypothetical protein PROSTU_01461 [Providencia stuartii ATCC 25827] >gi|188020255|gb|EDU58295.1| hypothetical protein PROSTU_01461 [Providencia stuartii ATCC 25827] (137 aa)
Score = 329, Expect = 2.0e-29, Identities = 68/141 (48%), Positives = 90/141 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           ++Y+SS+S N HRF+ K+     RLPI ++        S I T   PF+LL PTY GG  +  GAVPK V +FLN   NR   + VIA+GNTNF + Y IAGDII+ K Q+P+LY+FELLGT  DV+ V    N FW++ +
  S:     6 LIYFSSRSGNCHRFVEKVGLPATRLPIGEQQS------SIIATT--PFVLLLPTYGGGGSR--GAVPKEVIRFLNIESNRRLIRGVIAAGNTNFGEAYAIAGDIIATKCQVPYLYRFELLGTERDVQRVRDGLNAFWQQRH 136
>gi|99080361|ref|YP_612515.1| nrdI protein [Silicibacter sp. TM1040] >gi|122398351|sp|Q1GJB3|NRDI_SILST Protein nrdI >gi|99036641|gb|ABF63253.1| nrdI protein [Silicibacter sp. TM1040] (140 aa)
Score = 328, Expect = 2.6e-29, Identities = 66/137 (48%), Positives = 88/137 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           +VYYSS+S NT R M +L  + LRLP   + EP        P V+ P++L+TPT+A G G+  GAVPKPV KFLNN  NR   + VIA GN NF DT+ +AGD+I++K  +P LY+FEL GT +D+  +      FW
  S:     4 LVYYSSRSGNTARLMERLGLEALRLP---QTEPS-------PEVDAPYVLVTPTFADGEGR--GAVPKPVIKFLNNSRNRALLRGVIAGGNRNFGDTFALAGDVIAKKCNVPVLYRFELAGTETDIARMRAGLARFW 128
>gi|170765527|ref|ZP_02900338.1| nrdI protein [Escherichia albertii TW07627] >gi|170124673|gb|EDS93604.1| nrdI protein [Escherichia albertii TW07627] (136 aa)
Score = 327, Expect = 2.6e-29, Identities = 62/140 (44%), Positives = 92/140 (65%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVY+SS+S NT RF+ +L    +R+P+ +++            V+ P+IL+ P+Y GG   + GAVP+ V +FLN+  NR   + VIASGN NF + Y  AGD+I++K  +P+LY+FEL+GT SD+ENV K   EFW++
  S:     3 LIVYFSSRSENTQRFIERLGLPAVRIPLNERERIQ---------VDEPYILIVPSYGGG--GMAGAVPRQVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIENVRKGVTEFWQR 131
>gi|119964206|ref|YP_948077.1| nrdI protein [Arthrobacter aurescens TC1] >gi|119951065|gb|ABM09976.1| nrdI protein [Arthrobacter aurescens TC1] (159 aa)
Score = 327, Expect = 2.9e-29, Identities = 67/142 (47%), Positives = 90/142 (63%)
  Q:     5 RFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           R  ++Y+SS S NT RF+ KL     R+P+  +D P + LE        PF+L+ PTY G  G+  G+VPK V +FLN+P NR   + VI +GNTNF D YC AGDIIS K ++P LYKFEL+GT  DV+ V +   +FW +
  S:    22 RSHLIYFSSTSENTKRFVRKLGRDAARIPLYAQDAPLQALE--------PFVLVLPTYGGTNGE--GSVPKQVIRFLNDPRNRELIRGVIGAGNTNFADNYCAAGDIISVKCKVPHLYKFELMGTPEDVQRVNEGLEKFWTQ 153
>gi|77411315|ref|ZP_00787664.1| nrdI protein [Streptococcus agalactiae CJB111] >gi|77162651|gb|EAO73613.1| nrdI protein [Streptococcus agalactiae CJB111] (137 aa)
Score = 326, Expect = 3.9e-29, Identities = 71/140 (50%), Positives = 91/140 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKN 147
           +VY+SSKSNNTHRF+ KL     R+P     +   IL      V   +IL+ PTYAGG    KGAVPK V +FLN   NR +C+ VI+SGNTNF DTY IAG II++KL +P L++FELLGT  DV  V ++  +F  K+
  S:     7 VVYFSSKSNNTHRFVQKLAWSNQRIP----SDGSNIL------VTEDYILIVPTYAGGGDDTKGAVPKQVVQFLNVRQNREHCQGVISSGNTNFGDTYAIAGPIIARKLNVPLLHQFELLGTQEDVTRVKELLCQFTRKD 136
>gi|169173927|ref|ZP_02835871.1| NrdI protein [Arthrobacter chlorophenolicus A6] >gi|169018167|gb|EDS64643.1| NrdI protein [Arthrobacter chlorophenolicus A6] (144 aa)
Score = 326, Expect = 4.0e-29, Identities = 67/139 (48%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           ++Y+SS S+NTHRF+ KL     RLP+   D  D +L ++      PF+L+TPTY GG     GAVPK V KFLN P NR   + VIA+GNTNF+D+YC+AGD+I+ K +   LY+ EL+GT  DVE V      FW++
  S:     9 LIYFSSVSDNTHRFVQKLGLTAHRLPLRTSD--DTLLATE------PFVLVTPTYGGG--PEGGAVPKQVIKFLNVPGNRELIRGVIAAGNTNFHDSYCLAGDVIAAKCRTQLLYRVELMGTPEDVERVRTGLETFWKR 137
>gi|25010527|ref|NP_734922.1| ribonucleotide reductase stimulatory protein [Streptococcus agalactiae NEM316] >gi|23094880|emb|CAD46098.1| Unknown [Streptococcus agalactiae NEM316] (137 aa)
Score = 325, Expect = 4.6e-29, Identities = 71/140 (50%), Positives = 91/140 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKN 147
           +VY+SSKSNNTHRF+ KL     R+P     +   IL      V   +IL+ PTYAGG    KGAVPK V +FLN   NR +C+ VI+SGNTNF DTY IAG II++KL +P L++FELLGT  DV  V ++  +F  K+
  S:     7 VVYFSSKSNNTHRFVQKLAWSNQRIP----SDGSNIL------VTEDYILIVPTYAGGGDDTKGAVPKQVVQFLNVRQNREHCQGVISSGNTNFGDTYAIAGPIIARKLNVPLLHQFELLGTQEDVTRVKELLCQFTRKD 136
>gi|172039809|ref|YP_001799523.1| NrdI protein involved in ribonucleotide reduction [Corynebacterium urealyticum DSM 7109] >gi|171851113|emb|CAQ04089.1| NrdI protein involved in ribonucleotide reduction [Corynebacterium urealyticum DSM 7109] (156 aa)
Score = 324, Expect = 6.1e-29, Identities = 69/139 (49%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           ++Y+SS S NTHRF+ +L    LR+P+  +      LE  I  VN P++LL P+Y GG   L GAVPK V +FLN P NR   + VI SGNTNF + YCIAG +IS+K  +P LY+FELLGT+ DVE V    + FW +
  S:    21 LLYFSSASENTHRFIQRLERPALRIPLRPR------LEGMI-RVNAPYVLLLPSYGGG--ALNGAVPKQVIQFLNIPENRALIRGVITSGNTNFGEHYCIAGPVISRKCGVPELYRFELLGTDEDVEKVRNGLDAFWAQ 150
>gi|66880107|ref|ZP_00405092.1| COG1780: Protein involved in ribonucleotide reduction [Mycoplasma genitalium G-37] (137 aa)
Score = 323, Expect = 8.4e-29, Identities = 67/123 (54%), Positives = 91/123 (73%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGT 129
           FIVY+SS SNNTHRF+ KL  +  R+P++       I +S   TV++ ++L+ PTY+GG  +++GAVPK V +FLNN  NR  C+ VIASGNTNF DT+C+AG +IS+KL +P LY+FELLGT
  S:    21 FIVYFSSISNNTHRFIEKLGFQHKRIPVD-------ITQSI--TVSNEYVLICPTYSGGGNQVEGAVPKQVIQFLNNKHNRELCRGVIASGNTNFGDTFCLAGTVISKKLNVPLLYQFELLGT 134
>gi|157158453|ref|YP_001463984.1| ribonucleotide reductase stimulatory protein [Escherichia coli E24377A] >gi|193071027|ref|ZP_03051955.1| nrdI protein [Escherichia coli E110019] >gi|167016343|sp|A7ZQA5|NRDI_ECO24 Protein nrdI >gi|157080483|gb|ABV20191.1| nrdI protein [Escherichia coli E24377A] >gi|192955685|gb|EDV86160.1| nrdI protein [Escherichia coli E110019] (136 aa)
Score = 323, Expect = 8.7e-29, Identities = 62/139 (44%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NT RF+ +L    +R+P+ +++            V+ P+IL+ P+Y GG     GAVP+ V +FLN+  NR   + VIASGN NF + Y  AGD+I+QK  +P+LY+FEL+GT SD+ENV K   EFW++
  S:     4 LVYFSSSSENTQRFIERLGLPAVRIPLNERERIQ---------VDEPYILIVPSYGGG--GTAGAVPRQVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIAQKCGVPWLYRFELMGTQSDIENVRKGVTEFWQR 131
>gi|177673420|ref|ZP_02945764.1| NrdI protein [Micrococcus luteus NCTC 2665] >gi|172070302|gb|EDT56366.1| NrdI protein [Micrococcus luteus NCTC 2665] (155 aa)
Score = 321, Expect = 1.4e-28, Identities = 68/129 (52%), Positives = 89/129 (68%)
  Q:     8 IVYYSSKSNNTHRFMLKLNC---KCLRLPIEQKDEPDEILESKIPTV--NHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           ++Y+SS SN THRF+ KL     +  RLP+  ++          PT+    P++L+TPTY GG G   GAVPK V KFLN P NR+  + VIASGNTNF++ YC+AG IIS+K Q+P +YKFEL+GT  DVE V
  S:    25 LIYFSSASNYTHRFVEKLELPEDRVARLPLITRE----------PTLGATAPYVLMTPTYGGGSGP--GAVPKQVIKFLNVPENRHWIRGVIASGNTNFHEGYCLAGYIISRKCQVPLMYKFELMGTPDDVERV 146
>gi|13508062|ref|NP_110011.1| ribonucleotide reductase stimulatory protein [Mycoplasma pneumoniae M129] >gi|2498676|sp|P75460|NRDI_MYCPN Protein nrdI >gi|1674207|gb|AAB96161.1| probably nrdI [Mycoplasma pneumoniae M129] (153 aa)
Score = 320, Expect = 1.7e-28, Identities = 71/140 (50%), Positives = 93/140 (66%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           ++VY+SS SNNTHRF+ KL  +  R+P+      DE +E     VN  ++L  PTY+GG     GAVPK V  FLNN  NR+ C+ VI+SGNTNF +T+ IAG I+S+KL +P LY+FELLGT +DVE V  I   F+ K
  S:    21 YVVYFSSISNNTHRFIEKLEFEHTRIPVNL----DEQIE-----VNQEYVLFCPTYSGGGEYTSGAVPKQVIHFLNNKHNRDLCRGVISSGNTNFGNTFAIAGPILSKKLNVPLLYQFELLGTKNDVEQVQTIITNFFGK 151
>gi|91212035|ref|YP_542021.1| ribonucleotide reductase stimulatory protein [Escherichia coli UTI89] >gi|117624910|ref|YP_853850.1| ribonucleotide reductase stimulatory protein [Escherichia coli APEC O1] >gi|122422750|sp|Q1R824|NRDI_ECOUT Protein nrdI >gi|166233917|sp|A1AEL9|NRDI_ECOK1 Protein nrdI >gi|91073609|gb|ABE08490.1| hypothetical protein UTI89_C3034 [Escherichia coli UTI89] >gi|115514034|gb|ABJ02109.1| protein that stimulates ribonucleotide reduction [Escherichia coli APEC O1] (136 aa)
Score = 320, Expect = 1.9e-28, Identities = 61/139 (43%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NT RF+ +L    +R+P+ +++            V+ P+IL+ P+Y GG     GAVP+ V +FLN+  NR   + VIASGN NF + Y  AGD+I++K  +P+LY+FEL+GT SD+ENV K   EFW++
  S:     4 LVYFSSSSENTQRFIERLGLPAVRIPLNERERIQ---------VDEPYILIVPSYGGG--GTAGAVPRQVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCSVPWLYRFELMGTQSDIENVRKGVTEFWQR 131
>gi|82778046|ref|YP_404395.1| ribonucleotide reductase stimulatory protein [Shigella dysenteriae Sd197] >gi|123561825|sp|Q32CQ1|NRDI_SHIDS Protein nrdI >gi|81242194|gb|ABB62904.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (136 aa)
Score = 318, Expect = 3.0e-28, Identities = 63/139 (45%), Positives = 89/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NT RF+ +L    +R+P+          E K   V+ P+IL+ P+Y GG     GAVP+ V +FLN+  NR   + VIASGN NF + Y  AGD+I++K  +P+LY+FEL+GT SD+ENV K   EFW++
  S:     4 LVYFSSSSENTQRFIERLGLPAVRIPLN---------ERKQIQVDEPYILIVPSYGGG--GTAGAVPRQVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIENVRKGVTEFWQR 131
>gi|15803194|ref|NP_289226.1| ribonucleotide reductase stimulatory protein [Escherichia coli O157:H7 EDL933] >gi|15832791|ref|NP_311564.1| ribonucleotide reductase stimulatory protein [Escherichia coli O157:H7 str. Sakai] >gi|16130588|ref|NP_417160.1| protein that stimulates ribonucleotide reduction [Escherichia coli str. K-12 substr. MG1655] >gi|24113978|ref|NP_708488.1| ribonucleotide reductase stimulatory protein [Shigella flexneri 2a str. 301] >gi|26249069|ref|NP_755109.1| ribonucleotide reductase stimulatory protein [Escherichia coli CFT073] >gi|30064041|ref|NP_838212.1| ribonucleotide reductase stimulatory protein [Shigella flexneri 2a str. 2457T] >gi|89109467|ref|AP_003247.1| protein that stimulates ribonucleotide reduction [Escherichia coli W3110] >gi|110642799|ref|YP_670529.1| ribonucleotide reductase stimulatory protein [Escherichia coli 536] >gi|110806693|ref|YP_690213.1| ribonucleotide reductase stimulatory protein [Shigella flexneri 5 str. 8401] >gi|157162125|ref|YP_001459443.1| ribonucleotide reductase stimulatory protein [Escherichia coli HS] >gi|168708182|ref|ZP_02740459.1| nrdI protein [Escherichia coli O157:H7 str. EC4045] >gi|168719746|ref|ZP_02752023.1| nrdI protein [Escherichia coli O157:H7 str. EC4206] >gi|168734145|ref|ZP_02766422.1| nrdI protein [Escherichia coli O157:H7 str. EC4115] >gi|168750917|ref|ZP_02775939.1| nrdI protein [Escherichia coli O157:H7 str. EC4113] >gi|168755419|ref|ZP_02780426.1| nrdI protein [Escherichia coli O157:H7 str. EC4401] >gi|168762469|ref|ZP_02787476.1| nrdI protein [Escherichia coli O157:H7 str. EC4501] >gi|168768765|ref|ZP_02793772.1| nrdI protein [Escherichia coli O157:H7 str. EC4486] >gi|168774794|ref|ZP_02799801.1| nrdI protein [Escherichia coli O157:H7 str. EC4196] >gi|168778656|ref|ZP_02803663.1| nrdI protein [Escherichia coli O157:H7 str. EC4076] >gi|168789580|ref|ZP_02814587.1| nrdI protein [Escherichia coli O157:H7 str. EC869] >gi|168792062|ref|ZP_02817069.1| nrdI protein [Escherichia coli O157:H7 str. EC4042] >gi|168800559|ref|ZP_02825566.1| nrdI protein [Escherichia coli O157:H7 str. EC508] >gi|170019074|ref|YP_001724028.1| NrdI protein [Escherichia coli ATCC 8739] >gi|170082260|ref|YP_001731580.1| NrdI [Escherichia coli str. K12 substr. DH10B] >gi|170683274|ref|YP_001744825.1| nrdI protein [Escherichia coli SMS-3-5] >gi|187732904|ref|YP_001881574.1| nrdI protein [Shigella boydii CDC 3083-94] >gi|188493964|ref|ZP_03001234.1| nrdI protein [Escherichia coli 53638] >gi|191167081|ref|ZP_03028902.1| nrdI protein [Escherichia coli B7A] >gi|191171339|ref|ZP_03032888.1| nrdI protein [Escherichia coli F11] >gi|193065993|ref|ZP_03047052.1| nrdI protein [Escherichia coli E22] >gi|194427821|ref|ZP_03060367.1| nrdI protein [Escherichia coli B171] >gi|194433063|ref|ZP_03065346.1| nrdI protein [Shigella dysenteriae 1012] >gi|194439455|ref|ZP_03071531.1| nrdI protein [Escherichia coli 101-1] >gi|195938428|ref|ZP_03083810.1| ribonucleotide reductase stimulatory protein [Escherichia coli O157:H7 str. EC4024] >gi|67469810|sp|P0A772|NRDI_ECOLI Protein nrdI >gi|122958108|sp|Q0TEK1|NRDI_ECOL5 Protein nrdI >gi|123146763|sp|Q0T1A7|NRDI_SHIF8 Protein nrdI >gi|167016344|sp|A8A3F6|NRDI_ECOHS Protein nrdI >gi|189030485|sp|B1IUZ9|NRDI_ECOLC Protein nrdI >gi|67469811|sp|P0A773|NRDI_ECOL6 Protein nrdI >gi|67469814|sp|P0A774|NRDI_ECO57 Protein nrdI >gi|67469815|sp|P0A775|NRDI_SHIFL Protein nrdI >gi|12517113|gb|AAG57784.1|AE005496_7 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|26109476|gb|AAN81679.1|AE016765_81 NrdI protein [Escherichia coli CFT073] >gi|1050471|emb|CAA56185.1| unnamed protein product [Escherichia coli] >gi|1789029|gb|AAC75721.1| protein that stimulates ribonucleotide reduction [Escherichia coli str. K-12 substr. MG1655] >gi|13363008|dbj|BAB36960.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|24053091|gb|AAN44195.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30042297|gb|AAP18022.1| hypothetical protein S2888 [Shigella flexneri 2a str. 2457T] >gi|85675519|dbj|BAA16538.2| protein that stimulates ribonucleotide reduction [Escherichia coli W3110] >gi|110344391|gb|ABG70628.1| Nrdi protein [Escherichia coli 536] >gi|110616241|gb|ABF04908.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] >gi|157067805|gb|ABV07060.1| nrdI protein [Escherichia coli HS] >gi|169754002|gb|ACA76701.1| NrdI protein [Escherichia coli ATCC 8739] >gi|169890095|gb|ACB03802.1| NrdI [Escherichia coli str. K12 substr. DH10B] >gi|170520992|gb|ACB19170.1| nrdI protein [Escherichia coli SMS-3-5] >gi|187429896|gb|ACD09170.1| nrdI protein [Shigella boydii CDC 3083-94] >gi|187769580|gb|EDU33424.1| nrdI protein [Escherichia coli O157:H7 str. EC4196] >gi|188014999|gb|EDU53121.1| nrdI protein [Escherichia coli O157:H7 str. EC4113] >gi|188489163|gb|EDU64266.1| nrdI protein [Escherichia coli 53638] >gi|189003328|gb|EDU72314.1| nrdI protein [Escherichia coli O157:H7 str. EC4076] >gi|189357375|gb|EDU75794.1| nrdI protein [Escherichia coli O157:H7 str. EC4401] >gi|189362152|gb|EDU80571.1| nrdI protein [Escherichia coli O157:H7 str. EC4486] >gi|189367312|gb|EDU85728.1| nrdI protein [Escherichia coli O157:H7 str. EC4501] >gi|189370884|gb|EDU89300.1| nrdI protein [Escherichia coli O157:H7 str. EC869] >gi|189377152|gb|EDU95568.1| nrdI protein [Escherichia coli O157:H7 str. EC508] >gi|190902863|gb|EDV62591.1| nrdI protein [Escherichia coli B7A] >gi|190908273|gb|EDV67863.1| nrdI protein [Escherichia coli F11] >gi|192926407|gb|EDV81042.1| nrdI protein [Escherichia coli E22] >gi|194414054|gb|EDX30330.1| nrdI protein [Escherichia coli B171] >gi|194418790|gb|EDX34876.1| nrdI protein [Shigella dysenteriae 1012] >gi|194421631|gb|EDX37642.1| nrdI protein [Escherichia coli 101-1] (136 aa)
Score = 318, Expect = 3.1e-28, Identities = 61/139 (43%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NT RF+ +L    +R+P+ +++            V+ P+IL+ P+Y GG     GAVP+ V +FLN+  NR   + VIASGN NF + Y  AGD+I++K  +P+LY+FEL+GT SD+ENV K   EFW++
  S:     4 LVYFSSSSENTQRFIERLGLPAVRIPLNERERIQ---------VDEPYILIVPSYGGG--GTAGAVPRQVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIENVRKGVTEFWQR 131
>gi|82545245|ref|YP_409192.1| ribonucleotide reductase stimulatory protein [Shigella boydii Sb227] >gi|123558811|sp|Q31X44|NRDI_SHIBS Protein nrdI >gi|81246656|gb|ABB67364.1| conserved hypothetical protein [Shigella boydii Sb227] (136 aa)
Score = 318, Expect = 3.2e-28, Identities = 61/139 (43%), Positives = 90/139 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NT RF+ +L    +R+P+ +++            V+ P+IL+ P+Y GG     GAVP+ V +FLN+  NR   + VIASGN NF + Y  AGD+I++K  +P+LY+FEL+GT SD+ENV K   EFW++
  S:     4 LVYFSSSSENTQRFIERLGMPAVRIPLNERERIQ---------VDEPYILIVPSYGGG--GTAGAVPRQVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIENVRKGVTEFWQR 131
>gi|116670903|ref|YP_831836.1| NrdI protein [Arthrobacter sp. FB24] >gi|116611012|gb|ABK03736.1| NrdI protein [Arthrobacter sp. FB24] (162 aa)
Score = 317, Expect = 3.8e-28, Identities = 66/137 (48%), Positives = 91/137 (66%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           ++Y+SS S NT RF+ KL     R+P+ Q++   E++ S+      PF+L+ PTY G  G+  G+VPK V +FLNNP NR   + VI +GNTNF D YC+AGDII+ K QIP LY+FEL+GT  DV  V +  ++FW
  S:    28 LIYFSSASENTRRFVEKLGRDAARIPLHQREA--ELVASE------PFVLVVPTYGGTGGE--GSVPKQVIRFLNNPQNRALIRGVIGAGNTNFGDNYCMAGDIIAFKCQIPHLYRFELMGTPEDVRLVNQGLDKFW 154
>gi|169630495|ref|YP_001704144.1| protein NrdI [Mycobacterium abscessus] >gi|169242462|emb|CAM63490.1| Protein NrdI [Mycobacterium abscessus] (156 aa)
Score = 317, Expect = 4.7e-28, Identities = 68/138 (49%), Positives = 89/138 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLN----------CKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGL---GKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           +VY+SS S NTHRF+ KL           C  +R+P+    E           V+ P++L+ PTY GG    GK  G VPK V KFLNN  NR+  + VIA+GNTNF   YC AG +IS K  +P+LY+FEL+GT  DVE V+   +EFW+
  S:     4 LVYFSSVSENTHRFVQKLARASEARGEGPCPAIRIPLRGDIE-----------VDTPYVLIVPTYGGGHPVPGKAGGYVPKQVVKFLNNENNRSLIRGVIAAGNTNFGAEYCYAGKVISAKCDVPYLYRFELMGTAEDVEQVLDGLDEFWK 143
>gi|152971532|ref|YP_001336641.1| ribonucleotide reductase stimulatory protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166233919|sp|A6TCU0|NRDI_KLEP7 Protein nrdI >gi|150956381|gb|ABR78411.1| hypothetical protein KPN_03005 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (136 aa)
Score = 312, Expect = 1.5e-27, Identities = 59/140 (42%), Positives = 89/140 (63%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVY+SS+S NTHRF+ +L    +R+P+ +++            V+ P+IL+ P+Y GG     GAVP+   +FLN+  NR   + VIA+GN NF D +  AGD+I+QK  +P+LY+FEL+GT  D+  V K  +EFW++
  S:     3 LIVYFSSRSENTHRFVQRLGLPAVRIPLNEREHL---------RVDEPYILIVPSYGGG--GTAGAVPRQAIRFLNDVHNRQLIRGVIAAGNRNFGDGWGRAGDVIAQKCAVPYLYRFELMGTPDDINTVRKGVSEFWQR 131
>gi|152964772|ref|YP_001360556.1| NrdI protein [Kineococcus radiotolerans SRS30216] >gi|151359289|gb|ABS02292.1| NrdI protein [Kineococcus radiotolerans SRS30216] (132 aa)
Score = 311, Expect = 2.1e-27, Identities = 61/129 (47%), Positives = 85/129 (65%)
  Q:     8 IVYYSSKSNNTHRFM--LKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           +VY+SS S NTHRF+  L+L    LR+P+  +DEP ++ E        P++L+ PTY GG G   GAVPK V +FLN+P +R   + VI +GNTNF + Y  AGD+++ K ++P LY+FEL GT  DV  V
  S:     5 VVYFSSVSGNTHRFVGKLQLERPALRIPLRPRDEPLDVTE--------PYVLIVPTYGGGDGA--GAVPKQVIRFLNDPAHRALIRGVIGAGNTNFGEHYAAAGDVVAAKCRVPHLYRFELFGTPDDVRRV 125
>gi|15610189|ref|NP_217568.1| ribonucleotide reductase stimulatory protein [Mycobacterium tuberculosis H37Rv] >gi|15842618|ref|NP_337655.1| ribonucleotide reductase stimulatory protein [Mycobacterium tuberculosis CDC1551] >gi|31794230|ref|NP_856723.1| ribonucleotide reductase stimulatory protein [Mycobacterium bovis AF2122/97] >gi|121638936|ref|YP_979160.1| ribonucleotide reductase stimulatory protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662905|ref|YP_001284428.1| ribonucleotide reductase stimulatory protein [Mycobacterium tuberculosis H37Ra] >gi|148824243|ref|YP_001288997.1| ribonucleotide reductase stimulatory protein [Mycobacterium tuberculosis F11] >gi|167969654|ref|ZP_02551931.1| ribonucleotide reductase stimulatory protein [Mycobacterium tuberculosis H37Ra] >gi|194541741|ref|YP_002076772.1| hypothetical protein nrdI [Mycobacterium tuberculosis C] >gi|166233921|sp|A1KN49|NRDI_MYCBP Protein nrdI >gi|166233924|sp|A5U766|NRDI_MYCTA Protein nrdI >gi|54037908|sp|P65549|NRDI_MYCBO Protein nrdI >gi|54041663|sp|P65548|NRDI_MYCTU Protein nrdI >gi|1781162|emb|CAB06244.1| PROBABLE NRDI PROTEIN [Mycobacterium tuberculosis H37Rv] >gi|13882933|gb|AAK47469.1| nrdI protein [Mycobacterium tuberculosis CDC1551] >gi|31619825|emb|CAD96765.1| PROBABLE NRDI PROTEIN [Mycobacterium bovis AF2122/97] >gi|121494584|emb|CAL73065.1| Probable nrdI protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124599211|gb|EAY58315.1| hypothetical protein nrdI [Mycobacterium tuberculosis C] >gi|134151194|gb|EBA43239.1| hypothetical protein nrdI [Mycobacterium tuberculosis str. Haarlem] >gi|148507057|gb|ABQ74866.1| putative protein NrdI [Mycobacterium tuberculosis H37Ra] >gi|148722770|gb|ABR07395.1| hypothetical protein nrdI [Mycobacterium tuberculosis F11] (150 aa)
Score = 310, Expect = 2.5e-27, Identities = 63/139 (45%), Positives = 84/139 (60%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGK----LKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+ KL     R+P+  + E DE           P++L+ PTY GG         G VPK V  FLNN  NR   + VIA+GNTNF   +C AGD++S+K  +P+LY+FEL+GT  DV  V     EFW++
  S:     8 LVYFSSVSENTHRFVQKLGIPATRIPLHGRIEVDE-----------PYVLILPTYGGGRANPGLDAGGYVPKQVIAFLNNDHNRAQLRGVIAAGNTNFGAEFCYAGDVVSRKCSVPYLYRFELMGTEDDVAAVRTGLAEFWKE 139
>gi|68535291|ref|YP_249996.1| ribonucleotide reductase stimulatory protein [Corynebacterium jeikeium K411] >gi|68262890|emb|CAI36378.1| NrdI protein involved in ribonucleotide reduction [Corynebacterium jeikeium K411] (144 aa)
Score = 310, Expect = 2.7e-27, Identities = 66/139 (47%), Positives = 87/139 (62%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           IVY+SS S NT RF+ KL+    R+P+ +K EP+ I       V+ P++L+TPTY GG    + AVP+ V  FLNNP NR   + VI SGN NF   YC AG  I+ K ++P LY+FELLGT  DV  V +   EFW++
  S:    11 IVYFSSASENTRRFVDKLDIPARRIPLRRK-EPELI-------VDEPYVLITPTYGGG--DPRKAVPRQVITFLNNPHNRTFIRGVITSGNRNFGTAYCCAGPTIAAKCRVPELYRFELLGTARDVARVREGIREFWDR 139
>gi|144575096|gb|AAZ43812.2| NrdI protein [Mycoplasma synoviae 53] (153 aa)
Score = 302, Expect = 2.6e-26, Identities = 61/137 (44%), Positives = 90/137 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           IVY+SS++ NT +F+ KL     R+PI+     +         ++  ++L  PTY+GG G++KG+VPK V KFLN   NR++C A++ASGNTNF DTY +AG+++  KL++P L+ FELLGT  D E V +  N+ W
  S:    23 IVYFSSETGNTKKFVDKLKINSSRIPIDLNASLE---------ISQDYVLFCPTYSGGFGEVKGSVPKQVIKFLNKKKNRDHCMAIVASGNTNFGDTYGLAGNVLQAKLKVPLLHVFELLGTKHDEEVVHQKINQLW 150
>gi|71894415|ref|YP_278523.1| ribonucleotide reductase stimulatory protein [Mycoplasma synoviae 53] (143 aa)
Score = 300, Expect = 4.0e-26, Identities = 61/137 (44%), Positives = 90/137 (65%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           IVY+SS++ NT +F+ KL     R+PI+     +         ++  ++L  PTY+GG G++KG+VPK V KFLN   NR++C A++ASGNTNF DTY +AG+++  KL++P L+ FELLGT  D E V +  N+ W
  S:    13 IVYFSSETGNTKKFVDKLKINSSRIPIDLNASLE---------ISQDYVLFCPTYSGGFGEVKGSVPKQVIKFLNKKKNRDHCMAIVASGNTNFGDTYGLAGNVLQAKLKVPLLHVFELLGTKHDEEVVHQKINQLW 140
>gi|69938058|ref|ZP_00632609.1| NrdI [Paracoccus denitrificans PD1222] >gi|119387081|ref|YP_918136.1| NrdI protein [Paracoccus denitrificans PD1222] >gi|166233927|sp|A1BA96|NRDI_PARDP Protein nrdI >gi|119377676|gb|ABL72440.1| NrdI protein [Paracoccus denitrificans PD1222] (138 aa)
Score = 300, Expect = 4.1e-26, Identities = 61/137 (44%), Positives = 84/137 (61%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           +VY+SS S NT RF+ +L     R+PI  +DE        +P    P++L+ PTYA G+G+  GAVPK V +FLN+P  R   + VIA+GN NF  TY +AG +IS K  +P LY+FEL GT+ D+  V     +FW
  S:     4 LVYFSSGSGNTARFVTRLGLPAGRIPISPRDE--------MPAPALPYVLICPTYADGMGR--GAVPKQVIRFLNDPDRRALLRGVIATGNRNFGATYALAGRVISDKCNVPVLYRFELAGTDLDISRVQAGLAKFW 130
>gi|37525253|ref|NP_928597.1| ribonucleotide reductase stimulatory protein [Photorhabdus luminescens subsp. laumondii TTO1] >gi|73921255|sp|Q7N772|NRDI_PHOLL Protein nrdI >gi|36784680|emb|CAE13580.1| NrdI protein [Photorhabdus luminescens subsp. laumondii TTO1] (140 aa)
Score = 299, Expect = 4.7e-26, Identities = 68/142 (47%), Positives = 89/142 (62%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
           ++Y+SS S+N+HRF+ KL     R+PI Q D P  I          P+ILLTP+Y GG    KGAVP  V +FLN   NR   + VIA+GNTNF + Y IAG IIS+K +IP LY+FELLGT  DV+ V +    FW+ ++ 
  S:     6 LIYFSSSSSNSHRFVQKLEIPAFRIPINQSDSPLNI--------TSPYILLTPSYGGG--STKGAVPPQVIRFLNIAENRAFIRGVIAAGNTNFGEAYGIAGRIISEKCRIPLLYRFELLGTEEDVQRVRQGIQRFWQHDSL 137
>gi|41409199|ref|NP_962035.1| ribonucleotide reductase stimulatory protein [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118465853|ref|YP_883082.1| ribonucleotide reductase stimulatory protein [Mycobacterium avium 104] >gi|81413430|sp|Q73VB3|NRDI_MYCPA Protein nrdI >gi|166233920|sp|A0QJJ4|NRDI_MYCA1 Protein nrdI >gi|41398019|gb|AAS05649.1| NrdI [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167140|gb|ABK68037.1| NrdI protein [Mycobacterium avium 104] (150 aa)
Score = 298, Expect = 7.5e-26, Identities = 61/139 (43%), Positives = 86/139 (61%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLG----KLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+ KL    +R+P+  + E           V+HP++LL PTY GG         G VPK V  FLNN  NR+  + VIA+GN NF   +  AG+++S+K  +P+LY+FEL+GT  DV+ V     EFW++
  S:     8 LVYFSSVSENTHRFVQKLGIPAIRIPLHGRIE-----------VDHPYVLLLPTYGGGRATPDLNAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNNNFGAEFAYAGNVVSRKCGVPYLYRFELMGTQDDVDAVRAGLAEFWKE 139
>gi|172041162|ref|YP_001800876.1| NrdI protein involved in ribonucleotide reduction [Corynebacterium urealyticum DSM 7109] >gi|171852466|emb|CAQ05442.1| NrdI protein involved in ribonucleotide reduction [Corynebacterium urealyticum DSM 7109] (144 aa)
Score = 297, Expect = 9.0e-26, Identities = 62/137 (45%), Positives = 85/137 (62%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKL---KGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEF 143
            I Y+SS +NNTHRF+ KL     R+PI + +EP          V+ P +L+ PTY GG+G +      VPK V  FLN   NR+  + VIA+GN NF   +C+AGD+IS K Q+ +LY+FE++GT  DVE V +   EF
  S:     2 LITYFSSTTNNTHRFVQKLGLPNKRIPIYRYEEP--------LVVDEPHVLIVPTYGGGVGMVGENSRPVPKQVIHFLNEKQNRDYLRGVIAAGNINFGPDFCLAGDVISAKCQVSYLYRFEMMGTEHDVERVKEGLAEF 133
>gi|156932796|ref|YP_001436712.1| ribonucleotide reductase stimulatory protein [Enterobacter sakazakii ATCC BAA-894] >gi|166233918|sp|A7MI07|NRDI_ENTS8 Protein nrdI >gi|156531050|gb|ABU75876.1| hypothetical protein ESA_00592 [Enterobacter sakazakii ATCC BAA-894] (133 aa)
Score = 295, Expect = 1.5e-25, Identities = 61/141 (43%), Positives = 91/141 (64%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           ++Y+SS+S NTHRF+ +L     R+P+E ++             + P+IL+ PTY    G   GAVP+ V +FLN+  NR   + VIA+GN NF + +C AGDII+ K Q+PFLY+FEL+GT  D++NV K  +EFW++ +
  S:     4 LIYFSSRSENTHRFIARLGLPAARIPLEDRERL---------RADEPYILVVPTYG--GGGTAGAVPRQVIRFLNDEHNRALLRGVIAAGNRNFGEGFCRAGDIIAHKCQVPFLYRFELMGTGQDIDNVRKGVSEFWQRQH 133
>gi|184200805|ref|YP_001855012.1| NrdI protein [Kocuria rhizophila DC2201] >gi|183581035|dbj|BAG29506.1| NrdI protein [Kocuria rhizophila DC2201] (135 aa)
Score = 289, Expect = 6.7e-25, Identities = 58/137 (42%), Positives = 83/137 (60%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           +VY+SS + NT RF+ KL  + +RLP+   + P        P +  PF+L  P+Y    G   G+VP  V KFLN+  +R + K VI +GNTNF   +C+A + ++ K Q+P LYKFEL+GT+ DVE V +   EFW
  S:     1 MVYFSSVTRNTDRFIAKLPVRSIRLPLRTSEPP--------PRIEEPFVLAVPSYGRPGGA--GSVPPQVVKFLNDAPSRAHLKGVIGAGNTNFGPLFCVAAEKVAAKCQVPLLYKFELMGTDEDVEKVTQGLEEFW 127
>gi|163839182|ref|YP_001623587.1| NrdI [Renibacterium salmoninarum ATCC 33209] >gi|162952658|gb|ABY22173.1| NrdI [Renibacterium salmoninarum ATCC 33209] (140 aa)
Score = 289, Expect = 7.9e-25, Identities = 63/139 (45%), Positives = 83/139 (59%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NT RF+ KL     R+P+  + E      + +  V  P+IL  PTY GG  +  GAVPK V  FLN P NR   + VIA+GNTNF   YC+AG +I+ K  +P LY+FELLGT SD+  V      FW++
  S:     4 LVYFSSVSENTRRFVEKLETPADRIPLRPRSE------AALYAV-EPYILTVPTYGGG--EPCGAVPKQVVSFLNVPQNRKLLRGVIAAGNTNFGAAYCLAGAVIAAKCAVPLLYRFELLGTPSDIAAVNTGLEIFWQR 133
>gi|25028980|ref|NP_739034.1| ribonucleotide reductase stimulatory protein [Corynebacterium efficiens YS-314] >gi|23494267|dbj|BAC19234.1| NrdI protein [Corynebacterium efficiens YS-314] (194 aa)
Score = 287, Expect = 1.2e-24, Identities = 55/127 (43%), Positives = 85/127 (66%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGL---GKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV 133
            +VY+SS ++NTHRF+ KL    +R+P+ + +EP          V+ P++L+ PTY GG+   GK    VP  V +FLNN  NR+  +AV+A GN+NF   + +AGD+IS+K ++P++Y+FEL+G   DV
  S:    44 LVVYFSSATDNTHRFVQKLGLPNVRIPLTRMEEP--------LLVDEPYVLIVPTYGGGVTMSGKNSRPVPPQVIRFLNNKHNRSLIRAVVAGGNSNFGADFGLAGDVISRKCKVPYVYRFELMGNEEDV 165
>gi|86148042|ref|ZP_01066344.1| hypothetical protein MED222_16661 [Vibrio sp. MED222] >gi|85834175|gb|EAQ52331.1| hypothetical protein MED222_16661 [Vibrio sp. MED222] (132 aa)
Score = 287, Expect = 1.4e-24, Identities = 63/138 (45%), Positives = 80/138 (57%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           IVYYSS S NT RF+ +L    +RLP E  +   EI          PF+L+ PTYA G G+  GAVP  V   LNNP NR   K VIASGN NF   +   G I+++K  +P LY+FEL GT SD++ V     +FW+
  S:     2 IVYYSSASGNTKRFVEQLGLPAIRLPTEANERTLEI--------EQPFVLICPTYADGEGR--GAVPNSVISLLNNPNNRALIKGVIASGNRNFGALFARGGAIVAEKCNVPLLYRFELSGTQSDIDIVTNGLEQFWK 129
>gi|31544248|ref|NP_852826.1| ribonucleotide reductase stimulatory protein [Mycoplasma gallisepticum R] >gi|31541092|gb|AAP56394.1| NrdI [Mycoplasma gallisepticum R] (156 aa)
Score = 286, Expect = 1.6e-24, Identities = 58/137 (42%), Positives = 86/137 (62%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           +VY+SS + NT +F  KL     R+PI+  +E +         V++ ++L+ PTYAGGL   KG+VP+ V KFLN   NR +C  V+ASGNTNF +T+ +AG ++  KL +P L+ FEL+GT  D E V +  ++ W
  S:    25 VVYFSSTTENTKKFCDKLGLPATRIPIKLSEEIE---------VDYDYVLICPTYAGGLDDFKGSVPRQVIKFLNKVQNREHCVGVVASGNTNFGETFGLAGHVLRAKLHVPLLHVFELIGTKYDEELVRERIHKLW 152
>gi|5565931|gb|AAD45274.1|AF152114_2 NrdI protein [Mycoplasma gallisepticum] (151 aa)
Score = 285, Expect = 2.1e-24, Identities = 60/137 (43%), Positives = 87/137 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           +VY+SS + NT +F  KL     R+PI+    P E +E     V++ ++L+ PTYAGGL   KG+VP+ V KFLN   NR +C  V+ASGNTNF +T+ +AG ++  KL +P L+ FEL+GT  D E V +  ++ W
  S:    20 VVYFSSTTENTKKFCDKLGLPATRIPIK----PSEEIE-----VDYDYVLICPTYAGGLDDFKGSVPRQVIKFLNKVQNREHCVGVVASGNTNFGETFGLAGHVLRAKLHVPLLHVFELIGTKYDEELVRERIHKLW 147
>gi|15827933|ref|NP_302196.1| ribonucleotide reductase stimulatory protein [Mycobacterium leprae TN] >gi|20178011|sp|Q9CBP9|NRDI_MYCLE Protein nrdI >gi|13093486|emb|CAC30688.1| NrdI-family protein [Mycobacterium leprae] (138 aa)
Score = 285, Expect = 2.2e-24, Identities = 58/140 (41%), Positives = 84/140 (60%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLG----KLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKN 147
           +VY+SS S NTHRF+ KL    +R+P+  + E           V+ P++L+ PTY GG      +  G VPK V  FLNN  NR     V+A+GNTNF   +C AGD++++K  +P+LY+FEL+GT  DV  V       W+++
  S:     6 LVYFSSVSENTHRFVQKLGVPAMRIPLHSRIE-----------VSDPYVLVLPTYGGGRTAPDLQAGGYVPKQVIAFLNNEYNRALICGVVAAGNTNFGAEFCYAGDVVARKCGVPYLYRFELMGTEDDVTAVRAGLANLWKEH 138
>gi|33860184|sp|Q9XC21|NRDI_MYCGA Protein nrdI (151 aa)
Score = 285, Expect = 2.4e-24, Identities = 58/137 (42%), Positives = 86/137 (62%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           +VY+SS + NT +F  KL     R+PI+  +E +         V++ ++L+ PTYAGGL   KG+VP+ V KFLN   NR +C  V+ASGNTNF +T+ +AG ++  KL +P L+ FEL+GT  D E V +  ++ W
  S:    20 VVYFSSTTENTKKFCDKLGLPATRIPIKLSEEIE---------VDYDYVLICPTYAGGLDDFKGSVPRQVIKFLNKVQNREHCVGVVASGNTNFGETFGLAGHVLRAKLHVPLLHVFELIGTKYDEELVRERIHKLW 147
>gi|19553729|ref|NP_601731.1| ribonucleotide reductase stimulatory protein [Corynebacterium glutamicum ATCC 13032] >gi|62391370|ref|YP_226772.1| ribonucleotide reductase stimulatory protein [Corynebacterium glutamicum ATCC 13032] >gi|145296529|ref|YP_001139350.1| ribonucleotide reductase stimulatory protein [Corynebacterium glutamicum R] >gi|166233916|sp|A4QGT2|NRDI_CORGB Protein nrdI >gi|7674146|sp|Q9XD64|NRDI_CORGL Protein nrdI >gi|5230834|gb|AAD41035.1|AF112535_2 NrdI [Corynebacterium glutamicum] >gi|21325303|dbj|BAB99924.1| Protein involved in ribonucleotide reduction [Corynebacterium glutamicum ATCC 13032] >gi|41326711|emb|CAF21193.1| Protein involved in ribonucleotide reduction [Corynebacterium glutamicum ATCC 13032] >gi|140846449|dbj|BAF55448.1| hypothetical protein [Corynebacterium glutamicum R] (148 aa)
Score = 283, Expect = 3.8e-24, Identities = 56/127 (44%), Positives = 88/127 (69%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGL---GKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV 133
            IVY+SS ++NTHRF+ KL+   +R+P+ + +EP +I        N P++L+TPTY GG+   G+    VP  V +FLN+  NR+  +AV+A GN+NF   + +AG+IIS+K ++P++Y+FEL+G   DV
  S:     2 LIVYFSSATDNTHRFVQKLDLPNVRIPLTRVEEPLKI--------NEPYVLITPTYGGGVSMTGENSRPVPPQVIRFLNDEHNRSFIRAVVAGGNSNFGSDFGLAGEIISKKCKVPYVYRFELMGNEEDV 123
>gi|23335916|ref|ZP_00121147.1| COG1780: Protein involved in ribonucleotide reduction [Bifidobacterium longum DJO10A] >gi|189440323|ref|YP_001955404.1| Putative ribonucleotide reduction-related protein [Bifidobacterium longum DJO10A] >gi|189428758|gb|ACD98906.1| Putative ribonucleotide reduction-related protein [Bifidobacterium longum DJO10A] (152 aa)
Score = 282, Expect = 5.2e-24, Identities = 58/129 (44%), Positives = 82/129 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCK-----CLRLPIEQKDEPDEILESKIPTVN--HPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           +VY+SS S NT RF+     +       R+P+   D          P +N   P++++ PTY GG+  +K AVP  VK+FLN+P NR   + VIASGNTNF + YC AGDII+ K ++P+LY++EL+GT  D   V
  S:    18 LVYFSSASENTARFVAGCRLQDEGINVYRIPLRAAD----------PALNVREPYVIMVPTYGGGV--VKKAVPIQVKRFLNDPANREWIRGVIASGNTNFGEAYCAAGDIIAAKCKVPYLYRYELMGTPEDTAAV 141
>gi|108798784|ref|YP_638981.1| ribonucleotide reductase stimulatory protein [Mycobacterium sp. MCS] >gi|119867902|ref|YP_937854.1| ribonucleotide reductase stimulatory protein [Mycobacterium sp. KMS] >gi|126434385|ref|YP_001070076.1| ribonucleotide reductase stimulatory protein [Mycobacterium sp. JLS] >gi|123070379|sp|Q1BB09|NRDI_MYCSS Protein nrdI >gi|166233922|sp|A3PXF8|NRDI_MYCSJ Protein nrdI >gi|166233923|sp|A1UE06|NRDI_MYCSK Protein nrdI >gi|108769203|gb|ABG07925.1| nrdI protein [Mycobacterium sp. MCS] >gi|119693991|gb|ABL91064.1| NrdI protein [Mycobacterium sp. KMS] >gi|126234185|gb|ABN97585.1| NrdI protein [Mycobacterium sp. JLS] (152 aa)
Score = 280, Expect = 8.1e-24, Identities = 63/139 (45%), Positives = 85/139 (61%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQK-DEPDEILESKIPTVNHPFILLTPTYAGGLGK-----LKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           IVY+SS S NTHRF+ KL     R+PI  +  +PD + E        P++L+ PTY GG          G VPK V  FLNN  NR+  + VIA+GNTNF   +  AGD++S+K  +P+LY+FEL+GT  DV  V      FW++
  S:     4 IVYFSSVSENTHRFVEKLELPATRIPILGRIQDPDFVRE--------PYVLVLPTYGGGHANGPDPDAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNTNFGAEFGYAGDVVSRKCGVPYLYRFELMGTTDDVLAVRAGLENFWKE 140
>gi|23465251|ref|NP_695854.1| ribonucleotide reductase stimulatory protein [Bifidobacterium longum NCC2705] >gi|23325882|gb|AAN24490.1| NrdI-like protein [Bifidobacterium longum NCC2705] (135 aa)
Score = 280, Expect = 8.9e-24, Identities = 59/129 (45%), Positives = 82/129 (63%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVN--HPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           +VY+SS S NT RF+    C+     I     P   L +  P +N   P++++ PTY GG+  +K AVP  VK+FLN+P NR   + VIASGNTNF + YC AGDII+ K ++P+LY++EL+GT  D   V
  S:     1 MVYFSSASENTARFVA--GCRLQDEGINVYRIP---LRAAAPALNVREPYVIMVPTYGGGV--VKKAVPIQVKRFLNDPANREWIRGVIASGNTNFGEAYCAAGDIIAAKCKVPYLYRYELMGTPEDTAAV 124
>gi|68535547|ref|YP_250252.1| ribonucleotide reductase stimulatory protein [Corynebacterium jeikeium K411] >gi|68263146|emb|CAI36634.1| NrdI protein involved in ribonucleotide reduction [Corynebacterium jeikeium K411] (147 aa)
Score = 279, Expect = 1.1e-23, Identities = 57/130 (43%), Positives = 76/130 (58%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGG---LGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
            I Y+SS + NTHRF+ KL     R+P+++ D P          V+ P +L+ PTY GG    G     VPK V KFLN   NR   + VI +GN NF   +  AG++IS K Q+P+LY+FEL+GT  DV  V
  S:     2 LITYFSSTTENTHRFVRKLGLPSSRIPLKRNDAP--------LLVDQPHVLVVPTYGGGAGMTGDYARPVPKQVIKFLNVEQNRKWLRGVIGAGNINFGSDFAKAGEVISAKCQVPYLYRFELMGTEEDVHRV 126
>gi|184199705|ref|YP_001853912.1| putative NrdI protein [Kocuria rhizophila DC2201] >gi|183579935|dbj|BAG28406.1| putative NrdI protein [Kocuria rhizophila DC2201] (128 aa)
Score = 277, Expect = 1.6e-23, Identities = 56/123 (45%), Positives = 80/123 (65%)
  Q:    22 MLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           M +L  + +R+P+  + E        +  V+ P++L+ PTY GG  +  GAVPK V +FLN+PVNR+  + VI SG+TNF + YCIAG I+S K ++P LY+FELLGT+ DV  V +   EFW
  S:     1 MERLEREAVRIPLRPRAE-------GMIRVSRPYVLVLPTYGGG--ERSGAVPKQVVQFLNDPVNRSLLRGVITSGSTNFGEHYCIAGPIVSAKCRVPELYRFELLGTDRDVTRVTEGLREFW 114
>gi|7674143|sp|O69272|NRDI_CORAM Protein nrdI >gi|3077612|emb|CAA70764.1| NrdI protein [Corynebacterium ammoniagenes] (144 aa)
Score = 276, Expect = 2.1e-23, Identities = 59/136 (43%), Positives = 90/136 (66%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGL---GKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSD--------VENVIKIGNE 142
            +VY SS ++NTHRF+ KL+   +R+P+  KDEP          VN P++L+ PTY GG+   G+    VP+ V +FLNN  NR+  +AV+A GN+NF   +  AG++IS K ++P++Y+FE++G   D        V+N  K+G E
  S:     2 LVVYSSSVTDNTHRFVQKLDLPNVRIPLRLKDEP--------LIVNEPYVLVCPTYGGGVSLTGENSRPVPRQVIRFLNNEHNRSFIRAVVAGGNSNFGADFGKAGEVISAKCKVPYVYRFEMMGNEDDVRICRGGLVQNAAKLGLE 140
>gi|120403035|ref|YP_952864.1| ribonucleotide reductase stimulatory protein [Mycobacterium vanbaalenii PYR-1] >gi|166233925|sp|A1T6Q8|NRDI_MYCVP Protein nrdI >gi|119955853|gb|ABM12858.1| NrdI protein [Mycobacterium vanbaalenii PYR-1] (152 aa)
Score = 276, Expect = 2.3e-23, Identities = 61/137 (44%), Positives = 82/137 (59%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGK-----LKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           +VY+SS S NTHRF+ KL     R+PI  + + DE           P++L+ PTY GG          G VPK V  FLN+  NR+  + VIA+GNTNF   +  AG I+S+K  +PFLY+FEL+GT  DV  V +   +FW
  S:     4 LVYFSSVSENTHRFVEKLGLPATRIPIHGRIQVDE-----------PYVLVLPTYGGGHANGPDPDRGGYVPKQVIAFLNDEHNRSLIRGVIAAGNTNFGAEFGYAGVIVSRKCGVPFLYRFELMGTTDDVFAVRQGLTDFW 134
>gi|114766104|ref|ZP_01445113.1| ribonucleotide reductase protein [Roseovarius sp. HTCC2601] >gi|114541659|gb|EAU44700.1| ribonucleotide reductase protein [Roseovarius sp. HTCC2601] (137 aa)
Score = 276, Expect = 2.6e-23, Identities = 61/137 (44%), Positives = 82/137 (59%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW 144
           IVY+SS S NT RF+  L     R+P+     P  +L  +IP     F+L+ PTYA G G+  GAVPK V +FLN+P +R   + VI  GN NF  TY +A D+I++K  +P LYKFEL GT +D+  V    + FW
  S:     4 IVYFSSASGNTARFVDGLGMLASRIPVS----PKAVL-GRIP---EEFVLICPTYADGEGR--GAVPKQVIRFLNDPDHRRRLRGVIGGGNRNFGATYGLAADVIAKKCSVPLLYKFELAGTLTDIARVKDGLHAFW 130
>gi|183981655|ref|YP_001849946.1| NrdI protein [Mycobacterium marinum M] >gi|183174981|gb|ACC40091.1| NrdI protein [Mycobacterium marinum M] (153 aa)
Score = 275, Expect = 3.1e-23, Identities = 61/139 (43%), Positives = 85/139 (61%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGG-------LGKLKGA-VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+ KL     R+P+  + E DE           P++L+ PTY GG       LG   G  VPK V  FLNN  NR+  + VIA+GN NF   +  AG+++S+K  +P+LY+FEL+GT  DV  V     +FW++
  S:     7 LVYFSSVSENTHRFVQKLGLPATRIPLHGRIEVDE-----------PYVLILPTYGGGRANPDLDLGSNAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNNNFGAEFAYAGNVVSRKCGVPYLYRFELMGTADDVAAVRAGLADFWKE 142
>gi|118617478|ref|YP_905810.1| ribonucleotide reductase stimulatory protein [Mycobacterium ulcerans Agy99] >gi|118569588|gb|ABL04339.1| NrdI protein [Mycobacterium ulcerans Agy99] (153 aa)
Score = 274, Expect = 4.5e-23, Identities = 61/139 (43%), Positives = 85/139 (61%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGG-------LGKLKGA-VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +VY+SS S NTHRF+ KL     R+P+  + E DE           P++L+ PTY GG       LG   G  VPK V  FLNN  NR+  + VIA+GN NF   +  AG+++S+K  +P+LY+FEL+GT  DV  V     +FW++
  S:     7 LVYFSSVSENTHRFVQKLGFPATRIPLHGRIEVDE-----------PYVLILPTYGGGRANPDLDLGSNAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNNNFGAEFAYAGNVVSRKCGVPYLYRFELMGTADDVAAVRAGLADFWKE 142
>gi|92112511|ref|YP_572439.1| nrdI protein [Chromohalobacter salexigens DSM 3043] >gi|122420809|sp|Q1R0L8|NRDI_CHRSD Protein nrdI >gi|91795601|gb|ABE57740.1| nrdI protein [Chromohalobacter salexigens DSM 3043] (134 aa)
Score = 272, Expect = 7.4e-23, Identities = 53/129 (41%), Positives = 79/129 (61%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           +VY+S++S NT RF+ KL+    R+P  + D P          V  P++L+ PTY  G G  + AVP PV +FLN+P NR   + V+A GNTNF   + +AG +++ K ++P L++FEL+GT  DV  V
  S:     4 VVYFSTQSGNTRRFVEKLDVPAQRIPRSRNDAPLR--------VTRPYVLILPTY--GDGDPRTAVPGPVIRFLNDPRNRALIQGVVAGGNTNFGAAFGLAGRVVAHKCEVPLLHRFELMGTPEDVAKV 122
>gi|62425854|ref|ZP_00380985.1| COG1780: Protein involved in ribonucleotide reduction [Brevibacterium linens BL2] (137 aa)
Score = 271, Expect = 8.7e-23, Identities = 61/130 (46%), Positives = 76/130 (58%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
            +VYYSS S  T RF+ KL     RLP+  KDE           ++ PF+L+TPTY  G G  +GAVPK V KFLN   NR +   VI +GNTNF + YC A   ++ K  +P LY+ ELLGT  DVE V
  S:     2 LLVYYSSSSEYTDRFVSKLRHPSRRLPLLTKDE--------TLAIDEPFVLVTPTY--GAGPNRGAVPKQVIKFLNIESNRRHLVGVIGAGNTNFGEEYCRAAHKVAAKCNVPVLYRVELLGTPEDVEAV 121
>gi|183601893|ref|ZP_02963262.1| ribonucleotide reductase stimulatory protein [Bifidobacterium animalis subsp. lactis HN019] >gi|183218778|gb|EDT89420.1| ribonucleotide reductase stimulatory protein [Bifidobacterium animalis subsp. lactis HN019] (141 aa)
Score = 271, Expect = 8.8e-23, Identities = 57/129 (44%), Positives = 78/129 (60%)
  Q:     8 IVYYSSKSNNTHRFMLKLN-----CKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           +VY+SS S NT RF+   +         R+P++    P  + E        P+I++ PTY GG    + AVP  VK+FLN+P NR   + VIASGNTNF + Y  AG IIS+K  +P +Y+FEL+GT  DV  V
  S:     4 VVYFSSASRNTERFVEHCDFPSCGVNVFRIPLQPNAAPLNVRE--------PYIIIVPTYGGG--DARKAVPPQVKRFLNDPANREWIRGVIASGNTNFGEAYAAAGPIISRKCHVPLMYRFELMGTREDVHAV 127
>gi|145224885|ref|YP_001135563.1| ribonucleotide reductase stimulatory protein [Mycobacterium gilvum PYR-GCK] >gi|189030486|sp|A4TDU4|NRDI_MYCGI Protein nrdI >gi|145217371|gb|ABP46775.1| NrdI protein [Mycobacterium gilvum PYR-GCK] (148 aa)
Score = 271, Expect = 9.3e-23, Identities = 59/138 (42%), Positives = 83/138 (60%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGK-----LKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           IVY+SS S NTHRF+ KL    +R+P++ +   +E           P++L+ PTY GG          G VPK V  FLN+  NR+  + VIA+GNTNF   +  AG ++S+K  +PFLY+FEL+GT  DV  V     +FW+
  S:     4 IVYFSSVSENTHRFVQKLELPAIRIPLKDRIRVEE-----------PYVLILPTYGGGHANGPDPDRGGYVPKQVIAFLNDEHNRSLIRGVIAAGNTNFGAEFGYAGVVVSRKCDVPFLYRFELMGTTDDVFAVRAGLQDFWK 135
>gi|38234490|ref|NP_940257.1| ribonucleotide reductase stimulatory protein [Corynebacterium diphtheriae NCTC 13129] >gi|38200753|emb|CAE50456.1| Conserved hypothetical protein [Corynebacterium diphtheriae] (141 aa)
Score = 268, Expect = 1.9e-22, Identities = 57/129 (44%), Positives = 78/129 (60%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           ++Y+SS S NTHRF+ K      R+ +  +D+P  I+ +       P++L+TPTY GG   L  AVPK V KFLN   NR+    VI SGN NF   +C AG  I+ K  +P L++FELLGTN+D  +V
  S:     9 VIYFSSVSENTHRFIQKTKLTHQRIGLRTRDDP--IIATA------PYVLITPTYGGG--DLAKAVPKQVIKFLNVEQNRHFLAGVITSGNRNFGPAFCFAGTTIAHKCNVPELHRFELLGTNADAHHV 127
>gi|32491360|ref|NP_871614.1| ribonucleotide reductase stimulatory protein [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31340245|sp|Q8D1U5|NRDI_WIGBR Protein nrdI >gi|25166567|dbj|BAC24757.1| nrdI [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (141 aa)
Score = 266, Expect = 3.5e-22, Identities = 67/142 (47%), Positives = 85/142 (59%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
           +VY+SS S NTHRF+ KL     R+P+  K E           +  P+IL+ P+Y  G+  L  AVP  V  FLN   N+   K VI SGN NF   +CIAG+IIS+K ++P LYKFELLGTN DV NV    N+FW+K N 
  S:     4 LVYFSSSSENTHRFVKKLCIPAKRIPLIDKKEFQ---------IKSPYILVIPSYNNGI--LDTAVPHQVTNFLNTLHNKFFLKGVIGSGNKNFGVNFCIAGNIISKKYKVPLLYKFELLGTNKDVINVKNGINKFWKKLNL 134
>gi|38234438|ref|NP_940205.1| ribonucleotide reductase stimulatory protein [Corynebacterium diphtheriae NCTC 13129] >gi|38200701|emb|CAE50397.1| Conserved hypothetical protein [Corynebacterium diphtheriae] (141 aa)
Score = 257, Expect = 4.0e-21, Identities = 57/130 (43%), Positives = 79/130 (60%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGL---GKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
            +VY+SS + NT RF+ KL     R+P+ + D P  I E        P++L+ PTY GG    G     VP  V KFLNN  NR+  +AVI+ GN+NF   +  AGD+ISQK  +P++Y+FEL+G + DV  V
  S:     2 LVVYFSSATENTKRFVEKLGFPSQRIPLTKSDAPLRIDE--------PYVLVCPTYGGGASISGNNTKPVPVQVIKFLNNEHNRSFIRAVISGGNSNFGLDFGKAGDVISQKCSVPYVYRFELMGNDEDVRLV 126
>gi|163867487|ref|YP_001608686.1| ribonucleotide reductase stimulatory protein [Bartonella tribocorum CIP 105476] >gi|189030482|sp|A9IML0|NRDI_BART1 Protein nrdI >gi|161017133|emb|CAK00691.1| NrdI protein [Bartonella tribocorum CIP 105476] (132 aa)
Score = 253, Expect = 1.3e-20, Identities = 58/140 (41%), Positives = 78/140 (55%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVYYSS + NT  F+ +L  +  ++    K +P          V  P++L+ PTYA G G+  GAVPK V  FLN   NR   + VI SGN NF   Y +A  II++K  +P LY+FEL GT+ DV  V K    FW++
  S:     3 LIVYYSSATGNTEHFVSQLGQRLFKI---DKRKPSAF-------VGEPYVLVVPTYADGEGR--GAVPKAVIHFLNEAENRKLIRGVIGSGNRNFGRYYSLASKIIAEKCGVPCLYRFELRGTDEDVICVKKGLERFWKQ 130
>gi|49475005|ref|YP_033046.1| ribonucleotide reductase stimulatory protein [Bartonella henselae str. Houston-1] >gi|81648411|sp|Q6G5I3|NRDI_BARHE Protein nrdI >gi|49237810|emb|CAF27005.1| nrdI protein [Bartonella henselae str. Houston-1] (132 aa)
Score = 243, Expect = 1.6e-19, Identities = 56/140 (40%), Positives = 80/140 (57%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVYYSS + NT  F+ +L+ +  ++    K +P  +       V+ P++L+ PTYA G GK+  AVPK V +FLN   NR   + VI  GN NF   Y +A  II++K  +P LY+FEL GT  D+  V K    FW++
  S:     3 LIVYYSSATGNTEYFVSQLDQRLFKI---DKKKPSML-------VDEPYVLVVPTYADGEGKM--AVPKAVIRFLNEDENRKLIRGVIGGGNRNFGRYYSLASKIIAEKCFVPCLYRFELRGTEEDIICVKKGLERFWKQ 130
>gi|121602259|ref|YP_988674.1| ribonucleotide reductase stimulatory protein [Bartonella bacilliformis KC583] >gi|166233913|sp|A1URS1|NRDI_BARBK Protein nrdI >gi|120614436|gb|ABM45037.1| NrdI protein [Bartonella bacilliformis KC583] (130 aa)
Score = 238, Expect = 6.1e-19, Identities = 57/140 (40%), Positives = 79/140 (56%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVYYSS + NT  F+ +L  +  ++        D+ + S +  V  P++L+ PTYA G G+   AVPKPV  FLN   NR   + VI  GN NF   Y +A  II++K  +P LY FEL GT+ DV  V K   +FW++
  S:     3 LIVYYSSATGNTEHFVSQLGQRFFKI--------DKKISSAL--VYEPYVLVVPTYADGEGR--KAVPKPVIHFLNEVENRKLMRGVIGGGNRNFGRNYSLASKIIAEKCSVPCLYNFELRGTDEDVICVKKGLEKFWKQ 130
>gi|49473848|ref|YP_031890.1| ribonucleotide reductase stimulatory protein [Bartonella quintana str. Toulouse] >gi|81647266|sp|Q6G0R4|NRDI_BARQU Protein nrdI >gi|49239351|emb|CAF25684.1| nrdI protein [Bartonella quintana str. Toulouse] (132 aa)
Score = 236, Expect = 1.2e-18, Identities = 57/140 (40%), Positives = 80/140 (57%)
  Q:     7 FIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
            IVYYSS + NT  F+ +L  +  ++    K +P  +       V+ P++L+ PTYA G G++  AVPK V +FLN   NR   + VI  GN NF   Y +A  II++K  +P LY+FEL GTN DV  V K    FW++
  S:     3 LIVYYSSATGNTEYFVSQLGQRLFKI---DKKKPSVL-------VDEPYVLVVPTYADGEGRM--AVPKVVIRFLNECENRKLIRGVIGGGNRNFGCYYNLASKIIAEKCFVPCLYRFELRGTNEDVICVKKGLERFWKQ 130
>gi|57867422|ref|YP_189080.1| nrdI protein [Staphylococcus epidermidis RP62A] >gi|57638080|gb|AAW54868.1| nrdI protein [Staphylococcus epidermidis RP62A] (137 aa)
Score = 192, Expect = 1.3e-13, Identities = 48/127 (37%), Positives = 74/127 (58%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLRLPIEQ-KDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVI 137
           Y S++  T RFM K+  + +++ + + KDEP EI        N+ ++L+TPTY        G VP PV+ FL N  N+NN  AV++SGN N+   + IAGD IS++  +  + K+EL G   DV  ++
  S:    17 YYSRTRQTERFMEKV-LEQIQIDVHRIKDEPLEI--------NNSYVLITPTYD------FGEVPAPVETFLKNETNQNNLIAVMSSGNRNWGTNFAIAGDTISKRFNVELIGKYELAGNMVDVNKLV 129
>gi|169187244|ref|ZP_02847404.1| NrdI protein [Paenibacillus sp. JDR-2] >gi|169006076|gb|EDS52927.1| NrdI protein [Paenibacillus sp. JDR-2] (137 aa)
Score = 183, Expect = 1.6e-12, Identities = 50/131 (38%), Positives = 70/131 (53%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIK 138
           +V Y S++ N  RF+ KLN + +  PI + D  DE           P++L+T  Y  G G+    VP+ V  FLN   N NN + V ASGN N+ D +  + D IS    +P L KFEL GTN D+E  ++
  S:     2 LVVYDSRTGNVKRFINKLNMRAV--PIGELDIVDE-----------PYVLVT--YTTGFGQ----VPERVMNFLNR--NSNNLQGVSASGNRNWGDGFAKSADTISSLFNVPVLSKFELSGTNQDMEYFVE 111
>gi|62425396|ref|ZP_00380530.1| COG1780: Protein involved in ribonucleotide reduction [Brevibacterium linens BL2] (74 aa)
Score = 179, Expect = 4.1e-12, Identities = 33/68 (48%), Positives = 46/68 (67%)
  Q:    81 LNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           +N+  NR   + VI +GNTNF + YC+AG IIS K Q+P LY+FELLGT  D++ V    + FW++ N
  S:     1 MNDSANRAFIRGVITAGNTNFGEHYCLAGPIISSKCQVPELYRFELLGTQRDIDTVNTGLSRFWDQAN 68
>gi|167756376|ref|ZP_02428503.1| hypothetical protein CLORAM_01909 [Clostridium ramosum DSM 1402] >gi|167703784|gb|EDS18363.1| hypothetical protein CLORAM_01909 [Clostridium ramosum DSM 1402] (117 aa)
Score = 169, Expect = 5.6e-11, Identities = 45/133 (33%), Positives = 71/133 (53%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGN 141
           V ++S++ N    + +L+   L   I   DE           V+ PF+L+T  Y  G G     VP  V+ FLN+  N ++ K VI SG+  + + +C AGD+I+++  +P LYK E  GT+ D+E + KI N
  S:     3 VVFASRTGNVQSIVDRLSVDALE--ISSGDE----------AVSEPFLLIT--YTDGYGD----VPMEVESFLNS--NGDHLKGVIVSGDQGYGEAFCKAGDVIAEQYNVPCLYKVENDGTDEDIEEIKKIIN 115
>gi|15902200|ref|NP_357750.1| hypothetical protein spr0156 [Streptococcus pneumoniae R6] >gi|15457697|gb|AAK98960.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] (200 aa)
Score = 166, Expect = 1.3e-10, Identities = 47/135 (34%), Positives = 70/135 (51%)
  Q:    11 YSSKSNNTHRFMLKLNCKCL----RLPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           Y S S NT  F+ +L    L    R+ +++    D + E K    ++HP++   PTY  GG G   G V     PV  F+    N + C  V+ SGN NFN+ YC+     SQ+   P L  FE+ G   D+++V  I  + +E
  S:    52 YISLSGNTESFVTRLKDYLLSQYKRIEVQKIHIKDLVKEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYE 195
>gi|182683154|ref|YP_001834901.1| hypothetical protein SPCG_0184 [Streptococcus pneumoniae CGSP14] >gi|182628488|gb|ACB89436.1| hypothetical protein SPCG_0184 [Streptococcus pneumoniae CGSP14] (200 aa)
Score = 166, Expect = 1.4e-10, Identities = 46/135 (34%), Positives = 69/135 (51%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLR----LPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAVP---KPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           Y S S NT  F+ +L    L     + +++    D + E K    ++HP++   PTY  GG G   G V     PV  F+    N + C  V+ SGN NFN+ YC+     SQ+   P L  FE+ G   D+++V  I  + +E
  S:    52 YISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVKEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILMTPVGDFIAYGYNASKCSGVVGSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYE 195
>gi|76788158|ref|YP_330497.1| hypothetical protein SAK_1902 [Streptococcus agalactiae A909] >gi|77405030|ref|ZP_00782130.1| nrdI protein [Streptococcus agalactiae H36B] >gi|76563215|gb|ABA45799.1| nrdI protein [Streptococcus agalactiae A909] >gi|77176324|gb|EAO79093.1| nrdI protein [Streptococcus agalactiae H36B] (151 aa)
Score = 165, Expect = 1.9e-10, Identities = 47/129 (36%), Positives = 69/129 (53%)
  Q:    11 YSSKSNNTHRFMLKL--------NCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTY-AGGLGKLKG---AVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           Y S S NT  F+ +L        NC+   + I++++        +   V+ PF+ L PTY  GG G   G    +  P+  F+    N  NC  ++ SGN NFN+ YC+     S++   P L  FEL GT+SDVE +  I
  S:     8 YISLSGNTQSFVKRLSEQLSTWHNCQVSTINIKEQNH-------QTFPVDQPFVALLPTYLEGGNGIDNGDQEILTIPLGDFIAAHNNVKNCIGIVGSGNRNFNNQYCLTAKQYSERFGFPMLGDFELRGTSSDVERIANI 141
>gi|22538079|ref|NP_688930.1| hypothetical protein SAG1942 [Streptococcus agalactiae 2603V/R] >gi|25011968|ref|NP_736363.1| hypothetical protein gbs1930 [Streptococcus agalactiae NEM316] >gi|76797937|ref|ZP_00780198.1| nrdI protein [Streptococcus agalactiae 18RS21] >gi|77407868|ref|ZP_00784620.1| nrdI protein [Streptococcus agalactiae COH1] >gi|77411875|ref|ZP_00788208.1| nrdI protein [Streptococcus agalactiae CJB111] >gi|77412907|ref|ZP_00789111.1| nrdI protein [Streptococcus agalactiae 515] >gi|22534984|gb|AAN00803.1|AE014279_10 nrdI protein [Streptococcus agalactiae 2603V/R] >gi|24413510|emb|CAD47589.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586711|gb|EAO63208.1| nrdI protein [Streptococcus agalactiae 18RS21] >gi|77161047|gb|EAO72154.1| nrdI protein [Streptococcus agalactiae 515] >gi|77162096|gb|EAO73074.1| nrdI protein [Streptococcus agalactiae CJB111] >gi|77173513|gb|EAO76630.1| nrdI protein [Streptococcus agalactiae COH1] (151 aa)
Score = 165, Expect = 1.9e-10, Identities = 47/129 (36%), Positives = 69/129 (53%)
  Q:    11 YSSKSNNTHRFMLKL--------NCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTY-AGGLGKLKG---AVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           Y S S NT  F+ +L        NC+   + I++++        +   V+ PF+ L PTY  GG G   G    +  P+  F+    N  NC  ++ SGN NFN+ YC+     S++   P L  FEL GT+SDVE +  I
  S:     8 YISLSGNTQSFVKRLSEQLSTWHNCQVSTINIKEQNH-------QTFPVDQPFVALLPTYLEGGNGIDNGDQEILTIPLGDFIAAHNNVKNCIGIVGSGNRNFNNQYCLTAKQYSERFGFPMLGDFELRGTSSDVERIANI 141
>gi|27467430|ref|NP_764067.1| ribonucleotide reductase stimulatory protein [Staphylococcus epidermidis ATCC 12228] >gi|57866330|ref|YP_187989.1| ribonucleotide reductase stimulatory protein [Staphylococcus epidermidis RP62A] >gi|38258097|sp|Q8CQ03|NRDI_STAES Protein nrdI >gi|73921259|sp|Q5HR00|NRDI_STAEQ Protein nrdI >gi|27314973|gb|AAO04109.1|AE016745_208 NrdI protein [Staphylococcus epidermidis ATCC 12228] >gi|57636988|gb|AAW53776.1| nrdI protein [Staphylococcus epidermidis RP62A] (132 aa)
Score = 164, Expect = 2.4e-10, Identities = 50/134 (37%), Positives = 72/134 (53%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSD-VENVIKIGN 141
           +VYYS  S N  RF+ +   K         D  +   ++   +VN P+IL+T T         G VP+PV+ FLN  VN    +AV ASGN N+   +  AG  IS++ ++P + KFE+ GTN D +E   K+GN
  S:     3 VVYYSF-SGNVRRFISRAGIK---------DTFEITQDNCNESVNEPYILVTGTIG------FGEVPQPVQSFLN--VNHTQLQAVAASGNRNWGQNFAKAGHTISEEYKVPLMMKFEVQGTNKDIIEFKDKVGN 119
>gi|116516077|ref|YP_815679.1| hypothetical protein SPD_0160 [Streptococcus pneumoniae D39] >gi|73921252|sp|Q8DRF4|NRDIL_STRR6 Putative nrdI-like protein >gi|116076653|gb|ABJ54373.1| nrdI protein, putative [Streptococcus pneumoniae D39] (156 aa)
Score = 164, Expect = 2.7e-10, Identities = 47/135 (34%), Positives = 70/135 (51%)
  Q:    11 YSSKSNNTHRFMLKLNCKCL----RLPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           Y S S NT  F+ +L    L    R+ +++    D + E K    ++HP++   PTY  GG G   G V     PV  F+    N + C  V+ SGN NFN+ YC+     SQ+   P L  FE+ G   D+++V  I  + +E
  S:     8 YISLSGNTESFVTRLKDYLLSQYKRIEVQKIHIKDLVKEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYE 151
>gi|55820242|ref|YP_138684.1| hypothetical protein stu0144 [Streptococcus thermophilus LMG 18311] >gi|55822132|ref|YP_140573.1| hypothetical protein str0144 [Streptococcus thermophilus CNRZ1066] >gi|55736227|gb|AAV59869.1| ribonucleotide reductase (NrdI family protein) [Streptococcus thermophilus LMG 18311] >gi|55738117|gb|AAV61758.1| ribonucleotide reductase (NrdI family protein) [Streptococcus thermophilus CNRZ1066] (175 aa)
Score = 163, Expect = 2.7e-10, Identities = 50/129 (38%), Positives = 66/129 (51%)
  Q:    11 YSSKSNNTHRFM------LKLN--CKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           Y S S NT  F+      L LN    C ++ I++       L  +   V+ PF+ L PTY  GG G   G V     P+  F+    N   C  +I SGN NFN+ YC+     SQ+   P L  FEL GT SD+E +  I
  S:    31 YISLSGNTQSFVKRMSDYLSLNHGINCRQINIKE-------LNHETFQVDEPFVALLPTYLEGGNGVDNGDVEILTNPLGDFIAAHDNHKRCFGIIGSGNRNFNNQYCLTAKQYSQRFGFPMLGDFELRGTQSDIERLAPI 164
>gi|75758221|ref|ZP_00738346.1| NrdI protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74494275|gb|EAO57366.1| NrdI protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (123 aa)
Score = 163, Expect = 2.9e-10, Identities = 40/127 (31%), Positives = 68/127 (53%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           ++ + SK+ N  RF+ KL    +++       PD ++E        PFIL+T  Y  G G+    VP+  + FL    N +  + V +SGN N+ + +  AG IIS++  +P +++FEL GT  D++
  S:     4 MIVFDSKTGNVKRFIKKLGIPAVQI------TPDLVME-------QPFILIT--YTSGFGQ----VPETTQSFLQ--ANNSFLQGVASSGNRNWGEHFAAAGRIISEQYHVPLIHQFELSGTRKDIQ 109
>gi|148983569|ref|ZP_01816888.1| hypothetical protein CGSSp3BS71_05544 [Streptococcus pneumoniae SP3-BS71] >gi|147923716|gb|EDK74828.1| hypothetical protein CGSSp3BS71_05544 [Streptococcus pneumoniae SP3-BS71] (156 aa)
Score = 160, Expect = 6.2e-10, Identities = 46/135 (34%), Positives = 69/135 (51%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLR----LPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           Y S S NT  F+ +L    L     + +++    D + E K    ++HP++   PTY  GG G   G V     PV  F+    N + C  V+ SGN NFN+ YC+     SQ+   P L  FE+ G   D+++V  I  + +E
  S:     8 YISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVKEGKNFYEIDHPYVAFLPTYLEGGNGVDSGDVEILTTPVGDFIAYGNNASKCFGVVGSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYE 151
>gi|30019503|ref|NP_831134.1| ribonucleotide reductase stimulatory protein [Bacillus cereus ATCC 14579] >gi|75759353|ref|ZP_00739450.1| NrdI protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168135879|ref|ZP_02579108.1| ribonucleotide reductase stimulatory protein [Bacillus cereus B4264] >gi|168143194|ref|ZP_02586423.1| ribonucleotide reductase stimulatory protein [Bacillus cereus G9842] >gi|29895047|gb|AAP08335.1| NrdI protein [Bacillus cereus ATCC 14579] >gi|74493185|gb|EAO56304.1| NrdI protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|157955306|gb|ABW06023.1| NrdI [Bacillus thuringiensis serovar aizawai] >gi|157955308|gb|ABW06024.1| NrdI [Bacillus thuringiensis serovar canadensis] >gi|157955316|gb|ABW06030.1| NrdI [Bacillus thuringiensis serovar pakistani] >gi|157955326|gb|ABW06038.1| NrdI [Bacillus thuringiensis serovar entomocidus] >gi|157955330|gb|ABW06041.1| NrdI [Bacillus thuringiensis serovar galleriae] >gi|157955334|gb|ABW06044.1| NrdI [Bacillus thuringiensis serovar kurstaki] >gi|157955338|gb|ABW06047.1| NrdI [Bacillus thuringiensis serovar thuringiensis] >gi|157955342|gb|ABW06050.1| NrdI [Bacillus thuringiensis serovar tolworthi] >gi|157955346|gb|ABW06053.1| NrdI [Bacillus thuringiensis serovar alesti] >gi|157955350|gb|ABW06056.1| NrdI [Bacillus thuringiensis serovar colmeri] >gi|157955354|gb|ABW06059.1| NrdI [Bacillus thuringiensis serovar dakota] >gi|157955358|gb|ABW06062.1| NrdI [Bacillus thuringiensis serovar darmstadiensis] >gi|157955362|gb|ABW06065.1| NrdI [Bacillus thuringiensis serovar dendrolimus] >gi|157955366|gb|ABW06068.1| NrdI [Bacillus thuringiensis serovar galechiae] >gi|157955370|gb|ABW06071.1| NrdI [Bacillus thuringiensis serovar indiana] >gi|157955374|gb|ABW06074.1| NrdI [Bacillus thuringiensis serovar morrisoni] >gi|157955378|gb|ABW06077.1| NrdI [Bacillus thuringiensis serovar ostriniae] >gi|157955382|gb|ABW06080.1| NrdI [Bacillus thuringiensis serovar sotto] >gi|157955386|gb|ABW06083.1| NrdI [Bacillus thuringiensis serovar subtoxicus] >gi|157955390|gb|ABW06086.1| NrdI [Bacillus thuringiensis serovar thompsoni] >gi|157955394|gb|ABW06089.1| NrdI [Bacillus thuringiensis serovar tohokuensis] >gi|157955399|gb|ABW06093.1| NrdI [Bacillus thuringiensis serovar toumanoffi] >gi|157955403|gb|ABW06096.1| NrdI [Bacillus thuringiensis serovar wuhanensis] >gi|157955407|gb|ABW06099.1| NrdI [Bacillus cereus] (119 aa)
Score = 160, Expect = 6.4e-10, Identities = 49/127 (38%), Positives = 64/127 (50%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           +V Y S + N  RF+ KLN     +P  Q DE           ++  FIL+T  Y  G G     VP+ V  FL    N    K V ASGN N+ D +  + D IS K ++P + KFEL GTN+DVE
  S:     2 LVAYDSMTGNVKRFIHKLN-----MPAVQIDED--------LVIDEDFILIT--YTTGFGN----VPERVLDFLER--NNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVE 107
>gi|116627098|ref|YP_819717.1| hypothetical protein STER_0199 [Streptococcus thermophilus LMD-9] >gi|116100375|gb|ABJ65521.1| Protein involved in ribonucleotide reduction [Streptococcus thermophilus LMD-9] (152 aa)
Score = 160, Expect = 7.4e-10, Identities = 49/129 (37%), Positives = 66/129 (51%)
  Q:    11 YSSKSNNTHRFM------LKLN--CKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           Y S S NT  F+      L LN    C ++ I++       L  +   V+ PF+ + PTY  GG G   G V     P+  F+    N   C  +I SGN NFN+ YC+     SQ+   P L  FEL GT SD+E +  I
  S:     8 YISLSGNTQSFVKRMSDYLSLNHGINCRQINIKE-------LNHETFQVDEPFVAILPTYLEGGNGVDNGDVEILTNPLGDFIAAHDNHKRCFGIIGSGNRNFNNQYCLTAKQYSQRFGFPMLGDFELRGTQSDIERLAPI 141
>gi|163939258|ref|YP_001644142.1| ribonucleotide reductase stimulatory protein [Bacillus weihenstephanensis KBAB4] >gi|163861455|gb|ABY42514.1| NrdI protein [Bacillus weihenstephanensis KBAB4] (119 aa)
Score = 160, Expect = 7.5e-10, Identities = 49/127 (38%), Positives = 64/127 (50%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           +V Y S + N  RF+ KLN     +P  Q DE           ++  FIL+T  Y  G G     VP+ V  FL    N    K V ASGN N+ D +  + D IS K ++P + KFEL GTN+DVE
  S:     2 LVAYDSMTGNVKRFIHKLN-----MPAVQIDEA--------LVLDEDFILIT--YTTGFGN----VPERVLDFLER--NNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVE 107
>gi|116511805|ref|YP_809021.1| ribonucleotide reductase stimulatory protein [Lactococcus lactis subsp. cremoris SK11] >gi|123025462|sp|Q02ZM3|NRDI_LACLS Protein nrdI >gi|116107459|gb|ABJ72599.1| Ribonucleotide reduction protein [Lactococcus lactis subsp. cremoris SK11] (140 aa)
Score = 160, Expect = 7.8e-10, Identities = 44/133 (33%), Positives = 66/133 (49%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGA--VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEF 143
           Y S +  T RF+ K +   + +       PD+ LE     ++ PF+L+TP+YA     +  +  V  PV  F+    N  +C+ +I +GN NF   Y      +S K QIP LY FE  GT +DV  V K+  + 
  S:     5 YFSVTGQTRRFVSKTDLPNVEI------TPDDDLE-----MDEPFLLITPSYAEESPTVSKSIDVMDPVFDFMAYNDNYKHCRGIIGTGNRNFAGIYIFTAKEVSAKYQIPLLYDFEFNGTPADVAAVEKLAAQL 128
>gi|15672958|ref|NP_267132.1| ribonucleotide reductase stimulatory protein [Lactococcus lactis subsp. lactis Il1403] >gi|18202796|sp|Q9CGW6|NRDI_LACLA Protein nrdI >gi|12723919|gb|AAK05074.1|AE006332_3 ribonucleotide reductase [Lactococcus lactis subsp. lactis Il1403] (140 aa)
Score = 158, Expect = 1.0e-09, Identities = 45/133 (33%), Positives = 65/133 (48%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGA--VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEF 143
           Y S +  T RF+ K N   + +       PD+ +E     +N PF+L+TP+YA     +  +  V  PV  F+    N  +C  +I +GN NF   Y      +S K QIP LY FE  GT +DV  V K+  + 
  S:     5 YFSVTGQTRRFVSKTNLPNVEI------SPDDDIE-----MNEPFLLITPSYAEESPTVSKSIDVMDPVFDFMAYNDNYKHCLGIIGTGNRNFAGIYIFTAKELSAKYQIPLLYDFEFNGTPADVAAVEKLATQL 128
>gi|111657784|ref|ZP_01408503.1| hypothetical protein SpneT_02001020 [Streptococcus pneumoniae TIGR4] (160 aa)
Score = 158, Expect = 1.1e-09, Identities = 46/135 (34%), Positives = 69/135 (51%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLR----LPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           Y S S NT  F+ +L    L     + +++    D + E K    ++HP++   PTY  GG G   G V     PV  F+    N + C  V+ SGN NFN+ YC+     SQ+   P L  FE+ G   D+++V  I  + +E
  S:    12 YISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVKEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYE 155
>gi|148987905|ref|ZP_01819368.1| hypothetical protein CGSSp6BS73_10346 [Streptococcus pneumoniae SP6-BS73] >gi|147926369|gb|EDK77442.1| hypothetical protein CGSSp6BS73_10346 [Streptococcus pneumoniae SP6-BS73] (156 aa)
Score = 158, Expect = 1.2e-09, Identities = 46/135 (34%), Positives = 69/135 (51%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLR----LPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           Y S S NT  F+ +L    L     + +++    D + E K    ++HP++   PTY  GG G   G V     PV  F+    N + C  V+ SGN NFN+ YC+     SQ+   P L  FE+ G   D+++V  I  + +E
  S:     8 YISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVKEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASRCFGVVGSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYE 151
>gi|15900096|ref|NP_344700.1| hypothetical protein SP_0158 [Streptococcus pneumoniae TIGR4] >gi|148992748|ref|ZP_01822391.1| hypothetical protein CGSSp9BS68_03368 [Streptococcus pneumoniae SP9-BS68] >gi|148996593|ref|ZP_01824311.1| hypothetical protein CGSSp11BS70_07855 [Streptococcus pneumoniae SP11-BS70] >gi|149001730|ref|ZP_01826703.1| hypothetical protein CGSSp14BS69_08380 [Streptococcus pneumoniae SP14-BS69] >gi|149005918|ref|ZP_01829647.1| hypothetical protein CGSSp18BS74_07065 [Streptococcus pneumoniae SP18-BS74] >gi|149011037|ref|ZP_01832342.1| hypothetical protein CGSSp19BS75_11293 [Streptococcus pneumoniae SP19-BS75] >gi|149017841|ref|ZP_01834300.1| hypothetical protein CGSSp23BS72_10900 [Streptococcus pneumoniae SP23-BS72] >gi|168483808|ref|ZP_02708760.1| ribonucleotide reductase [Streptococcus pneumoniae CDC1873-00] >gi|168486060|ref|ZP_02710568.1| ribonucleotide reductase [Streptococcus pneumoniae CDC1087-00] >gi|168489354|ref|ZP_02713553.1| ribonucleotide reductase [Streptococcus pneumoniae SP195] >gi|168492370|ref|ZP_02716513.1| ribonucleotide reductase [Streptococcus pneumoniae CDC0288-04] >gi|168493865|ref|ZP_02718008.1| ribonucleotide reductase [Streptococcus pneumoniae CDC3059-06] >gi|168576401|ref|ZP_02722284.1| ribonucleotide reductase [Streptococcus pneumoniae MLV-016] >gi|169832732|ref|YP_001693688.1| ribonucleotide reductase [Streptococcus pneumoniae Hungary19A-6] >gi|194397724|ref|YP_002036875.1| nrdI protein, putative [Streptococcus pneumoniae G54] >gi|20178004|sp|Q97T03|NRDIL_STRPN Putative nrdI-like protein >gi|14971625|gb|AAK74340.1| NrdI family protein [Streptococcus pneumoniae TIGR4] >gi|147757168|gb|EDK64207.1| hypothetical protein CGSSp11BS70_07855 [Streptococcus pneumoniae SP11-BS70] >gi|147760188|gb|EDK67177.1| hypothetical protein CGSSp14BS69_08380 [Streptococcus pneumoniae SP14-BS69] >gi|147762274|gb|EDK69235.1| hypothetical protein CGSSp18BS74_07065 [Streptococcus pneumoniae SP18-BS74] >gi|147764673|gb|EDK71603.1| hypothetical protein CGSSp19BS75_11293 [Streptococcus pneumoniae SP19-BS75] >gi|147928474|gb|EDK79489.1| hypothetical protein CGSSp9BS68_03368 [Streptococcus pneumoniae SP9-BS68] >gi|147931405|gb|EDK82383.1| hypothetical protein CGSSp23BS72_10900 [Streptococcus pneumoniae SP23-BS72] >gi|168995234|gb|ACA35846.1| ribonucleotide reductase [Streptococcus pneumoniae Hungary19A-6] >gi|172042861|gb|EDT50907.1| ribonucleotide reductase [Streptococcus pneumoniae CDC1873-00] >gi|183570869|gb|EDT91397.1| ribonucleotide reductase [Streptococcus pneumoniae CDC1087-00] >gi|183572061|gb|EDT92589.1| ribonucleotide reductase [Streptococcus pneumoniae SP195] >gi|183573395|gb|EDT93923.1| ribonucleotide reductase [Streptococcus pneumoniae CDC0288-04] >gi|183576057|gb|EDT96585.1| ribonucleotide reductase [Streptococcus pneumoniae CDC3059-06] >gi|183577890|gb|EDT98418.1| ribonucleotide reductase [Streptococcus pneumoniae MLV-016] >gi|194357391|gb|ACF55839.1| nrdI protein, putative [Streptococcus pneumoniae G54] (156 aa)
Score = 157, Expect = 1.5e-09, Identities = 46/135 (34%), Positives = 69/135 (51%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLR----LPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWE 145
           Y S S NT  F+ +L    L     + +++    D + E K    ++HP++   PTY  GG G   G V     PV  F+    N + C  V+ SGN NFN+ YC+     SQ+   P L  FE+ G   D+++V  I  + +E
  S:     8 YISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVKEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGSGNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYE 151
>gi|152974877|ref|YP_001374394.1| ribonucleotide reductase stimulatory protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152023629|gb|ABS21399.1| NrdI protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (119 aa)
Score = 155, Expect = 2.4e-09, Identities = 45/127 (35%), Positives = 65/127 (51%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           ++ Y S + N  RF+ KLN   +++             S+   ++  F+L+T  Y  G G     VP+ V +FL    N  N K V ASGN N+ D +  + D IS K ++P + KFEL GTN DVE
  S:     2 LIAYDSMTGNVKRFINKLNMLAVQI-------------SEDLVIDEEFVLIT--YTTGFGN----VPERVLEFLER--NNANLKGVSASGNRNWGDMFGASADKISMKYEVPIVSKFELSGTNKDVE 107
>gi|30261450|ref|NP_843827.1| ribonucleotide reductase stimulatory protein [Bacillus anthracis str. Ames] >gi|42780543|ref|NP_977790.1| ribonucleotide reductase stimulatory protein [Bacillus cereus ATCC 10987] >gi|47526640|ref|YP_017989.1| ribonucleotide reductase stimulatory protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47566239|ref|ZP_00237267.1| nrdI protein [Bacillus cereus G9241] >gi|49184283|ref|YP_027535.1| ribonucleotide reductase stimulatory protein [Bacillus anthracis str. Sterne] >gi|52143991|ref|YP_082840.1| ribonucleotide reductase stimulatory protein [Bacillus cereus E33L] >gi|65318719|ref|ZP_00391678.1| COG1780: Protein involved in ribonucleotide reduction [Bacillus anthracis str. A2012] >gi|118476919|ref|YP_894070.1| ribonucleotide reductase stimulatory protein [Bacillus thuringiensis str. Al Hakam] >gi|165870354|ref|ZP_02215009.1| nrdI protein [Bacillus anthracis str. A0488] >gi|166982002|ref|ZP_02253449.1| ribonucleotide reductase stimulatory protein [Bacillus cereus AH187] >gi|166991997|ref|ZP_02258457.1| ribonucleotide reductase stimulatory protein [Bacillus cereus AH820] >gi|167634483|ref|ZP_02392804.1| nrdI protein [Bacillus anthracis str. A0442] >gi|167639251|ref|ZP_02397523.1| nrdI protein [Bacillus anthracis str. A0193] >gi|170686792|ref|ZP_02878012.1| nrdI protein [Bacillus anthracis str. A0465] >gi|170706230|ref|ZP_02896691.1| nrdI protein [Bacillus anthracis str. A0389] >gi|177651485|ref|ZP_02934274.1| nrdI protein [Bacillus anthracis str. A0174] >gi|190568077|ref|ZP_03020987.1| nrdI protein [Bacillus anthracis Tsiankovskii-I] >gi|196035292|ref|ZP_03102697.1| nrdI protein [Bacillus cereus W] >gi|196040761|ref|ZP_03108060.1| nrdI protein [Bacillus cereus NVH0597-99] >gi|196046525|ref|ZP_03113750.1| nrdI protein [Bacillus cereus 03BB108] >gi|30255304|gb|AAP25313.1| nrdI protein [Bacillus anthracis str. Ames] >gi|42736463|gb|AAS40398.1| nrdI protein [Bacillus cereus ATCC 10987] >gi|47501788|gb|AAT30464.1| nrdI protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47556792|gb|EAL15123.1| nrdI protein [Bacillus cereus G9241] >gi|49178210|gb|AAT53586.1| nrdI protein [Bacillus anthracis str. Sterne] >gi|51977460|gb|AAU19010.1| ribonucleotide reduction-related protein [Bacillus cereus E33L] >gi|118416144|gb|ABK84563.1| ribonucleotide reduction-related protein [Bacillus thuringiensis str. Al Hakam] >gi|157955312|gb|ABW06027.1| NrdI [Bacillus thuringiensis serovar finitimus] >gi|157955322|gb|ABW06035.1| NrdI [Bacillus thuringiensis serovar tochigiensis] >gi|164713849|gb|EDR19371.1| nrdI protein [Bacillus anthracis str. A0488] >gi|167512690|gb|EDR88064.1| nrdI protein [Bacillus anthracis str. A0193] >gi|167530371|gb|EDR93097.1| nrdI protein [Bacillus anthracis str. A0442] >gi|170128764|gb|EDS97630.1| nrdI protein [Bacillus anthracis str. A0389] >gi|170669315|gb|EDT20058.1| nrdI protein [Bacillus anthracis str. A0465] >gi|172082763|gb|EDT67826.1| nrdI protein [Bacillus anthracis str. A0174] >gi|190560811|gb|EDV14786.1| nrdI protein [Bacillus anthracis Tsiankovskii-I] >gi|195991969|gb|EDX55932.1| nrdI protein [Bacillus cereus W] >gi|196022709|gb|EDX61391.1| nrdI protein [Bacillus cereus 03BB108] >gi|196028551|gb|EDX67159.1| nrdI protein [Bacillus cereus NVH0597-99] (119 aa)
Score = 155, Expect = 2.6e-09, Identities = 48/127 (37%), Positives = 64/127 (50%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           +V Y S + N  RF+ KLN     +P  Q  E           ++  FIL+T  Y  G G     VP+ V +FL    N    K V ASGN N+ D +  + D IS K ++P + KFEL GTN+DVE
  S:     2 LVAYDSMTGNVKRFIHKLN-----MPAVQIGED--------LVIDEDFILIT--YTTGFGN----VPERVLEFLER--NNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFELSGTNNDVE 107
>gi|6782392|emb|CAB70606.1| ribonucleotide reductase-like (Nrd-like) protein [Streptococcus dysgalactiae subsp. equisimilis] (142 aa)
Score = 155, Expect = 2.6e-09, Identities = 47/131 (35%), Positives = 67/131 (51%)
  Q:     9 VYYSSKSNNTHRFMLKL------NCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           + + S S NT  F+ +L      N +C    I  KD     L+ +   V   F+ + PTY  GG G   G V     P+  F+    N  +C  +I SGN NFN+ YC+     +++   P L  FEL GTN D+E + KI
  S:     6 IVFISLSGNTLSFVKRLSLYLTENHECHVKQINIKD-----LKHETFPVEEDFVAMLPTYLEGGNGIDSGEVEILTNPLGDFIAAHDNYKHCMGIIGSGNKNFNNQYCLTAKQYAKRFGFPMLGDFELRGTNDDIERLAKI 141
>gi|86156142|gb|ABC86789.1| NrdI [Borrelia turicatae] (129 aa)
Score = 152, Expect = 5.3e-09, Identities = 50/142 (35%), Positives = 75/142 (52%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVI-KIGNE 142
           M+  ++ +V Y+SK+ N  RF+ K   K     I +    DEI       V+ P++LLT T+A G       VP  V+KFL +  N      V  SGN N+  ++C A ++I  +  +  + KFEL GT+ DVEN + +I NE
  S:     1 MKGVKYILVVYASKTGNVSRFIAKTGLK----DIFRVVTGDEI-------VSRPYVLLTYTFAFG------KVPPEVEKFLKH--NFKLMVGVAGSGNRNWGGSFCNAVNLIKNEYNVCEILKFELSGTSHDVENFVERIKNE 124
>gi|73663296|ref|YP_302077.1| ribonucleotide reductase stimulatory protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123641933|sp|Q49VS8|NRDI_STAS1 Protein nrdI >gi|72495811|dbj|BAE19132.1| NrdI protein involved in ribonucleotide reduction [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (132 aa)
Score = 152, Expect = 6.3e-09, Identities = 46/125 (36%), Positives = 65/125 (52%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV 133
           V Y S S N  RF+ K       + I Q +  ++I E        PFIL+T T         G VP+PV+ FL+  +N +  + V ASGN N+   +  AG  IS+K Q+P L KFE+ GT +D+
  S:     3 VVYFSFSGNVRRFIKKAEITN-TMEITQNNCTEKIEE--------PFILVTGTIG------FGEVPQPVQSFLD--INHDLLRGVAASGNRNWGQNFAKAGRSISEKYQVPLLMKFEVQGTQNDI 110
>gi|49480500|ref|YP_035574.1| ribonucleotide reductase stimulatory protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49332056|gb|AAT62702.1| ribonucleotide reduction-related protein [Bacillus thuringiensis serovar konkukian str. 97-27] (119 aa)
Score = 152, Expect = 6.3e-09, Identities = 47/127 (37%), Positives = 64/127 (50%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           ++ Y S + N  RF+ KLN     +P  Q  E           ++  FIL+T  Y  G G     VP+ V +FL    N    K V ASGN N+ D +  + D IS K ++P + KFEL GTN+DVE
  S:     2 LLAYDSMTGNVKRFIHKLN-----MPAVQIGED--------LVIDEDFILIT--YTTGFGN----VPERVLEFLER--NNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFELSGTNNDVE 107
>gi|125624345|ref|YP_001032828.1| ribonucleotide reductase stimulatory protein [Lactococcus lactis subsp. cremoris MG1363] >gi|2498675|sp|Q48709|NRDI_LACLM Protein nrdI >gi|1222681|emb|CAA63373.1| nrdI [Lactococcus lactis] >gi|124493153|emb|CAL98117.1| ribonucleotide reductase NrdI [Lactococcus lactis subsp. cremoris MG1363] (140 aa)
Score = 152, Expect = 6.3e-09, Identities = 43/133 (32%), Positives = 65/133 (48%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGA--VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEF 143
           Y S +  T RF+ K +   + +       PD+ LE     ++ PF+L+TP+YA     +  +  V   V  F+    N  +C+ +I +GN NF   Y      +S K QIP LY FE  GT +DV  V K+  + 
  S:     5 YFSVTGQTRRFVSKTDLPNVEI------TPDDDLE-----MDEPFLLITPSYAEESPTVSKSIDVMDSVFDFMAYNDNYKHCRGIIGTGNRNFAGIYIFTAKEVSAKYQIPLLYDFEFNGTPADVAAVEKLAAQL 128
>gi|169827408|ref|YP_001697566.1| NrdI protein [Lysinibacillus sphaericus C3-41] >gi|168991896|gb|ACA39436.1| NrdI protein [Lysinibacillus sphaericus C3-41] (119 aa)
Score = 152, Expect = 6.5e-09, Identities = 39/129 (30%), Positives = 68/129 (52%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNF-NDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           ++ Y+S++ N    + KL  + + L  E              ++N P++L+T  Y  GLG     +P  V++FL+   NR+ CK V+ASGN+NF +  +  AG+ I+    +P + K +L G  +D E +
  S:     1 MIVYASRTGNVRNVVSKLRAESIELSEEL-------------SLNKPYLLIT--YTDGLGD----IPAKVQRFLDK--NRDFCKGVVASGNSNFGHHVFGAAGEKIATTYHVPLVRKLDLRGNQTDYEAI 109
>gi|9630285|ref|NP_046712.1| hypothetical protein SPBc2p160 [Bacillus phage SPBc2] >gi|16079066|ref|NP_389889.1| ribonucleotide reductase stimulatory protein [Bacillus subtilis subsp. subtilis str. 168] >gi|55977286|sp|P68524|NRDIB_BACSU SPBc2 prophage-derived protein nrdI (BnrdI) >gi|55977287|sp|P68525|NRDIB_BPSPC Phage protein nrdI (BnrdI) >gi|2634400|emb|CAB13899.1| yosM [Bacillus subtilis subsp. subtilis str. 168] >gi|3025638|gb|AAC13133.1| similar to Bacillus subtilis NrdI (YmaA) [Bacteriophage SPBc2] (129 aa)
Score = 151, Expect = 7.7e-09, Identities = 43/128 (33%), Positives = 64/128 (50%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIK 138
           Y SK+ N  RF+  L         +Q+ + + I  +    +N  FI +T  Y  G G+    VP+    F+N   N+N  + V  SGN  + D Y +AGD +S K   P L KFEL GT  D++ +I+
  S:     3 YESKTGNVKRFVKAL---------QQEFDVEAIEITDDTIINQEFIHIT--YTIGFGE----VPERTLSFINK--NKNKIRGVAVSGNKVWGDNYGLAGDKLSAKFHTPLLLKFELSGTKQDLQKIIQ 113
>gi|49823284|gb|AAT68708.1| ribonucleoprotein [Borrelia hermsii] >gi|85726183|gb|ABC79614.1| auxiliary protein NrdI [Borrelia hermsii DAH] (129 aa)
Score = 150, Expect = 1.1e-08, Identities = 49/142 (34%), Positives = 73/142 (51%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVI-KIGNE 142
           M   R+ +V Y+SK+ N  RF+ K   K         D    +  S+I  VN P++LLT T +       G VP  V+ FL +  N      V  SGN N+ D++C A ++I  +  +  + KFEL GT+ DVE+ + +I NE
  S:     1 MLGDRYILVVYASKTGNIERFIAKTGLK---------DTFRIVTGSEI--VNRPYVLLTYTIS------FGKVPSEVENFLKH--NFKLMVGVAGSGNRNWGDSFCNAVNLIRNEYNVEEILKFELSGTSHDVESFVERIKNE 124
>gi|125719042|ref|YP_001036175.1| hypothetical protein SSA_2263 [Streptococcus sanguinis SK36] >gi|125498959|gb|ABN45625.1| Ribonucleotide reductase (NrdI family protein), putative [Streptococcus sanguinis SK36] (162 aa)
Score = 150, Expect = 1.1e-08, Identities = 54/147 (36%), Positives = 75/147 (51%)
  Q:     1 MENKRFFI-VYYSSKSNNTHRFMLKLNCKCLR----LPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFW--EKN 147
           MENK   + + Y S S NT  F+ +L    L     L +E+    D + E +    +++PFI   PTY  GG G   G V      V  F+    N + C  VI SGN NFN+ YC+     S++   P L  FE+ G   D++ V  I  E +  EKN
  S:     1 MENKMTKVSLVYISLSGNTESFVRRLTDYLLEQHPSLEVEKIHIKDLVKERQPFFEMDNPFIAFLPTYLEGGNGVDNGDVEILTTDVGDFIAYGQNASKCLGVIGSGNRNFNNQYCLTAKQYSERFGFPVLADFEMRGMLGDIKKVAGIIEELYHIEKN 159
>gi|126650014|ref|ZP_01722247.1| hypothetical protein BB14905_02050 [Bacillus sp. B14905] >gi|126593186|gb|EAZ87148.1| hypothetical protein BB14905_02050 [Bacillus sp. B14905] (119 aa)
Score = 150, Expect = 1.1e-08, Identities = 39/129 (30%), Positives = 67/129 (51%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNF-NDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           ++ Y+S++ N    + KL  + + L  E              ++N P++L+T  Y  GLG     +P  V++FL    NR+ CK V+ASGN+NF +  +  AG+ I+    +P + K +L G  +D E +
  S:     1 MIVYASRTGNVRNVVSKLRAESIELSEEL-------------SLNKPYLLIT--YTDGLGD----IPTKVQRFLEK--NRDFCKGVVASGNSNFGHHVFGAAGEKIATTYHVPLVRKLDLRGNQTDYEAI 109
>gi|184156233|ref|YP_001844573.1| ribonucleotide reductase [Lactobacillus fermentum IFO 3956] >gi|183227577|dbj|BAG28093.1| ribonucleotide reductase [Lactobacillus fermentum IFO 3956] (154 aa)
Score = 149, Expect = 1.2e-08, Identities = 45/138 (32%), Positives = 66/138 (47%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRL----PIEQKDEPDEILESKIPT-VNHPFILLTPTYA-GGLGKLKG---AVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           V Y S   NT  F+ +L     ++    P        EI    IP     PF    PTY  GG G   G    +  P+ +++    N +N   V+ SGN NFN+ YC+   + ++    PF+  +EL GTN D+E V +   +  EK
  S:     6 VLYISIEGNTRSFLKRLQTYANQMNSINPANPTINLKEITAQTIPAHEEEPFFAFVPTYLDGGDGFTSGYTEMMTNPLGEYIAEGKNADNLIGVVGSGNKNFNEQYCLTARMYAKAFDAPFVADYELRGTNEDLEVVYRRLKDVAEK 152
>gi|148544968|ref|YP_001272338.1| NrdI family protein [Lactobacillus reuteri F275] >gi|184154305|ref|YP_001842646.1| ribonucleotide reductase protein [Lactobacillus reuteri F275] >gi|194467204|ref|ZP_03073191.1| NrdI family protein [Lactobacillus reuteri 100-23] >gi|148532002|gb|ABQ84001.1| NrdI family protein [Lactobacillus reuteri F275] >gi|183225649|dbj|BAG26166.1| ribonucleotide reductase protein [Lactobacillus reuteri F275] >gi|194454240|gb|EDX43137.1| NrdI family protein [Lactobacillus reuteri 100-23] (155 aa)
Score = 149, Expect = 1.3e-08, Identities = 39/140 (27%), Positives = 63/140 (45%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEP----DEILESKIPT-VNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPV----NRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           + Y S   NT  F+ ++     +     +D P     E+ +  +P     PF    PTY  G   +     + +   L   +    N   C  V+ SGN NFN+ YC+     ++    PFL  +EL GT+ D+E +  I  + W + N
  S:     6 IIYISLEGNTRSFLTRMQGYAKQQHSISEDRPLLELKEVSDQTLPADETEPFFAFVPTYLNGGNGIDSGFTEIMTNALGEYIAYNDNAKQCVGVVGSGNKNFNEQYCLTARKYARDFDAPFLADYELRGTSQDIERIYTILAKRWSEIN 154
>gi|69245065|ref|ZP_00603223.1| NrdI family protein [Enterococcus faecium DO] >gi|68196066|gb|EAN10498.1| NrdI family protein [Enterococcus faecium DO] (148 aa)
Score = 148, Expect = 1.6e-08, Identities = 42/131 (32%), Positives = 61/131 (46%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILE-----SKIPTVNHPFILLTPTYAGGLGKLKGA----VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           + Y S S NT  F   L     ++  E    P+  L+     S       PF    PTY  G   L       + + ++++L +  N   C  V+ SGN NFN+ YC+     +Q    PFL  +EL GT SDV  + +I
  S:     3 ILYISISGNTRAFAKHLAEYAEKMHAEDPVNPEVTLKEIHENSDFTKETEPFFTFVPTYLDGGNGLDNGDTEILTETMREYLEHEDNHKLCLGVVGSGNKNFNNQYCLTAKQYAQTFGFPFLADYELRGTPSDVTRIYQI 142
>gi|171778866|ref|ZP_02919928.1| hypothetical protein STRINF_00787 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282512|gb|EDT47936.1| hypothetical protein STRINF_00787 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (156 aa)
Score = 147, Expect = 2.2e-08, Identities = 34/89 (38%), Positives = 49/89 (55%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V  PF+ + PTY  GG G   G V     P+  F+    N  +C  +I SGN NFN+ YC+     + +   P L  FEL GT+SD+E + ++
  S:    51 VASPFVAILPTYLEGGNGIDSGDVEILTTPLGDFIAAHDNDKHCFGIIGSGNRNFNEQYCLTAKQYANRFGFPMLGDFELRGTSSDIERLAEV 143
>gi|116494301|ref|YP_806035.1| hypothetical protein LSEI_0757 [Lactobacillus casei ATCC 334] >gi|116104451|gb|ABJ69593.1| Ribonucleotide reduction protein [Lactobacillus casei ATCC 334] (157 aa)
Score = 146, Expect = 2.8e-08, Identities = 30/86 (34%), Positives = 45/86 (52%)
  Q:    54 PFILLTPTYAGGLGKLKGAVPK----PVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           PF ++ PTY  G   +   V +     +  +L    N + C  +I SGN NFN+ YC+     +++   PFL  +EL GT SD E +  I
  S:    57 PFFVMVPTYLDGGNGIDNGVKELMTTAMGDYLAEGENADQCIGIIGSGNRNFNEQYCLTAKRYAKEFDAPFLADYELRGTPSDAEKIYAI 146
>gi|171779440|ref|ZP_02920404.1| hypothetical protein STRINF_01285 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282057|gb|EDT47488.1| hypothetical protein STRINF_01285 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (267 aa)
Score = 146, Expect = 3.0e-08, Identities = 41/128 (32%), Positives = 69/128 (53%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQK---DEPDEILESKIPT---VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           VYY S S NT  F+ +L+ + L+   ++        +++ S  P+   +N P+    P Y  GG G   G V     P+++ + +  N  +C  +I SGN NFN  +C+     S++   P L +FEL GT  D++ +
  S:     6 VYYISLSGNTTSFLERLD-RYLQKEFQESLNYINVKDLVNSGEPSTFKINDPYFAFLPAYLEGGNGLDTGDVEILTTPLRRLIAHKDNSKHCLGIIGSGNRNFNKQFCLTAHQYSEEFGFPVLDEFELRGTEEDIKRI 142
>gi|154686150|ref|YP_001421311.1| ribonucleotide reductase stimulatory protein [Bacillus amyloliquefaciens FZB42] >gi|166233912|sp|A7Z504|NRDI_BACA2 Protein nrdI >gi|154352001|gb|ABS74080.1| NrdI [Bacillus amyloliquefaciens FZB42] (130 aa)
Score = 146, Expect = 3.0e-08, Identities = 42/126 (33%), Positives = 64/126 (50%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           + + SK+ N  RF+ K + + +R    + DE D         V+ PF+L+T  Y    G+    VP   + FL    +      V ASGN  + D +  + D IS++ Q+P L+KFEL GT+ DVE
  S:     4 IIFDSKTGNVQRFVNKTDFQLIR----KVDETDH--------VDTPFVLVT--YTTNFGQ----VPASTQSFLEKYAHL--LLGVAASGNKVWGDNFAKSADTISRQYQVPILHKFELSGTSKDVE 109
>gi|19746887|ref|NP_608023.1| hypothetical protein spyM18_2048 [Streptococcus pyogenes MGAS8232] >gi|73921251|sp|Q8NZA2|NRDIL_STRP8 Putative nrdI-like protein >gi|19749131|gb|AAL98522.1| ribonucleotide reductase-like protein [Streptococcus pyogenes MGAS8232] (152 aa)
Score = 146, Expect = 3.2e-08, Identities = 33/89 (37%), Positives = 48/89 (53%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G V     P+  F+    N  +C  +I SGN NFN  YC+     +++   P L  FEL GTN+D+E + ++
  S:    49 VMESFVAILPTYLEGGNGIDSGKVEILTNPLGDFIAAHDNVKHCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPMLGDFELRGTNADIERLAQV 141
>gi|29375103|ref|NP_814256.1| ribonucleotide reductase stimulatory protein [Enterococcus faecalis V583] >gi|29342562|gb|AAO80327.1| nrdI protein [Enterococcus faecalis V583] (125 aa)
Score = 146, Expect = 3.2e-08, Identities = 42/138 (30%), Positives = 61/138 (44%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           Y S +  T RF+ KL+     LP  + +  +   E     +N PFIL+ PTY          + + V  FL+   N+     V   GN NF + +      I++   +P LY FE  GT+ DVE   K+  E   K N
  S:     5 YFSVTGQTRRFIKKLD-----LPAYELEPANPFFE-----INEPFILVIPTY-------DAEITEVVNDFLDYKSNQELLVGVAGGGNRNFAELFVYTAKDIARDYHVPLLYSFEFSGTDEDVETFKKVVEEIESKRN 125
>gi|56964871|ref|YP_176602.1| ribonucleotide reductase stimulatory protein [Bacillus clausii KSM-K16] >gi|56911114|dbj|BAD65641.1| protein involved in ribonucleotide reduction NrdI [Bacillus clausii KSM-K16] (126 aa)
Score = 145, Expect = 3.7e-08, Identities = 41/130 (31%), Positives = 66/130 (50%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIK 138
           + + SK+ N  RF+ KL       P +  ++ D++      TV+ PF+L+T  Y  G G L    P+  + FL    N    + V ASGN  + D +  + D I+    +P L+KFEL GT+ DV+  ++
  S:     3 IVFDSKTGNVKRFVAKL-------PFDDIEQIDDM-----TTVDKPFVLIT--YTTGFGDLS---PR-TRVFLEK--NHEQLQGVAASGNRIWGDRFARSADTIANMYNVPVLHKFELSGTSRDVDAFLQ 112
>gi|194468019|ref|ZP_03074005.1| NrdI family protein [Lactobacillus reuteri 100-23] >gi|194452872|gb|EDX41770.1| NrdI family protein [Lactobacillus reuteri 100-23] (158 aa)
Score = 145, Expect = 3.7e-08, Identities = 48/149 (32%), Positives = 69/149 (46%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPD----EILESKIPT-VNHPFILLTPTYAGGLGK----LKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNNF 149
           M+NKR  IVY S  S N   F  +L     +      + P     EI E  +PT  +  F +L PTY  G  +    L   +  P+  +L +  N   C  +I SGN      Y I     ++K  +P L  FE  GT  D+E++ KI  +   KN+ 
  S:     1 MDNKRIKIVYMSF-SGNVRSFTHRLQEYATQQHHLNNENPLIELLEISEETLPTKSDSKFFVLLPTYMIGGSRFTPTLTEILTTPMHDYLESYDNVKRCAGIIGSGNLTLGKMYVITAKTYAKKYDLPLLAAFESRGTTQDIEHIYKILTDKANKNSL 157
>gi|195978876|ref|YP_002124120.1| ribonucleotide reduction protein NrdI [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975581|gb|ACG63107.1| ribonucleotide reduction protein NrdI [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (152 aa)
Score = 143, Expect = 5.7e-08, Identities = 32/89 (35%), Positives = 47/89 (52%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G V     P+  F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT++D+E + ++
  S:    49 VKESFVAILPTYLEGGNGIDSGEVEILTNPLGDFIAAHDNAKRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPMLGDFELRGTSADIERLAQV 141
>gi|70727162|ref|YP_254078.1| ribonucleotide reductase stimulatory protein [Staphylococcus haemolyticus JCSC1435] >gi|123659580|sp|Q4L4F3|NRDI_STAHJ Protein nrdI >gi|68447888|dbj|BAE05472.1| NrdI protein involved in ribonucleotide reductase function [Staphylococcus haemolyticus JCSC1435] (132 aa)
Score = 143, Expect = 6.8e-08, Identities = 48/138 (34%), Positives = 70/138 (50%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPF----ILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV---ENVIKIGNEFWEK 146
           V Y S S N  RF+             ++ E  +++E        PF    IL+T T         G VPK V+ FL   +N +N +AV ASGN N+   +  AG  IS++  +P L KFE+ G+N DV   +N +   NE +E+
  S:     3 VVYFSFSGNVRRFI-------------KRSEISDVMEITKDNCTDPFEEPYILVTGTIG------FGEVPKEVQSFLE--INHHNLRAVAASGNRNWGQNFAKAGRTISEEYHVPLLMKFEVQGSNKDVIEFKNKVGHFNENYER 126
>gi|4490608|emb|CAB38641.1| NRD1 [Staphylococcus aureus] (132 aa)
Score = 143, Expect = 7.3e-08, Identities = 49/133 (36%), Positives = 66/133 (49%)
  Q:     9 VYYSSKSNNTHRFMLKLNCK-CLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV-ENVIKIGN 141
           + Y S + N  RF+ +   +  L +  E   EP          VN PFI++T T         G VP+PV+ FL   VN    + V ASGN N+   +  AG  IS++  +P L KFEL G N DV E   K+GN
  S:     3 IIYFSFTGNVRRFIKRTELENTLEITAENCMEP----------VNEPFIIVTGTIG------FGEVPEPVQSFLE--VNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGN 119
>gi|191637639|ref|YP_001986805.1| Ribonucleotide reductase protein NrdI [Lactobacillus casei] >gi|190711941|emb|CAQ65947.1| Ribonucleotide reductase protein NrdI [Lactobacillus casei BL23] (157 aa)
Score = 142, Expect = 8.4e-08, Identities = 29/86 (33%), Positives = 45/86 (52%)
  Q:    54 PFILLTPTYAGGLGKLKGAVPK----PVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           PF ++ PTY  G   +   V +     +  +L    + + C  +I SGN NFN+ YC+     +++   PFL  +EL GT SD E +  I
  S:    57 PFFVMVPTYLDGGNGIDNGVKELMTTAMGDYLAEGESADQCIGIIGSGNRNFNEQYCLTAKRYAKEFDAPFLADYELRGTPSDAEKIYAI 146
>gi|16078800|ref|NP_389619.1| ribonucleotide reductase stimulatory protein [Bacillus subtilis subsp. subtilis str. 168] >gi|1730613|sp|P50618|NRDI_BACSU Protein nrdI >gi|1262335|emb|CAA92809.1| YmaA [Bacillus subtilis] >gi|2634121|emb|CAB13621.1| ymaA [Bacillus subtilis subsp. subtilis str. 168] (130 aa)
Score = 141, Expect = 1.0e-07, Identities = 42/126 (33%), Positives = 63/126 (50%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           + + SK+ N  RF+ K   + +R    + DE D         V+ PF+L+T  Y    G+    VP   + FL    +      V ASGN  + D +  + D IS++ Q+P L+KFEL GT+ DVE
  S:     4 IIFDSKTGNVQRFVNKTGFQQIR----KVDEMDH--------VDTPFVLVT--YTTNFGQ----VPASTQSFLEKYAHL--LLGVAASGNKVWGDNFAKSADTISRQYQVPILHKFELSGTSKDVE 109
>gi|29376058|ref|NP_815212.1| hypothetical protein EF1491 [Enterococcus faecalis V583] >gi|29343520|gb|AAO81282.1| nrdI family protein [Enterococcus faecalis V583] (147 aa)
Score = 140, Expect = 1.6e-07, Identities = 44/134 (32%), Positives = 64/134 (47%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEP----DEILE-SKIPTVNHPFILLTPTYA-GGLGKLKG---AVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNE 142
           + Y S S NT  F+ +L           +  P     EI E S +     PF    PTY  GG G   G    + + ++++L    N   C  V+ SGN NFN  YC+     +++   PFL  +EL GT +D+E +  I  E
  S:     3 IRYISISGNTRSFVQRLTTYSEEQHQHNEKNPTITFKEISENSPLEVETEPFFTFVPTYLDGGDGINNGNTEILTEVMREYLAFENNYRYCSGVVGSGNKNFNHQYCLTAKQYAEQFNFPFLADYELRGTQADIERIYAILKE 145
>gi|81097044|ref|ZP_00875359.1| NrdI family protein [Streptococcus suis 89/1591] >gi|80976907|gb|EAP40475.1| NrdI family protein [Streptococcus suis 89/1591] (151 aa)
Score = 139, Expect = 1.8e-07, Identities = 42/133 (31%), Positives = 68/133 (51%)
  Q:     4 KRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDE---PDEILESKIP--TVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           K+  I+ Y S S NT  F+ +L     +   + + E     ++++  IP   ++ PF+   PTY  GG G   G V     P+  F+    N   C  V+ SGN NFN+ YC+     +++   P +  FEL G  +D+E +
  S:     3 KKHNILVYISLSGNTESFVKRLK-SFFQFQTDWEIELVHVKDLVKQDIPFYQLDAPFVAFLPTYLEGGNGVDNGDVEILTNPLGDFIALGTNTELCLGVVGSGNRNFNNQYCLTAKQYAERFNFPVIDTFELRGMQNDIERI 143
>gi|15923720|ref|NP_371254.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus Mu50] >gi|15926407|ref|NP_373940.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus N315] >gi|21282421|ref|NP_645509.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus MW2] >gi|49482987|ref|YP_040211.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485602|ref|YP_042823.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651567|ref|YP_185666.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus COL] >gi|82750434|ref|YP_416175.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus RF122] >gi|87161741|ref|YP_493418.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus USA300] >gi|88194506|ref|YP_499301.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267190|ref|YP_001246133.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus JH9] >gi|150393239|ref|YP_001315914.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus JH1] >gi|151220911|ref|YP_001331733.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979058|ref|YP_001441317.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus Mu3] >gi|161508995|ref|YP_001574654.1| ribonucleotide reductase stimulatory protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168726862|ref|ZP_02759139.1| ribonucleotide-diphosphate reductase subunit gamma [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123486798|sp|Q2FIR0|NRDI_STAA3 Protein nrdI >gi|123547704|sp|Q2YSJ9|NRDI_STAAB Protein nrdI >gi|166233929|sp|A7WZL9|NRDI_STAA1 Protein nrdI >gi|189030489|sp|A6TZK9|NRDI_STAA2 Protein nrdI >gi|189030490|sp|A5IQT4|NRDI_STAA9 Protein nrdI >gi|189030491|sp|A8Z002|NRDI_STAAT Protein nrdI >gi|56749209|sp|Q6GBA0|NRDI_STAAS Protein nrdI >gi|56749244|sp|Q6GIR1|NRDI_STAAR Protein nrdI >gi|56752536|sp|P68811|NRDI_STAAM Protein nrdI >gi|56752537|sp|P68812|NRDI_STAAN Protein nrdI >gi|56752539|sp|P68814|NRDI_STAAW Protein nrdI >gi|73921258|sp|Q5HHU1|NRDI_STAAC Protein nrdI >gi|110815876|sp|Q2G079|NRDI_STAA8 Protein nrdI >gi|110815877|sp|P0C1S2|NRDI_STAAU Protein nrdI >gi|13700621|dbj|BAB41918.1| NrdI protein involved in ribonucleotide reductase function [Staphylococcus aureus subsp. aureus N315] >gi|14246499|dbj|BAB56892.1| NrdI protein involved in ribonucleotide reductase function [Staphylococcus aureus subsp. aureus Mu50] >gi|14329708|emb|CAC40666.1| NrdI protein [Staphylococcus aureus] >gi|14588888|emb|CAC43039.1| NrdI protein [Staphylococcus aureus] >gi|21203858|dbj|BAB94557.1| NrdI protein involved in ribonucleotide reductase function [Staphylococcus aureus subsp. aureus MW2] >gi|49241116|emb|CAG39794.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244045|emb|CAG42471.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285753|gb|AAW37847.1| nrdI protein [Staphylococcus aureus subsp. aureus COL] >gi|82655965|emb|CAI80369.1| ribonucleotide reductase function protein [Staphylococcus aureus RF122] >gi|87127715|gb|ABD22229.1| nrdI protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202064|gb|ABD29874.1| ribonucleoside-diphosphate reductase 2, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740259|gb|ABQ48557.1| NrdI protein [Staphylococcus aureus subsp. aureus JH9] >gi|149945691|gb|ABR51627.1| NrdI protein [Staphylococcus aureus subsp. aureus JH1] >gi|150373711|dbj|BAF66971.1| ribonucleotide reduction-related NrdI protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721193|dbj|BAF77610.1| NrdI protein involved in ribonucleotide reductase function [Staphylococcus aureus subsp. aureus Mu3] >gi|160367804|gb|ABX28775.1| ribonucleotide-diphosphate reductase subunit gamma [Staphylococcus aureus subsp. aureus USA300_TCH1516] (132 aa)
Score = 139, Expect = 1.9e-07, Identities = 48/133 (36%), Positives = 66/133 (49%)
  Q:     9 VYYSSKSNNTHRFMLKLNCK-CLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV-ENVIKIGN 141
           + Y S + N  RF+ +   +  L +  E   EP          V+ PFI++T T         G VP+PV+ FL   VN    + V ASGN N+   +  AG  IS++  +P L KFEL G N DV E   K+GN
  S:     3 IIYFSFTGNVRRFIKRTELENTLEITAENCMEP----------VHEPFIIVTGTIG------FGEVPEPVQSFLE--VNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGN 119
>gi|51247292|pdb|1RLJ|A Chain A, Structural Genomics, A Flavoprotein Nrdi From Bacillus Subtilis (139 aa)
Score = 139, Expect = 2.1e-07, Identities = 42/126 (33%), Positives = 63/126 (50%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           + + SK+ N  RF+ K   + +R    + DE D         V+ PF+L+T  Y    G+    VP   + FL    +      V ASGN  + D +  + D IS++ Q+P L+KFEL GT+ DVE
  S:    13 IIFDSKTGNVQRFVNKTGFQQIR----KVDEMDH--------VDTPFVLVT--YTTNFGQ----VPASTQSFLEKYAHL--LLGVAASGNKVWGDNFAKSADTISRQYQVPILHKFELSGTSKDVE 118
>gi|146319793|ref|YP_001199505.1| ribonucleotide reduction protein [Streptococcus suis 05ZYH33] >gi|146321988|ref|YP_001201699.1| ribonucleotide reduction protein [Streptococcus suis 98HAH33] >gi|145690599|gb|ABP91105.1| Protein involved in ribonucleotide reduction [Streptococcus suis 05ZYH33] >gi|145692794|gb|ABP93299.1| Protein involved in ribonucleotide reduction [Streptococcus suis 98HAH33] (150 aa)
Score = 138, Expect = 2.2e-07, Identities = 42/133 (31%), Positives = 69/133 (51%)
  Q:     4 KRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDE---PDEILESKIP--TVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           K+ ++VY S  S NT  F+ +L     +   + + E     ++++  IP   ++ PF+   PTY  GG G   G V     P+  F+    N   C  V+ SGN NFN+ YC+     +++   P +  FEL G  +D+E +
  S:     3 KKIYLVYISL-SGNTESFVKRLK-SFFQFQTDWEIELVHVKDLVKQAIPFYQLDAPFVAFLPTYLEGGNGVDNGDVEILTNPLGDFIALGTNAELCLGVVGSGNRNFNNQYCLTAKQYAERFNFPVIDTFELRGMQNDIERI 142
>gi|157151680|ref|YP_001449420.1| ribonucleotide reductase-like protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157076474|gb|ABV11157.1| ribonucleotide reductase-like protein [Streptococcus gordonii str. Challis substr. CH1] (152 aa)
Score = 138, Expect = 2.4e-07, Identities = 42/126 (33%), Positives = 61/126 (48%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLR----LPIEQKDEPDEILESK-IPTVNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           Y S S NT  F+ +L          L +EQ +  D + E +    +++ F+   PTY  GG G   G V      +  F+    N   C  ++ SGN NFN+ YC+     SQ+   P L  FEL G  +D+  V
  S:     8 YISLSGNTASFIKRLTAYLQEGHADLEVEQVNIKDLVKEGQDFFAMDNQFVAFLPTYLEGGNGVDSGDVEILTNDLAAFIEYEENYKKCFGIVGSGNRNFNNQYCLTAKQYSQRFGFPLLDTFELRGLQNDISRV 142
>gi|66391352|ref|YP_238595.1| ORF099 [Staphylococcus phage Twort] >gi|62637282|gb|AAX92393.1| ORF099 [Staphylococcus phage Twort] (130 aa)
Score = 136, Expect = 4.3e-07, Identities = 45/137 (32%), Positives = 71/137 (51%)
  Q:     2 ENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIK 138
           + +R  IVYYS  +  T R + K+N       + +    +EI+E        P+IL+TPTY      +KG +PK V+KF++N    +  K VI +GN  + + +C A   I++   IP + K E  G  ++V N IK
  S:     3 KEERPIIVYYSG-TGQTKRLVDKINNDSFE--VMRMKTGNEIVE-------QPYILITPTY------MKGEIPKQVQKFISN---NHAPKEVIGTGNKQWGEHFCGASKKIAEMFSIPLVAKIEQAGHFNEV-NTIK 119
>gi|148544153|ref|YP_001271523.1| NrdI family protein [Lactobacillus reuteri F275] >gi|184153526|ref|YP_001841867.1| ribonucleotide reductase-like protein [Lactobacillus reuteri F275] >gi|148531187|gb|ABQ83186.1| NrdI family protein [Lactobacillus reuteri F275] >gi|183224870|dbj|BAG25387.1| ribonucleotide reductase-like protein [Lactobacillus reuteri F275] (158 aa)
Score = 136, Expect = 4.5e-07, Identities = 45/139 (32%), Positives = 64/139 (46%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPD----EILESKIPT-VNHPFILLTPTYAGGLGK----LKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           M+NKR  IVY S  S N   F  +L     +      + P     EI E  +PT  +  F +L PTY  G  +    L   +  P+  +L +  N   C  +I SGN      Y I     +++  +P L  FE  GT  D+E + KI
  S:     1 MDNKRIKIVYMSF-SGNVRSFTHRLQEYATQQHHLNNENPLIDLLEISEETLPTESDSKFFVLLPTYMIGGSRFTPTLTEILTTPMHDYLESYDNVKRCAGIIGSGNLTLGKMYVITAKTYAKEYGLPLLDAFESRGTTRDIERIYKI 147
>gi|90962206|ref|YP_536122.1| ribonucleotide reductase stimulatory protein [Lactobacillus salivarius UCC118] >gi|90821400|gb|ABE00039.1| NrdI protein [Lactobacillus salivarius UCC118] (127 aa)
Score = 135, Expect = 4.8e-07, Identities = 42/141 (29%), Positives = 64/141 (45%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKNN 148
           IVY++  +  T RF+ KL        I   D  +   E     VN PF+L+TPTY          + +P+  FL    N +  K ++ +GN NF + +      +S +  +P +Y FE  GT +DV N  K   E   K +
  S:     3 IVYFTV-TGQTKRFIKKLGSNYEYFEI---DAANPFFE-----VNDPFVLITPTY-------DKQITEPINDFLEYQNNSHYLKGIVGTGNRNFAELFIFTAKNLSYEYHVPLIYAFEFNGTPTDVSNFKKAVKELESKGH 127
>gi|146749575|gb|ABQ44373.1| ribonucleotide reductase-like protein [Lactobacillus reuteri] (158 aa)
Score = 135, Expect = 5.0e-07, Identities = 47/139 (33%), Positives = 64/139 (46%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPD----EILESKIPT-VNHPFILLTPTYAGGLGK----LKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           M+NKR  IVY S  S N   F  +L     +      + P     EI E  +PT  +  F +L PTY  G  +    L   +  P+  +L +  N   C  +I SGN      Y I     ++K  +P L  FE  GT  D+E V KI
  S:     1 MDNKRIKIVYMSF-SGNVRSFTHRLQEYATQQHHLNNENPLVDLLEISEETLPTESDSKFFVLLPTYMIGGSRFTPTLTEILTTPMHDYLESYDNVKCCAGIIGSGNLTLGKMYVITAKTYAKKYGLPLLDAFESRGTTWDIERVYKI 147
>gi|94989321|ref|YP_597422.1| hypothetical protein MGAS9429_Spy1691 [Streptococcus pyogenes MGAS9429] >gi|94542829|gb|ABF32878.1| nrdI protein [Streptococcus pyogenes MGAS9429] (153 aa)
Score = 134, Expect = 7.4e-07, Identities = 31/89 (34%), Positives = 46/89 (51%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G V     P+ +F+    N  +C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 VKEEFVAILPTYLEGGNGVDSGEVEILTTPLGEFIAAHGNAQHCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQV 141
>gi|56807834|ref|ZP_00365676.1| COG1780: Protein involved in ribonucleotide reduction [Streptococcus pyogenes M49 591] (160 aa)
Score = 134, Expect = 8.1e-07, Identities = 31/89 (34%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G V     P+ +F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 VKEEFVAILPTYLEGGNGVDSGEVEILTTPLGEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQV 141
>gi|47565404|ref|ZP_00236446.1| nrdI protein [Bacillus cereus G9241] >gi|47557758|gb|EAL16084.1| nrdI protein [Bacillus cereus G9241] (118 aa)
Score = 133, Expect = 1.0e-06, Identities = 42/125 (33%), Positives = 63/125 (50%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSD 132
           +V ++SK++N  RF+           I+     D +L      +   FIL+T  Y  G G+    VP+ V+ FL    N  + + V ASGN N+ D +  + D+IS K  +P L KFEL GT +D
  S:     2 LVAFASKTSNVERFIKSFPA------IKSVKITDNLL------LEEDFILVT--YTTGFGQ----VPQLVEDFLTK--NTKHLRGVAASGNRNWGDMFAKSADVISDKYNVPVLMKFELSGTIND 106
>gi|157692408|ref|YP_001486870.1| ribonucleotide reductase stimulatory protein [Bacillus pumilus SAFR-032] >gi|157681166|gb|ABV62310.1| ribonucleotide reduction protein NrdI [Bacillus pumilus SAFR-032] (132 aa)
Score = 132, Expect = 1.2e-06, Identities = 41/126 (32%), Positives = 61/126 (48%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           + + SK+ N  RF+ K          +QK   +E L++       PFIL+T  +  G G+    VP   + FL    N +    V  SGN  + D +  + D IS++ Q+P L+ FEL GT  DVE
  S:     6 IVFDSKTGNVQRFLDKTP-----FTDKQKLTGEEFLDT-------PFILVT--FTTGFGQ----VPSTTQSFLEK--NAHLLLGVAVSGNKVWGDNFAKSADTISKQYQVPILHTFELSGTKRDVE 111
>gi|71904338|ref|YP_281141.1| hypothetical protein M28_Spy1676 [Streptococcus pyogenes MGAS6180] >gi|94991266|ref|YP_599366.1| hypothetical protein MGAS10270_Spy1757 [Streptococcus pyogenes MGAS10270] >gi|71803433|gb|AAX72786.1| NrdI.1 [Streptococcus pyogenes MGAS6180] >gi|94544774|gb|ABF34822.1| NrdI protein [Streptococcus pyogenes MGAS10270] (160 aa)
Score = 131, Expect = 1.4e-06, Identities = 31/89 (34%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G V     P+ +F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 VKEEFVAILPTYLEGGNGVDSGEVEILTTPLGEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQV 141
>gi|15675774|ref|NP_269948.1| hypothetical protein SPy_1984 [Streptococcus pyogenes M1 GAS] >gi|71911503|ref|YP_283053.1| hypothetical protein M5005_Spy_1690 [Streptococcus pyogenes MGAS5005] >gi|20178007|sp|Q99XX2|NRDIL_STRP1 Putative nrdI-like protein >gi|13622998|gb|AAK34669.1| putative ribonucleotide reductase (NrdI protein) [Streptococcus pyogenes M1 GAS] >gi|71854285|gb|AAZ52308.1| nrdl.1 [Streptococcus pyogenes MGAS5005] (160 aa)
Score = 131, Expect = 1.7e-06, Identities = 31/89 (34%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G V     P+ +F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 VKEEFVAILPTYLEGGNGVDSGDVEILTTPLGEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQV 141
>gi|50915042|ref|YP_061014.1| hypothetical protein M6_Spy1696 [Streptococcus pyogenes MGAS10394] >gi|73921250|sp|Q5X9T2|NRDIL_STRP6 Putative nrdI-like protein >gi|50904116|gb|AAT87831.1| NrdI [Streptococcus pyogenes MGAS10394] (160 aa)
Score = 130, Expect = 2.0e-06, Identities = 31/89 (34%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G V     P+ +F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 VKEEFVAILPTYLEGGNGVDSGEVEILTTPLGEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQL 141
>gi|77409956|ref|ZP_00786551.1| nrdI protein [Streptococcus agalactiae COH1] >gi|77171436|gb|EAO74710.1| nrdI protein [Streptococcus agalactiae COH1] (77 aa)
Score = 130, Expect = 2.1e-06, Identities = 26/64 (40%), Positives = 36/64 (56%)
  Q:    76 PVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           P+  F+    N  NC  ++ SGN NFN+ YC+     S++   P L  FEL GT+SDVE +  I
  S:     4 PLGDFIAALNNVKNCIGIVGSGNRNFNNQYCLTAKQYSERFGFPMLGDFELRGTSSDVERIANI 67
>gi|48696467|ref|YP_024509.1| putative NrdI protein [Staphylococcus phage K] >gi|66395048|ref|YP_240946.1| ORF102 [Staphylococcus phage G1] >gi|46394849|gb|AAO47528.1| ORF79 [Staphylococcus phage K] >gi|62637070|gb|AAX92181.1| ORF102 [Bacteriophage G1] >gi|119658116|gb|ABL87151.1| putative ribonucleotide reduction-related protein [Staphylococcus phage 812] (130 aa)
Score = 130, Expect = 2.2e-06, Identities = 43/138 (31%), Positives = 70/138 (50%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIK 138
           M +K   ++ Y S +  T R + K+N       I    E   +   K   VN PFIL+TPTY       KGA+PK +++FL   +N  + K VI +GN  +   +C A   IS+  +IP + K E  G  ++++ +++
  S:     1 MTSKERPLIVYFSGTGQTERLVNKIN-------INNSFETFRVKSGK-EKVNKPFILITPTYK------KGAIPKQIERFLE--IN-GSPKEVIGTGNKQWGSNFCGASKKISEMFKIPLIAKVEQSGHFNEIQPILE 121
>gi|146322249|ref|YP_001174722.1| putative ribonucleotide reductase [Lactococcus lactis] >gi|145968740|gb|ABQ00018.1| putative ribonucleotide reductase [Lactococcus lactis] (188 aa)
Score = 130, Expect = 2.4e-06, Identities = 44/135 (32%), Positives = 67/135 (49%)
  Q:     9 VYYSSKSNNTHRFMLKLN---CKCLRLPIEQKDEPDEIL--ESKIPTVNHPFILLTPTY-AGGLGKLKG---AVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEF 143
           +YY S S NT  F+  L+    K L+  ++  +  D +   ES    +  P+    P Y  GG G   G    +  P+++ +    N   C  +I SGN NFN  +C+     S++   P L +FEL GT    E+VI+I N  
  S:     6 IYYISLSGNTTNFLEILDHYLQKELQEKLDYVNVKDLVKNNESLGFEIKEPYFAFLPAYLEGGNGVTTGNTEILTTPLRRLIAYKKNSKYCMGIIGSGNRNFNKQFCLTAHQYSEEFGFPVLDEFELRGTE---EDVIRISNRL 146
>gi|139474461|ref|YP_001129177.1| hypothetical protein SpyM51660 [Streptococcus pyogenes str. Manfredo] >gi|134272708|emb|CAM30980.1| putative NrdI-like protein [Streptococcus pyogenes str. Manfredo] (160 aa)
Score = 129, Expect = 2.4e-06, Identities = 30/89 (33%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGAVPK---PVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           +   F+ + PTY  GG G   G V     P+ +F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 IKEEFVAILPTYLEGGNGVDSGEVESLTTPLGEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQL 141
>gi|58338006|ref|YP_194591.1| ribonucleotide reductase stimulatory protein [Lactobacillus acidophilus NCFM] >gi|58255323|gb|AAV43560.1| ribonucleotide reductase [Lactobacillus acidophilus NCFM] (148 aa)
Score = 129, Expect = 2.5e-06, Identities = 31/85 (36%), Positives = 43/85 (50%)
  Q:    55 FILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           +IL+ P+Y       +  +   V  FL    N+ N   +I  GN NFND +      I+  L++P LY  E  GTN DV+NV KI
  S:    40 YILIVPSY-------QDFMMDSVVDFLTYKDNKKNIIGIIGCGNRNFNDLFAQTAKKIAATLKVPILYLLEFSGTNQDVKNVRKI 117
>gi|67078068|ref|YP_245688.1| ribonucleotide reductase stimulatory protein [Bacillus cereus E33L] >gi|66970374|gb|AAY60350.1| NrdI-like protein [Bacillus cereus E33L] (118 aa)
Score = 129, Expect = 2.7e-06, Identities = 45/125 (36%), Positives = 64/125 (51%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPT---VNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSD 132
           +V ++SK++N  RF+              K  PD I   KI     +   FIL+T  Y  GLG+    VP+ V+ FL    N  + + V ASGN N+ D +  + D+IS K  +P L KFEL G  +D
  S:     2 LVAFASKTSNVERFI--------------KSFPD-IKSVKITDNLLLEEDFILVT--YTTGLGQ----VPQLVEDFLTK--NNKHLRGVAASGNRNWGDMFTKSADVISDKYNVPVLMKFELSGMIND 106
>gi|21911242|ref|NP_665510.1| hypothetical protein SpyM3_1706 [Streptococcus pyogenes MGAS315] >gi|28896618|ref|NP_802968.1| hypothetical protein SPs1706 [Streptococcus pyogenes SSI-1] >gi|25453136|sp|Q8K5R3|NRDIL_STRP3 Putative nrdI-like protein >gi|21905455|gb|AAM80313.1| putative ribonucleotide reductase [Streptococcus pyogenes MGAS315] >gi|28811872|dbj|BAC64801.1| putative ribonucleotide reductase (NrdI protein) [Streptococcus pyogenes SSI-1] (160 aa)
Score = 129, Expect = 3.1e-06, Identities = 30/89 (33%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGA---VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G    +  P+ +F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 VKEEFVAILPTYLEGGNGVDSGEAEILTTPLGEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQV 141
>gi|94995178|ref|YP_603276.1| hypothetical protein MGAS10750_Spy1782 [Streptococcus pyogenes MGAS10750] >gi|94548686|gb|ABF38732.1| NrdI protein [Streptococcus pyogenes MGAS10750] (160 aa)
Score = 128, Expect = 3.3e-06, Identities = 30/89 (33%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTY-AGGLGKLKGA---VPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           V   F+ + PTY  GG G   G    +  P+ +F+    N   C  +I SGN NFN  YC+     +++   P L  FEL GT  D+  + ++
  S:    49 VKEEFVAILPTYLEGGNGVDSGEMEILTTPLGEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLAQV 141
>gi|52080343|ref|YP_079134.1| ribonucleotide reductase stimulatory protein [Bacillus licheniformis ATCC 14580] >gi|52785722|ref|YP_091551.1| ribonucleotide reductase stimulatory protein [Bacillus licheniformis ATCC 14580] >gi|73921253|sp|Q65JA6|NRDI_BACLD Protein nrdI >gi|52003554|gb|AAU23496.1| NrdI [Bacillus licheniformis ATCC 14580] >gi|52348224|gb|AAU40858.1| YmaA [Bacillus licheniformis DSM 13] (131 aa)
Score = 128, Expect = 3.3e-06, Identities = 43/126 (34%), Positives = 62/126 (49%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           + + SK+ N  RF+ K   +  R     K   +E L+        PF+L+T  Y  G G+    VPK  + FL    N +    V ASGN  + D +  + + IS++ Q+P L KFEL GT  DVE
  S:     4 IVFDSKTGNVQRFVDKTPFRNKR-----KVSTEEYLD-------EPFVLIT--YTTGFGE----VPKTTEMFLEK--NAHLLLGVAASGNRVWGDNFAKSAEKISKQYQVPILGKFELSGTAKDVE 109
>gi|194014386|ref|ZP_03053003.1| NrdI protein [Bacillus pumilus ATCC 7061] >gi|194013412|gb|EDW22977.1| NrdI protein [Bacillus pumilus ATCC 7061] (132 aa)
Score = 128, Expect = 4.0e-06, Identities = 40/126 (31%), Positives = 61/126 (48%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
           + + SK+ N  RF+ K          ++K   +E L++       PFIL+T  +  G G+    VP   + FL    N +    V  SGN  + D +  + D IS++ Q+P L+ FEL GT  DVE
  S:     6 IVFDSKTGNVQRFLDKTP-----FTDKRKLTGEEFLDT-------PFILVT--FTTGFGQ----VPSTTQSFLEK--NAHLLLGVAVSGNKVWGDNFAKSADTISKQYQVPILHTFELSGTKRDVE 111
>gi|24380144|ref|NP_722099.1| hypothetical protein SMU.1777 [Streptococcus mutans UA159] >gi|24378144|gb|AAN59405.1|AE015005_11 putative ribonucleotide reductase protein, Nrd [Streptococcus mutans UA159] (153 aa)
Score = 127, Expect = 4.1e-06, Identities = 29/82 (35%), Positives = 43/82 (52%)
  Q:    55 FILLTPTY-AGGLGKLKGAV---PKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           F+   PTY  GG G   G +     P+++F+    N   C  ++ SGN NFN+ YC+     +++   P L  FEL G   DVE +
  S:    57 FVAFLPTYLEGGNGLDSGDIEILTTPLREFIAFADNYRYCYGIVGSGNKNFNNQYCLTAKQYAEQFGFPVLDNFELRGLADDVERI 142
>gi|81427639|ref|YP_394636.1| hypothetical protein LSA0023 [Lactobacillus sakei subsp. sakei 23K] >gi|78609278|emb|CAI54325.1| Putative ribonucleotide reductase (NrdI-like) [Lactobacillus sakei subsp. sakei 23K] (155 aa)
Score = 126, Expect = 6.8e-06, Identities = 28/80 (35%), Positives = 42/80 (52%)
  Q:    54 PFILLTPTYAGGLGKLKGAVPKPVKKFLNNPV--------NRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV 133
           PF    PTY  G       +   VK+ + N +        N + C  VI SGN NFN+ YC+     +++  +PF+  +EL G + DV
  S:    57 PFYAFVPTYLDG----GNGIDNGVKELMTNSLGEYIAYGHNADLCYGVIGSGNRNFNEQYCLTAKRYAEQFNVPFIADYELRGNSRDV 140
>gi|28379180|ref|NP_786072.1| hypothetical protein lp_2673 [Lactobacillus plantarum WCFS1] >gi|28272018|emb|CAD64923.1| ribonucleotide reductase protein NrdI [Lactobacillus plantarum WCFS1] (161 aa)
Score = 125, Expect = 7.7e-06, Identities = 29/95 (30%), Positives = 44/95 (46%)
  Q:    45 ESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVK----KFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           +S       P+    PTY  G   +   V + +     ++LN   N   C  V+ SGN NFND YC+     +++L    +  +EL GT  D E V  +
  S:    49 QSDFAIETEPYFAFVPTYLDGGNGIDNGVKELMTNVLGEYLNYDQNSRFCLGVVGSGNRNFNDQYCLTARRYAEQLDTDMIADYELRGTAVDTERVYNV 147
>gi|170017904|ref|YP_001728823.1| nrdI protein [Leuconostoc citreum KM20] >gi|169804761|gb|ACA83379.1| nrdI protein [Leuconostoc citreum KM20] (143 aa)
Score = 125, Expect = 8.3e-06, Identities = 40/128 (31%), Positives = 62/128 (48%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEIL---ESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNN-------PVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           V Y+S   NT  F+ KL     R+  +  D+ D  +   E+       PFI + PTY   L    G  P+  + F N          NR   + ++ SGN NFN  + + G   +++  +P L+ +EL G+  D E V
  S:     3 VLYASTEGNTKSFVEKLQ----RVAAQYGDKVDARMIGEETDYANETAPFIAIVPTY---LTGGTGTGPEVTEIFTNALGEYIAFGNNRRYLRGIVGSGNRNFNVQFNLTGKRYAEQFDVPMLFAYELRGSKFDAEKV 133
>gi|116630258|ref|YP_815454.1| ribonucleotide reductase stimulatory protein [Lactobacillus gasseri ATCC 33323] >gi|116095840|gb|ABJ60992.1| Ribonucleotide reduction protein [Lactobacillus gasseri ATCC 33323] (153 aa)
Score = 123, Expect = 1.4e-05, Identities = 33/96 (34%), Positives = 48/96 (50%)
  Q:    51 VNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEK 146
           +N  +IL+ P+Y       +  +   V  FL    N+ N   +I  GN NFND +      IS  L +P LY  EL G ++DV+NV +I  E  +K
  S:    36 MNDKYILILPSY-------QDFMMDSVVDFLTYKDNKENLLGLIGCGNRNFNDLFAQTAKKISVTLHVPILYLLELSGNSTDVKNVRQIVKEARKK 124
>gi|116332779|ref|YP_794306.1| hypothetical protein LVIS_0104 [Lactobacillus brevis ATCC 367] >gi|116098126|gb|ABJ63275.1| Ribonucleotide reduction protein [Lactobacillus brevis ATCC 367] (157 aa)
Score = 120, Expect = 2.7e-05, Identities = 36/124 (29%), Positives = 54/124 (43%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPD----EILE-SKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPV----NRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSD 132
           + + S   NT  F+  L     +    Q + P+    EI E S +     PF    PTY  G   +   V + + K L   +    N      V+ SGN NFN+ YC+     +    +PF+  +EL G   D
  S:     6 ILFISIEGNTRNFVENLTAYAAKQHASQPELPEITATEISETSDLTDETQPFFCFVPTYLDGGNGIDNGVKELMTKVLGEYIAYHHNAQQLLGVVGSGNRNFNEQYCLTAKRYATTFGVPFIADYELRGVPRD 138
>gi|42519733|ref|NP_965663.1| ribonucleotide reductase stimulatory protein [Lactobacillus johnsonii NCC 533] >gi|41584022|gb|AAS09629.1| NrdI protein [Lactobacillus johnsonii NCC 533] (153 aa)
Score = 119, Expect = 3.5e-05, Identities = 31/89 (34%), Positives = 45/89 (50%)
  Q:    51 VNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKI 139
           +N  +IL+ P+Y       +  +   V  FL    N+ N   +I  GN NFND +      IS  L +P LY  EL G ++DV+NV +I
  S:    36 MNDKYILILPSY-------QDFMMDSVVDFLTYKDNKKNLLGLIGCGNRNFNDLFGQTAKKISVTLHVPILYLLELSGNSTDVKNVRQI 117
>gi|196048053|ref|ZP_03115231.1| NrdI protein [Bacillus cereus 03BB108] >gi|196021309|gb|EDX60038.1| NrdI protein [Bacillus cereus 03BB108] (123 aa)
Score = 117, Expect = 7.0e-05, Identities = 40/126 (31%), Positives = 60/126 (47%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDV 133
           ++ + SK+ N  RF+ KL  +  R  +      ++I E         F+L+T  Y  G G    A+P+ V  FL    N      V ASGN N  D Y  + D I+ +  +P L KFEL GT +++
  S:     2 LIIWESKTGNVSRFIEKLPKELKRNALRISQINNKIREK--------FVLIT--YTTGFG----AIPEEVNSFLEK--NYEYLLGVSASGNKNLGDNYAASADKIAAQYAVPILTKFELSGTKNNI 111
>gi|116492147|ref|YP_803882.1| hypothetical protein PEPE_0344 [Pediococcus pentosaceus ATCC 25745] >gi|116102297|gb|ABJ67440.1| Ribonucleotide reduction protein [Pediococcus pentosaceus ATCC 25745] (168 aa)
Score = 116, Expect = 7.7e-05, Identities = 41/136 (30%), Positives = 63/136 (46%)
  Q:     1 MENKRFFIVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPT-------VNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPV----NRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           MEN+ + I  Y S + NT  F+  L     ++   Q D  + ++ SK  T          P+    PTY  G   +   V + +   L   +    NR  C  VI SGN NFN+ YC+     +Q      +  +EL G +SD + +
  S:    14 MENQIYII--YISVAGNTQSFVDDLADYAEKM--HQNDTSNPLIISKEVTDQTDFADETQPYFAFVPTYLDGGNGIDNGVKELMTNTLGEYIAYHDNRKFCLGVIGSGNRNFNEQYCLTARRYAQDYGFEMIDDYELRGNSSDCKRI 156
>gi|184156151|ref|YP_001844491.1| putative ribonucleotide reductase [Lactobacillus fermentum IFO 3956] >gi|183227495|dbj|BAG28011.1| putative ribonucleotide reductase [Lactobacillus fermentum IFO 3956] (153 aa)
Score = 115, Expect = 1.2e-04, Identities = 34/128 (26%), Positives = 63/128 (49%)
  Q:     9 VYYSSKSNNTHRFMLKL-----NCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYA-GGLGKLKG---AVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           + Y S S NT  F+ +L     +   +   I  +++PD         +  PF+ + P +  GG G+  G    +   +  +L    N + C  +I SGN NFN  + +     +++   P+L  FEL G+++D+  +
  S:     7 ILYISLSGNTRDFVRRLTDYYQDLGVVVNSINVREKPDR------QKLTAPFVTILPAFLNGGNGRDNGYSEILSPALGHYLAYEGNYHRCYGIIGSGNRNFNRQFALTAKQYAKRFGFPYLTDFELRGSDNDITRI 137
>gi|163791216|ref|ZP_02185632.1| hypothetical protein CAT7_02387 [Carnobacterium sp. AT7] >gi|159873486|gb|EDP67574.1| hypothetical protein CAT7_02387 [Carnobacterium sp. AT7] (121 aa)
Score = 113, Expect = 2.0e-04, Identities = 35/134 (26%), Positives = 55/134 (41%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNE 142
           V Y S +  T +F+ KL+   L L             +    +N PFI++TPTY      +       +  F+    N+   K V   GN NF   +      ++ +  +P L+ FE  G + DV  + K  NE
  S:     3 VVYISLTGQTRKFVKKLDMDSLEL----------TPTNPYLALNEPFIIITPTYDKDATDI-------LNDFIETADNKTYFKGVAGGGNLNFGKLFAFTAIDLANEYHVPLLHTFEFQGNDEDVAQLKKAVNE 119
>gi|149277657|ref|ZP_01883797.1| ribonucleotide reductase stimulatory protein [Pedobacter sp. BAL39] >gi|149231345|gb|EDM36724.1| ribonucleotide reductase stimulatory protein [Pedobacter sp. BAL39] (122 aa)
Score = 107, Expect = 8.8e-04, Identities = 38/130 (29%), Positives = 63/130 (48%)
  Q:     9 VYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIK 138
           +YY SK+ N  RF+        RL +++  +  +I +   P      I    TY  G+G+    +P    +FL    N +  K+V +SGN N+   + +A   I+ K ++P L +FEL GT  D+   I+
  S:     6 IYYDSKTGNVERFIN-------RLRLQRDWDIQKIDQISQPLQEGHLI----TYTTGIGE----IPAATLRFLEE--NSSMIKSVSSSGNKNWGPNFAMAATKIAAKFKLPVLMQFELSGTGEDIRKFIE 118
>gi|162448130|ref|YP_001621262.1| protein involved in ribonucleotide reduction [Acholeplasma laidlawii PG-8A] >gi|161986237|gb|ABX81886.1| protein involved in ribonucleotide reduction [Acholeplasma laidlawii PG-8A] (124 aa)
Score = 105, Expect = 1.6e-03, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    71 GAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENV 136
           G +P+  K FL++   +++   V  SGN N+ + Y  AGD I  + +IP + KFE  G  SD E V
  S:    47 GQIPETTKNFLDS--YKDHVVGVAVSGNKNWGENYGKAGDKIEAQYKIPLILKFEGSGFKSDKETV 110
>gi|116490253|ref|YP_809797.1| ribonucleotide reduction protein [Oenococcus oeni PSU-1] >gi|118586505|ref|ZP_01543949.1| hypothetical protein, NrdI family [Oenococcus oeni ATCC BAA-1163] >gi|116090978|gb|ABJ56132.1| Ribonucleotide reduction protein [Oenococcus oeni PSU-1] >gi|118433069|gb|EAV39791.1| hypothetical protein, NrdI family [Oenococcus oeni ATCC BAA-1163] (155 aa)
Score = 96, Expect = 2.0e-02, Identities = 31/102 (30%), Positives = 45/102 (44%)
  Q:    34 IEQKDEPDEILESKIPTVNHPFILLTPTY-AGGLG---KLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVEN 135
           +E  D  D + E K      PF +  PTY  GG G   ++       +  +L+   N      +  SGN NFN  + +     + K   P LY +EL G   D+EN
  S:    42 VEVSDSTDLVEEEK------PFFINVPTYLEGGTGIGPEIHEIFTNALGDYLDYHDNFKKLIGIFGSGNRNFNVQFVLTAKRYASKYNKPLLYTYELSGIQKDIEN 141
>gi|194015330|ref|ZP_03053946.1| NrdI protein [Bacillus pumilus ATCC 7061] >gi|194012734|gb|EDW22300.1| NrdI protein [Bacillus pumilus ATCC 7061] (55 aa)
Score = 95, Expect = 2.2e-02, Identities = 18/43 (41%), Positives = 26/43 (60%)
  Q:    92 AVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVE 134
            + ASGN N+ D +  A D+I+    +P + KFEL GT  DV+
  S:     3 GIAASGNRNWGDGFGAAADVIATLYDVPVIGKFELAGTEEDVK 45
>gi|194246585|ref|YP_002004224.1| Ribonucleotide reductase, alpha subunit [Candidatus Phytoplasma mali] >gi|193806942|emb|CAP18374.1| Ribonucleotide reductase, alpha subunit [Candidatus Phytoplasma mali] (830 aa)
Score = 95, Expect = 2.7e-02, Identities = 26/77 (33%), Positives = 40/77 (51%)
  Q:    71 GAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSDVENVIKIGNEFWEKN 147
           G +PK  K FL+   +  +   V  SGN N+   +  AGD+I+    IP + KFE  G + DV  + K  +++  KN
  S:    57 GEIPKETKIFLDK--HSASTIGVAVSGNKNWGSNFGKAGDLIASNFSIPLVLKFEGSGFDEDVLYLKKWLSDYIYKN 131
>gi|167940574|ref|ZP_02527649.1| ribonucleotide reductase stimulatory protein [Bacillus cereus AH1134] (82 aa)
Score = 90, Expect = 9.6e-02, Identities = 34/98 (34%), Positives = 44/98 (44%)
  Q:     8 IVYYSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTY 105
           +V Y S + N  RF+ KLN     +P  Q DE           ++  FIL+  TY  G G     VP+ V  FL    N    K V ASGN N+ D +
  S:     2 LVAYDSMTGNVKRFIHKLN-----MPAVQIDED--------LVIDEDFILI--TYTTGFGN----VPERVLDFLER--NNEKLKGVSASGNRNWGDMF 78
>gi|171853533|emb|CAM11391.1| Ribonucleotide reductase, alpha subunit [Candidatus Phytoplasma australiense] (856 aa)
Score = 88, Expect = 1.5e-01, Identities = 23/62 (37%), Positives = 30/62 (48%)
  Q:    71 GAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSD 132
           G V +  K FL+   NR+    V  SGN  +   Y  AGDII+    IP + KFE  G   +
  S:    54 GEVSQEAKLFLDQ--NRDKVIGVAVSGNKTWGQNYGKAGDIIASTYNIPLVLKFEGSGIQEE 113
>gi|10957413|ref|NP_051639.1| ribonucleotide reductase [Deinococcus radiodurans R1] >gi|20178017|sp|Q9RZL8|NRDI_DEIRA Protein nrdI >gi|6460842|gb|AAF12546.1|AE001826_15 ribonucleotide reductase, NrdI family [Deinococcus radiodurans R1] (141 aa)
Score = 84, Expect = 5.0e-01, Identities = 28/122 (22%), Positives = 52/122 (42%)
  Q:    11 YSSKSNNTHRFMLKLNCKCLRLPIEQKDEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIPFLYKFELLGTNSD 132
           Y S + N   F   L  +    P+  +D          P     ++LLT T+        G VP   ++ L    + +  + V+ASG+ ++   +  A D+I+ + ++P + K    GT +D
  S:     6 YDSLTGNVRHFAETLAAELHVSPMRVQD----------PAPTDAYLLLTYTFG------SGEVPASTRRLLTT--HGHLLRGVVASGSYHWGHNFARAADVIAAEYRVPVVAKLNKGGTAAD 109
>gi|145517372|ref|XP_001444569.1| hypothetical protein GSPATT00012678001 [Paramecium tetraurelia strain d4-2] >gi|124411991|emb|CAK77172.1| unnamed protein product [Paramecium tetraurelia] (860 aa)
Score = 82, Expect = 7.2e-01, Identities = 33/112 (29%), Positives = 59/112 (52%)
  Q:    38 DEPDEILESKIPTVNHPFILLTPTYAGGLGKLKGAVPKPVKKFLNNPVNRNNCKAVIASGNTNFNDTYCIAGDIISQKLQIP-FLYKFELLGTNSDVEN--VIKIGNEFWEKNNF 149
           DE +E+ +SK+  V         + + GL KL    P+P K+    P  ++ C+ ++ +GN+ +N  Y  AG+I S++ ++  F + F +L   S  EN  ++ I  +   KN F
  S:   218 DEEEEMSDSKL--VKQLLDCKCDSLSTGLLKLLQG-PQPKKRAFLKPDLKSICQTLLENGNSIYN--YYSAGEIESKQFKLQNFKFNFIILSDISQFENILILHIEQQLERKNQF 327