>gi|26553540|ref|NP_757474.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma penetrans HF-2] >gi|26453546|dbj|BAC43878.1| ribonucleotide diphosphate reductase subunit beta [Mycoplasma penetrans HF-2] (339 aa)
Score = 1754, Expect = 0.0e+00, Identities = 339/339 (100%), Positives = 339/339 (100%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF
  S:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
>gi|50365347|ref|YP_053772.1| ribonucleotide-diphosphate reductase subunit beta [Mesoplasma florum L1] >gi|50363903|gb|AAT75888.1| ribonucleoside-diphosphate reductase beta chain [Mesoplasma florum L1] (340 aa)
Score = 1452, Expect = 5.4e-159, Identities = 271/336 (80%), Positives = 298/336 (88%)
  Q:     4 KKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           K  YYN+SVSPIEYA+ G KGKMRSVNWN +ND+KDLEVWNRITQNFWLPEKI +SNDL SW  L   WQEL+ RTFTGLTLLD+IQAT+GDVAQV NSLTDHEQVIYTNFAFMV VHARSYGSIFST CSS+QI  AH+WV+N E+LQ+RA+ LIPYY+ DDPLKSKVAAA+MPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKVIHNYYSGYKYQKKVAKL PEKQAEMK+FVF LLY++IDLEK +L ELY  F +AD AI+FSVYNAGKFLQNLGYDSPFT EET I+PEIF QLSARADENHDFFSG+GSSYIMG  EET+DDDW+F
  S:     5 KNQYYNESVSPIEYAQQGFKGKMRSVNWNVVNDEKDLEVWNRITQNFWLPEKIPVSNDLTSWRTLTPEWQELITRTFTGLTLLDTIQATVGDVAQVPNSLTDHEQVIYTNFAFMVAVHARSYGSIFSTLCSSEQIEEAHEWVINTETLQERAKALIPYYVNDDPLKSKVAAALMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNYYSGYKYQKKVAKLSPEKQAEMKEFVFKLLYELIDLEKAYLKELYEDFGLADDAIRFSVYNAGKFLQNLGYDSPFTEEETRIEPEIFTQLSARADENHDFFSGNGSSYIMGVSEETEDDDWEF 340
>gi|42561374|ref|NP_975825.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492872|emb|CAE77467.1| ribonucleoside-diphosphate reductase 2 beta chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] (339 aa)
Score = 1413, Expect = 1.7e-154, Identities = 261/339 (76%), Positives = 298/339 (87%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           M  ++ YY++SVSPIE+ K+  KG +RSVNWN IND+KDLEVWNRITQNFWLPEKI +SNDL SW  L S WQ+LV RTFTGLTLLD++QAT+GDVAQ+++SLTDHEQVIY+NFAFMVGVHARSYG+IFST CSS+QI  AH+WVV  E+LQKRA+ LIPYY G DPLKSKVAAA+MPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKVIHNYYSGYKYQKKVAKLP EKQ EMK+FVF LLY++IDLE  +L ELYAGF+I D AI+FSVYNAGKFLQNLGYDSPF+ EET I+PEIF QLSARADENHDFFSG+GSSY+MG   ET+D+DW+F
  S:     1 MAKEQKYYHESVSPIEFVKNNFKGNLRSVNWNVINDEKDLEVWNRITQNFWLPEKIPVSNDLSSWRSLSSEWQQLVTRTFTGLTLLDTVQATVGDVAQIEHSLTDHEQVIYSNFAFMVGVHARSYGTIFSTLCSSEQIEEAHEWVVKTETLQKRAKALIPYYTGTDPLKSKVAAALMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNYYSGYKYQKKVAKLPVEKQTEMKEFVFKLLYELIDLETAYLKELYAGFDIVDDAIRFSVYNAGKFLQNLGYDSPFSEEETRIEPEIFNQLSARADENHDFFSGNGSSYVMGVSVETEDEDWEF 339
>gi|83319806|ref|YP_424093.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283692|gb|ABC01624.1| ribonucleoside-diphosphate reductase, beta subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (339 aa)
Score = 1409, Expect = 5.1e-154, Identities = 261/339 (76%), Positives = 299/339 (88%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           M  ++ YY +SVSPIE+ K+  KG +RSVNWN IND+KDLEVWNRITQNFWLPEKI +SNDLPSW  L + WQ+LV RTFTGLTLLD++QAT+GDVAQ+++SLTDHEQVIY+NFAFMVGVHARSYG+IFST CSS+QI  AH+WVV  ESLQKRA+ LIPYY G DPLKSKVAAA+MPGFLLYGGFYLPFYL ++  LPNT DI+RLILRDKVIHNYYSGYKYQKKVAKL  EKQAEMK+FVF LLY++IDLE  +L ELYAGF+IAD AI+FSVYNAGKFLQNLGYDSPF+ EET I+PEIF QLSARADENHDFFSG+GSSY+MG   ET+D+DW+F
  S:     1 MAKEQKYYQESVSPIEFVKNDFKGNLRSVNWNVINDEKDLEVWNRITQNFWLPEKIPVSNDLPSWRSLSAEWQQLVTRTFTGLTLLDTVQATVGDVAQIEHSLTDHEQVIYSNFAFMVGVHARSYGTIFSTLCSSEQIEEAHEWVVKTESLQKRAKALIPYYAGTDPLKSKVAAALMPGFLLYGGFYLPFYLSSRAKLPNTSDIVRLILRDKVIHNYYSGYKYQKKVAKLSVEKQAEMKEFVFKLLYELIDLETAYLKELYAGFDIADDAIRFSVYNAGKFLQNLGYDSPFSEEETRIEPEIFNQLSARADENHDFFSGNGSSYVMGVSVETEDEDWEF 339
>gi|139474322|ref|YP_001129038.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes str. Manfredo] >gi|134272569|emb|CAM30835.1| ribonucleoside-diphosphate reductase beta subunit [Streptococcus pyogenes str. Manfredo] (337 aa)
Score = 1400, Expect = 5.3e-153, Identities = 253/335 (75%), Positives = 297/335 (88%)
  Q:     5 KDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + YY +S SPIEYA    + ++RS+NWN++NDDKDLEVWNR+TQNFWLPEK+ +SNDL SW  L  +WQ+L+ RT+TGLTLLD++QAT+GDVAQ+++S TDHEQVIYTNFAFMVG+HARSYG+IFST CSS+QI  AH+WVV+ +SLQ RA+VLIPYY GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  +PNT DIIRLILRDKVIHNYYSGYKYQ+KVA+L PEKQAEMK FVFDLLY++IDLEK +L ELYAGF++A+ AI+FS+YNAGKFLQNLGYDSPFT EET I PE+F QLSARADENHDFFSG+GSSY+MG  EET DDDW+F
  S:     3 QHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVTQNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDHEQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQQKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQNLGYDSPFTDEETRISPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF 337
>gi|19745563|ref|NP_606699.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS8232] >gi|19747686|gb|AAL97198.1| putative ribonucleotide reductase 2 [Streptococcus pyogenes MGAS8232] (337 aa)
Score = 1399, Expect = 7.7e-153, Identities = 252/335 (75%), Positives = 297/335 (88%)
  Q:     5 KDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + YY +S SPIEYA    + ++RS+NWN++NDDKDLEVWNR+TQNFWLPEK+ +SNDL SW  L  +WQ+L+ RT+TGLTLLD++QAT+GDVAQ+++S TDHEQVIYTNFAFMVG+HARSYG+IFST CSS+QI  AH+WVV+ +SLQ R++VLIPYY GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  +PNT DIIRLILRDKVIHNYYSGYKYQ+KVA+L PEKQAEMK FVFDLLY++IDLEK +L ELYAGF++A+ AI+FS+YNAGKFLQNLGYDSPFT EET I PE+F QLSARADENHDFFSG+GSSY+MG  EET DDDW+F
  S:     3 QHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVTQNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDHEQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRSRVLIPYYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQQKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQNLGYDSPFTEEETRISPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF 337
>gi|21909837|ref|NP_664105.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS315] >gi|28896468|ref|NP_802818.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes SSI-1] >gi|50913718|ref|YP_059690.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS10394] >gi|21904023|gb|AAM78908.1| putative ribonucleotide reductase 2 [Streptococcus pyogenes MGAS315] >gi|28811719|dbj|BAC64651.1| putative ribonucleotide reductase 2 [Streptococcus pyogenes SSI-1] >gi|50902792|gb|AAT86507.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS10394] (337 aa)
Score = 1399, Expect = 7.9e-153, Identities = 252/335 (75%), Positives = 297/335 (88%)
  Q:     5 KDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + YY +S SPIEYA    + ++RS+NWN++NDDKDLEVWNR+TQNFWLPEK+ +SNDL SW  L  +WQ+L+ RT+TGLTLLD++QAT+GDVAQ+++S TDHEQVIYTNFAFMVG+HARSYG+IFST CSS+QI  AH+WVV+ +SLQ RA+VLIPYY GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  +PNT DIIRLILRDKVIHNYYSGYKYQ+KVA+L PEKQAEMK FVFDLLY++IDLEK +L ELYAGF++A+ AI+FS+YNAGKFLQNLGYDSPFT EET + PE+F QLSARADENHDFFSG+GSSY+MG  EET DDDW+F
  S:     3 QHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVTQNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDHEQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQQKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQNLGYDSPFTDEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF 337
>gi|15674552|ref|NP_268726.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes M1 GAS] >gi|71910160|ref|YP_281710.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS5005] >gi|94987981|ref|YP_596082.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS9429] >gi|94989855|ref|YP_597955.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS10270] >gi|94991863|ref|YP_599962.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS2096] >gi|13621658|gb|AAK33447.1| putative ribonucleotide reductase 2 [Streptococcus pyogenes M1 GAS] >gi|71852942|gb|AAZ50965.1| ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS5005] >gi|94541489|gb|ABF31538.1| ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS9429] >gi|94543363|gb|ABF33411.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS10270] >gi|94545371|gb|ABF35418.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS2096] (337 aa)
Score = 1398, Expect = 1.1e-152, Identities = 251/335 (74%), Positives = 297/335 (88%)
  Q:     5 KDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + YY +S SPIEYA    + ++RS+NWN++NDDKDLEVWNR+TQNFWLPEK+ +SNDL SW  L  +WQ+L+ RT+TGLTLLD++QAT+GDVAQ+++S TDHEQVIYTNFAFMVG+HARSYG+IFST CSS+QI  AH+WVV+ +SLQ RA+VLIPYY GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  +PNT DIIRLILRDKVIHNYYSGYKYQ+KVA+L PEKQAEMK FVFDLLY++IDLEK +L ELYAGF++A+ AI+FS+YNAGKFLQNLGY+SPFT EET + PE+F QLSARADENHDFFSG+GSSY+MG  EET DDDW+F
  S:     3 QHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVTQNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDHEQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQQKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQNLGYESPFTDEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF 337
>gi|71903000|ref|YP_279803.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS6180] >gi|71802095|gb|AAX71448.1| ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS6180] (337 aa)
Score = 1396, Expect = 1.6e-152, Identities = 252/335 (75%), Positives = 297/335 (88%)
  Q:     5 KDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + YY +S SPIEYA    + ++RS+NWN++NDDKDLEVWNR+TQNFWLPEK+ +SNDL SW  L  +WQ+L+ RT+TGLTLLD++QAT+GDVAQ+++S TDHEQVIYTNFAFMVG+HARSYG+IFST CSS+QI  AH+WVV+ +SLQ R++VLIPYY GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  +PNT DIIRLILRDKVIHNYYSGYKYQ+KVA+L PEKQAEMK FVFDLLY++IDLEK +L ELYAGF++A+ AI+FS+YNAGKFLQNLGYDSPFT EET I PE+F QLSARADENHDFFSG+GSSY+MG  EET DDDW+F
  S:     3 QHYYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVTQNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDHEQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRSRVLIPYYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQQKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQNLGYDSPFTDEETRISPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF 337
>gi|94993745|ref|YP_601843.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS10750] >gi|94547253|gb|ABF37299.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS10750] (337 aa)
Score = 1395, Expect = 2.4e-152, Identities = 251/333 (75%), Positives = 296/333 (88%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           YY +S SPIEYA    + ++RS+NWN++NDDKDLEVWNR+TQNFWLPEK+ +SNDL SW  L  +WQ+L+ RT+TGLTLLD++QAT+GDVAQ+++S TDHEQVIYTNFAFMVG+HARSYG+IFST CSS+QI  AH+WVV+ +SLQ RA+VLIPYY GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  +PNT DIIRLILRDKVIHNYYSGYKYQ+KVA+L PEKQAEMK FVFDLLY++IDLEK +L ELYAGF++A+ AI+FS+YNAGKFLQNLGY+SPFT EET + PE+F QLSARADENHDFFSG+GSSY+MG  EET DDDW+F
  S:     5 YYERSQSPIEYALSETQKQLRSINWNYLNDDKDLEVWNRVTQNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDHEQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQQKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQNLGYESPFTEEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF 337
>gi|13508061|ref|NP_110010.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma pneumoniae M129] >gi|2500211|sp|P75461|RIR2_MYCPN Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|1674208|gb|AAB96162.1| ribonucleoside-diphosphate reductase beta chain [Mycoplasma pneumoniae M129] (339 aa)
Score = 1383, Expect = 5.7e-151, Identities = 252/339 (74%), Positives = 293/339 (86%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           M N K Y+ +SVSP+EYA+   +G +RSVNWN ++D+KDLEVWNRITQNFWLPEKI +SND+PSW +L   WQ+L+ +TFTGLTLLD+IQATIGD+ Q+  +LTDHEQVIY NFAFMVGVHARSYG+IFST C+S+QI  AH+WVV  ESLQKRA+ LIPYY G DPLKSKVAAA+MPGFLLYGGFYLPFYL ++  LPNT DIIRLILRDKVIHNYYSGYK+Q+KV K+  EKQAEMK+FVFDL+Y++I+LEK +L ELY GF I + AIKFS+YNAGKFLQNLGYDSPFT EET IKPEIF QLSARADENHDFFSG+GSSY+MG  EET+D DWDF
  S:     1 MANTKKYFLESVSPLEYAQKKFQGNLRSVNWNLVDDEKDLEVWNRITQNFWLPEKIPVSNDIPSWKQLSKEWQDLITKTFTGLTLLDTIQATIGDIKQIDYALTDHEQVIYANFAFMVGVHARSYGTIFSTLCTSEQITEAHEWVVKTESLQKRAKALIPYYTGKDPLKSKVAAALMPGFLLYGGFYLPFYLSSRKQLPNTSDIIRLILRDKVIHNYYSGYKFQRKVEKMSKEKQAEMKRFVFDLMYELIELEKAYLKELYEGFGIVEDAIKFSIYNAGKFLQNLGYDSPFTEEETRIKPEIFAQLSARADENHDFFSGNGSSYVMGISEETEDKDWDF 339
>gi|12045084|ref|NP_072895.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma genitalium G37] >gi|1350602|sp|P47471|RIR2_MYCGE Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|3844832|gb|AAC71450.1| ribonucleoside-diphosphate reductase, beta chain [Mycoplasma genitalium G37] >gi|166078981|gb|ABY79599.1| ribonucleoside-diphosphate reductase, beta chain [synthetic Mycoplasma genitalium JCVI-1.0] (340 aa)
Score = 1382, Expect = 7.6e-151, Identities = 251/337 (74%), Positives = 294/337 (87%)
  Q:     3 NKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           N K Y+ +S SP+ Y K+  +G +RSVNWN ++D+KDLEVWNRI QNFWLPEKI +SND+PSW KL  +WQ+L+ +TFTGLTLLD+IQATIGD+ Q+ ++LTDHEQVIY NFAFMVGVHARSYG+IFST C+S+QIN+AH+WVVN ESLQKRA+ LIPYY G+DPLKSKVAAA+MPGFLLYGGFYLPFYL ++  LPNT DIIRLILRDKVIHNYYSGYKYQ+K+ KLP  KQ EMK FVF+L+Y++I+LEK++L ELY GF I D AIKFSVYNAGKFLQNLGYDSPFT  ET IKPEIF QLSARADENHDFFSG+GSSY+MG  EET+DDDW+F
  S:     4 NNKKYFLESFSPLGYVKNNFQGNLRSVNWNLVDDEKDLEVWNRIVQNFWLPEKIPVSNDIPSWKKLSKDWQDLITKTFTGLTLLDTIQATIGDICQIDHALTDHEQVIYANFAFMVGVHARSYGTIFSTLCTSEQINAAHEWVVNTESLQKRAKALIPYYTGNDPLKSKVAAALMPGFLLYGGFYLPFYLSSRKQLPNTSDIIRLILRDKVIHNYYSGYKYQRKLEKLPLAKQKEMKAFVFELMYRLIELEKDYLKELYEGFGIVDDAIKFSVYNAGKFLQNLGYDSPFTAAETRIKPEIFAQLSARADENHDFFSGNGSSYVMGVSEETNDDDWNF 340
>gi|144227519|gb|AAZ44308.2| ribonucleoside-diphosphate reductase beta chain [Mycoplasma hyopneumoniae J] (353 aa)
Score = 1376, Expect = 3.4e-150, Identities = 253/336 (75%), Positives = 297/336 (88%)
  Q:     4 KKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           K DYY++SVSP+EYA +   GKMRS+NWN IND KDLEVW RI QNFW+PEKI +SNDL SW  L   W+++V RTFTGLTLLD+IQATIGDVAQ+K+SLTDHEQVIYTNFAFMVGVHARSYGSIFST CSS++I  AH+WV+N E LQKRA++LIP+Y+G+DPLKSKVAAA+MPGFLLYGGFYLPFYL A++ LPNT DIIRLILRDKVIHNYYSGYK+QKKV KL PEKQ E+KKF FDLLY++I+LEK++L +LY+   +A+ AIKFS+YNAGKFLQNLGYDSPF+ EETEI+PEIF QLSARADENHDFFSG+GSSY+M   EET+D+DW+F
  S:    18 KNDYYHQSVSPLEYALNNFSGKMRSINWNIINDPKDLEVWTRIVQNFWIPEKIPLSNDLESWRTLSPTWKKVVTRTFTGLTLLDTIQATIGDVAQIKHSLTDHEQVIYTNFAFMVGVHARSYGSIFSTLCSSEEIEEAHNWVINNEKLQKRARILIPFYVGEDPLKSKVAAALMPGFLLYGGFYLPFYLSARSKLPNTSDIIRLILRDKVIHNYYSGYKFQKKVEKLSPEKQDEIKKFTFDLLYKLIELEKDYLYDLYSEVGLAESAIKFSIYNAGKFLQNLGYDSPFSKEETEIEPEIFSQLSARADENHDFFSGNGSSYVMALAEETEDEDWEF 353
>gi|71893573|ref|YP_279019.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma hyopneumoniae J] >gi|72080562|ref|YP_287620.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma hyopneumoniae 7448] (339 aa)
Score = 1376, Expect = 3.7e-150, Identities = 254/339 (74%), Positives = 298/339 (87%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           M  K DYY++SVSP+EYA +   GKMRS+NWN IND KDLEVW RI QNFW+PEKI +SNDL SW  L   W+++V RTFTGLTLLD+IQATIGDVAQ+K+SLTDHEQVIYTNFAFMVGVHARSYGSIFST CSS++I  AH+WV+N E LQKRA++LIP+Y+G+DPLKSKVAAA+MPGFLLYGGFYLPFYL A++ LPNT DIIRLILRDKVIHNYYSGYK+QKKV KL PEKQ E+KKF FDLLY++I+LEK++L +LY+   +A+ AIKFS+YNAGKFLQNLGYDSPF+ EETEI+PEIF QLSARADENHDFFSG+GSSY+M   EET+D+DW+F
  S:     1 MKIKNDYYHQSVSPLEYALNNFSGKMRSINWNIINDPKDLEVWTRIVQNFWIPEKIPLSNDLESWRTLSPTWKKVVTRTFTGLTLLDTIQATIGDVAQIKHSLTDHEQVIYTNFAFMVGVHARSYGSIFSTLCSSEEIEEAHNWVINNEKLQKRARILIPFYVGEDPLKSKVAAALMPGFLLYGGFYLPFYLSARSKLPNTSDIIRLILRDKVIHNYYSGYKFQKKVEKLSPEKQDEIKKFTFDLLYKLIELEKDYLYDLYSEVGLAESAIKFSIYNAGKFLQNLGYDSPFSKEETEIEPEIFSQLSARADENHDFFSGNGSSYVMALAEETEDEDWEF 339
>gi|54020059|ref|YP_115670.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma hyopneumoniae 232] >gi|53987232|gb|AAV27433.1| ribonucleoside-diphosphate reductase beta chain [Mycoplasma hyopneumoniae 232] (353 aa)
Score = 1370, Expect = 1.5e-149, Identities = 251/334 (75%), Positives = 296/334 (88%)
  Q:     6 DYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           DYY++SVSP+EYA +   GKMRS+NWN IND KDLEVW RI QNFW+PEKI +SNDL SW  L   W+++V RTFTGLTLLD+IQATIGDVAQ+K+SLTDHEQVIYTNFAFMVGVHARSYGSIFST CSS++I  AH+WV+N E LQKRA++LIP+Y+G+DPLKSKVAAA+MPGFLLYGGFYLPFYL A++ LPNT D+IRLILRDKVIHNYYSGYK+QKKV KL PEKQ E+KKF FDLLY++I+LEK++L +LY+   +A+ AIKFS+YNAGKFLQNLGYDSPF+ EETEI+PEIF QLSARADENHDFFSG+GSSY+M   EET+D+DW+F
  S:    20 DYYHQSVSPLEYALNNFSGKMRSINWNIINDPKDLEVWTRIVQNFWIPEKIPLSNDLESWRTLSPTWKKVVTRTFTGLTLLDTIQATIGDVAQIKHSLTDHEQVIYTNFAFMVGVHARSYGSIFSTLCSSEEIEEAHNWVINNEKLQKRARILIPFYVGEDPLKSKVAAALMPGFLLYGGFYLPFYLSARSKLPNTSDVIRLILRDKVIHNYYSGYKFQKKVEKLSPEKQDEIKKFTFDLLYKLIELEKDYLYDLYSEVGLAESAIKFSIYNAGKFLQNLGYDSPFSKEETEIEPEIFSQLSARADENHDFFSGNGSSYVMALAEETEDEDWEF 353
>gi|22536601|ref|NP_687452.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus agalactiae 2603V/R] >gi|76788476|ref|YP_329136.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus agalactiae A909] >gi|76798641|ref|ZP_00780867.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77406064|ref|ZP_00783140.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae H36B] >gi|77407720|ref|ZP_00784475.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae COH1] >gi|77411308|ref|ZP_00787657.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae CJB111] >gi|77414130|ref|ZP_00790296.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 515] >gi|22533438|gb|AAM99324.1|AE014211_1 ribonucleoside-diphosphate reductase 2, beta subunit [Streptococcus agalactiae 2603V/R] >gi|76563533|gb|ABA46117.1| ribonucleoside-diphosphate reductase 2, beta subunit [Streptococcus agalactiae A909] >gi|76586006|gb|EAO62538.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77159800|gb|EAO70945.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 515] >gi|77162644|gb|EAO73606.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae CJB111] >gi|77173719|gb|EAO76833.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae COH1] >gi|77175344|gb|EAO78137.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae H36B] (336 aa)
Score = 1366, Expect = 4.6e-149, Identities = 253/335 (75%), Positives = 292/335 (87%)
  Q:     5 KDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + YY++S SP++YA       MRSVNWN +NDDKDLEVWNR+TQNFWLPEKI +SNDL SW  LD++WQ+L+ RTFTGLTLLDS+QAT+GD+AQ+K+S TDHEQVIY NFAFMV +HARSYG+IFST C+S QI  AH+WVV+ ESLQ R+++LIP+Y GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKVIHNYYSGYKYQ+KVAKL  EKQAEMK FVFDLLYQ+IDLEK +L ELY GF++A+ AI+FS+YNAGKFLQNLGYDSPFT EET I PE+F QLSARADENHDFFSG+GSSYIMG  EET D+DW+F
  S:     2 QSYYDRSQSPLDYALSEKAFPMRSVNWNKLNDDKDLEVWNRVTQNFWLPEKIPVSNDLNSWRTLDADWQQLITRTFTGLTLLDSVQATVGDIAQIKHSQTDHEQVIYANFAFMVAIHARSYGTIFSTLCTSQQIEEAHEWVVDTESLQARSRILIPFYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNYYSGYKYQQKVAKLSVEKQAEMKTFVFDLLYQLIDLEKAYLYELYDGFDLAEDAIRFSIYNAGKFLQNLGYDSPFTEEETRISPEVFAQLSARADENHDFFSGNGSSYIMGITEETLDEDWEF 336
>gi|71894414|ref|YP_278522.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma synoviae 53] >gi|71851202|gb|AAZ43811.1| ribonucleoside-diphosphate reductase beta chain [Mycoplasma synoviae 53] (339 aa)
Score = 1361, Expect = 2.0e-148, Identities = 248/339 (73%), Positives = 295/339 (87%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           M +   YYN+S+SP++Y K+ L+G MRSVNWNF+ND KDLEVWNR+TQNFWLPEKI +SNDL SWN++D +WQEL+VRTFTGLTLLD+IQAT+GD+AQ+ NSLTDHEQVIY NFAFMVGVHARSYG+IFST  +SD I  AH+WV+N E LQ RA+ L+PYY   DPLKSK+AAA+MPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKV+HNYYSGYKY++KV KLP EKQAE K+F F ++Y++I+LEK+FL ELY GF +AD+AI FS+YNAGKFLQN GY+SPFTPEET+I PE+F QLSARADENHDFFSG+GSSY+MG  EET D+DW+F
  S:     1 MISNNKYYNQSLSPLDYVKNNLQGVMRSVNWNFVNDPKDLEVWNRVTQNFWLPEKIPVSNDLKSWNEMDKSWQELLVRTFTGLTLLDTIQATLGDIAQIPNSLTDHEQVIYANFAFMVGVHARSYGTIFSTLSNSDDIEKAHEWVINNEKLQARAKFLVPYYTSKDPLKSKIAAALMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVLHNYYSGYKYRQKVEKLPKEKQAEYKEFTFKIMYELIELEKDFLRELYDGFGLADEAIAFSLYNAGKFLQNCGYESPFTPEETKISPEVFAQLSARADENHDFFSGNGSSYVMGVSEETQDEDWEF 339
>gi|25010526|ref|NP_734921.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus agalactiae NEM316] >gi|23094879|emb|CAD46097.1| unknown [Streptococcus agalactiae NEM316] (336 aa)
Score = 1359, Expect = 3.3e-148, Identities = 253/335 (75%), Positives = 291/335 (86%)
  Q:     5 KDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + YY++S SP++YA       MRSVNWN +NDDKDLEVWNR+TQNFWLPEKI +SNDL SW  LD++WQ+L+ RTFTGLTLLDS+QAT+GD+AQ+K+S TDHEQVIY NFAFMV +HARSYG+IFST C+S QI  AH+WVV+ ESLQ R+++LIP+Y GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKVIHNYYSGYKYQ+KVAKL  EKQAEMK FVFDLLYQ+IDLEK +L ELY GF++A+ AI+FS YNAGKFLQNLGYDSPFT EET I PE+F QLSARADENHDFFSG+GSSYIMG  EET D+DW+F
  S:     2 QSYYDRSQSPLDYALSEKAFPMRSVNWNKLNDDKDLEVWNRVTQNFWLPEKIPVSNDLNSWRTLDADWQQLITRTFTGLTLLDSVQATVGDIAQIKHSQTDHEQVIYANFAFMVAIHARSYGTIFSTLCTSQQIEEAHEWVVDTESLQARSRILIPFYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNYYSGYKYQQKVAKLSVEKQAEMKTFVFDLLYQLIDLEKAYLYELYDGFDLAEDAIRFSNYNAGKFLQNLGYDSPFTEEETRISPEVFAQLSARADENHDFFSGNGSSYIMGITEETLDEDWEF 336
>gi|31544249|ref|NP_852827.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma gallisepticum R] >gi|26398734|sp|Q9XC20|RIR2_MYCGA Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|5565932|gb|AAD45275.1|AF152114_3 ribonucleoside-diphosphate reductase beta chain [Mycoplasma gallisepticum] >gi|31541093|gb|AAP56395.1| NrdF [Mycoplasma gallisepticum R] (339 aa)
Score = 1350, Expect = 4.0e-147, Identities = 247/339 (72%), Positives = 287/339 (84%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           M N   YY+KS SP+ Y  +G KG MRS+NWN IND KDLEVW R+TQNFWLPEKI +SNDL SWN+L   W++LV RTFTGLTLLD+IQ T+GD+AQ+ NSLTDHEQ +Y NF+FMVGVHARSYG+IFST  +SD+I  AH+WV+N E LQ RA+ L+PYY  DDPLKSK+AAA+MPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKVIHNYYSGYKY+ KV KLP EKQ E KKFVF++LY++I+LEK+FL ELY GF +AD+AI FS+YNAGKFLQN GY+SPFTPEET+I PE+F QLSARADENHDFFSG+GSSYIMG  EET DDDW+F
  S:     1 MSNNNKYYDKSFSPLGYVANGQKGVMRSINWNVINDPKDLEVWTRVTQNFWLPEKIPVSNDLKSWNELTPEWKQLVTRTFTGLTLLDTIQCTLGDIAQIPNSLTDHEQFVYANFSFMVGVHARSYGTIFSTLNTSDEIEEAHEWVINNEKLQARAKFLVPYYTSDDPLKSKIAAALMPGFLLYGGFYLPFYLAARGKLPNTSDIIRLILRDKVIHNYYSGYKYRLKVQKLPKEKQEEYKKFVFEILYKLIELEKDFLRELYDGFGLADEAIAFSLYNAGKFLQNCGYESPFTPEETKISPEVFAQLSARADENHDFFSGNGSSYIMGVTEETQDDDWEF 339
>gi|56807592|ref|ZP_00365501.1| COG0208: Ribonucleotide reductase, beta subunit [Streptococcus pyogenes M49 591] (311 aa)
Score = 1342, Expect = 3.0e-146, Identities = 241/311 (77%), Positives = 281/311 (90%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           VNWN++NDDKDLEVWNR+TQNFWLPEK+ +SNDL SW  L  +WQ+L+ RT+TGLTLLD++QAT+GDVAQ+++S TDHEQVIYTNFAFMVG+HARSYG+IFST CSS+QI  AH+WVV+ +SLQ RA+VLIPYY GDDPLKSKVAAAMMPGFLLYGGFYLPFYL A+  +PNT DIIRLILRDKVIHNYYSGYKYQ+KVA+L PEKQAEMK FVFDLLY++IDLEK +L ELYAGF++A+ AI+FS+YNAGKFLQNLGY+SPFT EET + PE+F QLSARADENHDFFSG+GSSY+MG  EET DDDW+F
  S:     1 VNWNYLNDDKDLEVWNRVTQNFWLPEKVPVSNDLNSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDHEQVIYTNFAFMVGIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQDRARVLIPYYTGDDPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQQKVARLSPEKQAEMKAFVFDLLYELIDLEKAYLRELYAGFDLAEDAIRFSLYNAGKFLQNLGYESPFTDEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF 311
>gi|15829010|ref|NP_326370.1| ribonucleotide-diphosphate reductase subunit beta [Mycoplasma pulmonis UAB CTIP] >gi|14089954|emb|CAC13712.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN (RIBONUCLEOTIDE REDUCTASE) [Mycoplasma pulmonis] (341 aa)
Score = 1339, Expect = 7.3e-146, Identities = 247/336 (73%), Positives = 292/336 (86%)
  Q:     4 KKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +K Y+  S SP+E+A +  +GKMRSVNWN I+D+KDLEVWNR+ QNFWLPEKI +SNDL +W  LD  WQ+++ RTFTGLTLLD+IQATIGD+AQ+ +SLTDHEQVIYTNFAFMV +HARSYG+IFST CS++QIN AH+WV+N +SLQ RA++LIP+Y G DPLKSKVAAA+MPGFLLYGGFYLPFYL ++  LPNT DIIRLILRDKVIHNYYSGYKYQKKV KL  EKQ EMK+FVFDLLY++IDLEK++L ELY    +A+ AIKFS+YNAGKFLQNLGYDSPFT EET+I  EIF QLSARADENHDFFSG+GSSY+MG  EET+D+DW+F
  S:     6 RKTYFEDSTSPLEFALNNFRGKMRSVNWNKIDDEKDLEVWNRVCQNFWLPEKIPVSNDLETWRSLDPIWQKVITRTFTGLTLLDTIQATIGDIAQLPHSLTDHEQVIYTNFAFMVAIHARSYGTIFSTLCSTEQINEAHEWVINTKSLQDRAKILIPFYTGKDPLKSKVAAALMPGFLLYGGFYLPFYLSSRMKLPNTSDIIRLILRDKVIHNYYSGYKYQKKVEKLSLEKQKEMKEFVFDLLYKLIDLEKKYLYELYEEIGLAEDAIKFSLYNAGKFLQNLGYDSPFTSEETKIDAEIFSQLSARADENHDFFSGNGSSYVMGISEETEDEDWEF 341
>gi|144575330|gb|AAZ53597.2| ribonucleoside-diphosphate reductase beta chain [Mycoplasma hyopneumoniae 7448] (314 aa)
Score = 1309, Expect = 2.2e-142, Identities = 240/314 (76%), Positives = 280/314 (89%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           MRS+NWN IND KDLEVW RI QNFW+PEKI +SNDL SW  L   W+++V RTFTGLTLLD+IQATIGDVAQ+K+SLTDHEQVIYTNFAFMVGVHARSYGSIFST CSS++I  AH+WV+N E LQKRA++LIP+Y+G+DPLKSKVAAA+MPGFLLYGGFYLPFYL A++ LPNT DIIRLILRDKVIHNYYSGYK+QKKV KL PEKQ E+KKF FDLLY++I+LEK++L +LY+   +A+ AIKFS+YNAGKFLQNLGYDSPF+ EETEI+PEIF QLSARADENHDFFSG+GSSY+M   EET+D+DW+F
  S:     1 MRSINWNIINDPKDLEVWTRIVQNFWIPEKIPLSNDLESWRTLSPTWKKVVTRTFTGLTLLDTIQATIGDVAQIKHSLTDHEQVIYTNFAFMVGVHARSYGSIFSTLCSSEEIEEAHNWVINNEKLQKRARILIPFYVGEDPLKSKVAAALMPGFLLYGGFYLPFYLSARSKLPNTSDIIRLILRDKVIHNYYSGYKFQKKVEKLSPEKQDEIKKFTFDLLYKLIELEKDYLYDLYSEVGLAESAIKFSIYNAGKFLQNLGYDSPFSKEETEIEPEIFSQLSARADENHDFFSGNGSSYVMALAEETEDEDWEF 314
>gi|161508077|ref|YP_001578044.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus helveticus DPC 4571] >gi|160349066|gb|ABX27740.1| ribonucleoside-diphosphate reductase [Lactobacillus helveticus DPC 4571] (340 aa)
Score = 1295, Expect = 7.4e-141, Identities = 242/333 (72%), Positives = 282/333 (84%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           YY+ S SP+E+A +     MR++NWN I DDKDLEVWNR+TQNFWLPEKI +SND+ SWN+L  +WQ+L+ RTFTGLTLLD+ QA++GDVAQ+KNS TD EQ IY NFAFMV VHARSYG+IFST C+S+QI  AH+WVVN ++LQ RA+ +IPYY G+DPLKSKVAAA+MPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKVIHNYYSGYKYQ  V KL P KQAEMKKFVFD L ++IDLEK++L+ELY  F++ D AI FS+YNAGKFLQNLGYDSPFT EET I PE+F QLSA+ADENHDFFSG+GSSY+MG  EET DDDWDF
  S:     8 YYDYSQSPVEFAYNNNGKNMRAINWNDIKDDKDLEVWNRVTQNFWLPEKIPVSNDISSWNQLSDDWQQLITRTFTGLTLLDTTQASVGDVAQIKNSQTDIEQAIYANFAFMVAVHARSYGTIFSTLCTSEQIEEAHEWVVNNDALQARAKAVIPYYTGNDPLKSKVAAAIMPGFLLYGGFYLPFYLAARGKLPNTADIIRLILRDKVIHNYYSGYKYQLAVKKLAPAKQAEMKKFVFDFLDKLIDLEKKYLHELYGDFDLVDDAIHFSLYNAGKFLQNLGYDSPFTAEETYISPEVFAQLSAQADENHDFFSGNGSSYVMGTGEETKDDDWDF 340
>gi|111610216|gb|ABH11600.1| ribonucleoside-diphosphate reductase 2 alpha subunit [Lactobacillus helveticus CNRZ32] (340 aa)
Score = 1294, Expect = 1.1e-140, Identities = 241/333 (72%), Positives = 282/333 (84%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           YY+ S SP+E+A +     MR++NWN I DDKDLEVWNR+TQNFWLPEKI +SND+ SWN+L  +WQ+L+ RTFTGLTLLD+ QA++GDVAQ+KNS TD EQ IY NFAFMV VHARSYG+IFST C+S+QI  AH+WVVN ++LQ RA+ +IPYY G+DPLKSKVAAA+MPGFLLYGGFYLPFYL A+  LPNT DIIRLILRDKVIHNYYSGYKYQ  V KL P KQAEMKKFVFD L ++IDLEK++L+ELY  F++ D AI FS+YNAGKFLQNLGYDSPFT EET + PE+F QLSA+ADENHDFFSG+GSSY+MG  EET DDDWDF
  S:     8 YYDYSQSPVEFAYNNNGKNMRAINWNDIKDDKDLEVWNRVTQNFWLPEKIPVSNDISSWNQLSDDWQQLITRTFTGLTLLDTTQASVGDVAQIKNSQTDIEQAIYANFAFMVAVHARSYGTIFSTLCTSEQIEEAHEWVVNNDALQARAKAVIPYYTGNDPLKSKVAAAIMPGFLLYGGFYLPFYLAARGKLPNTADIIRLILRDKVIHNYYSGYKYQLAVKKLAPAKQAEMKKFVFDFLDKLIDLEKKYLHELYGDFDLVDDAIHFSLYNAGKFLQNLGYDSPFTAEETYVSPEVFAQLSAQADENHDFFSGNGSSYVMGTGEETKDDDWDF 340
>gi|66880106|ref|ZP_00405091.1| COG0208: Ribonucleotide reductase, beta subunit [Mycoplasma genitalium G-37] (223 aa)
Score = 955, Expect = 2.5e-101, Identities = 176/223 (78%), Positives = 199/223 (89%)
  Q:   117 MVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           MVGVHARSYG+IFST C+S+QIN+AH+WVVN ESLQKRA+ LIPYY G+DPLKSKVAAA+MPGFLLYGGFYLPFYL ++  LPNT DIIRLILRDKVIHNYYSGYKYQ+K+ KLP  KQ EMK FVF+L+Y++I+LEK++L ELY GF I D AIKFSVYNAGKFLQNLGYDSPFT  ET IKPEIF QLSARADENHDFFSG+GSSY+MG  EET+DDDW+F
  S:     1 MVGVHARSYGTIFSTLCTSEQINAAHEWVVNTESLQKRAKALIPYYTGNDPLKSKVAAALMPGFLLYGGFYLPFYLSSRKQLPNTSDIIRLILRDKVIHNYYSGYKYQRKLEKLPLAKQKEMKAFVFELMYRLIELEKDYLKELYEGFGIVDDAIKFSVYNAGKFLQNLGYDSPFTAAETRIKPEIFAQLSARADENHDFFSGNGSSYVMGVSEETNDDDWNF 223
>gi|23465253|ref|NP_695856.1| ribonucleotide-diphosphate reductase subunit beta [Bifidobacterium longum NCC2705] >gi|23325884|gb|AAN24492.1| ribonucleoside-diphosphate reductase 2 beta chain [Bifidobacterium longum NCC2705] (330 aa)
Score = 916, Expect = 7.1e-97, Identities = 170/328 (51%), Positives = 230/328 (70%)
  Q:    12 VSPIEYAKDGLK--GKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++PI   +  LK   ++ ++NWN + D+KDLEVW+R+T NFWLPEK+ +SND+PSW K+  +   L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHA+SY SIFST CS++QI++A DW  N E LQK+A++++ YY GD+P K KVA+ ++  FL Y GFYLP Y  A   L NT D+IRLI+RD+ +H YY GYKYQK +A+L   ++ +++ + +DLL ++ D E E+   LY    + D   KF  YN  K L NLGY + F  E  ++ P I   LS  ADENHDFFSGSGSSY+MG  EETDDDDWDF
  S:     1 MAPISIPRKPLKLIDRVSAINWNRLEDEKDLEVWDRLTGNFWLPEKVPVSNDIPSWQKMTEDEHTLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHAKSYSSIFSTLCSTEQIDAAFDWSENNEFLQKKAEIVLDYYEGDNPYKRKVASTLLESFLFYSGFYLPMYFSAHAKLTNTADVIRLIIRDEAVHGYYIGYKYQKGIAQLSDAERLDLQDYTYDLLNELYDNEVEYTQSLYDCVGLTDDVEKFLRYNGNKALMNLGYPALFPAEICDVNPAILAALSPNADENHDFFSGSGSSYVMGKAEETDDDDWDF 330
>gi|23335914|ref|ZP_00121145.1| COG0208: Ribonucleotide reductase, beta subunit [Bifidobacterium longum DJO10A] >gi|189440326|ref|YP_001955407.1| Ribonucleotide reductase beta subunit [Bifidobacterium longum DJO10A] >gi|189428761|gb|ACD98909.1| Ribonucleotide reductase beta subunit [Bifidobacterium longum DJO10A] (330 aa)
Score = 914, Expect = 1.4e-96, Identities = 170/328 (51%), Positives = 231/328 (70%)
  Q:    12 VSPIEYAKDGLK--GKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++PI   +  LK   ++ ++NWN + D+KDLEVW+R+T NFWLPEK+ +SND+PSW K+  +   L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHA+SY SIFST CS++QI++A DW  N E LQK+A++++ YY GD+P K KVA+ ++  FL Y GFYLP Y  A   L NT D+IRLI+RD+ +H YY GYKYQK +A+L   ++ +++ + +DLL ++ D E E+   LY   ++ D   KF  YN  K L NLGY + F  E  ++ P I   LS  ADENHDFFSGSGSSY+MG  EETDDDDWDF
  S:     1 MAPISIPRKPLKLIDRVSAINWNRLEDEKDLEVWDRLTGNFWLPEKVPVSNDIPSWQKMTEDEHTLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHAKSYSSIFSTLCSTEQIDAAFDWSENNEFLQKKAEIVLDYYEGDNPYKRKVASTLLESFLFYSGFYLPMYFSAHAKLTNTADVIRLIIRDEAVHGYYIGYKYQKGIAQLSDAERLDLQDYTYDLLNELYDNEVEYTQSLYDRVDLTDDVEKFLRYNGNKALMNLGYPALFPAEICDVNPAILAALSPNADENHDFFSGSGSSYVMGKAEETDDDDWDF 330
>gi|163842202|ref|YP_001626607.1| ribonucleotide-diphosphate reductase subunit beta [Renibacterium salmoninarum ATCC 33209] >gi|162955678|gb|ABY25193.1| ribonucleoside-diphosphate reductase beta chain [Renibacterium salmoninarum ATCC 33209] (325 aa)
Score = 897, Expect = 1.3e-94, Identities = 163/318 (51%), Positives = 228/318 (71%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           L  +++++NWN I DDKD+EVWNR+  NFWLPEK+ +SND+ SW  L  + Q+L +R FTGLTLLD++Q T+G V+ + +++T HE+ +YTN AFM  VHA+SY SIFST CS+ +I+ A  W V  E+LQK+AQ+++ YY GDDPLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+  E++ E+K + FDLLY++ + E ++ ++LY    +A+   KF  YNA K L NLGY++ F    T++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     8 LVDQVQAINWNRIQDDKDVEVWNRLVNNFWLPEKVPLSNDVQSWATLTPDEQQLTMRVFTGLTLLDTLQGTVGAVSLIPDAITPHEEAVYTNIAFMESVHAKSYSSIFSTLCSTKEIDEAFRWSVENENLQKKAQIVMNYYTGDDPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLEKVSEERREEIKAYTFDLLYELYENEIQYTHDLYDAVGLAEDVKKFLHYNANKALMNLGYEAMFPSTVTDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 325
>gi|152971534|ref|YP_001336643.1| ribonucleotide-diphosphate reductase subunit beta [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956383|gb|ABR78413.1| ribonucleotide-diphosphate reductase beta subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (320 aa)
Score = 890, Expect = 8.7e-94, Identities = 161/315 (51%), Positives = 217/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L +  Q+L +R FTGLTLLD+IQ T+G  A + ++LT HE+ + +N +FM  VHARSY SIFST C S ++++A  W  +C+ LQ++AQ+++ YY  D+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK +  + P K+ E+K F  DLL  + D E  +  ELY      D    F  YNA K L NLGY++ F  E   + P I   LS  ADENHDFFSGSGSSY++G +EET DDDWDF
  S:     6 RVSAINWNRIDDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNTVGAPALMADALTPHEEAVLSNISFMEAVHARSYSSIFSTLCHSKEVDAAFAWSESCDPLQRKAQLMLDYYQADEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLEIVSPGKREELKNFALDLLMDLYDNELAYSRELYGESGWFDDVSAFLCYNANKALMNLGYEALFPAEMAAVNPAILAALSPNADENHDFFSGSGSSYVIGKMEETADDDWDF 320
>gi|108798796|ref|YP_638993.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium sp. MCS] >gi|119867913|ref|YP_937865.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium sp. KMS] >gi|126434397|ref|YP_001070088.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium sp. JLS] >gi|108769215|gb|ABG07937.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Mycobacterium sp. MCS] >gi|119694002|gb|ABL91075.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Mycobacterium sp. KMS] >gi|126234197|gb|ABN97597.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Mycobacterium sp. JLS] (320 aa)
Score = 888, Expect = 1.4e-93, Identities = 160/315 (50%), Positives = 226/315 (71%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + DDKD EVW+R+T NFWLPEK+ +SND+PSWN L ++ ++L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHARSY +IFST CS+ +I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK +A   P  QAE+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     6 RVSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDIPSWNTLTAHEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHARSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAEIVMQYYKGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQKGLALQDPATQAELKDYTYELLFELYDNEVEYTQDLYDSVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDEDWDF 320
>gi|146312797|ref|YP_001177871.1| ribonucleotide-diphosphate reductase subunit beta [Enterobacter sp. 638] >gi|145319673|gb|ABP61820.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Enterobacter sp. 638] (319 aa)
Score = 885, Expect = 3.2e-93, Identities = 162/315 (51%), Positives = 215/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD+IQ ++G  A + +SLT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W     SLQ++AQ+++ YY  DDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   K+ E+K F  DLL  + D E  +  ELYAG +       F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D DWDF
  S:     5 RVSAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSHAEQQLTIRVFTGLTLLDTIQNSVGAPALMGDSLTPHEEAVMSNISFMEAVHARSYSSIFSTLCQTKDVDAAYSWSEASTSLQRKAQLVLEYYHADDPLKKKIASVFLESFLFYSGFWLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLEKISEAKREELKGFALDLLMDLYDNELSYTEELYAGTSWETDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDADWDF 319
>gi|119961248|ref|YP_948075.1| ribonucleotide-diphosphate reductase subunit beta [Arthrobacter aurescens TC1] >gi|119948107|gb|ABM07018.1| ribonucleoside-diphosphate reductase beta chain [Arthrobacter aurescens TC1] (324 aa)
Score = 883, Expect = 4.9e-93, Identities = 159/314 (50%), Positives = 226/314 (71%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + ++NWN I DDKD+EVWNR+  NFWLPEK+ +SND+ SW+ L  + Q+L +R FTGLTLLD+IQ T+G V+ + +++T HE+ +YTN AFM  VHA+SY SIFST CS+ +I+ A  W +  E+LQK+AQ+++ YY GDDPLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+   ++ E+K + F+LL+++ + E ++ ++LY G  +A+   KF  YNA K L NLGY++ F    T++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DW+F
  S:    11 VEAINWNKIQDDKDVEVWNRLVNNFWLPEKVPLSNDVQSWHTLTPDEQQLTMRVFTGLTLLDTIQGTVGAVSLIPDAITPHEEAVYTNIAFMESVHAKSYSSIFSTLCSTKEIDDAFRWSLENENLQKKAQIVMDYYQGDDPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLEKVSEARKQEIKDYTFELLFELYENEVQYTHDLYDGVGLAEDVKKFLHYNANKALMNLGYEAMFPASVTDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWEF 324
>gi|15827930|ref|NP_302193.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium leprae TN] >gi|14195114|sp|Q9CBQ2|RIR2_MYCLE Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|13093483|emb|CAC30684.1| ribonucleotide reductase small subunit [Mycobacterium leprae] (325 aa)
Score = 880, Expect = 9.8e-93, Identities = 160/318 (50%), Positives = 230/318 (72%)
  Q:    22 LKGKMR------SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           L GKM+      ++NWN++ DDKD EVW+R+T NFWLPEK+ +SNDLPSW  L ++ ++L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHA+SY SIFST CS+ +I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +  +   ++AE+K++ ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     2 LTGKMKLIDRVSAINWNWLQDDKDAEVWDRLTGNFWLPEKVPVSNDLPSWGTLTASEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHAKSYSSIFSTLCSTAEIDEAFRWSEENNNLQRKAKIVMEYYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLVLVDDARRAELKEYTYELLFELYDNEVEYTQDLYDRVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDEDWDF 325
>gi|194433043|ref|ZP_03065326.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella dysenteriae 1012] >gi|194418770|gb|EDX34856.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella dysenteriae 1012] (319 aa)
Score = 875, Expect = 4.1e-92, Identities = 160/315 (50%), Positives = 217/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+P  ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKITDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKIPLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|120403054|ref|YP_952883.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium vanbaalenii PYR-1] >gi|119955872|gb|ABM12877.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Mycobacterium vanbaalenii PYR-1] (324 aa)
Score = 873, Expect = 7.2e-92, Identities = 160/320 (50%), Positives = 227/320 (70%)
  Q:    20 DGLK--GKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           DG+K   ++ ++NWN + DDKD EVW R+T NFWLPEK+ +SND+PSWN L ++ ++L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHARSY +IFST CS+ +I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK +A      + E+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     3 DGMKLIDRVSAINWNRLQDDKDAEVWERLTGNFWLPEKVPVSNDIPSWNTLTAHEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHARSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAEIVMQYYKGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQKGLALESEATRQELKDYTYELLFELYDNEVEYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 324
>gi|157371959|ref|YP_001479948.1| ribonucleotide-diphosphate reductase subunit beta [Serratia proteamaculans 568] >gi|157323723|gb|ABV42820.1| Ribonucleoside-diphosphate reductase [Serratia proteamaculans 568] (323 aa)
Score = 871, Expect = 1.2e-91, Identities = 160/314 (50%), Positives = 212/314 (67%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +R+VNWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L    Q+L +R FTGLTLLD+IQ T+G  A + +++T HE+ +Y+N +FM  VHARSY SIFST C +  ++ A+ W     +LQK+A +++ +Y  DDPL  KVA+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+   ++ ++K F FDLL  + D E  +  ELY G    +    F  YNA K L NLGY++ F P   E+ P I   LS  ADENHDFFSGSGSSY++G    T+DDDWDF
  S:    10 VRAVNWNIIEDDKDLEVWNRLTSNFWLPEKVPLSNDIPSWATLTPKEQQLTIRVFTGLTLLDTIQNTVGAPALIADAITPHEEAVYSNISFMEAVHARSYSSIFSTLCQTPDVDDAYRWSEENRALQKKASIILAHYRSDDPLMKKVASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLEKVDAARRQQVKNFAFDLLQDLYDNEVRYTEELYDGVGWTEDVKTFLHYNANKALMNLGYEALFPPSMAEVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDDDWDF 323
>gi|154508355|ref|ZP_02043997.1| hypothetical protein ACTODO_00852 [Actinomyces odontolyticus ATCC 17982] >gi|153797989|gb|EDN80409.1| hypothetical protein ACTODO_00852 [Actinomyces odontolyticus ATCC 17982] (425 aa)
Score = 870, Expect = 1.7e-91, Identities = 158/312 (50%), Positives = 217/312 (69%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I DDKDLEVW+R+T NFWLPEKI +SNDLPSW  L  + Q +  R FTGLTLLD++Q T+G V+ + ++ T HE+ +YTN AFM  VHA+SY SIFST  S+++IN +  W    E+LQK+A+++  YY G+DP K KVA+ M+  FL Y GFY P Y  +   L NT D+IRLI+RD+ +H YY GYKYQ  V +   E+Q +++ + + LLY++ + E+++  +LY    + +   KF  YNA K L NLGY++ F  + T++ P I   LS  ADENHDFFSGSGSSY+MG V +T+D+DWDF
  S:   114 AINWNKIQDDKDLEVWDRLTGNFWLPEKIPLSNDLPSWKTLTKDEQLMTNRVFTGLTLLDTLQGTVGAVSLIPDARTPHEEAVYTNIAFMESVHAKSYSSIFSTLLSTEEINESFRWSNENEALQKKAEIVKSYYDGNDPEKRKVASTMLESFLFYSGFYAPMYWSSHAKLTNTADLIRLIIRDEAVHGYYIGYKYQLAVNESSQERQDDLRDYTYSLLYELYENEEQYTEDLYDPLGLTEDVKKFLRYNANKALMNLGYEALFPADATDVNPAILAALSPNADENHDFFSGSGSSYVMGEVVDTEDEDWDF 425
>gi|38234491|ref|NP_940258.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium diphtheriae NCTC 13129] >gi|38200754|emb|CAE50457.1| ribonucleoside-diphosphate reductase beta chain 2 [Corynebacterium diphtheriae] (341 aa)
Score = 869, Expect = 1.9e-91, Identities = 163/333 (48%), Positives = 231/333 (69%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIA--------DQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           Y + S++P ++  +     +R +NWN   D KD EVW R+T NFWLPEK+ +SNDLP+W  +   ++ELV RTFTGLTLLD++QA++G+++Q+ ++ T+HEQ +Y N AFM  VHARSY S+FST CSS +I+ A+ W ++   LQ+RA  +I +Y G DPLK KVA+ ++   LLY GFYLP +L  +  L NT D+IRLILRDK +H YYSGYKYQ+ + +L PE+  EM +F + L  +++D+EK +  +LYA  + A        D  + F  YNA K L NLGY+  +  +   + PEI   L+  ++E HDFFSGSGS+YI+G  EET ++DWDF
  S:     3 YVDNSITPPQWPHNPTT-PLRPINWNRTQDAKDNEVWQRLTANFWLPEKVPLSNDLPTWRTMTPVYRELVTRTFTGLTLLDTLQASVGEISQIPDAHTEHEQAVYANIAFMQAVHARSYSSVFSTMCSSTEIDDAYTWAISNPLLQRRATRVIEHYYGSDPLKRKVASTLLSSLLLYAGFYLPLWLSTRGKLMNTADMIRLILRDKAVHGYYSGYKYQRGL-ELKPERANEMAEFTYSLCDELLDMEKAYTADLYAPADQANALEGLTLDGVMSFVYYNADKALMNLGYEPAYEEQAAHVSPEIIAALTPESNETHDFFSGSGSAYIIGTAEETTEEDWDF 341
>gi|187734239|ref|YP_001881572.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella boydii CDC 3083-94] >gi|187431231|gb|ACD10505.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella boydii CDC 3083-94] (319 aa)
Score = 869, Expect = 2.1e-91, Identities = 159/315 (50%), Positives = 218/315 (69%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA  + AD    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETSWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|26249071|ref|NP_755111.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli CFT073] >gi|26109478|gb|AAN81681.1|AE016765_83 Ribonucleoside-diphosphate reductase 2 beta chain [Escherichia coli CFT073] (319 aa)
Score = 869, Expect = 2.3e-91, Identities = 159/315 (50%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ I +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NLGY+  F     E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAILSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNLEKISQARREELKSFAFDLLLELYDNELQYTDELYAETPWADDVTAFLCYNANKALMNLGYEPLFPAGMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|62425398|ref|ZP_00380532.1| COG0208: Ribonucleotide reductase, beta subunit [Brevibacterium linens BL2] (341 aa)
Score = 869, Expect = 2.4e-91, Identities = 163/329 (49%), Positives = 228/329 (69%)
  Q:    11 SVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           SV+P  Y  D    ++R +NWN + D+KDLEVWNR+T NFWLPEK+ +SND+P+W +L    + L +R FTGLT+LD++QAT+G++ Q++++ T+HE+ +YTN AFM  VHARSY S+FST  ++ +I+ A+ W V  + LQ+R + ++ +Y GDDPLK KV++ ++   LLY GFYLP +      L NT D+IRLILRDK +H YYSGYKYQ+ +      +Q EM++F ++LL  + +LE  +  ELY    + D    F  YNA K L NLGY + F  +ET++ PEI   L+  ADENHDFFSGSGSSY++G  E+T DDDWDF
  S:    14 SVTPPAYRHDP-AARLRPINWNRVGDEKDLEVWNRLTANFWLPEKVPLSNDIPAWQRLTQVERTLTMRVFTGLTMLDTVQATVGEICQIQDARTEHEEAVYTNIAFMQSVHARSYSSVFSTLSTTVEIDDAYRWAVGNDLLQQRCKKVLQHYYGDDPLKRKVSSTLLSSLLLYAGFYLPLHFSVHATLTNTADMIRLILRDKAVHGYYSGYKYQRGIENQTSARQEEMREFTYELLEDLYELELAYSGELYEPLGLMDDVAVFVRYNANKALMNLGYPARFNSDETQVNPEILAALAPGADENHDFFSGSGSSYVIGKGEDTSDDDWDF 341
>gi|145224865|ref|YP_001135543.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium gilvum PYR-GCK] >gi|145217351|gb|ABP46755.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Mycobacterium gilvum PYR-GCK] (320 aa)
Score = 868, Expect = 2.4e-91, Identities = 157/315 (49%), Positives = 224/315 (71%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + DDKD EVW+R+T NFWLPEK+ +SND+PSWN L ++ ++L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHARSY +IFST CS+ +I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK +A      + E+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     6 RVSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDIPSWNTLTAHEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHARSYSNIFSTLCSTSEIDDAFRWSEENPNLQRKAEIVMQYYKGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQKGLALADDATRQELKDYTYELLFELYDNEVEYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVITEDEDWDF 320
>gi|54026269|ref|YP_120511.1| ribonucleotide-diphosphate reductase subunit beta [Nocardia farcinica IFM 10152] >gi|54017777|dbj|BAD59147.1| putative ribonucleoside-diphosphate reductase beta subunit [Nocardia farcinica IFM 10152] (320 aa)
Score = 867, Expect = 3.4e-91, Identities = 155/315 (49%), Positives = 220/315 (69%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D+KD EVW R+T NFWLPEK+ +SND+PSWN L  + Q+L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ + TN AFM  VHA+SY SIFST CS+ +I+ A  W     +LQ++A++++ YY GDDPLK KVA+ ++  FL Y GFYLP +  ++  L NT D+IRLI+RD+ +H YY GYKYQ+ + ++   ++ E+K + F+LLY++ + E E+  +LY    + +    F  YNA K L NLGY+  F  +ET + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     6 RVSAINWNRVPDEKDAEVWARLTGNFWLPEKVPVSNDIPSWNTLTPHEQQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVLTNIAFMESVHAKSYSSIFSTLCSTKEIDEAFRWSEENRNLQRKAEIVLDYYQGDDPLKRKVASTLLESFLFYSGFYLPMHWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLEQVSEAEREELKNYTFELLYELYENEVEYTQDLYDEVGLTEDVKTFLRYNANKALMNLGYEGLFPADETRVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 320
>gi|16130590|ref|NP_417162.1| ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like protein [Escherichia coli str. K-12 substr. MG1655] >gi|74313247|ref|YP_311666.1| ribonucleotide-diphosphate reductase subunit beta [Shigella sonnei Ss046] >gi|89109469|ref|AP_003249.1| ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like [Escherichia coli W3110] >gi|157162127|ref|YP_001459445.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli HS] >gi|170019072|ref|YP_001724026.1| ribonucleoside-diphosphate reductase [Escherichia coli ATCC 8739] >gi|170082262|ref|YP_001731582.1| ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like protein [Escherichia coli str. K12 substr. DH10B] >gi|188492563|ref|ZP_02999833.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 53638] >gi|193065983|ref|ZP_03047042.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E22] >gi|193070996|ref|ZP_03051924.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E110019] >gi|194427830|ref|ZP_03060376.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B171] >gi|194439440|ref|ZP_03071516.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 101-1] >gi|2507306|sp|P37146|RIR4_ECOLI Ribonucleoside-diphosphate reductase 2 subunit beta (Ribonucleotide reductase 2) (R2F protein) >gi|1789031|gb|AAC75723.1| ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like protein [Escherichia coli str. K-12 substr. MG1655] >gi|1800064|dbj|BAA16541.1| ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like [Escherichia coli W3110] >gi|73856724|gb|AAZ89431.1| ribonucleoside-diphosphate reductase 2, beta chain, frag [Shigella sonnei Ss046] >gi|157067807|gb|ABV07062.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli HS] >gi|169754000|gb|ACA76699.1| Ribonucleoside-diphosphate reductase [Escherichia coli ATCC 8739] >gi|169890097|gb|ACB03804.1| ribonucleoside-diphosphate reductase 2, beta subunit, ferritin-like protein [Escherichia coli str. K12 substr. DH10B] >gi|188487762|gb|EDU62865.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 53638] >gi|192926397|gb|EDV81032.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E22] >gi|192955654|gb|EDV86129.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E110019] >gi|194414063|gb|EDX30339.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B171] >gi|194421616|gb|EDX37627.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 101-1] (319 aa)
Score = 867, Expect = 3.8e-91, Identities = 159/315 (50%), Positives = 217/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|191167101|ref|ZP_03028922.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B7A] >gi|190902883|gb|EDV62611.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B7A] (319 aa)
Score = 867, Expect = 3.9e-91, Identities = 159/315 (50%), Positives = 217/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|110642801|ref|YP_670531.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli 536] >gi|191171432|ref|ZP_03032981.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli F11] >gi|110344393|gb|ABG70630.1| ribonucleoside-diphosphate reductase 2 beta chain [Escherichia coli 536] >gi|190908366|gb|EDV67956.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli F11] (319 aa)
Score = 866, Expect = 4.5e-91, Identities = 158/315 (50%), Positives = 217/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+ +  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+  E++ E+K F FDLL ++ D E ++ +ELYA    +D    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKITSVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNLEKISQEQREELKSFAFDLLLELYDNELQYTDELYAETPWSDDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|38234435|ref|NP_940202.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium diphtheriae NCTC 13129] >gi|38200698|emb|CAE50394.1| ribonucleotide reductase beta-chain 1 [Corynebacterium diphtheriae] (328 aa)
Score = 866, Expect = 5.2e-91, Identities = 162/312 (51%), Positives = 218/312 (69%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D+KDLEVW+R+T NFWLPEKI +SND+ SWN L+   ++  +R FTGLTLLD+IQ T+G V+ + ++++ HE+ +YTN AFM  VHA+SY +IF T  S+ +IN A  W    E+LQK+A++++ YY GDDPLK KVA+ ++  FL Y GFYLP Y  +   L NT DIIRLI+RD+ +H YY GYK+Q+ + K  PE+QAE+K + FDLLY + D E ++  +LY      +   +F  YNA K L NLGY++ F  +E  + P I   LS  ADENHDFFSGSGSSY++G  E T DDDWDF
  S:    17 AINWNSIPDEKDLEVWDRLTGNFWLPEKIPVSNDIKSWNTLNDLEKQTTMRVFTGLTLLDTIQGTVGAVSMLPDAVSLHEEAVYTNIAFMESVHAKSYSNIFMTLASTPEINDAFRWSEENENLQKKAKIILSYYEGDDPLKRKVASTLLESFLFYSGFYLPMYWSSHAKLTNTADIIRLIIRDEAVHGYYIGYKFQQALRKETPERQAELKGYTFDLLYDLYDNEIQYTEDLYDDLGWTEDVKRFLRYNANKALNNLGYEALFPADECRVSPAILSALSPNADENHDFFSGSGSSYVIGKAENTTDDDWDF 328
>gi|18158911|pdb|1KGN|A Chain A, R2f From Corynebacterium Ammoniagenes In Its Oxidised, Fe Containing, Form >gi|18158912|pdb|1KGN|B Chain B, R2f From Corynebacterium Ammoniagenes In Its Oxidised, Fe Containing, Form >gi|18158913|pdb|1KGN|C Chain C, R2f From Corynebacterium Ammoniagenes In Its Oxidised, Fe Containing, Form >gi|18158914|pdb|1KGN|D Chain D, R2f From Corynebacterium Ammoniagenes In Its Oxidised, Fe Containing, Form >gi|18158915|pdb|1KGO|A Chain A, R2f From Corynebacterium Ammoniagenes In Its Reduced, Fe Containing, Form >gi|18158916|pdb|1KGO|B Chain B, R2f From Corynebacterium Ammoniagenes In Its Reduced, Fe Containing, Form >gi|18158917|pdb|1KGO|C Chain C, R2f From Corynebacterium Ammoniagenes In Its Reduced, Fe Containing, Form >gi|18158918|pdb|1KGO|D Chain D, R2f From Corynebacterium Ammoniagenes In Its Reduced, Fe Containing, Form >gi|18158919|pdb|1KGP|A Chain A, R2f From Corynebacterium Ammoniagenes In Its Mn Substituted Form >gi|18158920|pdb|1KGP|B Chain B, R2f From Corynebacterium Ammoniagenes In Its Mn Substituted Form >gi|18158921|pdb|1KGP|C Chain C, R2f From Corynebacterium Ammoniagenes In Its Mn Substituted Form >gi|18158922|pdb|1KGP|D Chain D, R2f From Corynebacterium Ammoniagenes In Its Mn Substituted Form >gi|48425146|pdb|1OQU|A Chain A, A Protein Coordinated Tri-Nuclear Fe Complex Formed During Soaking Of Crystals Of The Ribonucleotide Reductase R2f Protein From Corynebacterium Ammoniagenes >gi|48425147|pdb|1OQU|B Chain B, A Protein Coordinated Tri-Nuclear Fe Complex Formed During Soaking Of Crystals Of The Ribonucleotide Reductase R2f Protein From Corynebacterium Ammoniagenes >gi|48425148|pdb|1OQU|C Chain C, A Protein Coordinated Tri-Nuclear Fe Complex Formed During Soaking Of Crystals Of The Ribonucleotide Reductase R2f Protein From Corynebacterium Ammoniagenes >gi|48425149|pdb|1OQU|D Chain D, A Protein Coordinated Tri-Nuclear Fe Complex Formed During Soaking Of Crystals Of The Ribonucleotide Reductase R2f Protein From Corynebacterium Ammoniagenes >gi|193506844|pdb|3DHZ|A Chain A, Apo (Iron Free) Structure Of C. Ammoniagenes R2 Protein >gi|193506845|pdb|3DHZ|B Chain B, Apo (Iron Free) Structure Of C. Ammoniagenes R2 Protein >gi|3077614|emb|CAA70766.1| ribonucleotide reductase subunit R2F [Corynebacterium ammoniagenes] (329 aa)
Score = 865, Expect = 5.7e-91, Identities = 163/314 (51%), Positives = 219/314 (69%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++++NWN I D+KDLEVW+R+T NFWLPEKI +SND+ SWNK+    Q   +R FTGLTLLD+IQ T+G ++ + ++ T HE+ +YTN AFM  VHA+SY +IF T  S+ QIN A  W    E+LQ++A++++ YY GDDPLK KVA+ ++  FL Y GFYLP YL ++  L NT DIIRLI+RD+ +H YY GYKYQ+ V KL   +Q E K + FDL+Y + + E E+  ++Y      +   +F  YNA K L NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G  E+T DDDWDF
  S:    16 VKAINWNVIPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNKMTPQEQLATMRVFTGLTLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLGWTEDVKRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSLSPNADENHDFFSGSGSSYVIGKAEDTTDDDWDF 329
>gi|116670901|ref|YP_831834.1| ribonucleotide-diphosphate reductase subunit beta [Arthrobacter sp. FB24] >gi|116611010|gb|ABK03734.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Arthrobacter sp. FB24] (324 aa)
Score = 865, Expect = 5.8e-91, Identities = 159/318 (50%), Positives = 223/318 (70%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           L   + ++NWN I DDKD++VWNR+  NFWLPEK+ +SND+ SW  L  + Q+L +R FTGLTLLD+IQ T+G V+ + +++T HE+ +YTN AFM  VHA+SY SIFST  S+ +I+ A  W     +LQK+AQ+++ YY GDDPLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+  EK+ E+K + F+LL+++ + E ++ ++LY    +A+   KF  YNA K L NLGY++ F    T++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     7 LLSHVEAINWNRIQDDKDVDVWNRLVNNFWLPEKVPLSNDVQSWATLTPDEQQLTMRVFTGLTLLDTIQGTVGAVSLIPDAITPHEEAVYTNIAFMESVHAKSYSSIFSTLASTKEIDEAFRWSTENANLQKKAQIVMDYYQGDDPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLEKVSEEKRQEIKDYTFELLFELYENEVQYTHDLYDSVGLAEDVKKFLHYNANKALMNLGYEAMFPASVTDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 324
>gi|24113980|ref|NP_708490.1| ribonucleotide-diphosphate reductase subunit beta [Shigella flexneri 2a str. 301] >gi|30064043|ref|NP_838214.1| ribonucleotide-diphosphate reductase subunit beta [Shigella flexneri 2a str. 2457T] >gi|110806691|ref|YP_690211.1| ribonucleotide-diphosphate reductase subunit beta [Shigella flexneri 5 str. 8401] >gi|24053093|gb|AAN44197.1| ribonucleoside-diphosphate reductase 2, beta chain [Shigella flexneri 2a str. 301] >gi|30042299|gb|AAP18024.1| ribonucleoside-diphosphate reductase 2, beta chain [Shigella flexneri 2a str. 2457T] >gi|110616239|gb|ABF04906.1| ribonucleoside-diphosphate reductase 2, beta chain [Shigella flexneri 5 str. 8401] (319 aa)
Score = 863, Expect = 1.1e-90, Identities = 158/315 (50%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YN  K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFLCYNTNKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|118465359|ref|YP_883075.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium avium 104] >gi|118166646|gb|ABK67543.1| ribonucleoside-diphosphate reductase, beta subunit [Mycobacterium avium 104] (324 aa)
Score = 863, Expect = 1.2e-90, Identities = 156/315 (49%), Positives = 224/315 (71%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + DDKD EVW+R+T NFWLPEK+ +SNDL SW  L ++ +++ +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHARSY +IFST CS+ +I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ+ +A +   K+ E+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    10 RLSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDLQSWATLTAHEKQMTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHARSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAEIVMQYYKGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLALVDDAKRQELKDYTYELLFELYDNEVEYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDEDWDF 324
>gi|91212037|ref|YP_542023.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli UTI89] >gi|117624912|ref|YP_853853.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli APEC O1] >gi|91073611|gb|ABE08492.1| ribonucleoside-diphosphate reductase 2 beta chain [Escherichia coli UTI89] >gi|115514036|gb|ABJ02111.1| ribonucleoside-diphosphate reductase 2 beta chain [Escherichia coli APEC O1] (319 aa)
Score = 862, Expect = 1.4e-90, Identities = 158/315 (50%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK   K+   ++ E+K F FDLL ++ D E ++ +ELYA    +D    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFASRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNQEKISQAQREELKSFAFDLLLELYDNELQYTDELYAETPWSDDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|41409193|ref|NP_962029.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41398013|gb|AAS05643.1| NrdG [Mycobacterium avium subsp. paratuberculosis K-10] (324 aa)
Score = 861, Expect = 1.6e-90, Identities = 156/315 (49%), Positives = 224/315 (71%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + DDKD EVW+R+T NFWLPEK+ +SNDL SW  L ++ +++ +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHARSY +IFST CS+ +I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ+ +A +   K+ E+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    10 RVSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDLQSWATLTAHEKQMTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHARSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAEIVMQYYKGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLALVDDAKRQELKDYTYELLFELYDNEVEYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDEDWDF 324
>gi|118617484|ref|YP_905816.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium ulcerans Agy99] >gi|118569594|gb|ABL04345.1| ribonucleoside-diphosphate reductase (beta chain) NrdF2 [Mycobacterium ulcerans Agy99] (324 aa)
Score = 860, Expect = 2.1e-90, Identities = 152/315 (48%), Positives = 220/315 (69%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D+KD EVW+R+T NFWLPEK+ +SND+PSW  L +  ++L +R FTGLT+LD+IQ T+G V+ + ++LT HE+ + TN AFM  VHA+SY  IFST CS+ +I+ A  W     +LQ++A++++ YY GDDPLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +A     ++ E+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T D+DWDF
  S:    10 RVSAINWNRVQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGAVSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENSNLQRKAEIVLEYYRGDDPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLAAADEARRTELKDYTYELLFELYDNEVEYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATQDEDWDF 324
>gi|157148214|ref|YP_001455533.1| ribonucleotide-diphosphate reductase subunit beta [Citrobacter koseri ATCC BAA-895] >gi|157085419|gb|ABV15097.1| hypothetical protein CKO_04025 [Citrobacter koseri ATCC BAA-895] (319 aa)
Score = 860, Expect = 2.4e-90, Identities = 156/315 (49%), Positives = 213/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L +  Q+L +R FTGLTLLD+IQ   G  A ++++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ+++ +Y  D+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + KL   ++ E+K F  DLL ++ D E  +  ELYA          F  YNA K L NLGY++ F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RVSAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPALMQDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIILQHYTADNPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLEKLSESERDELKHFALDLLMELYDNESRYTEELYAETGWVADVNAFLCYNANKALMNLGYEALFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAIETEDEDWNF 319
>gi|3068719|gb|AAC14561.1| ribonucleoside diphosphate reductase small subunit [Corynebacterium ammoniagenes] (329 aa)
Score = 860, Expect = 2.6e-90, Identities = 163/314 (51%), Positives = 218/314 (69%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++++NWN I D+KDLEVW+R+T NFWLPEKI +SND+ SWNK+    Q   +R FTGLTLLD+IQ T+G ++ + +  T HE+ +YTN AFM  VHA+SY +IF T  S+ QIN A  W    E+LQ++A++++ YY GDDPLK KVA+ ++  FL Y GFYLP YL ++  L NT DIIRLI+RD+ +H YY GYKYQ+ V KL   +Q E K + FDL+Y + + E E+  ++Y      +   +F  YNA K L NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G  E+T DDDWDF
  S:    16 VKAINWNVIPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNKMTPQEQLATMRVFTGLTLLDTIQGTVGAISLLPDVETMHEEGVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTADIIRLIIRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLGWTEDVKRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSLSPNADENHDFFSGSGSSYVIGKAEDTTDDDWDF 329
>gi|15842613|ref|NP_337650.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis CDC1551] >gi|31794226|ref|NP_856719.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium bovis AF2122/97] >gi|57117051|ref|YP_177921.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis H37Rv] >gi|121638932|ref|YP_979156.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662901|ref|YP_001284424.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis H37Ra] >gi|148824239|ref|YP_001288993.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis F11] >gi|167969649|ref|ZP_02551926.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis H37Ra] >gi|194541737|ref|YP_002076768.1| ribonucleoside-diphosphate reductase (beta chain) nrdF2 [Mycobacterium tuberculosis C] >gi|1395209|gb|AAB81406.1| ribonucleotide reductase R2-2 small subunit [Mycobacterium tuberculosis] >gi|13882928|gb|AAK47464.1| ribonucleoside-diphosphate reductase R2-2, beta subunit [Mycobacterium tuberculosis CDC1551] >gi|31619821|emb|CAD96761.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE (BETA CHAIN) NRDF2 (RIBONUCLEOTIDE REDUCTASE SMALL SUBUNIT) (R2F PROTEIN) [Mycobacterium bovis AF2122/97] >gi|41352780|emb|CAE55544.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE (BETA CHAIN) NRDF2 (RIBONUCLEOTIDE REDUCTASE SMALL SUBUNIT) (R2F PROTEIN) [Mycobacterium tuberculosis H37Rv] >gi|121494580|emb|CAL73061.1| Ribonucleoside-diphosphate reductase (beta chain) nrdF2 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124599207|gb|EAY58311.1| ribonucleoside-diphosphate reductase (beta chain) nrdF2 [Mycobacterium tuberculosis C] >gi|134151191|gb|EBA43236.1| ribonucleoside-diphosphate reductase (beta chain) nrdF2 [Mycobacterium tuberculosis str. Haarlem] >gi|148507053|gb|ABQ74862.1| ribonucleoside-diphosphate reductase subunit beta NrdF2 [Mycobacterium tuberculosis H37Ra] >gi|148722766|gb|ABR07391.1| ribonucleoside-diphosphate reductase beta subunit nrdF2 [Mycobacterium tuberculosis F11] (324 aa)
Score = 858, Expect = 3.8e-90, Identities = 153/315 (48%), Positives = 222/315 (70%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D+KD EVW+R+T NFWLPEK+ +SND+PSW  L +  ++L +R FTGLT+LD+IQ T+G V+ + ++LT HE+ + TN AFM  VHA+SY  IFST CS+ +I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +A +    +AE+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+DDDWDF
  S:    10 RVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGAVSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVEYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDDDWDF 324
>gi|68535290|ref|YP_249995.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium jeikeium K411] >gi|68262889|emb|CAI36377.1| ribonucleoside-diphosphate reductase beta chain [Corynebacterium jeikeium K411] (338 aa)
Score = 858, Expect = 3.9e-90, Identities = 165/333 (49%), Positives = 236/333 (70%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGF-----NIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           Y  +S +P ++  D  +  +R VNWN ++D KDLE+W R+T NFWLPEK+ +SNDLP+WN L    +EL  + FTGLTLLD++QAT+G+++Q+ ++ T+HEQ +Y N AFM  VHARSY S+FST CSS++IN+A+ W +   +LQ+RA  ++ +Y GDDPLK KVAA ++   LLY GFYLP +   +  L NT D+IRLILRDK +H YYSGYK+Q+ + +  PE+ AE+++F F L+ ++++LEKE+  +LY        ++ D  + F  YNA K L NLGY   +  E  + +PEI   L+  ++E HDFFSGSGSSY++G  E T++DDWDF
  S:     3 YLMRSQTPPQWPHDPAR-PLRPVNWNRLDDQKDLEIWQRLTSNFWLPEKVPLSNDLPTWNALTDAERELTTKVFTGLTLLDTVQATVGEISQIPDARTEHEQAVYANIAFMQAVHARSYSSVFSTMCSSEEINAAYTWAIGNPALQRRATAVMQHYYGDDPLKRKVAATLLSSLLLYAGFYLPLWFSCRGTLMNTADMIRLILRDKAVHGYYSGYKFQRGL-EAHPERSAELEEFTFTLVEELLELEKEYSGDLYGETLPDEKSLIDGVMAFVHYNADKALMNLGYPPQYEEEAAKTEPEIIAALAPDSNETHDFFSGSGSSYVIGRAESTEEDDWDF 338
>gi|15803196|ref|NP_289228.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 EDL933] >gi|15832793|ref|NP_311566.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. Sakai] >gi|168708184|ref|ZP_02740461.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4045] >gi|168719748|ref|ZP_02752025.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4206] >gi|168734147|ref|ZP_02766424.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4115] >gi|168750919|ref|ZP_02775941.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4113] >gi|168755421|ref|ZP_02780428.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4401] >gi|168762471|ref|ZP_02787478.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4501] >gi|168768767|ref|ZP_02793774.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4486] >gi|168774792|ref|ZP_02799799.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4196] >gi|168778658|ref|ZP_02803665.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4076] >gi|168787931|ref|ZP_02812938.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC869] >gi|168792060|ref|ZP_02817067.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4042] >gi|168800561|ref|ZP_02825568.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC508] >gi|195938430|ref|ZP_03083812.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4024] >gi|12517115|gb|AAG57786.1|AE005496_9 ribonucleoside-diphosphate reductase 2, beta chain [Escherichia coli O157:H7 EDL933] >gi|13363010|dbj|BAB36962.1| ribonucleoside-diphosphate reductase 2 beta chain [Escherichia coli O157:H7 str. Sakai] >gi|187769524|gb|EDU33368.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4196] >gi|188015002|gb|EDU53124.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4113] >gi|189003218|gb|EDU72204.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4076] >gi|189357305|gb|EDU75724.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4401] >gi|189362069|gb|EDU80488.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4486] >gi|189367242|gb|EDU85658.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4501] >gi|189372097|gb|EDU90513.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC869] >gi|189377142|gb|EDU95558.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC508] (319 aa)
Score = 858, Expect = 4.3e-90, Identities = 158/315 (50%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+ +DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEYEDWNF 319
>gi|19553723|ref|NP_601725.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium glutamicum ATCC 13032] >gi|62391364|ref|YP_226766.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium glutamicum ATCC 13032] >gi|15430572|dbj|BAB64405.1| ribonucleoside diphosphate reductase [Corynebacterium glutamicum] >gi|21325297|dbj|BAB99918.1| Ribonucleotide reductase beta subunit [Corynebacterium glutamicum ATCC 13032] >gi|41326705|emb|CAF21187.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 BETA CHAIN [Corynebacterium glutamicum ATCC 13032] (334 aa)
Score = 857, Expect = 4.5e-90, Identities = 159/314 (50%), Positives = 219/314 (69%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++++NWN I D KDLEVW+R+T NFWLPEK+ +SND+ SW  L+   +   +R FTGLTLLD+IQ T+G ++ + ++ + HE+ + TN AFM  VHA+SY +IF T  S+ +IN A  W    E+LQ++A++++ YY GDDPLK K+A+ ++  FL Y GFYLP Y  + + L NT D+IRLI+RD+ +H YY GYKYQK VAK  PE+Q E+K++ FDLLY + D E ++  +LY      +   +F  YNA K L NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G  E T+DDDWDF
  S:    21 VKAINWNSIPDSKDLEVWDRLTGNFWLPEKVPVSNDIKSWGTLNEVEKAATMRVFTGLTLLDTIQGTVGAISLLPDADSLHEEAVLTNIAFMESVHAKSYSNIFMTLASTAEINDAFRWSEENENLQRKAKIILSYYEGDDPLKRKIASVILESFLFYSGFYLPMYWSSHSKLTNTADVIRLIIRDEAVHGYYIGYKYQKAVAKETPERQEELKEYTFDLLYDLYDNETQYSEDLYDDLGWTEDVKRFLRYNANKALNNLGYEGLFPADETKVSPNILSALSPNADENHDFFSGSGSSYVIGKAENTEDDDWDF 334
>gi|157159438|ref|YP_001463986.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli E24377A] >gi|157081468|gb|ABV21176.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E24377A] (319 aa)
Score = 857, Expect = 5.9e-90, Identities = 158/315 (50%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NL Y+  F  E  E+ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFLCYNANKALMNLDYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|145296522|ref|YP_001139343.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium glutamicum R] >gi|140846442|dbj|BAF55441.1| hypothetical protein [Corynebacterium glutamicum R] (334 aa)
Score = 856, Expect = 6.2e-90, Identities = 159/314 (50%), Positives = 219/314 (69%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++++NWN I D KDLEVW+R+T NFWLPEK+ +SND+ SW  L+   +   +R FTGLTLLD+IQ T+G ++ + ++ + HE+ + TN AFM  VHA+SY +IF T  S+ +IN A  W    E+LQ++A++++ YY GDDPLK K+A+ ++  FL Y GFYLP Y  + + L NT D+IRLI+RD+ +H YY GYKYQK VAK  PE+Q E+K++ FDLLY + D E ++  +LY      +   +F  YNA K L NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G  E T+DDDWDF
  S:    21 VKAINWNSIPDSKDLEVWDRLTGNFWLPEKVPVSNDIKSWGTLNDVEKAATMRVFTGLTLLDTIQGTVGAISLLPDADSLHEEAVLTNIAFMESVHAKSYSNIFMTLASTAEINDAFRWSEENENLQRKAKIILSYYEGDDPLKRKIASVILESFLFYSGFYLPMYWSSHSKLTNTADVIRLIIRDEAVHGYYIGYKYQKAVAKETPERQEELKEYTFDLLYDLYDNETQYSEDLYDDLGWTEDVKRFLRYNANKALNNLGYEGLFPADETKVSPNILSALSPNADENHDFFSGSGSSYVIGKAENTEDDDWDF 334
>gi|118469232|ref|YP_886661.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium smegmatis str. MC2 155] >gi|118469934|ref|YP_885432.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium smegmatis str. MC2 155] >gi|118170519|gb|ABK71415.1| ribonucleoside-diphosphate reductase, beta subunit [Mycobacterium smegmatis str. MC2 155] >gi|118171221|gb|ABK72117.1| ribonucleoside-diphosphate reductase, beta subunit [Mycobacterium smegmatis str. MC2 155] (324 aa)
Score = 856, Expect = 6.4e-90, Identities = 156/320 (48%), Positives = 227/320 (70%)
  Q:    20 DGLK--GKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           DG+K   ++ ++NWN + D+KD EVW+R+T NFWLPEK+ +SND+ SW+ L  N ++L +R FTGLTLLD+IQ T+G V+ + +++T HE+ + TN AFM  VHA+SY +IFST CS+ +I+ A  W     +LQ++A +++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ+ +A +  EK+ E+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   L+  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     3 DGIKLIDRVSAINWNRLQDEKDAEVWHRLTGNFWLPEKVPVSNDIQSWHTLTDNEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDAVTPHEEAVLTNIAFMESVHAKSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAAIVMQYYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLALVDEEKKQELKDYTYELLFELYDNEVEYTQDLYDSVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALAPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 324
>gi|167362055|ref|ZP_02296607.1| Ribonucleoside-diphosphate reductase [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167071088|gb|EDR75012.1| Ribonucleoside-diphosphate reductase [Rhizobium leguminosarum bv. trifolii WSM1325] (324 aa)
Score = 854, Expect = 1.2e-89, Identities = 155/315 (49%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++R+VNWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L +  Q+L +R FTGLTLLD+IQ  +G +  ++++ T HE+ + +N +FM  VHARSY SIFST CS+  ++ A+ W    E LQ+++ +++  Y   DPLK KVA+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ + +L  E++ E+K F F+LL ++ D E ++   LY G  + +   KF  YNA K L NLGY++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    10 RVRAVNWNRIEDDKDLEVWNRLTGNFWLPEKVPLSNDIPSWATLTAAEQQLTIRVFTGLTLLDTIQNGVGSIRLMEDAATSHEEAVLSNVSFMEAVHARSYSSIFSTLCSTPDVDDAYRWSEENEFLQRKSALIMEQYRSGDPLKKKVASVFLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLERLGDERKQEIKDFAFELLLELYDNEAKYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWDF 324
>gi|111023403|ref|YP_706375.1| ribonucleotide-diphosphate reductase subunit beta [Rhodococcus sp. RHA1] >gi|110822933|gb|ABG98217.1| ribonucleotide reductase [Rhodococcus sp. RHA1] (321 aa)
Score = 854, Expect = 1.3e-89, Identities = 154/318 (48%), Positives = 221/318 (69%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           L  ++ ++NWN + D+KD EVW+R+  NFWLPEK+ +SND+PSW  L    ++L +R FTGLTLLD+IQ T+G V+ + +++T HE+ +YTN AFM  VHA+SY SIFST CS+  I+ A  W     +LQ++A++++ YY GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + +L   ++ ++K + F+LL+++ D E ++  +LY    + +   KF  YNA K L NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     4 LVSRVSAINWNRVQDEKDAEVWDRLVGNFWLPEKVPVSNDIPSWGTLTPQEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDAITPHEEAVYTNIAFMESVHAKSYSSIFSTLCSTRDIDDAFRWSEENPNLQRKAEIVMDYYQGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLEQLTEAERDDLKNYTFELLFELYDNEVDYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEGLFPKDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 321
>gi|123441277|ref|YP_001005264.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122088238|emb|CAL11027.1| ribonucleoside-diphosphate reductase 2 beta chain [Yersinia enterocolitica subsp. enterocolitica 8081] (323 aa)
Score = 853, Expect = 1.6e-89, Identities = 157/312 (50%), Positives = 213/312 (68%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW KL ++ Q+L +R FTGLTLLD+IQ T+G  A +K+++T HE+ +++N +FM  VHARSY SIFST C +  ++ A+ W      LQK+A +++ +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+   ++ E+K F FDLL  + D E  +   LY G    +   KF  YNA K L NLGY++ F   +  + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    12 AINWNKIEDDKDLEVWNRLTANFWLPEKVPLSNDIPSWAKLTADEQQLTIRVFTGLTLLDTIQNTLGAPALIKDAITPHEEAVFSNISFMEAVHARSYSSIFSTLCMTSDVDEAYRWSEENGPLQKKADIILQHYNNDDPLKKKIASVFLESFLFYSGFYLPMYWSSRARLTNTADLIRLIIRDEAVHGYYIGYKFQKGLEKVDNNRRQEIKNFAFDLLQDLYDNEIHYTESLYDGVGWTEDVKKFLHYNANKALMNLGYEALFPASQANVNPAILAALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 323
>gi|156932794|ref|YP_001436710.1| ribonucleotide-diphosphate reductase subunit beta [Enterobacter sakazakii ATCC BAA-894] >gi|156531048|gb|ABU75874.1| hypothetical protein ESA_00590 [Enterobacter sakazakii ATCC BAA-894] (320 aa)
Score = 852, Expect = 1.8e-89, Identities = 152/315 (48%), Positives = 212/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D+KDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD+IQ  +G  A + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ+++ +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ+ +A++   ++  +K F  DL+ ++ D E  +   LY      D    F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DWDF
  S:     6 RISAINWNKLQDEKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTPGEQQLTIRVFTGLTLLDTIQNAVGAPALMADALTPHEEAVLSNVSFMEAVHARSYSSIFSTLCQTPDVDAAYAWSEENAPLQRKAQIILAHYRDDDPLKKKIASVFLESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQQALAQVDDARRESLKTFSLDLMMELYDNELAYTEALYRDVGWVDDVSAFLCYNANKALMNLGYEALFPPEMAQVNPSILAALSPGADENHDFFSGSGSSYVMGKAVETEDEDWDF 320
>gi|161502142|ref|YP_001569254.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160863489|gb|ABX20112.1| hypothetical protein SARI_00165 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (319 aa)
Score = 852, Expect = 2.0e-89, Identities = 153/315 (48%), Positives = 214/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L++  Q+L +R FTGLTLLD+IQ   G  + + +++T HE+ + +N +FM  VHARSY SIFST C S  +++A+ W      LQ++AQ+++ +Y+ D+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ  + K    ++ E+K F  DLL ++ D E  +   LYA  +  D    F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLNAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQSKDVDAAYAWSEENPQLQRKAQIMMTHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKQSAIEREELKLFALDLLMELYDNETRYTEALYAETDWVDDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGSGSSYVMGKAVETEDEDWNF 319
>gi|86359305|ref|YP_471197.1| ribonucleotide-diphosphate reductase subunit beta [Rhizobium etli CFN 42] >gi|86283407|gb|ABC92470.1| ribonucleoside-diphosphate reductase, beta subunit protein [Rhizobium etli CFN 42] (324 aa)
Score = 852, Expect = 2.1e-89, Identities = 155/315 (49%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++R++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L +  Q+L +R FTGLTLLD+IQ  +G V  +++++T HE+ + +N +FM  VHARSY SIFST CS+  ++ A+ W    E LQ+++ +++  Y   D LK KVA+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +  L  E++ E+K F FDLL ++ D E ++   LY G  +++   KF  YNA K L NLGY++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    10 RVRAINWNRIEDDKDLEVWNRLTGNFWLPEKVPLSNDIPSWATLTAAEQQLTIRVFTGLTLLDTIQNGVGAVGLMEDAVTPHEEAVLSNVSFMEAVHARSYSSIFSTLCSTPDVDDAYRWSEENEFLQRKSALIMEQYASGDALKKKVASVFLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLETLSEERRQEIKYFAFDLLLELYDNEAKYTEALYDGVGLSEDVKKFLHYNANKALMNLGYEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWDF 324
>gi|16766119|ref|NP_461734.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella typhimurium LT2] >gi|167992529|ref|ZP_02573627.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168219124|ref|ZP_02644356.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168228482|ref|ZP_02653713.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168233769|ref|ZP_02658827.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194469894|ref|ZP_03075878.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|585861|sp|P17424|RIR4_SALTY Ribonucleoside-diphosphate reductase 2 subunit beta (Ribonucleotide reductase 2) (R2F protein) >gi|4389108|pdb|2R2F|A Chain A, Ribonucleotide Reductase R2f Protein From Salmonella Typhimurium (Oxidized) >gi|4389109|pdb|2R2F|B Chain B, Ribonucleotide Reductase R2f Protein From Salmonella Typhimurium (Oxidized) >gi|4389155|pdb|1R2F|A Chain A, Ribonucleotide Reductase R2f Protein From Salmonella Typhimurium >gi|4389156|pdb|1R2F|B Chain B, Ribonucleotide Reductase R2f Protein From Salmonella Typhimurium >gi|109157246|pdb|2BQ1|I Chain I, Ribonucleotide Reductase Class 1b Holocomplex R1e,R2f From Salmonella Typhimurium >gi|109157247|pdb|2BQ1|J Chain J, Ribonucleotide Reductase Class 1b Holocomplex R1e,R2f From Salmonella Typhimurium >gi|311979|emb|CAA51695.1| ribonucleoside-diphosphate reductase [Salmonella typhimurium] >gi|16421357|gb|AAL21693.1| ribonucleoside-diphosphate reductase 2, beta subunit [Salmonella typhimurium LT2] >gi|194456258|gb|EDX45097.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (319 aa)
Score = 852, Expect = 2.2e-89, Identities = 152/315 (48%), Positives = 214/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L +  Q+L +R FTGLTLLD+IQ   G  + + +++T HE+ + +N +FM  VHARSY SIFST C + ++++A+ W      LQ++AQ+++ +Y+ D+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ  + KL   ++ E+K F  DLL ++ D E  +   LYA     +    F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF 319
>gi|152964774|ref|YP_001360558.1| ribonucleotide-diphosphate reductase subunit beta [Kineococcus radiotolerans SRS30216] >gi|151359291|gb|ABS02294.1| Ribonucleoside-diphosphate reductase [Kineococcus radiotolerans SRS30216] (323 aa)
Score = 851, Expect = 2.4e-89, Identities = 153/318 (48%), Positives = 221/318 (69%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           L  ++ ++NWN + DDKDLE+WNR+T NFWLPEK+ +SND+ SW  L +  + L +R FTGLTLLD+IQ T+G V+ + ++LT HE+ +YTN AFM  VHARSY SIFST  ++ +I+ A  W  + E+LQ++A +++ YY GDDPLK KVA+ ++  FL Y GF+LP +  ++  L NT D++RLI+RD+ +H YY GYK+Q+ +  +   K+ E+K + F+LLY++ D E ++  +LY G  + +    F  YNA K L NLGY+  F  + T++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DW+F
  S:     6 LVDRVNAINWNRLQDDKDLEIWNRLTSNFWLPEKVPLSNDVQSWQNLGAQERTLTLRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMESVHARSYSSIFSTLATTREIDEAFAWSEDNEALQRKASIVLEYYHGDDPLKRKVASTLLESFLFYSGFFLPMHFSSRAQLTNTADLVRLIIRDEAVHGYYIGYKFQRGLELVDQAKRDEIKDYAFELLYELYDNECKYTADLYDGVGLTEDVKTFLHYNANKALMNLGYEGMFPSDMTKVDPSILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWEF 323
>gi|116253995|ref|YP_769833.1| ribonucleotide-diphosphate reductase subunit beta [Rhizobium leguminosarum bv. viciae 3841] >gi|115258643|emb|CAK09747.1| putative ribonucleoside-diphosphate reductase beta subunit [Rhizobium leguminosarum bv. viciae 3841] (324 aa)
Score = 850, Expect = 3.2e-89, Identities = 153/315 (48%), Positives = 216/315 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++R++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L +  Q+L +R FTGLTLLD+IQ  +G +  ++++ T HE+ + +N +FM  VHARSY SIFST CS+  ++ A+ W    E LQ+++ +++  Y   DPLK KVA+  +  FL Y GFYLP Y  ++  L NT D++RLI+RD+ +H YY GYK+Q+ + +L  E++ E+K F F+LL ++ D E ++   LY G  + +   KF  YNA K L NLGY++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    10 RVRAINWNRIEDDKDLEVWNRLTGNFWLPEKVPLSNDIPSWATLTAAEQQLTIRVFTGLTLLDTIQNGVGSIRLMEDAATPHEEAVLSNVSFMEAVHARSYSSIFSTLCSTPDVDDAYRWSEENEFLQRKSALIMEQYRSGDPLKKKVASVFLESFLFYSGFYLPMYWSSRAKLTNTADMVRLIIRDEAVHGYYIGYKFQRGLERLGDERKQEIKDFAFELLLELYDNEAKYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWDF 324
>gi|5230837|gb|AAD41037.1|AF112536_1 ribonucleotide reductase beta-chain [Corynebacterium glutamicum] (334 aa)
Score = 850, Expect = 3.4e-89, Identities = 158/314 (50%), Positives = 218/314 (69%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++++NWN I D KDLEVW+R+T NFWLPEK+ +SND+ SW  L+   +   +R FTGLTLLD+IQ T+G ++ + ++ + HE+ + TN AFM  VHA+SY +IF T  S+ +IN A  W    E+LQ++A++++ YY GDDPLK K+A+ ++  FL Y GFYLP Y  + + L NT D+IRLI+RD+ +H YY GYKYQK VAK  PE+Q E+K++ FDLLY + D E ++  +LY      +   +F  Y A K L NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G  E T+DDDWDF
  S:    21 VKAINWNSIPDSKDLEVWDRLTGNFWLPEKVPVSNDIKSWGTLNEVEKAATMRVFTGLTLLDTIQGTVGAISLLPDADSLHEEAVLTNIAFMESVHAKSYSNIFMTLASTAEINDAFRWSEENENLQRKAKIILSYYEGDDPLKRKIASVILESFLFYSGFYLPMYWSSHSKLTNTADVIRLIIRDEAVHGYYIGYKYQKAVAKETPERQEELKEYTFDLLYDLYDNETQYSEDLYDDLGWTEDVKRFLRYIANKALNNLGYEGLFPADETKVSPNILSALSPNADENHDFFSGSGSSYVIGKAENTEDDDWDF 334
>gi|50122260|ref|YP_051427.1| ribonucleotide-diphosphate reductase subunit beta [Pectobacterium atrosepticum SCRI1043] >gi|49612786|emb|CAG76236.1| ribonucleoside-diphosphate reductase 2 beta chain [Erwinia carotovora subsp. atroseptica SCRI1043] (320 aa)
Score = 849, Expect = 3.9e-89, Identities = 154/316 (48%), Positives = 217/316 (68%)
  Q:    24 GKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
            +++++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW+ L++  ++L +R FTGLTLLD+IQ T+G    + +++T HE+ + +N +FM  VHARSY SIFST C + +++ A+ W     +LQK++ +++ +Y  DDPL  KVA+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +AK  P +Q ++K F +DLL  + D E  +  ELY G    +   KF  YNA K L NLGY++ F    T++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     5 ARIQAINWNKIEDDKDLEVWNRLTSNFWLPEKVPLSNDIPSWSTLNTRERQLTIRVFTGLTLLDTIQNTLGAPTLMPDAVTPHEEAVLSNISFMEAVHARSYSSIFSTLCLTSEVDDAYRWSEENPALQKKSDIILSHYRSDDPLMKKVASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALAKADPARQQQVKNFAYDLLQDLYDNEVLYTQELYDGVGWTEDVKKFLHYNANKALMNLGYEALFPASMTDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 320
>gi|62181312|ref|YP_217729.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161615703|ref|YP_001589668.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167544311|ref|ZP_02339882.1| hypothetical protein Sentent_13603 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167552693|ref|ZP_02346445.1| hypothetical protein Sentente_19580 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168822877|ref|ZP_02834877.1| hypothetical protein Salentericaenterica_26082 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|62128945|gb|AAX66648.1| ribonucleoside-diphosphate reductase 2, beta subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365067|gb|ABX68835.1| hypothetical protein SPAB_03488 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (319 aa)
Score = 849, Expect = 3.9e-89, Identities = 152/315 (48%), Positives = 214/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L +  Q+L +R FTGLTLLD+IQ   G  + + +++T HE+ + +N +FM  VHARSY SIFST C + ++++A+ W      LQ++AQ+++ +Y+ D+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ  + KL   ++ E+K F  DLL ++ D E  +   LYA     +    F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEICYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF 319
>gi|159184148|ref|NP_353105.2| ribonucleotide-diphosphate reductase subunit beta [Agrobacterium tumefaciens str. C58] >gi|159139483|gb|AAK85890.2| ribonucleoside-diphosphate reductase 2 beta chain [Agrobacterium tumefaciens str. C58] (324 aa)
Score = 849, Expect = 4.0e-89, Identities = 155/315 (49%), Positives = 213/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++R+VNWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L    QEL +R FTGLTLLD+IQ  +G V  + +S T HE+ + +N +FM  VHARSY SIFST CS+  ++ A+ W    E LQ+++ +++  Y   DPLK K+A+  +  FL Y GFYLP +  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ + +L   ++ E+K F FDLL ++ D E ++  +LY G  + +   +F  YNA K L NLGY++ F  E   + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    10 RIRAVNWNRIEDDKDLEVWNRLTSNFWLPEKVPLSNDIPSWGTLKPEEQELTIRVFTGLTLLDTIQNGVGAVRLMPDSATPHEEAVLSNISFMEAVHARSYSSIFSTLCSTPDVDDAYRWSEENEFLQRKSAIIMREYDSGDPLKKKIASVFLESFLFYSGFYLPMFWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALDRLGEAQRQEIKDFAFDLLLELYDNEAKYTEDLYDGVGLTEDVKQFLHYNANKALMNLGYEALFPAEACRVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWDF 324
>gi|25028975|ref|NP_739029.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium efficiens YS-314] >gi|23494262|dbj|BAC19229.1| ribonucleotide reductase beta chain [Corynebacterium efficiens YS-314] (334 aa)
Score = 849, Expect = 4.4e-89, Identities = 155/312 (49%), Positives = 216/312 (69%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I DDKDLEVW+R+T NFWLPEKI +SND+ SW  L    ++  +R FTGLTLLD+IQ T+G V+ + ++ + HE+ + TN AFM  VHA+SY +IF T  S+ QIN A  W    E+LQ++A++++ YY G+DPLK K+A+ ++  FL Y GFYLP Y  +   L NT D+IRLI+RD+ +H YY GYKYQK +A+   ++Q E+K++ FDLLY + + E ++  +LY      +   +F  YNA K + NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G  E T+D+DWDF
  S:    23 AINWNSIPDDKDLEVWDRLTGNFWLPEKIPVSNDIKSWGTLTDKEKQATMRVFTGLTLLDTIQGTVGAVSLLPDAESLHEEAVLTNIAFMESVHAKSYSNIFMTLASTPQINDAFRWSEENEALQRKAKIILAYYEGEDPLKRKIASVILESFLFYSGFYLPMYWSSHAKLTNTADVIRLIIRDEAVHGYYVGYKYQKALARESAQRQEELKEYAFDLLYDLYENETQYTEDLYDELGWTEDVKRFLRYNANKAMNNLGYEGLFPADETKVSPAILSALSPNADENHDFFSGSGSSYVIGKAEHTEDEDWDF 334
>gi|16761590|ref|NP_457207.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143070|ref|NP_806412.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25330821|pir||AH0841 ribonucleoside-diphosphate reductase (EC 1.17.4.1) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16503891|emb|CAD05919.1| ribonucleoside-diphosphate reductase 2 beta chain [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138703|gb|AAO70272.1| ribonucleoside-diphosphate reductase 2 beta chain [Salmonella enterica subsp. enterica serovar Typhi Ty2] (319 aa)
Score = 848, Expect = 6.2e-89, Identities = 151/315 (47%), Positives = 214/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L +  Q+L +R FTGLTLLD+IQ   G  + + +++T HE+ + +N +FM  VHARSY SIFST C + ++++A+ W      LQ++AQ+++ +Y+ D+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q  + KL   ++ E+K F  DLL ++ D E  +   LYA     +    F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKHQIALQKLSAIEREELKLFALDLLMELYDNEICYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF 319
>gi|167558100|ref|ZP_02351110.1| hypothetical protein Sententeri_14818 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (319 aa)
Score = 847, Expect = 8.4e-89, Identities = 152/315 (48%), Positives = 213/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L +  Q+L +R FTGLTLLD+IQ   G  + + +++T HE+ + +N +FM  VHARSY SIFST C + +++ A+ W      LQ++AQ+++ +Y+ D+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ  + KL   ++ E+K F  DLL ++ D E  +   LYA     +    F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     5 RISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDVAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEICYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF 319
>gi|163867489|ref|YP_001608688.1| ribonucleotide-diphosphate reductase subunit beta [Bartonella tribocorum CIP 105476] >gi|161017135|emb|CAK00693.1| ribonucleoside-diphosphate reductase beta chain [Bartonella tribocorum CIP 105476] (324 aa)
Score = 846, Expect = 8.6e-89, Identities = 151/312 (48%), Positives = 216/312 (69%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +VNWN ++D+KDLEVWNR+T NFWLPEK+ +SND+PSW+ L    ++L +R FTGLTLLD+IQ T+G ++ + +++T+HE+ + TN AFM  VHARSY SIFST CS+ +++ A  W      LQK+A++++  Y  +DPLK K+A+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q   AKL   K+ E+K F F+LL+ + ++E ++  +LY    + +    F  YNA K L NLG+++ F PE   + P I   LS  +DENHDFFSG+GSSY++G    T DDDW+F
  S:    13 AVNWNRLHDEKDLEVWNRLTGNFWLPEKVPLSNDIPSWSSLTEEERKLTIRVFTGLTLLDTIQNTVGAISLLADAITEHEEAVLTNIAFMEAVHARSYSSIFSTLCSTVEVDDAFRWSEENSHLQKKARLVLERYEANDPLKKKIASTLLESFLFYSGFYLPMYWASRAKLTNTADLIRLIIRDEAVHGYYIGYKFQLGYAKLEEAKRQEVKDFAFNLLFDLYNIECKYTEDLYDSLGLTEDVKIFLHYNANKALMNLGFEALFPPEVCHVNPAILASLSPNSDENHDFFSGAGSSYVIGKAVATTDDDWEF 324
>gi|77957732|ref|ZP_00821780.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia bercovieri ATCC 43970] (323 aa)
Score = 846, Expect = 8.9e-89, Identities = 155/315 (49%), Positives = 213/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L  N Q+L +R FTGLTLLD+IQ T+G  A +K+++T HE+ +++N +FM  VHARSY SIFST C +  ++ A+ W      LQK+A +++ +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + ++   ++ E+K F FDLL  + D E  +  +LY      +   KF  YNA K L NLGY++ F   +  + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     9 RISAINWNKIEDDKDLEVWNRLTANFWLPEKVPLSNDIPSWATLTPNEQQLTIRVFTGLTLLDTIQNTLGAPALIKDAMTPHEEAVFSNISFMEAVHARSYSSIFSTLCMTSDVDDAYRWSEENGPLQKKADIILQHYHNDDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLERVDNSRRQEIKNFAFDLLQDLYDNEVRYTEDLYDKVGWTEDVKKFLHYNANKALMNLGYEALFPASQAAVSPAILAALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 323
>gi|77961613|ref|ZP_00825446.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia mollaretii ATCC 43969] (323 aa)
Score = 846, Expect = 9.8e-89, Identities = 156/315 (49%), Positives = 213/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L  N Q+L +R FTGLTLLD+IQ T+G  A +K+++T HE+ +++N +FM  VHARSY SIFST C +  ++ A+ W      LQK+A +++ +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+   ++ E+K F FDLL  + D E  +  +LY      +   KF  YNA K L NLGY++ F   +  + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     9 RISAINWNKIEDDKDLEVWNRLTANFWLPEKVPLSNDIPSWATLTPNEQQLTIRVFTGLTLLDTIQNTLGAPALIKDAITPHEEAVFSNISFMEAVHARSYSSIFSTLCMTSDVDDAYRWSEENGPLQKKADIILQHYHNDDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLEKVDNNRRQEIKNFAFDLLQDLYDNEVRYTEDLYDKVGWTEDVKKFLHYNANKALMNLGYEALFPSSQAAVSPAILAALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 323
>gi|153949141|ref|YP_001400043.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pseudotuberculosis IP 31758] >gi|152960636|gb|ABS48097.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pseudotuberculosis IP 31758] (323 aa)
Score = 842, Expect = 2.6e-88, Identities = 156/315 (49%), Positives = 213/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L  + Q+L +R FTGLTLLD+IQ T+G  A +K+++T HE+ I++N +FM  VHARSY SIFST C +  ++ A+ W  +   LQK+A +++ +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+    + E+K F FDLL  + D E  +  +LY      +   KF  YNA K L NLGY++ F   +  + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     9 RISAINWNKIEDDKDLEVWNRLTSNFWLPEKVPLSNDIPSWATLTPHEQQLTIRVFTGLTLLDTIQNTLGAPALIKDAITPHEEAIFSNISFMEAVHARSYSSIFSTLCLTSDVDDAYRWSEDNGPLQKKADIILQHYHNDDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLEKVDSVHRQEIKNFAFDLLQDLYDNEVRYTEDLYDHVGWTEDVKKFLHYNANKALMNLGYEALFPASQAAVSPAILAALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 323
>gi|68535550|ref|YP_250255.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium jeikeium K411] >gi|68263149|emb|CAI36637.1| ribonucleoside-diphosphate reductase beta chain [Corynebacterium jeikeium K411] (331 aa)
Score = 842, Expect = 2.7e-88, Identities = 153/312 (49%), Positives = 213/312 (68%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D+KDLEVW+R+T NFWLPEK+ +SND+PSW+ L+   ++  +R FTGLT+LD+IQ T+G V  ++++ T HE+ ++TN +FM  VHA+SY SIF T  S+ +IN A  W    E LQ +A++++ +Y GDDP+K K+A+ ++  FL Y GFYLP Y  +   L NT DIIRLI+RD+ +H YY GYKYQ+ +    PE+Q E+K+  FDLL ++ D E ++  +LY      +   +F  YNA K L NLGY+  F  +ET + P I   L+   DENHDFFSGSGSSY++G  E T DDDWDF
  S:    20 AINWNSIPDEKDLEVWDRLTANFWLPEKVPLSNDVPSWSTLNDMEKQATMRVFTGLTMLDTIQGTVGAVKLIEDAATPHEEAVFTNISFMESVHAKSYSSIFMTLASTPEINDAFRWSEENEKLQNKAKIILDFYEGDDPMKKKIASVLLESFLFYSGFYLPMYWSSHAKLTNTADIIRLIIRDESVHGYYIGYKYQRALENETPERQEELKEHTFDLLLELYDNEAQYTEDLYDELGWTEDVKRFLRYNANKALNNLGYEGLFPADETRVSPAILSALNPGGDENHDFFSGSGSSYVIGKAENTVDDDWDF 331
>gi|16122857|ref|NP_406170.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis CO92] >gi|22125124|ref|NP_668547.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis KIM] >gi|45442235|ref|NP_993774.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis biovar Microtus str. 91001] >gi|51597273|ref|YP_071464.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pseudotuberculosis IP 32953] >gi|108808370|ref|YP_652286.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Antiqua] >gi|108811297|ref|YP_647064.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Nepal516] >gi|145598906|ref|YP_001162982.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Pestoides F] >gi|149365457|ref|ZP_01887492.1| ribonucleoside-diphosphate reductase 2 beta chain [Yersinia pestis CA88-4125] >gi|162420024|ref|YP_001607865.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Angola] >gi|165925252|ref|ZP_02221084.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939901|ref|ZP_02228439.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166008124|ref|ZP_02229022.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212554|ref|ZP_02238589.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398943|ref|ZP_02304467.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421281|ref|ZP_02313034.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423716|ref|ZP_02315469.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468720|ref|ZP_02333424.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis FV-1] >gi|170023362|ref|YP_001719867.1| ribonucleoside-diphosphate reductase [Yersinia pseudotuberculosis YPIII] >gi|186896377|ref|YP_001873489.1| ribonucleotide reductase [Yersinia pseudotuberculosis PB1/+] >gi|21957983|gb|AAM84798.1|AE013726_1 ribonucleoside-diphosphate reductase 2, beta chain, frag [Yersinia pestis KIM] >gi|45437099|gb|AAS62651.1| ribonucleoside-diphosphate reductase 2 beta chain [Yersinia pestis biovar Microtus str. 91001] >gi|51590555|emb|CAH22196.1| ribonucleoside-diphosphate reductase 2 beta chain [Yersinia pseudotuberculosis IP 32953] >gi|108774945|gb|ABG17464.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Yersinia pestis Nepal516] >gi|108780283|gb|ABG14341.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Yersinia pestis Antiqua] >gi|115348336|emb|CAL21269.1| ribonucleoside-diphosphate reductase 2 beta chain [Yersinia pestis CO92] >gi|145210602|gb|ABP40009.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Yersinia pestis Pestoides F] >gi|149291870|gb|EDM41944.1| ribonucleoside-diphosphate reductase 2 beta chain [Yersinia pestis CA88-4125] >gi|162352839|gb|ABX86787.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis Angola] >gi|165912120|gb|EDR30759.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165922859|gb|EDR40010.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992506|gb|EDR44807.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206485|gb|EDR50965.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960770|gb|EDR56791.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051447|gb|EDR62855.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057886|gb|EDR67632.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749896|gb|ACA67414.1| Ribonucleoside-diphosphate reductase [Yersinia pseudotuberculosis YPIII] >gi|186699403|gb|ACC90032.1| ribonucleotide reductase [Yersinia pseudotuberculosis PB1/+] (323 aa)
Score = 842, Expect = 2.8e-88, Identities = 156/315 (49%), Positives = 212/315 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L  + Q+L +R FTGLTLLD+IQ T+G  A +K+++T HE+ I++N +FM  VHARSY SIFST C +  ++ A+ W  +   LQK+A ++  +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + K+    + E+K F FDLL  + D E  +  +LY      +   KF  YNA K L NLGY++ F   +  + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:     9 RISAINWNKIEDDKDLEVWNRLTSNFWLPEKVPLSNDIPSWATLTPHEQQLTIRVFTGLTLLDTIQNTLGAPALIKDAITPHEEAIFSNISFMEAVHARSYSSIFSTLCLTSDVDDAYRWSEDNGPLQKKADIISQHYHNDDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLGKIDSAHRQEIKNFAFDLLQDLYDNEVRYTEDLYDHVGWTEDVKKFLHYNANKALMNLGYEALFPASQAAVSPAILAALSPNADENHDFFSGSGSSYVIGKAVNTEDEDWDF 323
>gi|69938055|ref|ZP_00632606.1| Ribonucleoside-diphosphate reductase [Paracoccus denitrificans PD1222] >gi|119387083|ref|YP_918138.1| ribonucleotide-diphosphate reductase subunit beta [Paracoccus denitrificans PD1222] >gi|119377678|gb|ABL72442.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Paracoccus denitrificans PD1222] (329 aa)
Score = 842, Expect = 2.9e-88, Identities = 154/319 (48%), Positives = 216/319 (67%)
  Q:    21 GLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQ-VLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
            ++  +R++NWN + D+KDLEVWNR+T NFWLPEK+ +SND+ SW  L    +EL +R FTGLTLLD+IQ T+G  A + ++LT HE+ + +N AFM  VHARSY SIFST C + ++++A  W      LQ++A+ VL  Y  G DPLK K+A+  +  F+ Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQ+ + +L   ++A +K F F L++ + D+E ++  ELY G  + +    F  YNA K LQNLGY++ F P+  E+ P I   LS  + ENHDFFSGSGSSY++G    T+D+DWDF
  S:    11 AMRTPVRAINWNRLEDEKDLEVWNRLTVNFWLPEKVPLSNDVQSWATLRPEERELTIRVFTGLTLLDTIQNTVGAPAMMPDALTPHEEAVLSNIAFMEAVHARSYSSIFSTLCLTPEVDAAFRWAEENPHLQQKARLVLEEYKAGSDPLKRKIASVFLESFMFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKYQRGLERLGEAERAALKDFAFSLIFDLYDIEAKYTAELYDGIGLTEDVKSFLHYNANKALQNLGYEALFPPQACEVNPAILAALSPDS-ENHDFFSGSGSSYVIGKAVATEDEDWDF 329
>gi|49475007|ref|YP_033048.1| ribonucleotide-diphosphate reductase subunit beta [Bartonella henselae str. Houston-1] >gi|49237812|emb|CAF27007.1| Ribonucleotide reductase beta-chain [Bartonella henselae str. Houston-1] (324 aa)
Score = 841, Expect = 3.8e-88, Identities = 151/312 (48%), Positives = 215/312 (68%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +VNWN ++D+KDLEVWNR+T NFWLPEK+ +SND+PSW  L    ++L +R FTGLTLLD+IQ T+G ++ + +++T+HE+ + TN AFM  VHARSY SIFST CS+ +++ A  W      LQK+A++++  Y G+DPLK K+A+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q   AKL   K+ E+K F F+LL+ + ++E ++  +LY    + +    F  YNA K L NLG+++ F  E   + P I   LS  +DENHDFFSG+GSSY++G    T DDDW+F
  S:    13 AVNWNRLHDEKDLEVWNRLTGNFWLPEKVPLSNDIPSWASLTEEERKLTIRVFTGLTLLDTIQNTVGAISLMADAITEHEEAVLTNIAFMEAVHARSYSSIFSTLCSTVEVDDAFRWSEENIHLQKKARLVLERYEGNDPLKKKIASTLLESFLFYSGFYLPMYWASRAKLTNTADLIRLIIRDEAVHGYYIGYKFQLGFAKLDETKKKEVKDFAFNLLFDLYNIECKYTEDLYDALGLTEDVKIFLHYNANKALMNLGFEALFPSEVCRVNPAILAALSPNSDENHDFFSGAGSSYVIGKAVATTDDDWEF 324
>gi|49473850|ref|YP_031892.1| ribonucleotide-diphosphate reductase subunit beta [Bartonella quintana str. Toulouse] >gi|49239353|emb|CAF25686.1| Ribonucleotide reductase beta-chain [Bartonella quintana str. Toulouse] (324 aa)
Score = 841, Expect = 3.9e-88, Identities = 152/312 (48%), Positives = 213/312 (68%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +VNWN ++D+KDLEVWNR+T NFWLPEK+ +SND+PSW  L    ++L VR FTGLTLLD+IQ T+G ++ + +++T+HE+ + TN AFM  VHARSY SIFST CS+ +++ A  W      LQK+A++++  Y   DPLK K+A+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q   AKL   K+ E+K F F+LL+ + ++E ++  +LY    + +    F  YNA K L NLG++  F PE   + P I   LS  +DENHDFFSG+GSSY++G    T DDDW+F
  S:    13 AVNWNRLHDEKDLEVWNRLTGNFWLPEKVPLSNDIPSWASLTEEERKLTVRVFTGLTLLDTIQNTVGAISLMADAITEHEEAVLTNIAFMEAVHARSYSSIFSTLCSTVEVDDAFRWSEENIHLQKKARLVLERYEASDPLKKKIASTLLESFLFYSGFYLPMYWASRAKLTNTADLIRLIIRDEAVHGYYIGYKFQLGFAKLNESKKQEIKDFSFNLLFDLYNIECKYTEDLYDALGLTEDVKVFLHYNANKALMNLGFEPLFPPEVCRVNPAILAALSPSSDENHDFFSGAGSSYVIGKAVATTDDDWEF 324
>gi|77973120|ref|ZP_00828672.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia frederiksenii ATCC 33641] (323 aa)
Score = 838, Expect = 8.3e-88, Identities = 154/312 (49%), Positives = 211/312 (67%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+PSW  L  N Q+L +R FTGLTLLD+IQ T+G  A +K+++T HE+ +++N +FM  VHARSY SIFST C +  ++ A+ W      LQK+A +++ +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+QK + ++   ++ E+K F FDLL  + D E  +  +LY      +   KF  YNA K L NLGY++ F   +  + P I   LS  ADENHDFFSGSGSSY++G    T+D+DW+F
  S:    12 AINWNKIEDDKDLEVWNRLTANFWLPEKVPLSNDIPSWATLAPNEQQLTIRVFTGLTLLDTIQNTLGAPALIKDAITPHEEAVFSNISFMEAVHARSYSSIFSTLCMTSDVDDAYRWSEENGPLQKKADIILQHYHNDDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQKGLERVDNNRRQEIKNFAFDLLQDLYDNEVRYTEDLYDDVGWTEDVKKFLHYNANKALMNLGYEALFPASQAAVSPAILAALSPNADENHDFFSGSGSSYVIGKAVSTEDEDWNF 323
>gi|23500072|ref|NP_699512.1| ribonucleotide-diphosphate reductase subunit beta [Brucella suis 1330] >gi|62317763|ref|YP_223616.1| ribonucleotide-diphosphate reductase subunit beta [Brucella abortus bv. 1 str. 9-941] >gi|83269749|ref|YP_419040.1| ribonucleotide-diphosphate reductase subunit beta [Brucella melitensis biovar Abortus 2308] >gi|148558197|ref|YP_001257348.1| ribonucleotide-diphosphate reductase subunit beta [Brucella ovis ATCC 25840] >gi|161620390|ref|YP_001594276.1| ribonucleotide-diphosphate reductase subunit beta [Brucella canis ATCC 23365] >gi|189023015|ref|YP_001932756.1| Ribonucleotide reductase [Brucella abortus S19] >gi|23463663|gb|AAN33517.1| ribonucleoside-diphosphate reductase, beta subunit [Brucella suis 1330] >gi|62197956|gb|AAX76255.1| NrdF, ribonucleoside-diphosphate reductase, beta subunit [Brucella abortus biovar 1 str. 9-941] >gi|82940023|emb|CAJ13054.1| Ribonucleotide reductase [Brucella melitensis biovar Abortus 2308] >gi|148369482|gb|ABQ62354.1| ribonucleoside-diphosphate reductase, beta subunit [Brucella ovis ATCC 25840] >gi|161337201|gb|ABX63505.1| Ribonucleoside-diphosphate reductase [Brucella canis ATCC 23365] >gi|189021589|gb|ACD74310.1| Ribonucleotide reductase [Brucella abortus S19] (329 aa)
Score = 836, Expect = 1.3e-87, Identities = 155/322 (48%), Positives = 212/322 (65%)
  Q:    18 AKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           A  G    +R++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+ SW  L    ++L +R FTGLTLLD+IQ  +G V  + ++LT HE+ + +N +FM  VHARSY SIFST C +  ++ A+ W    E LQ+++ +++  Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +  L  EK+ E+K F F+LL ++ D E  +   LY G  + +   KF  YNA K L NLGY++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DW F
  S:     8 ATKGRPASVRAINWNRIEDDKDLEVWNRLTGNFWLPEKVPLSNDIQSWETLKPQEKQLTIRVFTGLTLLDTIQNAVGAVKLMDDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCLTPDVDDAYRWSEENEFLQRKSTLILDQYHADDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALEVLSEEKRQEIKDFAFELLLELYDNEVRYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWAF 329
>gi|77977846|ref|ZP_00833285.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia intermedia ATCC 29909] (330 aa)
Score = 835, Expect = 1.7e-87, Identities = 154/312 (49%), Positives = 211/312 (67%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I DDKDL+VWNR+T NFWLPEK+ +SND+PSW  L  N Q+L +R FTGLTLLD+IQ T+G  A +K+++T HE+ +++N +FM  VHARSY SIFST C +  ++ A+ W      LQK+A +++ +Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ + K+   ++ E+K F FDLL  + D E  +  +LY      +   KF  YNA K L NLGY++ F   +  + P I   LS  ADENHDFFSGSGSSY++G    T+D+DWDF
  S:    19 AINWNKIEDDKDLDVWNRLTANFWLPEKVPLSNDIPSWATLTPNEQQLTIRVFTGLTLLDTIQNTLGAPALIKDAITPHEEAVFSNISFMEAVHARSYSSIFSTLCMTSDVDDAYRWSEENGPLQKKADIILQHYHNDDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQQGLEKVDNARRQEIKNFAFDLLQDLYDNEVRYTEDLYDKVGWTEDVKKFLHYNANKALMNLGYEALFPASQAAVSPAILAALSPNADENHDFFSGSGSSYVIGKAINTEDEDWDF 330
>gi|163844498|ref|YP_001622153.1| ribonucleotide-diphosphate reductase subunit beta [Brucella suis ATCC 23445] >gi|163675221|gb|ABY39331.1| Hypothetical protein, conserved [Brucella suis ATCC 23445] (329 aa)
Score = 835, Expect = 1.7e-87, Identities = 155/322 (48%), Positives = 212/322 (65%)
  Q:    18 AKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           A  G    +R++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+ SW  L    ++L +R FTGLTLLD+IQ  +G V  + ++LT HE+ + +N +FM  VHARSY SIFST C +  ++ A+ W    E LQ+++ +++  Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +  L  EK+ E+K F F+LL ++ D E  +   LY G  + +   KF  YNA K L NLGY++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DW F
  S:     8 ATKGGPASVRAINWNRIEDDKDLEVWNRLTGNFWLPEKVPLSNDIQSWETLKPQEKQLTIRVFTGLTLLDTIQNAVGAVKLMDDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCLTPDVDDAYRWSEENEFLQRKSTLILDQYHADDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALEVLSEEKRQEIKDFAFELLLELYDNEVRYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWAF 329
>gi|114766102|ref|ZP_01445111.1| ribonucleoside-diphosphate reductase, beta subunit protein [Roseovarius sp. HTCC2601] >gi|114541657|gb|EAU44698.1| ribonucleoside-diphosphate reductase, beta subunit protein [Roseovarius sp. HTCC2601] (326 aa)
Score = 835, Expect = 2.0e-87, Identities = 153/313 (48%), Positives = 212/313 (67%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGD-DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           R++NWN + D+KDLEVWNR+T NFWLPEK+ +SND+ SW  L    ++L +R FTGLTLLD+IQ ++G  A + + LT HE+ + TN AFM  VHARSY SIFST CS+ +++ A  W      LQ +A+ ++  Y  + DPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +    PE++ E+K + F LL+++ D+E  +  ELY G  + ++   F  YNA K LQNLG+++ F PE  E+ P I   LS  + ENHDFFSGSGSSY++G    T+DDDWDF
  S:    14 RAINWNRLQDEKDLEVWNRLTVNFWLPEKVPLSNDVQSWATLTEEERQLTIRVFTGLTLLDTIQNSVGAPAMMPDCLTPHEESVLTNIAFMEAVHARSYSSIFSTLCSTREVDEAFRWSDENPHLQAKARAVLETYAPEADPLKRKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRGLELESPERRQELKDYAFGLLFELYDIEARYTEELYDGIGLTEEVKAFLHYNANKALQNLGFEALFPPEAAEVNPAILAALSPDS-ENHDFFSGSGSSYVIGRAVATEDDDWDF 326
>gi|17989274|ref|NP_541907.1| ribonucleotide-diphosphate reductase subunit beta [Brucella melitensis 16M] >gi|17985137|gb|AAL54171.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN [Brucella melitensis 16M] (335 aa)
Score = 835, Expect = 2.1e-87, Identities = 155/322 (48%), Positives = 211/322 (65%)
  Q:    18 AKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           A  G    +R++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+ SW  L    ++L  R FTGLTLLD+IQ  +G V  + ++LT HE+ + +N +FM  VHARSY SIFST C +  ++ A+ W    E LQ+++ +++  Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +  L  EK+ E+K F F+LL ++ D E  +   LY G  + +   KF  YNA K L NLGY++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DW F
  S:    14 ATKGRPASVRAINWNRIEDDKDLEVWNRLTGNFWLPEKVPLSNDIQSWETLKPQEKQLTTRVFTGLTLLDTIQNAVGAVKLMDDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCLTPDVDDAYRWSEENEFLQRKSTLILDQYHADDPLKKKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALEVLSEEKRQEIKDFAFELLLELYDNEVRYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWAF 335
>gi|82778048|ref|YP_404397.1| ribonucleotide-diphosphate reductase subunit beta [Shigella dysenteriae Sd197] >gi|81242196|gb|ABB62906.1| ribonucleoside-diphosphate reductase 2, beta chain [Shigella dysenteriae Sd197] (322 aa)
Score = 834, Expect = 2.5e-87, Identities = 154/312 (49%), Positives = 213/312 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDD 336
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + + ++LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GD+PLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGS SSY+MG   ET+D++
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEVVHARSYSSIFSTLCQTKDVDAAYAWSEENALLQRKAQIIQQHYRGDNPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKSLEKISEAQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKTFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGSSSSYVMGKAVETEDEE 316
>gi|121602770|ref|YP_988676.1| ribonucleotide-diphosphate reductase subunit beta [Bartonella bacilliformis KC583] >gi|120614947|gb|ABM45548.1| ribonucleoside-diphosphate reductase, beta subunit [Bartonella bacilliformis KC583] (324 aa)
Score = 828, Expect = 1.2e-86, Identities = 151/314 (48%), Positives = 214/314 (68%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +R+VNWN ++D+KDLEVWNR+T NFWLPEK+ +SND+PSW  L    ++L +R FTGLTLLD++Q T+G V+ + +++T+HE+ + TN AFM  VHARSY SIFST C +  ++ A  W      LQK+A++++ +Y  +DPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ IH YY GYK+Q   AKL   ++ EMK F F++L+ + ++E ++  +LY    + +    F  YNA K L NLG++S F  E   + P I   LS  +DENHDFFSGSGSSY++G    T D+DW+F
  S:    11 VRAVNWNRLHDEKDLEVWNRLTGNFWLPEKVPLSNDIPSWESLTEEEKKLTIRVFTGLTLLDTVQNTVGAVSLMADAVTEHEEAVLTNIAFMEAVHARSYSSIFSTLCLTVDVDDAFRWSEENVYLQKKAKLVLEHYEANDPLKKKIASTFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAIHGYYIGYKFQLGFAKLNEAQKQEMKDFTFNMLFDLYNIECKYTEDLYDSLGLTEDVKVFLHYNANKALMNLGFESLFPSEVCRVNPAILAALSPNSDENHDFFSGSGSSYVIGKAVATTDEDWEF 324
>gi|37525251|ref|NP_928595.1| ribonucleotide-diphosphate reductase subunit beta [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36784678|emb|CAE13578.1| ribonucleoside-diphosphate reductase 2 beta chain (ribonucleotide reductase 2) (R2f protein) [Photorhabdus luminescens subsp. laumondii TTO1] (319 aa)
Score = 824, Expect = 3.2e-86, Identities = 155/312 (49%), Positives = 213/312 (68%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I DDKDLEVWNR+T NFWLPEKI +SND+ SWN L +  ++L +R FTGLTLLD+IQ T+G  A ++++LT HE+ + +N +FM  VHARSY SIFST C +  ++ A+ W     SLQ +A++++ YY    PLK K+A+  +  FL Y GFYLP Y  ++ +L NT D+IRLI+RD+ IH YY GYK+Q+ + K    +Q E+K+F F LL ++ + E ++  ELY      +   KF  YNA K L NLGY++ F PE T + P I   LS  A+ENHDFFSGSGSSY++G    T+D+DW+F
  S:     8 AINWNRIEDDKDLEVWNRLTTNFWLPEKIPLSNDITSWNTLTTEEKKLTIRVFTGLTLLDTIQNTVGAPALMEDALTPHEEAVMSNISFMEAVHARSYSSIFSTLCLTTDVDDAYRWSEKSFSLQNKAKIILNYYSYHHPLKKKIASVFLESFLFYSGFYLPMYWSSRGILTNTADLIRLIIRDEAIHGYYIGYKFQQSLKKHSTLEQKEIKEFTFSLLLELYENEIKYTEELYDIVGWTEDIKKFLHYNANKALMNLGYETLFPPEITNVSPTILSALSPNANENHDFFSGSGSSYVIGKAVNTEDEDWNF 319
>gi|92112513|ref|YP_572441.1| ribonucleotide-diphosphate reductase subunit beta [Chromohalobacter salexigens DSM 3043] >gi|91795603|gb|ABE57742.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Chromohalobacter salexigens DSM 3043] (326 aa)
Score = 822, Expect = 6.1e-86, Identities = 152/315 (48%), Positives = 211/315 (66%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETE-IKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D+KDLEVWNR+T NFWLPEK+ +SND+ +WN L    Q L +R FTGLTLLD+IQ TIG    +++++T HE+ ++TN +FM  VHARSY SIFST C++  ++ A+ W      LQ +A++++  Y  DDPL  KVA+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +A+   E+Q E+K   FDLL ++ D E  +   LY    + ++   F  YNA K L NLGY+ P  P  TE + P I   LS  A+ENHDFFSGSGSSY++G  E T+D+DW F
  S:    12 RVDAINWNRLQDEKDLEVWNRLTANFWLPEKVPLSNDVSAWNTLTEQEQTLTIRVFTGLTLLDTIQGTIGAPTLIEDAVTPHEEAVFTNISFMESVHARSYSSIFSTLCATRDVDDAYRWSEENPHLQNKAELILNRYRMDDPLMRKVASVFLESFLFYSGFYLPMYWASRGKLTNTADLIRLIIRDEAVHGYYIGYKFQQALARESAERQQEIKDATFDLLLELYDNEVHYTESLYDDVGLTEEVKAFLHYNANKALMNLGYE-PLFPGATEAVNPAILAALSPGAEENHDFFSGSGSSYVIGRSERTEDEDWAF 326
>gi|15841457|ref|NP_336494.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis CDC1551] >gi|57116932|ref|YP_177853.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis H37Rv] >gi|148661790|ref|YP_001283313.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis H37Ra] >gi|148823195|ref|YP_001287949.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis F11] >gi|167970496|ref|ZP_02552773.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium tuberculosis H37Ra] >gi|194544203|ref|YP_002079232.1| ribonucleoside-diphosphate reductase (beta chain) nrdF1 [Mycobacterium tuberculosis C] >gi|1710397|sp|Q10840|RIR2_MYCTU Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|13881697|gb|AAK46308.1| ribonucleoside-diphosphate reductase R2-1, beta subunit [Mycobacterium tuberculosis CDC1551] >gi|38490297|emb|CAE55444.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE (BETA CHAIN) NRDF1 (RIBONUCLEOTIDE REDUCTASE SMALL SUBUNIT) (R2F PROTEIN) [Mycobacterium tuberculosis H37Rv] >gi|124601210|gb|EAY60220.1| ribonucleoside-diphosphate reductase (beta chain) nrdF1 [Mycobacterium tuberculosis C] >gi|134150312|gb|EBA42357.1| ribonucleoside-diphosphate reductase (beta chain) nrdF1 [Mycobacterium tuberculosis str. Haarlem] >gi|148505942|gb|ABQ73751.1| ribonucleoside-diphosphate reductase subunit beta NrdF1 [Mycobacterium tuberculosis H37Ra] >gi|148721722|gb|ABR06347.1| ribonucleoside-diphosphate reductase beta subunit nrdF1 [Mycobacterium tuberculosis F11] (322 aa)
Score = 817, Expect = 2.2e-85, Identities = 150/315 (47%), Positives = 208/315 (66%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D KDL+VW R+T NFWLPEKI +SNDL SW  L S  Q+  +R FTGLTLLD+ QAT+G VA + +++T HE+ + TN AFM  VHA+SY SIFST CS+ QI+ A DW      LQ++AQ+++ YY GDD LK K ++ M+  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK Q+ +A L   ++A+ +++  +LL+ +   E ++ ++LY      D  + +  YNA K L NLGY   F  +  ++ P +   L   A ENHDFFSGSGSSY+MG  + T D DWDF
  S:     8 RVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVAMIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVMLESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYAHDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDWDF 322
>gi|31793160|ref|NP_855653.1| ribonucleotide-diphosphate reductase subunit beta [Mycobacterium bovis AF2122/97] >gi|31618751|emb|CAD94705.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE (BETA CHAIN) NRDF1 (RIBONUCLEOTIDE REDUCTASE SMALL SUBUNIT) (R2F PROTEIN) [Mycobacterium bovis AF2122/97] (322 aa)
Score = 817, Expect = 2.2e-85, Identities = 150/315 (47%), Positives = 208/315 (66%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D KDL+VW R+T NFWLPEKI +SNDL SW  L S  Q+  +R FTGLTLLD+ QAT+G VA + +++T HE+ + TN AFM  VHA+SY SIFST CS+ QI+ A DW      LQ++AQ+++ YY GDD LK K ++ M+  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK Q+ +A L   ++A+ +++  +LL+ +   E ++ ++LY      D  + +  YNA K L NLGY   F  +  ++ P +   L   A ENHDFFSGSGSSY+MG  + T D DWDF
  S:     8 RVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVAMIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVMLESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYAHDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDWDF 322
>gi|153010278|ref|YP_001371492.1| ribonucleotide-diphosphate reductase subunit beta [Ochrobactrum anthropi ATCC 49188] >gi|151562166|gb|ABS15663.1| Ribonucleoside-diphosphate reductase [Ochrobactrum anthropi ATCC 49188] (328 aa)
Score = 815, Expect = 3.6e-85, Identities = 149/314 (47%), Positives = 209/314 (66%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +R++NWN I D+KDLEVWNR+T NFWLPEK+ +SND+ SW  L    ++L +R FTGLTLLD+IQ  +G V  + ++ T HE+ + +N +FM  VHARSY SIFST C +  ++ A+ W    E LQ+++ +++  Y  DDPLK K+A+  +  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ + +L  E++  +K F F+LL ++ D E  +   LY G  + +   KF  YNA K L NLGY++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+D+DW F
  S:    15 VRAINWNRIEDEKDLEVWNRLTGNFWLPEKVPLSNDIQSWETLKPQEKQLTIRVFTGLTLLDTIQNAVGAVKLMDDAATPHEEAVLSNISFMEAVHARSYSSIFSTLCLTPDVDDAYRWSEENEFLQRKSVLILDQYRADDPLKRKIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRGLERLNEEQKQAIKDFAFELLLELYDNEVRYTEALYDGVGLTEDVKKFLHYNANKALMNLGYEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWSF 328
>gi|99080359|ref|YP_612513.1| ribonucleotide-diphosphate reductase subunit beta [Silicibacter sp. TM1040] >gi|99036639|gb|ABF63251.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Silicibacter sp. TM1040] (338 aa)
Score = 815, Expect = 4.2e-85, Identities = 146/325 (44%), Positives = 215/325 (66%)
  Q:    15 IEYAKDGLKGKM--RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGD-DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           IE  KD  + +   +++NWN + DDKDLE+WNR+T NFWLPEK+ +SND+ SW++L  + Q L +R FTGLTLLD+IQ  +G    +++++T HE+ + +N +FM  VHARSY S+FST C + +++ A  W    E LQ ++++++  Y     PL+ K+A+  +  FL Y GFYLP +  ++  L NT D+IRLI+RD+ IH YY GYK+Q+ + +    ++ E+K F F LL+ + D+E  +  +LY G  + +    F  YNA K LQNLG+++ F  E   + P I   LS  +DENHDFFSGSGSSY++G    T+DDDWDF
  S:    11 IECMKDMTQARAVPKAINWNRLQDDKDLEIWNRLTVNFWLPEKVPLSNDIQSWSQLTPDEQTLTIRVFTGLTLLDTIQNAVGAPTLMQDAITPHEEAVLSNISFMEAVHARSYSSVFSTLCQTTEVDEAFRWSAENEHLQAKSRLILGEYDATASPLRKKIASVFLESFLFYSGFYLPMHWSSRARLTNTADLIRLIIRDEAIHGYYIGYKFQRGLERASEAERKELKDFAFGLLFDLYDIEARYTEQLYDGLGLTEDVKNFLHYNANKALQNLGFEALFPEETCRVNPAIMAALSPGSDENHDFFSGSGSSYVIGKAVATEDDDWDF 338
>gi|67008229|emb|CAH18519.1| ribonucleoside-dihosphate reductase beta chain [Rhodobacteraceae bacterium 198] (325 aa)
Score = 811, Expect = 1.2e-84, Identities = 144/313 (46%), Positives = 211/313 (67%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGD-DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN + DDKDLE+WNR+T NFWLPEK+ +SND+ SW++L  + Q L +R FTGLTLLD+IQ  +G    +++++T HE+ + +N AFM  VHARSY S+FST C + +++ A  W    E LQ ++++++  Y     PL+ KVA+  +  FL Y GFYLP +  ++  L NT D+IRLI+RD+ IH YY GYK+Q+ + ++   ++ E+K F F LL+ + D+E  +  +LY G  + +    F  YNA K LQNLG+++ F  E   + P I   LS  +DENHDFFSGSGSSY++G  E T+D+DWDF
  S:    12 KAINWNRLQDDKDLEIWNRLTVNFWLPEKVPLSNDIQSWSQLTPDEQTLTIRVFTGLTLLDTIQNAVGAPTLMQDAITPHEESVLSNIAFMEAVHARSYSSVFSTLCQTTEVDEAFRWSAENEHLQAKSRLILDEYNSTASPLRKKVASVFLESFLFYSGFYLPMHWSSRARLTNTADLIRLIIRDEAIHGYYIGYKFQRGLERVSEAERKEIKDFAFALLFDLYDIEARYTEQLYDGLGLTEDVKNFLHYNANKALQNLGFEALFPDESCRVNPAIMAALSPGSDENHDFFSGSGSSYVIGKAEATEDEDWDF 325
>gi|86148040|ref|ZP_01066342.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio sp. MED222] >gi|85834173|gb|EAQ52329.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio sp. MED222] (320 aa)
Score = 806, Expect = 4.4e-84, Identities = 150/316 (47%), Positives = 210/316 (66%)
  Q:    24 GKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGD-DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           G ++++NWN + D KDLE+WNR+T NFWLPEK+ +SND+ +W +L    Q L +R FTGLTLLD+IQ T+G  A ++++ T HE+ + TN AFM  VHARSY S+FST C++ QI+ A  W      LQK+AQ+++  Y+ + DPLK KVA+  +  FL Y GFYLP +  ++  L NT D+IRLI+RD+ IH YY GYK+Q     L  E+QA +K   + L++ + ++E ++   LY    + +    F  YNA K L NLG+++ F  E  ++ P I   LS  ADENHDFFSGSGSSY++G    T+DDDWDF
  S:     4 GPVQAINWNRMIDGKDLEIWNRLTVNFWLPEKVPLSNDIQTWKQLTEEEQTLTIRVFTGLTLLDTIQNTVGAPALMEDARTPHEEAVLTNIAFMEAVHARSYSSVFSTLCTTPQIDEAFRWAEENPLLQKKAQIILDDYLAEGDPLKKKVASVFLESFLFYSGFYLPMHWSSRAKLTNTADLIRLIIRDEAIHGYYIGYKFQLAYQSLSEEEQARVKDEAYSLMFSLYEIETQYTESLYDPVGLTEDVKHFLHYNANKALMNLGFEALFPDELCQVNPAIMAALSPNADENHDFFSGSGSSYVIGKAVATEDDDWDF 320
>gi|62425856|ref|ZP_00380987.1| COG0208: Ribonucleotide reductase, beta subunit [Brevibacterium linens BL2] (318 aa)
Score = 801, Expect = 1.4e-83, Identities = 152/312 (48%), Positives = 211/312 (67%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN + D  D +VW+R+T NFWLPEK+ +SND+PSW  L    + L +R FTGLTLLD+IQ T+G ++ + +++T HE+ + TN AFM  VHA+SY SIFST CS+ +I+ A  W      LQ +A +++ YY GDDPLK KVA+ ++  FL Y GFYLP Y  A   L NT D+IRLI+RD+ +H YY GYKYQK +     E++ E+K +  +L++++ + E  + ++LY    +A+    F  YNA K L NLGY++ F  E TE+ P I   LS  +DENHDFFSGSGSSY++G  E T+DDDWDF
  S:     7 AINWNRVVDPVDDDVWDRLTGNFWLPEKVPLSNDIPSWATLTEEEKTLTMRVFTGLTLLDTIQGTVGAISLIPDAVTPHEEAVMTNIAFMESVHAKSYSSIFSTLCSTKEIDEAFRWSRENTYLQSKADIILSYYRGDDPLKRKVASTLLESFLFYSGFYLPMYWSAHAKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLESQSEERKQELKDYTMNLMFELYENEVAYTHDLYDSVGLAEDCKMFLHYNANKALMNLGYEAMFPKEVTEVNPAILAALSPNSDENHDFFSGSGSSYVIGKAENTEDDDWDF 318
>gi|1395207|gb|AAB81405.1| ribonucleotide reductase R2-1 small subunit [Mycobacterium tuberculosis] (321 aa)
Score = 794, Expect = 1.1e-82, Identities = 147/315 (46%), Positives = 208/315 (66%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++ ++NWN + D KDL+VW R+T NFWLPEKI +SNDL SW  L S  Q+  +R FTGLTLLD+ QAT+G VA + +++T HE+ + TN AFM  VHA+SY SIFST CS+ QI+ A DW      LQ++AQ+++ YY GDD  +++ ++ M+  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK Q+ +A L   ++A+ +++  +LL+ +   E ++ ++LY      D  + +  YNA K L NLGY   F  +  ++ P +   L   A ENHDFFSGSGSSY+MG  + T D DWDF
  S:     8 RVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVAMIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDA-QAQRSSVMLESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYAHDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDWDF 321
>gi|82545243|ref|YP_409190.1| ribonucleotide-diphosphate reductase subunit beta [Shigella boydii Sb227] >gi|81246654|gb|ABB67362.1| ribonucleoside-diphosphate reductase 2, beta chain, frag [Shigella boydii Sb227] (304 aa)
Score = 790, Expect = 2.9e-82, Identities = 147/296 (49%), Positives = 200/296 (67%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGS 320
           ++ ++NWN I+DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L    Q+L +R FTGLTLLD++Q  IG  + +  +LT HE+ + +N +FM  VHARSY SIFST C +  +++A+ W      LQ++AQ++  +Y GDDPLK K+A+  +  FL Y GF+LP Y  ++  L NT D+IRLI+RD+ +H YY GYKYQK + K+   ++ E+K F FDLL ++ D E ++ +ELYA    AD    F  YNA K L NLGY+  F  E  E+ P I   LS  ADENHDFFSGS
  S:     5 RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVFTGLTLLDTLQNVIGAPSLMPYALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYSDELYAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGS 300
>gi|25027435|ref|NP_737489.1| ribonucleotide-diphosphate reductase subunit beta [Corynebacterium efficiens YS-314] >gi|23492716|dbj|BAC17689.1| putative ribonucleotide reductase [Corynebacterium efficiens YS-314] (339 aa)
Score = 774, Expect = 2.0e-80, Identities = 150/339 (44%), Positives = 212/339 (62%)
  Q:     1 MDNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD-PLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           M  ++   N+ ++P EYA  G    +  +NW+ I D  D+++WNR+T NFWLPEKI +SND+  WN +        +R FTGLTLLD+IQ T+G V+ + ++ T HE+ + TN +FM  VHA+SY +IF T  S+ +IN A  W  + E LQ +A+ ++ YY  D  P + K+A+ M+   L Y GFYLP  + +   L NT D+IRLI+RD+ IH YY GYKYQK +A L PEKQA       +LL  + D E E+   +Y     ++    F  YNA K +QNLGY+S F  ++ +  P +   L   ++ENHDFFSGSGSSY++G+VE T D+DWDF
  S:     1 MKEEETMTNQLLTPAEYAA-GDVFPIEGINWDHIPDQVDMDIWNRLTTNFWLPEKIPVSNDIQKWNSMSEAEHLATLRVFTGLTLLDTIQGTVGAVSMIPDATTHHEEAVLTNISFMESVHAKSYSNIFMTLASTPEINEAFRWSRHNEHLQYKAKRILDYYQQDSTPARKKIASVMLESLLFYSGFYLPLRMASIGKLTNTADVIRLIIRDEAIHGYYIGYKYQKHIATLSPEKQATNHDEAVELLLDLYDNELEYTRHVYDDLGWSEDVSAFLRYNANKAMQNLGYESIFPVDQCKFDPGVMTSLDPSSNENHDFFSGSGSSYVIGDVEATSDEDWDF 339
>gi|51247866|pdb|1UZR|A Chain A, Crystal Structure Of The Class Ib Ribonucleotide Reductase R2f-2 Subunit From Mycobacterium Tuberculosis >gi|51247867|pdb|1UZR|B Chain B, Crystal Structure Of The Class Ib Ribonucleotide Reductase R2f-2 Subunit From Mycobacterium Tuberculosis >gi|51247868|pdb|1UZR|C Chain C, Crystal Structure Of The Class Ib Ribonucleotide Reductase R2f-2 Subunit From Mycobacterium Tuberculosis (296 aa)
Score = 733, Expect = 1.3e-75, Identities = 131/287 (45%), Positives = 197/287 (68%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD 311
           ++ ++NWN + D+KD EVW+R+T NFWLPEK+ +SND+PSW  L +  ++L +R FTGLT+LD+IQ T+G V+ + ++LT HE+ + TN AFM  VHA+SY  IFST CS+ +I+ A  W     +LQ++A++++  Y GD+PLK KVA+ ++  FL Y GFYLP Y  ++  L NT D+IRLI+RD+ +H YY GYK+Q+ +A +    +AE+K + ++LL+++ D E E+  +LY    + +   KF  YNA K L NLGY++ F  +ET++ P I   LS  AD
  S:    10 RVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGAVSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQSYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVEYTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNAD 296
>gi|32491358|ref|NP_871612.1| ribonucleotide-diphosphate reductase subunit beta [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166565|dbj|BAC24755.1| nrdF [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (324 aa)
Score = 725, Expect = 1.0e-74, Identities = 141/312 (45%), Positives = 201/312 (64%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D+KDLEVWN +T NFWLPEKI +SND+ SW  L    ++L +R FTGLTLLD++Q  IG  + + ++ T HE+ + +N  FM  VHARSY SIFST CS+ +++SA+ W    + LQ +  ++   Y+  + LK K+A+  +  FL Y GFYLP +  ++  L NT D+IRLI+RD+ +H YY GYK+QK +  L  +++  +K F F+LLY++ + E  +   LY         I F  YNA K L NLGY+  F  +E+ + P+I   L+  ++ENHDFFSGSGSSY+MG    T D+DW F
  S:    13 AINWNRIEDEKDLEVWNHVTTNFWLPEKIPLSNDIQSWKMLSKEEKKLTIRIFTGLTLLDTLQNIIGAPSIMMDAKTMHEKAVISNIGFMEAVHARSYSSIFSTLCSTTEVDSAYFWSEKNKFLQNKVNIISKIYLEKNSLKKKIASVFLESFLFYSGFYLPMFYSSRGKLTNTSDLIRLIIRDEAVHGYYIGYKFQKDLISLNEKEKKNIKDFAFNLLYKLYENEINYSYSLYKDIIPIKNIISFLNYNANKSLMNLGYEQYFPDDESLVNPDILSALTPNSNENHDFFSGSGSSYVMGKTVLTKDEDWTF 324
>gi|28377561|ref|NP_784453.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus plantarum WCFS1] >gi|28270393|emb|CAD63296.1| ribonucleoside-diphosphate reductase, beta chain [Lactobacillus plantarum WCFS1] (336 aa)
Score = 605, Expect = 9.5e-61, Identities = 129/322 (40%), Positives = 187/322 (58%)
  Q:    17 YAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           Y K    G  +++NW+ ++D  D   W ++T+ FWL  +I +SND+  W +LD + + +V   F GLTLLD++Q+  G  A  +N LT HE  +  N  FM  VHA+SY +IF T  + D+IN   DW  + E LQ +AQ +   Y  I +DPLK KVA   +  FL Y GFY P Y    N LPN  +II+LILRD+ +H  Y GYK+Q        ++QAE K ++FD LY++ + E+ +++ +Y     +D+ + FS YNA K L NLG D+ F     ++ P +   +S     NHDFFS  G+ Y +G VE   D D+D
  S:     8 YQKLLSNGNYKAINWDRVSDAIDKSTWEKLTEQFWLDTRIPVSNDMADWRELDDDHRWVVGHVFGGLTLLDTLQSQDGLQALRRNVLTSHETAVLNNIQFMESVHAKSYSTIFETLNTPDEINEIFDWSDSEEFLQAKAQWIYKLYDNIDEDPLKQKVANVFLETFLFYSGFYTPLYYLGHNQLPNVAEIIKLILRDESVHGTYIGYKFQLGFKDRSEKQQAEFKDWMFDFLYKLYENEENYIHLVYDQIGWSDEVLTFSRYNANKALMNLGQDALFPDTAEDVNPVVMNGIST-GTSNHDFFSQVGNGYRLGQVEAMQDTDYD 330
>gi|15901045|ref|NP_345649.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae TIGR4] >gi|111657123|ref|ZP_01407908.1| hypothetical protein SpneT_02001649 [Streptococcus pneumoniae TIGR4] >gi|14972661|gb|AAK75289.1| ribonucleoside-diphosphate reductase 2, beta subunit [Streptococcus pneumoniae TIGR4] (320 aa)
Score = 597, Expect = 7.2e-60, Identities = 120/313 (38%), Positives = 183/313 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ ++ N  FM  VHA+SY SIFST  +  +I    +W      LQK+A+++   Y+   PL+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP E+Q ++K++++DLLY + + E+ +   LY G    ++   F  YNA K L N+G D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD+++
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSNKEKDLVGKVFGGLTLLDTMQSETGVQALRADIRTPHEEAVFNNIQFMESVHAKSYSSIFSTLNTKAEIEEIFEWTNTNPYLQKKAEIVNEIYLNGSPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTESLYDGVGWTEEVKTFLRYNANKALMNMGQDPLFPDSAEDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGEVEAMQDDDYNY 317
>gi|149004132|ref|ZP_01828935.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP14-BS69] >gi|147757865|gb|EDK64875.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP14-BS69] (320 aa)
Score = 596, Expect = 8.3e-60, Identities = 120/313 (38%), Positives = 183/313 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ ++ N  FM  VHA+SY SIFST  +  +I    +W      LQK+A+++   Y+   PL+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP E+Q ++K++++DLLY + + E+ +   LY G    ++   F  YNA K L N+G D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD+++
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSNKEKDLVGKVFGGLTLLDTMQSETGVQALRADIRTPHEEAVFNNIQFMESVHAKSYSSIFSTLNTKTEIEEIFEWTNTNPYLQKKAEIVNEIYLNGSPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTESLYDGVGWTEEVKTFLRYNANKALMNMGQDPLFPDSAEDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGEVEAMQDDDYNY 317
>gi|56808544|ref|ZP_00366279.1| COG0208: Ribonucleotide reductase, beta subunit [Streptococcus pyogenes M49 591] (319 aa)
Score = 596, Expect = 8.7e-60, Identities = 123/312 (39%), Positives = 182/312 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL    ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  N E LQK+AQ++   Y   D L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q   + +++DLLYQ+ + E+++   LY G    ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+++
  S:     7 AINWNEIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSLQEKDLVGKVFGGLTLLDTMQSETGVEAIRADVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFEWTNNNEFLQKKAQIINEIYEHGDALQKKVASTYLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEDEQENFRDWMYDLLYQLYENEEKYTKTLYDGVGWTEEVMTFLRYNANKALMNLGQDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGSVEAMSDDDYNY 317
>gi|148994532|ref|ZP_01823712.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|147927202|gb|EDK78238.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae SP9-BS68] (319 aa)
Score = 596, Expect = 1.0e-59, Identities = 120/312 (38%), Positives = 182/312 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ ++ N  FM  VHA+SY SIFST  +  +I    +W      LQK+A+++   Y+   PL+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP E+Q ++K++++DLLY + + E+ +   LY G    ++   F  YNA K L N+G D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD++
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSNKEKDLVGKVFGGLTLLDTMQSETGVQALRADIRTPHEEAVFNNIQFMESVHAKSYSSIFSTLNTKAEIEEIFEWTNTNPYLQKKAEIVNEIYLNGSPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTESLYDGVGWTEEVKTFLRYNANKALMNMGQDPLFPDSAEDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGEVEAMQDDDYN 316
>gi|15903110|ref|NP_358660.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae R6] >gi|116517162|ref|YP_816517.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae D39] >gi|148985789|ref|ZP_01818917.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP3-BS71] >gi|148990437|ref|ZP_01821595.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP6-BS73] >gi|148999044|ref|ZP_01826476.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP11-BS70] >gi|149008157|ref|ZP_01831676.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|149026429|ref|ZP_01836566.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP23-BS72] >gi|168483243|ref|ZP_02708195.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|168486506|ref|ZP_02711014.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|168491101|ref|ZP_02715244.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|168493105|ref|ZP_02717248.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC3059-06] >gi|168577270|ref|ZP_02723064.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae MLV-016] >gi|169833110|ref|YP_001694622.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182684087|ref|YP_001835834.1| ribonucleotide-diphosphate reductase beta subunit [Streptococcus pneumoniae CGSP14] >gi|194397329|ref|YP_002037788.1| ribonucleoside-diphosphate reductase beta subunit [Streptococcus pneumoniae G54] >gi|15458689|gb|AAK99870.1| Nonessential ribonucleoside-diP reductase 2, subunit beta, class I, function unknown [Streptococcus pneumoniae R6] >gi|116077738|gb|ABJ55458.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae D39] >gi|147755114|gb|EDK62169.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP11-BS70] >gi|147760396|gb|EDK67375.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|147922093|gb|EDK73216.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP3-BS71] >gi|147924289|gb|EDK75383.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP6-BS73] >gi|147929260|gb|EDK80261.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae SP23-BS72] >gi|168995612|gb|ACA36224.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|172043347|gb|EDT51393.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|182629421|gb|ACB90369.1| ribonucleotide-diphosphate reductase beta subunit [Streptococcus pneumoniae CGSP14] >gi|183570430|gb|EDT90958.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|183574343|gb|EDT94871.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|183576617|gb|EDT97145.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae CDC3059-06] >gi|183577169|gb|EDT97697.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus pneumoniae MLV-016] >gi|194356996|gb|ACF55444.1| ribonucleoside-diphosphate reductase beta subunit [Streptococcus pneumoniae G54] (320 aa)
Score = 596, Expect = 1.0e-59, Identities = 120/313 (38%), Positives = 183/313 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ ++ N  FM  VHA+SY SIFST  +  +I    +W      LQK+A+++   Y+   PL+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP E+Q ++K++++DLLY + + E+ +   LY G    ++   F  YNA K L N+G D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD+++
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSNKEKDLVGKVFGGLTLLDTMQSETGVQALRADIRTPHEEAVFNNIQFMESVHAKSYSSIFSTLNTKAEIEEIFEWTNTNPYLQKKAEIVNEIYLNGSPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTESLYDGVGWTEEVKTFLRYNANKALMNMGQDPLFPDSAEDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGEVEAMQDDDYNY 317
>gi|149013339|ref|ZP_01834070.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae SP19-BS75] >gi|147762929|gb|EDK69876.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pneumoniae SP19-BS75] (320 aa)
Score = 596, Expect = 1.0e-59, Identities = 120/313 (38%), Positives = 183/313 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ ++ N  FM  VHA+SY SIFST  +  +I    +W      LQK+A+++   Y+   PL+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP E+Q ++K++++DLLY + + E+ +   LY G    ++   F  YNA K L N+G D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD+++
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSNKEKDLVGKVFGGLTLLDTMQSETGVQALRADIRTPHEEAVFNNIQFMESVHAKSYSSIFSTLNTKTEIEEIFEWTNTNPYLQKKAEIVNEIYLNGSPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTESLYDGVGWTEEVKTFLRYNANKALMNMGQDPLFPDSADDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGEVEAMQDDDYNY 317
>gi|15675308|ref|NP_269482.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes M1 GAS] >gi|21910586|ref|NP_664854.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS315] >gi|28895723|ref|NP_802073.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes SSI-1] >gi|71910937|ref|YP_282487.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS5005] >gi|94988801|ref|YP_596902.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS9429] >gi|94992686|ref|YP_600785.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS2096] >gi|13622486|gb|AAK34203.1| ribonucleotide diphosphate reductase small subunit [Streptococcus pyogenes M1 GAS] >gi|21904787|gb|AAM79657.1| putative ribonucleoside-diphosphate reductase 2 beta subunit [Streptococcus pyogenes MGAS315] >gi|28810972|dbj|BAC63906.1| putative ribonucleotide diphosphate reductase, small subunit [Streptococcus pyogenes SSI-1] >gi|71853719|gb|AAZ51742.1| ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS5005] >gi|94542309|gb|ABF32358.1| ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS9429] >gi|94546194|gb|ABF36241.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS2096] (319 aa)
Score = 591, Expect = 3.5e-59, Identities = 121/312 (38%), Positives = 182/312 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL    ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  N E LQ++A+++   Y   D L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q   + +++DLLYQ+ + E+++   LY G    ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+++
  S:     7 AINWNEIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSLQEKDLVGKVFGGLTLLDTMQSETGVEAIRADVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFEWTNNNEFLQEKARIINDIYANGDALQKKVASTYLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEDEQENFRDWMYDLLYQLYENEEKYTKTLYDGVGWTEEVMTFLRYNANKALMNLGQDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGSVEAMSDDDYNY 317
>gi|94990703|ref|YP_598803.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS10270] >gi|94544211|gb|ABF34259.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS10270] (320 aa)
Score = 591, Expect = 3.7e-59, Identities = 121/312 (38%), Positives = 182/312 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL    ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  N E LQ++A+++   Y   D L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q   + +++DLLYQ+ + E+++   LY G    ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+++
  S:     8 AINWNEIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSLQEKDLVGKVFGGLTLLDTMQSETGVEAIRADVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFEWTNNNEFLQEKARIINNIYANGDALQKKVASTYLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEDEQENFRDWMYDLLYQLYENEEKYTKTLYDGVGWTEEVMTFLRYNANKALMNLGQDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGSVEAMSDDDYNY 318
>gi|19746348|ref|NP_607484.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS8232] >gi|50914444|ref|YP_060416.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS10394] >gi|71903783|ref|YP_280586.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS6180] >gi|94994624|ref|YP_602722.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes MGAS10750] >gi|139473584|ref|YP_001128300.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus pyogenes str. Manfredo] >gi|19748543|gb|AAL97983.1| ribonucleotide diphosphate reductase small subunit [Streptococcus pyogenes MGAS8232] >gi|50903518|gb|AAT87233.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS10394] >gi|71802878|gb|AAX72231.1| ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS6180] >gi|94548132|gb|ABF38178.1| Ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes MGAS10750] >gi|134271831|emb|CAM30066.1| putative ribonucleoside-diphosphate reductase beta chain [Streptococcus pyogenes str. Manfredo] (319 aa)
Score = 591, Expect = 3.7e-59, Identities = 121/312 (38%), Positives = 182/312 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL    ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  N E LQ++A+++   Y   D L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q   + +++DLLYQ+ + E+++   LY G    ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+++
  S:     7 AINWNEIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSLQEKDLVGKVFGGLTLLDTMQSETGVEAIRADVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFEWTNNNEFLQEKARIINNIYANGDALQKKVASTYLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEDEQENFRDWMYDLLYQLYENEEKYTKTLYDGVGWTEEVMTFLRYNANKALMNLGQDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGSVEAMSDDDYNY 317
>gi|157149762|ref|YP_001450838.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus gordonii str. Challis substr. CH1] >gi|157074556|gb|ABV09239.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus gordonii str. Challis substr. CH1] (319 aa)
Score = 591, Expect = 4.0e-59, Identities = 121/313 (38%), Positives = 182/313 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL    ++LV + F GLTLLD++Q+  G  A  K+  T HE+ ++ N  FM  VHA+SY SIFST  +  +I+    W      LQK+A+++   Y+    L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP E+Q ++K++++DLLY + + E+ +   LY G    ++   F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   D+D+D+
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSHKEKDLVGKVFGGLTLLDTLQSESGVDALRKDVRTAHEEAVFNNIQFMESVHAKSYSSIFSTLNTKSEIDEIFAWTNTNPYLQKKAEIINEIYLNGTALEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTETLYDGVGWTEEVKTFLRYNANKALMNLGQDPLFPDTADDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGEVEAMQDEDYDY 317
>gi|77410697|ref|ZP_00787056.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae CJB111] >gi|77163233|gb|EAO74185.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae CJB111] (319 aa)
Score = 590, Expect = 4.5e-59, Identities = 120/312 (38%), Positives = 183/312 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  N E LQ++A+++   Y   + L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q   + +++DLLYQ+ + E+++   LY G    ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+++
  S:     7 AINWNEIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSAQEKDLVGKVFGGLTLLDTMQSETGIEAIRADVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKSEIEEIFEWTNNNEFLQEKARIINDIYANGNALQKKVASTYLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEDEQENFRDWMYDLLYQLYENEEKYTKTLYDGVGWTEEVMTFLRYNANKALMNLGQDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGSVEAMHDDDYNY 317
>gi|22536982|ref|NP_687833.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus agalactiae 2603V/R] >gi|25010891|ref|NP_735286.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus agalactiae NEM316] >gi|76788606|ref|YP_329564.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus agalactiae A909] >gi|76799231|ref|ZP_00781405.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77405557|ref|ZP_00782648.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae H36B] >gi|77408849|ref|ZP_00785576.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae COH1] >gi|77413113|ref|ZP_00789313.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 515] >gi|22533837|gb|AAM99705.1|AE014229_6 ribonucleoside-diphosphate reductase 2, beta subunit [Streptococcus agalactiae 2603V/R] >gi|23095270|emb|CAD46480.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563663|gb|ABA46247.1| ribonucleoside-diphosphate reductase 2, beta subunit [Streptococcus agalactiae A909] >gi|76585414|gb|EAO61998.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 18RS21] >gi|77160814|gb|EAO71925.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae 515] >gi|77172535|gb|EAO75677.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae COH1] >gi|77175864|gb|EAO78642.1| ribonucleoside-diphosphate reductase, beta subunit [Streptococcus agalactiae H36B] (319 aa)
Score = 590, Expect = 4.5e-59, Identities = 120/312 (38%), Positives = 183/312 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  N E LQ++A+++   Y   + L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q   + +++DLLYQ+ + E+++   LY G    ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+++
  S:     7 AINWNEIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSAQEKDLVGKVFGGLTLLDTMQSETGVEAIRADVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKSEIEEIFEWTNNNEFLQEKARIINDIYANGNALQKKVASTYLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEDEQENFRDWMYDLLYQLYENEEKYTKTLYDGVGWTEEVMTFLRYNANKALMNLGQDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGSVEAMHDDDYNY 317
>gi|81096918|ref|ZP_00875242.1| Ribonucleoside-diphosphate reductase [Streptococcus suis 89/1591] >gi|80977038|gb|EAP40597.1| Ribonucleoside-diphosphate reductase [Streptococcus suis 89/1591] (320 aa)
Score = 590, Expect = 4.9e-59, Identities = 121/311 (38%), Positives = 181/311 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ +Y N  FM  VHA+SY SIFST  +  +I    +W  + E LQ++A+++   Y    PL+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +L  E+Q +++ +++DLLYQ+ + E+ +   LY      ++ + F  YNA K L NLG D  F     ++ P I   +S     NHDFFS  G+ Y++G VE   DDD+
  S:     7 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLTAEEKDLVGKVFGGLTLLDTLQSETGVQALRNDIRTPHEEAVYNNIQFMESVHAKSYSSIFSTLNTKSEIEDIFEWTNSNEYLQRKAKIINEIYETGTPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELSEEEQDKLRDWMYDLLYQLYENEEGYTRSLYDAVGWTEEVLTFLRYNANKALMNLGQDPLFPDSADDVNPIIMNGIST-GTSNHDFFSQVGNGYLLGEVEAMTDDDY 316
>gi|146318863|ref|YP_001198575.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus suis 05ZYH33] >gi|146321071|ref|YP_001200782.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus suis 98HAH33] >gi|145689669|gb|ABP90175.1| Ribonucleotide reductase, beta subunit [Streptococcus suis 05ZYH33] >gi|145691877|gb|ABP92382.1| Ribonucleotide reductase, beta subunit [Streptococcus suis 98HAH33] (319 aa)
Score = 589, Expect = 5.8e-59, Identities = 121/311 (38%), Positives = 181/311 (58%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ +Y N  FM  VHA+SY SIFST  +  +I    +W  + E LQ++A+++   Y    PL+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +L  E+Q +++ +++DLLYQ+ + E+ +   LY      ++ + F  YNA K L NLG D  F     ++ P I   +S     NHDFFS  G+ Y++G VE   DDD+
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLTAEEKDLVGKVFGGLTLLDTLQSETGVQALRNDIRTPHEEAVYNNIQFMESVHAKSYSSIFSTLNTKSEIEDIFEWTNSNEYLQRKAKIINEIYETGTPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELSEEEQDKLRDWMYDLLYQLYENEEGYTRSLYDAVGWTEEVLTFLRYNANKALMNLGQDPLFPDSADDVNPIIMNGIST-GTSNHDFFSQVGNGYLLGEVEAMTDDDY 315
>gi|24379140|ref|NP_721095.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus mutans UA159] >gi|24377045|gb|AAN58401.1|AE014910_5 putative ribonucleotide reductase, small subunit [Streptococcus mutans UA159] (319 aa)
Score = 581, Expect = 5.8e-58, Identities = 121/310 (39%), Positives = 180/310 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  N E LQK+A+++   Y   + L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +L  E+Q+E + +++DLLYQ+ + E+ +   LY      ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+
  S:     7 AINWNEIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSAAEKDLVGKVFGGLTLLDTMQSQSGVEAIRGDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKSEIEGIFEWTNNNEYLQKKAKIINEIYENGNALQKKVASTFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELSEEEQSEFRDWMYDLLYQLYENEELYTQTLYDPVGWTEEVMTFLRYNANKALMNLGQDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGSVEAMHDDDY 315
>gi|55821276|ref|YP_139718.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus thermophilus LMG 18311] >gi|55823189|ref|YP_141630.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus thermophilus CNRZ1066] >gi|116628014|ref|YP_820633.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus thermophilus LMD-9] >gi|55737261|gb|AAV60903.1| ribonucleotide diphosphate reductase beta subunit [Streptococcus thermophilus LMG 18311] >gi|55739174|gb|AAV62815.1| ribonucleotide diphosphate reductase beta subunit [Streptococcus thermophilus CNRZ1066] >gi|116101291|gb|ABJ66437.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Streptococcus thermophilus LMD-9] (320 aa)
Score = 579, Expect = 8.5e-58, Identities = 118/313 (37%), Positives = 181/313 (57%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL +  ++LV + F GLTLLD++Q+  G  A   +  T HE+ +  N  FM  VHA+SY SIFST  +  +I    +W  + + LQ +A+++   Y     L+ KVA+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q   +++++DLLYQ+ + E+ +   LY G    ++ + F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD+++
  S:     6 KAINWNEIEDAIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSAEEKDLVGKVFGGLTLLDTMQSQTGVEAIRADVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKSEIEEIFEWTNSNKYLQTKAKIINDIYENGTALQKKVASTYLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEKEQESFREWMYDLLYQLYENEELYTKSLYDGVGWTEEVMTFLRYNANKALMNLGQDPLFPDSANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGTVEAMQDDDYNY 317
>gi|125717616|ref|YP_001034749.1| ribonucleotide-diphosphate reductase subunit beta [Streptococcus sanguinis SK36] >gi|125497533|gb|ABN44199.1| Ribonucleoside-diphosphate reductase 2, beta subunit, putative [Streptococcus sanguinis SK36] (319 aa)
Score = 579, Expect = 9.8e-58, Identities = 118/313 (37%), Positives = 181/313 (57%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NWN I D  D   W ++T+ FWL  +I +SNDL  W KL    ++LV + F GLTLLD++Q+  G  A  K+  T HE+ ++ N  FM  VHA+SY SIFST  +  +I+    W      LQK+A+++   Y+    L+ K+A+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q ++K++++DLLY + + E+ +   LY      ++   F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD+++
  S:     6 KAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSHKEKDLVGKVFGGLTLLDTLQSESGVDALRKDVRTAHEEAVFNNIQFMESVHAKSYSSIFSTLNTKSEIDEIFAWTNTNPYLQKKAEIINEIYLNGTALEKKIASVFLETFLFYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLAFNELPEDEQEKLKEWMYDLLYTLYENEEGYTESLYDTVGWTEEVKTFLRYNANKALMNLGQDPLFPDSADDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGEVEAMQDDDYNY 317
>gi|116333244|ref|YP_794771.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus brevis ATCC 367] >gi|116098591|gb|ABJ63740.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Lactobacillus brevis ATCC 367] (331 aa)
Score = 574, Expect = 3.5e-57, Identities = 119/310 (38%), Positives = 182/310 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD-PLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           ++NWN ++D+ D   W ++T+ FWL  +I +SNDL  W  LD++ Q +V   F GLTLLD++Q+  G  A  ++  T HE  +  N  FM  VHA+SY +IFST  + D+I+    W  + E LQ + + +   Y  D+ PLK K+++  +  FL Y GF+ P Y    N L N  +II+LILRD+ +H  Y GYK+Q  + +L   +Q +MK +++D LYQ+ D E+++ + LY      ++ + F  YNA K L NLG D  F     ++ P +   +S  +  NHDFFS  G+ Y++GNVE    DD+
  S:     9 AINWNAVSDEIDKATWEKLTEQFWLDTRIPVSNDLDDWRTLDTDHQWVVGHVFGGLTLLDTLQSQDGMAALRRDIRTPHETAVLNNIQFMESVHAKSYSTIFSTLNTPDEIDEIFQWSDSEEFLQNKTKRIYDLYHDDEHPLKKKISSVFLETFLFYSGFFTPLYYLGHNKLNNVAEIIKLILRDESVHGTYIGYKFQLGMKELTDAEQQQMKDWMYDFLYQLYDNEEKYTHTLYDQIGWTEKVLTFIRYNANKALMNLGQDPLFPDTAEDVDPVVMNGIST-STANHDFFSQVGNGYLLGNVEAMSSDDY 318
>gi|116494955|ref|YP_806689.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus casei ATCC 334] >gi|191638466|ref|YP_001987632.1| Ribonucleoside-diphosphate reductase, beta chain [Lactobacillus casei] >gi|116105105|gb|ABJ70247.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Lactobacillus casei ATCC 334] >gi|190712768|emb|CAQ66774.1| Ribonucleoside-diphosphate reductase, beta chain [Lactobacillus casei BL23] (326 aa)
Score = 570, Expect = 9.2e-57, Identities = 119/312 (38%), Positives = 179/312 (57%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN I D+ D   W ++T+ FWL  +I +SNDL  W  L+ + Q +V   F GLTLLD++Q+  G  +  +N  T  E  +  N  FM  VHA+SY SIFST  +  +I+   DW  + E LQ +A  +   Y     L+ K+A+  +  FL Y GF+ P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP  +Q  +K +++DLL+ + + E+++ N+LYA  N  D+ + F  YNA K L NLG ++ F     ++ P +   +S  +  NHDFFS  G+ Y +G VE   DDD+ F
  S:     7 AINWNAIEDEVDKATWEKLTEQFWLDTRIPLSNDLDDWRSLNHDEQWVVGHVFGGLTLLDTLQSQDGMASLRQNIRTQQETAVLNNIQFMESVHAKSYSSIFSTLNTPAEIDEIFDWTNHNEHLQYKANKINDIYHNGSALQKKIASVFLETFLFYSGFFTPLYYLGNNKLTNVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQQTLKDWMYDLLFDLYENEEKYTNDLYAKTNWTDEVLTFLRYNANKALMNLGQETAFPDTADDVNPIVMNGIST-STANHDFFSQVGNGYRLGQVEAMQDDDYQF 317
>gi|81428551|ref|YP_395551.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus sakei subsp. sakei 23K] >gi|78610193|emb|CAI55242.1| Ribonucleoside-diphosphate reductase, beta chain [Lactobacillus sakei subsp. sakei 23K] (318 aa)
Score = 570, Expect = 1.1e-56, Identities = 118/312 (37%), Positives = 178/312 (57%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN + D  D   W ++T+ FWL  +I +SNDL  W  L  N + +V   F GLTLLD++Q+  G  +   N  T HE+ +  N  FM  VHA+SY SIFST  + ++I+   DW    E LQ +A  +   Y    PL+ K+A+  +  FL Y GFY P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +L   +Q E++ +++DLLY +   E+++ +E+Y G    ++ + +  YNA K L NLG  + F     ++ P +   +S  +  NHDFFS  G+ Y +GNVE  +D D+DF
  S:     7 AINWNQVEDQIDKATWEKLTEQFWLDTRIPLSNDLDDWRSLPDNEKWIVGHVFGGLTLLDTLQSQDGMASLKANIRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTPNEIDEIFDWTNTNEYLQYKANKINSIYQNGSPLQQKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELAKAEQEELQNWMYDLLYDLYANEEKYTHEVYDGTGWTEEVLTYLRYNANKALMNLGQGALFPDTAEDVNPVVLNGMST-STANHDFFSQVGNGYRLGNVEAMNDSDYDF 317
>gi|116493227|ref|YP_804962.1| ribonucleotide-diphosphate reductase subunit beta [Pediococcus pentosaceus ATCC 25745] >gi|116103377|gb|ABJ68520.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Pediococcus pentosaceus ATCC 25745] (317 aa)
Score = 568, Expect = 1.7e-56, Identities = 120/311 (38%), Positives = 181/311 (58%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD-PLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           ++NWN I+D  D   W ++T+ FWL  +I ISNDL  W +LD + + +V   F GLTLLD++Q+  G  A  K+  T HE  +  N  FM  VHA+SY SIF T  +  +I+    W  + E LQ + + +   Y  D+ PLK K+++  +  FL Y GF+ P Y    N L N  +II+LILRD+ +H  Y GYK+Q  + +L   +Q E+K ++++ LY + D E+++++ LY      D+ + F+ YNA K L NLG D  F   E ++ P +   +S     NHDFFS  G+ Y +GNVE   D+D++
  S:     6 AINWNAISDQIDKATWEKLTEQFWLDTRIPISNDLSDWRELDEDHKWVVGHVFGGLTLLDTLQSQDGMAALRKDIRTPHETAVLNNIQFMESVHAKSYSSIFETLNTPSEIDEIFAWSDSEEFLQNKTKRIYELYHDDEHPLKKKISSVFLETFLFYSGFFTPLYYLGHNQLNNVAEIIKLILRDESVHGTYIGYKFQLGLKELGENEQQEIKDWMYNFLYDLYDNEEKYVHTLYDQVGWTDEVLTFTRYNANKALMNLGQDPLFPDTEADVNPIVMNGIST-GTSNHDFFSQVGNGYRLGNVETMSDEDYN 316
>gi|158079504|ref|YP_001504317.1| putative ribonucleotide reductase [Enterococcus phage phiEF24C] >gi|157890348|dbj|BAF81476.1| putative ribonucleotide reductase [Enterococcus phage phiEF24C] (327 aa)
Score = 565, Expect = 3.8e-56, Identities = 118/317 (37%), Positives = 183/317 (57%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPF-YLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           L+ K   +NWN I+D  D   W ++T+ FWL  ++ + ND+  W KL    Q+L+ + F GLTLLD++Q+  G  + + +  T HE+ +  N AFM  VHA+SY +IFSTF +  +I++  +WV   + LQ +A ++   Y    PL+ K A+ ++  FL Y GFY P  YLG   ++ NT +II+LI+RD+ +H  Y GYKYQ    +LP  +Q EM+++V DL +++ + E ++  ELY+          F  YN  K L NLG +  F     ++ P +   +S     NHDFFS  G+ Y++G VE   D D++
  S:     3 LQEKYEGINWNKIDDVIDQATWKKLTEQFWLDTRVPVGNDVNDWAKLSDMEQDLINKVFGGLTLLDTVQSESGVHSLLDDVRTQHEEAVLNNIAFMEAVHAKSYSTIFSTFNTPTEIDNIFEWVATNKRLQYKANIINDIYRNGTPLQKKSASVLLESFLFYSGFYTPLRYLGEAKMV-NTAEIIKLIIRDESVHGTYIGYKYQLGFNQLPETEQKEMEQWVIDLAFKLWENETQYTAELYSEIGWTKDVNTFLEYNLNKALANLGMNPLFPTTSADVNPIVMNGIST-TTSNHDFFSQVGNGYLLGKVEPVTDADYN 318
>gi|148543559|ref|YP_001270929.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus reuteri F275] >gi|184152966|ref|YP_001841307.1| ribonucleotide diphosphate reductase beta subunit [Lactobacillus reuteri F275] >gi|148530593|gb|ABQ82592.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Lactobacillus reuteri F275] >gi|183224310|dbj|BAG24827.1| ribonucleotide diphosphate reductase beta subunit [Lactobacillus reuteri F275] (339 aa)
Score = 564, Expect = 5.2e-56, Identities = 121/314 (38%), Positives = 179/314 (57%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI--GDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           + +++NWN ++D  D   W ++T+ FWL  +I ++ND+  W +LD + Q  V   F GLTLLD++Q+  G  A  ++  T HE  +  N  FM  VHA+SY +IFST  + DQI    +W    E LQ +A  +   Y+    DPLK KVA   +  FL Y GFY P Y    N L N  +II+LILRD+ +H  Y GYK+Q  +     ++Q +MK ++++ LY++ D E+++ + LY      D  + F  YNA K L NLG D  F    +++ P +   +S  +  NHDFFS  G+ Y MG VE  +D D+D
  S:    11 QYKAINWNEVSDMIDKATWEKLTEQFWLDTRIPVANDMDDWRELDDDHQWTVGHVFGGLTLLDTVQSEAGLTALKEDVKTPHETAVLNNIQFMESVHAKSYSTIFSTLNTPDQIKEIFEWSDTEEYLQNKAVKIANMYLDPSQDPLKKKVANVFLETFLFYSGFYTPLYYLGHNKLNNVAEIIKLILRDESVHGTYIGYKFQVGLRDRTEKQQQDMKDWMYNFLYELYDNEEKYTHLLYDQVGWTDDVLTFIRYNANKALMNLGQDPLFPDTASDVNPVVMNGIST-STSNHDFFSQVGNGYRMGAVEAMNDSDYD 325
>gi|69245952|ref|ZP_00603724.1| Ribonucleoside-diphosphate reductase [Enterococcus faecium DO] >gi|68195482|gb|EAN09926.1| Ribonucleoside-diphosphate reductase [Enterococcus faecium DO] (321 aa)
Score = 560, Expect = 1.6e-55, Identities = 118/310 (38%), Positives = 172/310 (55%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W  L    ++ V   F GLTLLD++Q+  G     K+  T HE+ +  N  FM  VHA+SY SIFST  +  +I    DW      LQK+A+ +   Y    PL+ K+A+  +  FL Y GFY P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP  +Q  +K ++++LLY++ + E+ +  ELY      ++   F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G+VE   DDD+
  S:     8 AINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGHVEAMKDDDY 316
>gi|194468106|ref|ZP_03074092.1| Ribonucleoside-diphosphate reductase [Lactobacillus reuteri 100-23] >gi|194452959|gb|EDX41857.1| Ribonucleoside-diphosphate reductase [Lactobacillus reuteri 100-23] (339 aa)
Score = 559, Expect = 2.0e-55, Identities = 120/314 (38%), Positives = 179/314 (57%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI--GDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           + +++NWN ++D  D   W ++T+ FWL  +I ++ND+  W +LD + Q  V   F GLTLLD++Q+  G  A  ++  T HE  +  N  FM  VHA+SY +IFST  + DQI    +W    E LQ +A  +   Y+    DPLK KVA   +  FL Y GFY P Y    N L N  +II+LILRD+ +H  Y GYK+Q  +     ++Q +MK ++++ LY++ D E+++ + LY      D  + F  YNA K L NLG D  F    +++ P +   +S  +  NHDFFS  G+ Y MG VE  +D D++
  S:    11 QYKAINWNEVSDMIDKATWEKLTEQFWLDTRIPVANDMDDWRELDDDHQWTVGHVFGGLTLLDTVQSEAGLTALKEDVKTPHETAVLNNIQFMESVHAKSYSTIFSTLNTPDQIKEIFEWSDTEEYLQNKAVKIANMYLDPSQDPLKKKVANVFLETFLFYSGFYTPLYYLGHNKLNNVAEIIKLILRDESVHGTYIGYKFQVGLRDRTEKQQQDMKDWMYNFLYELYDNEEKYTHLLYDQVGWTDDVLTFIRYNANKALMNLGQDPLFPDTASDVNPVVMNGIST-STSNHDFFSQVGNGYRMGAVEAMNDSDYN 325
>gi|90962208|ref|YP_536124.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus salivarius UCC118] >gi|90821402|gb|ABE00041.1| Ribonucleoside-diphosphate reductase beta chain [Lactobacillus salivarius UCC118] (326 aa)
Score = 549, Expect = 2.5e-54, Identities = 116/312 (37%), Positives = 178/312 (57%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++NWN + D+ D   W ++T+ FWL  +I +SNDL  W + + + +++V + F GLTLLD++Q+  G  +  K+  T HE+ +  N  FM  VHA+SY SIFST  +  +I    DW  + E LQ +A  +   Y    PL+ KVA+  +  FL Y GFY P Y    N L N  +II+LILRD+ +H  Y GYK+Q    +L  ++Q E   +++DLLY++ + E+++ + LY      D  + F  YNA K L NLG D  F     +    + +   + +  NHDFFS  G+ Y++G+VE  +D D+ F
  S:     7 AINWNALEDEIDKATWEKLTEQFWLDTRIPLSNDLSDWREFNEDDKDVVGKVFGGLTLLDTLQSQDGMSSLKKDVRTQHEEAVMNNIEFMESVHAKSYSSIFSTLNTPKEIEEIFDWTNSNEILQYKANRINEIYQNGSPLQKKVASVFLETFLFYSGFYTPLYWLGHNKLANVAEIIKLILRDESVHGTYIGYKFQLGFNELSDDEQEEFTSWMYDLLYELYENEEKYTHLLYDKVGWTDDVLVFLRYNANKALMNLGMDPLFADGYAQNVNPVVMNGISTSTSNHDFFSQVGNGYLLGDVEAMEDSDYLF 318
>gi|29375101|ref|NP_814254.1| ribonucleotide-diphosphate reductase subunit beta [Enterococcus faecalis V583] >gi|29342560|gb|AAO80325.1| ribonucleoside-diphosphate reductase 2, beta subunit [Enterococcus faecalis V583] (321 aa)
Score = 549, Expect = 2.7e-54, Identities = 117/310 (37%), Positives = 177/310 (57%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSL-TDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           ++NWN I D  D   W ++T+ FWL  +I +SNDL  W  L    +  V   F GLTLLD++Q+  G + Q++N + T HE+ +  N  FM  VHA+SY SIFST  +  +I+   +W    + LQ +A+ +   Y    PL+ K+A+  +  FL Y GFY P Y    N L N  +II+LI+RD+ +H  Y GYK+Q    +LP ++Q ++K ++++LLY++ + E+ +  ELY      ++   F  YNA K L NLG D  F     ++ P +   +S     NHDFFS  G+ Y++G VE   DDD+
  S:     7 AINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSDLEKTTVGYVFGGLTLLDTVQSESG-MDQLRNDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIDDIFEWTNTNKHLQYKAERINEIYKNGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEDEQDKLKDWMYNLLYELYENEERYTEELYDDLGWTEEVKTFLRYNANKALMNLGMDPLFADTANDVNPIVMNGIST-GTSNHDFFSQVGNGYLLGTVEAMKDDDY 315
>gi|118586508|ref|ZP_01543952.1| ribonucleoside-diphosphate reductase 2, beta subunit [Oenococcus oeni ATCC BAA-1163] >gi|118433072|gb|EAV39794.1| ribonucleoside-diphosphate reductase 2, beta subunit [Oenococcus oeni ATCC BAA-1163] (337 aa)
Score = 543, Expect = 1.4e-53, Identities = 113/311 (36%), Positives = 172/311 (55%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           ++NWN + D  D   W ++T+ FWL  +I ISND+  W  L     +L    F GLT+LD++Q+  G  + +  ++T HE+ +  N  FM  VHA+SY SIF T  +  +I+   DW    E LQ +A  +   Y   DPLK K+A+  +  FL Y GFY P Y    N + N  +II+LI+RD+ +H  Y GYK+Q    +L  ++Q E+  + +DLLY + D E+++ ++LY   +  D  + F  YN  K L NLG +  F     ++ P +   +S  +  NHDFFS  G+ Y +G VE    DD++
  S:    13 AINWNKVIDPIDKATWEKLTEQFWLDTRIPISNDMKDWRSLGLVEHKLYDHVFGGLTMLDTLQSQDGMASLLDAAVTPHERAVLNNIKFMESVHAKSYSSIFETLDTPAEIDEIFDWASKNEQLQYKANKINSVYHDPDPLKRKIASVFLETFLFYSGFYTPLYFVGHNKMANVAEIIKLIIRDESVHGTYIGYKFQLAYKELTEQEQKELNSWAYDLLYDLYDNEEKYTHQLYDEIDWFDDVMIFLRYNGNKALMNLGLEPMFADGAEDVNPVVMNGIST-STANHDFFSQVGNGYRLGQVENLSPDDYN 322
>gi|116490256|ref|YP_809800.1| ribonucleotide-diphosphate reductase subunit beta [Oenococcus oeni PSU-1] >gi|116090981|gb|ABJ56135.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Oenococcus oeni PSU-1] (337 aa)
Score = 541, Expect = 2.2e-53, Identities = 112/311 (36%), Positives = 172/311 (55%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           ++NWN + D  D   W ++T+ FWL  +I ISND+  W  L     +L    F GLT+LD++Q+  G  + +  ++T HE+ +  N  FM  VHA+SY SIF T  +  +I+   DW    E LQ +A  +   Y   DPLK K+A+  +  FL Y GFY P Y    N + N  +II+LI+RD+ +H  Y GYK+Q    +L  ++Q ++  + +DLLY + D E+++ ++LY   +  D  + F  YN  K L NLG +  F     ++ P +   +S  +  NHDFFS  G+ Y +G VE    DD++
  S:    13 AINWNKVIDPIDKATWEKLTEQFWLDTRIPISNDMKDWRSLGPVEHKLYDHVFGGLTMLDTLQSQDGMASLLDAAVTPHERAVLNNIKFMESVHAKSYSSIFETLDTPAEIDEIFDWASKNEQLQYKANKINSVYHDPDPLKRKIASVFLETFLFYSGFYTPLYFVGHNKMANVAEIIKLIIRDESVHGTYIGYKFQLAYKELTEQEQKDLNSWAYDLLYDLYDNEEKYTHQLYDEIDWFDDVMIFLRYNGNKALMNLGLEPMFADGAEDVNPVVMNGIST-STANHDFFSQVGNGYRLGQVENLSPDDYN 322
>gi|163791218|ref|ZP_02185634.1| ribonucleotide-diphosphate [Carnobacterium sp. AT7] >gi|159873488|gb|EDP67576.1| ribonucleotide-diphosphate [Carnobacterium sp. AT7] (320 aa)
Score = 539, Expect = 4.4e-53, Identities = 115/312 (36%), Positives = 174/312 (55%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           +++NWN I D  D   W ++ + FW   +I +SNDL  W +L    +++V + F GLTLLD++Q+  G  A      T HE+ +Y N  FM  +HA+SY +IFST  S  +I+    W    + LQ +A  +   Y     L+ KVA+ M+  FL Y GF+ P +    N LPN  +II+LILRD+ +H  Y GYK+Q    +LP  ++ EMK + ++LL+++   E ++   LY      ++   F  YNA K LQNLG+D  F     ++ P I   +S     NHDFFS  G+ Y++G VE  + DD++
  S:     6 KAINWNNIEDMIDKLTWEKLVEQFWTDTRIPVSNDLDDWARLPKAEKDMVGKVFGGLTLLDTLQSQDGVQALKPFIRTQHEEAVYNNIQFMESMHAKSYSAIFSTLNSKVEIDEIFQWTNTNDLLQIKASTINDIYQNGTELQRKVASVMLESFLFYSGFFAPLHYLGNNKLPNVAEIIKLILRDESVHGTYIGYKFQIAYNQLPDNEKEEMKNWTYELLFKLYQNEVKYAEYLYDEIGWTERVKVFLRYNANKALQNLGFDPLFPDTANDVDPVIMNGIST-GTSNHDFFSQVGNGYLLGMVESMETDDYE 316
>gi|13274105|emb|CAC33823.1| ribonucleotide reductase beta-subunit [Corynebacterium glutamicum] (201 aa)
Score = 538, Expect = 5.7e-53, Identities = 103/201 (51%), Positives = 137/201 (68%)
  Q:   139 NSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           N A  W    E+LQ++A++++ YY GDDPLK K+A+ ++  FL Y GFYLP Y  + + L NT D+IRLI+RD+ +H YY GYKYQK VAK  PE+Q E+K++ FDLLY + D E ++  +LY      +   +F  YNA K L NLGY+  F  +ET++ P I   LS  ADENHDFFSGSGSSY++G  E T+DDDWDF
  S:     1 NDAFRWSEENENLQRKAKIILSYYEGDDPLKRKIASVILESFLFYSGFYLPMYWSSHSKLTNTADVIRLIIRDEAVHGYYIGYKYQKAVAKETPERQEELKEYTFDLLYDLYDNETQYSEDLYDDLGWTEDVKRFLRYNANKALNNLGYEGLFPADETKVSPNILSALSPNADENHDFFSGSGSSYVIGKAENTEDDDWDF 201
>gi|116617385|ref|YP_817756.1| ribonucleotide-diphosphate reductase subunit beta [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096232|gb|ABJ61383.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (325 aa)
Score = 537, Expect = 5.9e-53, Identities = 116/315 (36%), Positives = 181/315 (57%)
  Q:    24 GKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDH-EQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           G   ++NWN I D+ D   W ++TQ FWL  +I ISNDL +W   +    ++ +   F GLT LD++Q+  G +AQ+K   T+  E+ +  N  FM  VHA+SY SIF T     +I    +W  + E LQ +A  +   Y     L+ K+A+  +  FL Y GFY P Y    N + N  +II+LI+RD+ +H  Y GYK+Q    K+  E++ E++ +++DLLY++ + E+++ +ELY      +Q + F  YNA K L NLG +  F     ++ P +   +S  +  NHDFFSG G+ Y++G VE  +DDD++
  S:     7 GSYTAINWNNIEDELDKATWEKLTQQFWLDTRIPISNDLRTWRGNMSEQERQTMNLVFGGLTTLDTLQSQDG-MAQLKLDATNQKEEAVLNNIQFMESVHAKSYSSIFETLNEKVEIEKIFEWADSNEFLQYKANRINDIYHNGSALQKKIASVFLETFLFYSGFYTPLYFLGHNKMLNVAEIIKLIIRDESVHGTYIGYKFQIGFNKISAEERTELQSWMYDLLYELYENEEKYTHELYDDLGWTEQVLTFLRYNANKALMNLGQEPMFPDGAEDVNPVVMNGIST-STANHDFFSGVGNGYLLGEVEAMNDDDYN 321
>gi|15672956|ref|NP_267130.1| ribonucleotide-diphosphate reductase subunit beta [Lactococcus lactis subsp. lactis Il1403] >gi|12723917|gb|AAK05072.1|AE006332_1 ribonucleoside-diphosphate reductase beta chain (EC 1.17.4.1) [Lactococcus lactis subsp. lactis Il1403] (325 aa)
Score = 529, Expect = 5.8e-52, Identities = 109/311 (35%), Positives = 174/311 (55%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           +++WN I D  D   W ++T  FWL  ++ +SNDL  W KL    ++   + F GLTLLD++Q+  G      ++ T  E   + N  FM  VHA+SY +IFST  +  +I    +WV     +Q +A+++   Y    PL+ KVA+  +   L Y GFY P      N + N+ +II+LI+RD+ +H  Y GYK+Q    +L  ++Q E + ++++LLYQ+ + E+++ + LY      D+ + F  YNA K L NLG D  F     ++ P +   +S  +  NHDFFS  G+SY++G VE   D+D++
  S:    15 AIDWNSIEDSIDKYTWEKLTSQFWLDTRVPVSNDLDDWRKLPQLERDTFAKAFAGLTLLDTLQSVDGAEVLKHDARTPQEIACFNNIQFMESVHAKSYSTIFSTLNTKKEIEELFNWVDTNVYMQTKAEIINKIYESGTPLQKKVASVFLETCLFYSGFYTPLRYLGNNKMINSAEIIKLIIRDESVHGTYIGYKFQLGFNELSEDEQGEFRDWMYELLYQLYENEEKYSHLLYDKVGWTDEVLTFLRYNANKALMNLGQDPLFPDTAADVNPVVMNGIST-SSSNHDFFSQVGNSYLLGEVEAMSDEDYE 324
>gi|116511803|ref|YP_809019.1| ribonucleotide-diphosphate reductase subunit beta [Lactococcus lactis subsp. cremoris SK11] >gi|125624347|ref|YP_001032830.1| ribonucleotide-diphosphate reductase subunit beta [Lactococcus lactis subsp. cremoris MG1363] >gi|116107457|gb|ABJ72597.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Lactococcus lactis subsp. cremoris SK11] >gi|124493155|emb|CAL98119.1| ribonucleoside-diphosphate reductase beta chain [Lactococcus lactis subsp. cremoris MG1363] (325 aa)
Score = 519, Expect = 7.6e-51, Identities = 108/311 (34%), Positives = 173/311 (55%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWD 338
           +++WN I D  D   W ++T  FWL  ++ +SNDL  W KL    ++   + F GLTLLD++Q+  G      ++ T  E   + N  FM  VHA+SY +IFST  +  +I    +WV     +Q +A+++   Y     L+ KVA+  +   L Y GFY P      N + N+ +II+LI+RD+ +H  Y GYK+Q    +L  ++Q+E + ++++LLY++ + E+ + + LY      D+ + F  YNA K L NLG D  F     ++ P +   +S  +  NHDFFS  G+SY++G VE   D+D+D
  S:    15 AIDWNSIEDSIDKYTWEKLTSQFWLDTRVPVSNDLDDWRKLPQLERDTFAKAFAGLTLLDTLQSVDGAEVLKHDARTPQEIACFNNIQFMESVHAKSYSTIFSTLNTKKEIEELFNWVDTNVYMQTKAEIINKIYESGTALQKKVASVFLETCLFYSGFYTPLLYLGNNKMINSAEIIKLIIRDESVHGTYIGYKFQLGFNELSEDEQSEFRDWMYELLYKLYENEENYSHLLYDKVGWTDEVLTFLRYNANKALMNLGQDPLFPDTAADVNPVVMNGIST-SSSNHDFFSQVGNSYLLGEVEAMSDEDYD 324
>gi|146322252|ref|YP_001174719.1| putative ribonucleotide reductase subunit beta [Lactococcus lactis] >gi|145968743|gb|ABQ00021.1| putative ribonucleotide reductase subunit beta [Lactococcus lactis] (316 aa)
Score = 496, Expect = 3.5e-48, Identities = 103/313 (32%), Positives = 175/313 (55%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFT-PEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++NW  I D+ D  VW++ T  FWL  ++ +SNDL  W KL    +E+V +   GL LLD++Q+  G  A  KN+ T  E+ + ++F FM  +HA++YG+I  +  +   I   + W+ N   +Q +A+ +   Y    P++ KVA+  + G L Y  F++P +   +N L N  ++I+L++RD+ +H  Y GYK+++   +L   +Q     +++  L +++D E  +  E+Y+   + +    F  YNA K LQN+G+D  F      ++ P +   +S     NHDFFS  G+ Y+MG  EE  DDD+ F
  S:     4 KTMNWQLIEDELDEYVWDKATAQFWLDTRVPVSNDLLDWRKLSDMEKEVVKKAVGGLALLDTLQSEEGLYALKKNARTLKERAVLSDFTFMESIHAKTYGTILISLNTFKDIEEIYTWMNNDRRMQFKAKKINEIYQNGTPMQVKVASVFLEGILYYSNFFIPLWYRGQNKLANLAELIKLVIRDESVHGTYLGYKFRQDFNELSITEQENFTNWMYSFLEELLDNEFAYTEEVYSEIGLVEDIKTFVKYNANKSLQNMGFDIYFKDASANDVNPIVMNGISIET-ANHDFFSQVGAGYLMGEAEEMLDDDYIF 316
>gi|16078802|ref|NP_389621.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus subtilis subsp. subtilis str. 168] >gi|1710395|sp|P50621|RIR2_BACSU Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|1154633|emb|CAA92811.1| NrdF [Bacillus subtilis] >gi|2634123|emb|CAB13623.1| ribonucleoside-diphosphate reductase (minor subunit) [Bacillus subtilis subsp. subtilis str. 168] >gi|116733911|gb|ABK20014.1| ribonucleotide-diphosphate reductase beta [synthetic construct] (329 aa)
Score = 476, Expect = 7.6e-46, Identities = 119/312 (38%), Positives = 175/312 (56%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG---DDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + NW+   DD     +N+  + FWLPE+IA++ DL +W  L  N Q+  ++   GLTLLD+ Q   G +  V   +  H++    NF  M+   VHA+SY +IF T   ++ IN   +WV   + LQK+AQ+++  Y     DD +   K+ VA+  +  FL Y GFY P Y   +  L  + +II LILRD+ IH  Y G   Q+   K   EK+AE+++F  DLL Q+ + E E+  +LY    ++    KF  YNA K L NLG+D  F  EE +I P +   L+ +  ++HDFFS  G+ Y    VE   DDD+ F
  S:     7 AANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTG-MPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETINEVFEWVKQNKYLQKKAQMIVGLYKAIQKDDEISLFKAMVASVYLESFLFYSGFYYPLYFYGQGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTEEKKAELREFAIDLLNQLYENELEYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFDPYF--EEEDINPIVLNGLNTKT-KSHDFFSMKGNGYKKATVEPLKDDDFYF 322
>gi|154686152|ref|YP_001421313.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus amyloliquefaciens FZB42] >gi|154352003|gb|ABS74082.1| NrdF [Bacillus amyloliquefaciens FZB42] (329 aa)
Score = 475, Expect = 1.1e-45, Identities = 118/312 (37%), Positives = 175/312 (56%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG---DDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + NW+   DD     +N+  + FWLPE+IA++ DL +W  L  N Q+  ++   GLTLLD+ Q   G +  V   +  H++    NF  M+   VHA+SY +IF T   ++ IN   +WV   + LQK+AQ+++  Y     DD +   K+ VA+  +  FL Y GFY P Y   +  L  + +II LILRD+ IH  Y G   Q+   K   EK+AE+++F  DLL Q+ + E E+  +LY    ++    KF  YNA K L NLG+D  F  EE +I P +   L+ +  ++HDFFS  G+ Y    VE   D+D+ F
  S:     7 AANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTG-MPIVAEHVEGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETINEVFEWVKQNKYLQKKAQMIVGLYKAIQKDDEISLFKAMVASVYLESFLFYSGFYYPLYFYGQGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTEEKKAELREFAIDLLNQLYENELEYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFDPYF--EEEDINPIVLNGLNTKT-KSHDFFSMKGNGYKKATVEPIKDEDFYF 322
>gi|9630287|ref|NP_046714.1| hypothetical protein SPBc2p162 [Bacillus phage SPBc2] >gi|50812253|ref|NP_389886.2| ribonucleotide-diphosphate reductase subunit beta [Bacillus subtilis subsp. subtilis str. 168] >gi|2522310|gb|AAB92486.1| YojQ/S [Bacillus subtilis] >gi|3025640|gb|AAC13135.1| unknown [Bacteriophage SPBc2] >gi|32468776|emb|CAB13896.2| yosP [Bacillus subtilis subsp. subtilis str. 168] (329 aa)
Score = 458, Expect = 9.7e-44, Identities = 113/312 (36%), Positives = 171/312 (54%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI---GDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + NW+   DD     +N+  + FWLPE+IA++ DL +W  L  N Q+  ++   GLTLLD+ Q   G +  V   +  H++    NF  M+   VHA+SY +IF T   ++QIN   +WV N   LQK+A+ ++  Y     +D +   K  VA+  +  FL Y GFY P Y   +  L  + +II LI+RD+ IH  Y G   Q+   K  P+KQ E+  +  +LL ++ + E E+  ++Y    +A    KF  YNA K L NLG+D  F  EE ++ P +   L+ +  ++HDFFS  G+ Y    VE   D D+ F
  S:     7 AANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTG-MPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFLTLAPTEQINEVFEWVKNNRFLQKKARTIVSVYKTIKKNDEISLFKGMVASVFLESFLFYSGFYYPLYFYGQGKLMQSGEIINLIIRDEAIHGVYVGLLAQEIYKKQTPQKQKELYAWALNLLQELYENELEYTEDVYDQVGLAPDVKKFIRYNANKALNNLGFDHWF--EEEDVNPIVINGLNTKT-KSHDFFSTKGNGYKKATVEPLKDSDFIF 322
>gi|52080345|ref|YP_079136.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus licheniformis ATCC 14580] >gi|52785724|ref|YP_091553.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus licheniformis ATCC 14580] >gi|52003556|gb|AAU23498.1| ribonucleoside-diphosphate reductase (minor subunit) [Bacillus licheniformis ATCC 14580] >gi|52348226|gb|AAU40860.1| NrdF [Bacillus licheniformis DSM 13] (325 aa)
Score = 455, Expect = 2.1e-43, Identities = 113/303 (37%), Positives = 168/303 (55%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY----IGD--DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVE 330
           + NW+   DD     +N+  + FWLPE+IA++ DL +W  L  N Q+  ++   GLTLLD+ Q   G +  V   +  H++    NF  M+   VHA+SY +IF T   ++ IN   +WV   + LQK+AQ+++  Y     GD     K+ VA+  +  FL Y GFY P Y   +  L  + +II LILRD+ IH  Y G   Q+   +  PEK+ E+  F  DLL ++ + E E+  +LY    ++    KF  YNA K L NLG+++ F  EE EI P +   L+ +  ++HDFFS  G+ Y    VE
  S:     7 AANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTG-MPLVAEHVEGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETINEVFEWVKQNKYLQKKAQIIVGLYEKIRQGDKISLFKAMVASVYLESFLFYSGFYYPLYFYGQGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNQQTPEKKEELYAFSIDLLKELYENELEYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFEAYF--EEEEINPIVLNGLNTKT-KSHDFFSMKGNGYKKATVE 313
>gi|168135877|ref|ZP_02579106.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus B4264] >gi|157955328|gb|ABW06040.1| NrdF [Bacillus thuringiensis serovar entomocidus] >gi|157955388|gb|ABW06085.1| NrdF [Bacillus thuringiensis serovar subtoxicus] >gi|157955409|gb|ABW06101.1| NrdF [Bacillus cereus] (322 aa)
Score = 451, Expect = 6.4e-43, Identities = 113/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   DLL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEEQQEVQKETQDLLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|152974880|ref|YP_001374397.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152023632|gb|ABS21402.1| Ribonucleoside-diphosphate reductase [Bacillus cereus subsp. cytotoxis NVH 391-98] (322 aa)
Score = 450, Expect = 7.2e-43, Identities = 112/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV     L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q +++K   DLL ++ ++E  +  E+YA   +  +  +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQTTYKRVLGGLTLLDTKQGGEGMPLVLVHIENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDEIFDWVDQHPLLEKKAGIITGYYRKLLKPQVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGLLAQQIFAELSAEEQEDVQKETQDLLMELYEIETAYTEEIYASIGLVGEVNRFVRYNANKGLMNLGLEPRF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLSDDDFVF 320
>gi|157955401|gb|ABW06095.1| NrdF [Bacillus thuringiensis serovar toumanoffi] (322 aa)
Score = 449, Expect = 1.1e-42, Identities = 112/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWAQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITGYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|30019505|ref|NP_831136.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus ATCC 14579] >gi|29895049|gb|AAP08337.1| Ribonucleoside-diphosphate reductase beta chain [Bacillus cereus ATCC 14579] >gi|157955310|gb|ABW06026.1| NrdF [Bacillus thuringiensis serovar canadensis] >gi|157955392|gb|ABW06088.1| NrdF [Bacillus thuringiensis serovar thompsoni] >gi|157955396|gb|ABW06091.1| NrdF [Bacillus thuringiensis serovar tohokuensis] (322 aa)
Score = 448, Expect = 1.4e-42, Identities = 112/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|157955319|gb|ABW06033.1| NrdF [Bacillus thuringiensis serovar pakistani] (322 aa)
Score = 448, Expect = 1.6e-42, Identities = 112/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSTEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|75759355|ref|ZP_00739452.1| Ribonucleoside-diphosphate reductase beta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168143196|ref|ZP_02586425.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus G9842] >gi|74493187|gb|EAO56306.1| Ribonucleoside-diphosphate reductase beta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|157955348|gb|ABW06055.1| NrdF [Bacillus thuringiensis serovar alesti] >gi|157955356|gb|ABW06061.1| NrdF [Bacillus thuringiensis serovar dakota] >gi|157955360|gb|ABW06064.1| NrdF [Bacillus thuringiensis serovar darmstadiensis] >gi|157955364|gb|ABW06067.1| NrdF [Bacillus thuringiensis serovar dendrolimus] >gi|157955380|gb|ABW06079.1| NrdF [Bacillus thuringiensis serovar ostriniae] (322 aa)
Score = 447, Expect = 1.6e-42, Identities = 112/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITGYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|157955305|gb|ABW06022.1| NrdF [Bacillus thuringiensis serovar aizawai] >gi|157955352|gb|ABW06058.1| NrdF [Bacillus thuringiensis serovar colmeri] >gi|157955372|gb|ABW06073.1| NrdF [Bacillus thuringiensis serovar indiana] >gi|157955405|gb|ABW06098.1| NrdF [Bacillus thuringiensis serovar wuhanensis] (322 aa)
Score = 446, Expect = 2.1e-42, Identities = 112/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSVEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|157955336|gb|ABW06046.1| NrdF [Bacillus thuringiensis serovar kurstaki] (322 aa)
Score = 446, Expect = 2.3e-42, Identities = 112/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSVEEQQEVQKETQELLMELSEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|47566242|ref|ZP_00237270.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus G9241] >gi|47556795|gb|EAL15126.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus G9241] (322 aa)
Score = 445, Expect = 2.8e-42, Identities = 111/314 (35%), Positives = 166/314 (52%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV     L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWAQLSKQEQVAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDEIFDWVDTHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEDQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLSDDDFVF 320
>gi|52143985|ref|YP_082843.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus E33L] >gi|51977454|gb|AAU19004.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus E33L] >gi|157955324|gb|ABW06037.1| NrdF [Bacillus thuringiensis serovar tochigiensis] (322 aa)
Score = 445, Expect = 3.0e-42, Identities = 111/314 (35%), Positives = 166/314 (52%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV     L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWAQLSKEEQVAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDEIFDWVDTHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEDQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLSDDDFVF 320
>gi|157955376|gb|ABW06076.1| NrdF [Bacillus thuringiensis serovar morrisoni] (322 aa)
Score = 444, Expect = 4.1e-42, Identities = 111/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  Y+           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITSYHRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|167554442|ref|ZP_02348181.1| hypothetical protein Sentente_28378 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (153 aa)
Score = 444, Expect = 4.3e-42, Identities = 73/149 (48%), Positives = 110/149 (73%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVA 173
           ++ ++NWN I DDKDLEVWNR+T NFWLPEK+ +SND+P+W  L +  Q+L +R FTGLTLLD+IQ   G  + + +++T HE+ + +N +FM  VHARSY SIFST C + ++++A+ W      LQ++AQ+++ +Y+ D+PLK K+A
  S:     5 RISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIA 153
>gi|157692410|ref|YP_001486872.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus pumilus SAFR-032] >gi|194015081|ref|ZP_03053698.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus pumilus ATCC 7061] >gi|157681168|gb|ABV62312.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus pumilus SAFR-032] >gi|194014107|gb|EDW23672.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus pumilus ATCC 7061] (326 aa)
Score = 443, Expect = 4.6e-42, Identities = 112/312 (35%), Positives = 170/312 (54%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG---DDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + NW+   DD     +N+  + FWLPE+I+++ DL +W  L    ++  ++   GLTLLD+ Q   G +  V   +  H++    NF  M+   VHA+SY +IF T   ++ I+   +WV   + LQK+A +++  Y     DDP+   K+ VA+  +  FL Y GFY P Y   +  L  + +II LILRD+ IH  Y G   Q+   K  P+ Q E+  F  DLL ++ + E  +  ++Y   N++    KF  YNA K L NLG+   F  EE EI P +   L+ +  ++HDFFS  G+ Y    VE   DDD+ F
  S:     7 AANWSKHEDDFTQMFYNQNVKQFWLPEEISLNGDLLTWKYLGEKERDTYMKVLAGLTLLDTEQGNTG-MPIVAEHVEGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETISEVFEWVKKNKFLQKKADMIVSLYRSIQKDDPISLFKAMVASVYLESFLFYSGFYYPLYFYGQGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTPDVQKELYDFSIDLLNELYENELHYTEDIYDQVNLSHDVKKFIRYNANKALMNLGFAPYF--EEEEINPIVLNGLNTKT-KSHDFFSMKGNGYKKATVEPLKDDDFFF 322
>gi|164688728|ref|ZP_02212756.1| hypothetical protein CLOBAR_02375 [Clostridium bartlettii DSM 16795] >gi|164602204|gb|EDQ95669.1| hypothetical protein CLOBAR_02375 [Clostridium bartlettii DSM 16795] (327 aa)
Score = 443, Expect = 4.7e-42, Identities = 106/313 (33%), Positives = 171/313 (54%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQ--VIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDP----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           ++VNWN  +DD     W++  + FWLPE+I++S D+  W++L    + L  +   GLTLLD+ QA  G  + +  SLTD+ Q   + +    M  +HA+SY SIF+T  +  +I+   +W+ +  +LQK+A++++  Y   D       S   +  +  FL Y GF+ P +L  +  +  + +II LILRD+ +H  Y G   Q+       E+Q E K  V D+  ++++ E  + N +Y G  +AD+ I F  YNA + ++NLGYD+    E   + P +   LS    + HDFFS  G+ Y  G  E   D D+ F
  S:    10 KAVNWNVEDDDFTQAFWDQNVKQFWLPEEISVSKDVKVWSELSPEERNLYKKVLGGLTLLDTKQANNGIPSMM--SLTDNLQRKAVLSFMGTMEEIHAKSYSSIFTTLLTVPEIDEIFEWIESEPTLQKKAEIVLAQYENTDDRYGLYMSMATSVFLESFLFYSGFFYPLFLAGQGKMMASGEIISLILRDESLHGKYIGLLAQEIFKDFSKEEQKEYKSKVMDVFDRLMENEINYTNTIYEGTGLADEVINFLKYNANRAMENLGYDNRL--EVDPVNPIVLNGLSTET-KTHDFFSTKGNGYQKGVYESLQDSDFVF 323
>gi|30261453|ref|NP_843830.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus anthracis str. Ames] >gi|47526645|ref|YP_017994.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184287|ref|YP_027539.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus anthracis str. Sterne] >gi|49477196|ref|YP_035577.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65318723|ref|ZP_00391682.1| COG0208: Ribonucleotide reductase, beta subunit [Bacillus anthracis str. A2012] >gi|118476922|ref|YP_894073.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus thuringiensis str. Al Hakam] >gi|165870361|ref|ZP_02215016.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0488] >gi|166992001|ref|ZP_02258461.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus AH820] >gi|167634337|ref|ZP_02392658.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0442] >gi|167639338|ref|ZP_02397610.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0193] >gi|170686782|ref|ZP_02878002.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0465] >gi|170706310|ref|ZP_02896771.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0389] >gi|177651561|ref|ZP_02934350.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0174] >gi|190568085|ref|ZP_03020995.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis Tsiankovskii-I] >gi|196035278|ref|ZP_03102683.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus W] >gi|196046555|ref|ZP_03113780.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus 03BB108] >gi|30255307|gb|AAP25316.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. Ames] >gi|47501793|gb|AAT30469.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178214|gb|AAT53590.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. Sterne] >gi|49328752|gb|AAT59398.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|72414680|emb|CAG28950.1| ribonucleoside-diphosphate reductase class Ib beta chain [Bacillus anthracis] >gi|118416147|gb|ABK84566.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Bacillus thuringiensis str. Al Hakam] >gi|157955314|gb|ABW06029.1| NrdF [Bacillus thuringiensis serovar finitimus] >gi|164713856|gb|EDR19378.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0488] >gi|167512777|gb|EDR88151.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0193] >gi|167530225|gb|EDR92951.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0442] >gi|170128844|gb|EDS97710.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0389] >gi|170669305|gb|EDT20048.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0465] >gi|172082839|gb|EDT67902.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis str. A0174] >gi|190560819|gb|EDV14794.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus anthracis Tsiankovskii-I] >gi|195991955|gb|EDX55918.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus W] >gi|196022739|gb|EDX61421.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus 03BB108] (322 aa)
Score = 443, Expect = 5.4e-42, Identities = 111/314 (35%), Positives = 166/314 (52%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV     L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDEIFDWVDTHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEDQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLSDDDFVF 320
>gi|42780545|ref|NP_977792.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus ATCC 10987] >gi|42736465|gb|AAS40400.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus cereus ATCC 10987] (322 aa)
Score = 442, Expect = 6.1e-42, Identities = 111/314 (35%), Positives = 167/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   +WV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFEWVDNHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEDQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLSDDDFVF 320
>gi|157955332|gb|ABW06043.1| NrdF [Bacillus thuringiensis serovar galleriae] >gi|157955344|gb|ABW06052.1| NrdF [Bacillus thuringiensis serovar tolworthi] (322 aa)
Score = 442, Expect = 6.2e-42, Identities = 111/314 (35%), Positives = 168/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   DWV N   L+K+A ++  Y+           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFDWVDNHPLLEKKAGIITSYHRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSVEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|157955340|gb|ABW06049.1| NrdF [Bacillus thuringiensis serovar thuringiensis] >gi|157955368|gb|ABW06070.1| NrdF [Bacillus thuringiensis serovar galechiae] >gi|157955384|gb|ABW06082.1| NrdF [Bacillus thuringiensis serovar sotto] (322 aa)
Score = 440, Expect = 1.3e-41, Identities = 110/314 (35%), Positives = 167/314 (53%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   +WV     L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+  A+L  E+Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWAQLSKEEQVAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFEWVDTHPLLEKKAGIITGYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEEQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|56964873|ref|YP_176604.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus clausii KSM-K16] >gi|56911116|dbj|BAD65643.1| ribonucleoside-diphosphate reductase beta chain [Bacillus clausii KSM-K16] (334 aa)
Score = 436, Expect = 3.4e-41, Identities = 111/312 (35%), Positives = 169/312 (54%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI----GDDP--LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           + NW+   DD     +N+  + FWLPE++A++ DL +W  L    ++  ++   GLTLLD+ Q   G +  V   +  H++    NF  M+   VHA+SY +IF T  +S++IN   +WV     LQK+A  ++  Y     GDD    K+ VA+  +  FL Y GFY P Y   +  L  + +II LILRD+ IH  Y G   Q+   K  P+ Q E+ +F  +LL ++   E  +  +LY    ++    KF  YNA K L NLG+D  F  E+ +I P +   L+ +  ++HDFFS  G+ Y    VE   D+D+ F
  S:     7 AANWSKHEDDFTQMFYNQNVKQFWLPEEVALNGDLLTWKYLTPAEKDTYMKVLAGLTLLDTEQGNTG-MPLVAEHVQGHQRKAVLNFMAMMENAVHAKSYSNIFMTLATSEEINDLFEWVKVNPRLQKKANTIVSIYKDIKRGDDISLFKALVASVYLESFLFYSGFYYPLYFYGQGKLMQSGEIINLILRDEAIHGVYIGLLAQEIYNKQSPDTQKELHQFAIELLDELYKNELLYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFDPYF--EDEDINPIVLNGLNTKT-KSHDFFSMKGNGYKKATVEPLRDEDFFF 322
>gi|163939261|ref|YP_001644145.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus weihenstephanensis KBAB4] >gi|163861458|gb|ABY42517.1| Ribonucleoside-diphosphate reductase [Bacillus weihenstephanensis KBAB4] (322 aa)
Score = 435, Expect = 5.0e-41, Identities = 109/314 (34%), Positives = 166/314 (52%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   +WV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+RD+ IH  + G   Q+   +L  E+Q E++    +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWAQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFEWVDNHPLLEKKAGIVTSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIRDESIHGVFVGILAQQIFTELSAEEQQEVQTETQELLMELYEIELAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLADDDFVF 320
>gi|157310978|ref|YP_001468974.1| putative ribonucleotide reductase [Corynebacterium phage P1201] >gi|95832126|gb|ABF57526.1| putative ribonucleotide reductase [Corynebacterium phage P1201] (237 aa)
Score = 429, Expect = 2.1e-40, Identities = 92/223 (41%), Positives = 133/223 (59%)
  Q:   115 AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKV---------AAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
            FM  VHA+SY S+FST   S+ I+ A  WV N ++ Q +  V    Y   D    +V         ++ ++  FL Y GFYLP +  ++  L NT D+IRLI+RD+ +H YY GYK+QK +    P ++  +K+ V +L  ++   E   + E+Y    ++ Q   F  YN  K +QNLG ++ F  E T ++P I  QLS  ++E HDFFSGSGSSY++G  EET DDDW
  S:     5 GFMEEVHAKSYSSVFSTLFGSEDIDGAFAWVENNKATQVKKLVFDEAYDISDYNDRRVEYYGAIIRASSVLLESFLFYTGFYLPLHFASQGKLTNTADLIRLIMRDEGVHGYYLGYKFQKVMEGALPYERDAVKERVTNLACRLFVNEIPLIEEIYEPLGLSAQVQTFLRYNLNKAMQNLGLENVFPAEMTRVEPRILSQLSVDSEETHDFFSGSGSSYVIGQAEETTDDDW 236
>gi|126650012|ref|ZP_01722245.1| ribonucleotide-diphosphate [Bacillus sp. B14905] >gi|126593184|gb|EAZ87146.1| ribonucleotide-diphosphate [Bacillus sp. B14905] (322 aa)
Score = 410, Expect = 3.4e-38, Identities = 103/312 (33%), Positives = 167/312 (53%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIG--DVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY----IGDDP--LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +VNWN    +     W++  +  W PE+IA+S D+  W   +   Q+   + F GLTLLD++Q  IG   VA   + L   E+ + T F     +HA+SY  IF+T C++++I+   +WV   E LQ +A  +   Y     GD     K+  ++ M+  FL Y GF+ P YLG +  L N+ +II LILRD+ IH    G+  Q    +   EKQ  ++ + ++LL  +   E ++  ++YA   ++ +   +  YNA K L N+G+++ F PEE E+ P +   +       +DFFS  G++Y    V    DD ++F
  S:     8 AVNWNKATSELAQIFWDQQWKQIWFPEEIAVSKDIKQWKSFEH--QDTYKKVFAGLTLLDTVQTNIGMNRVAAYTDDL--QEKAVLTVFDAFEAIHAKSYSYIFTTLCTNEEIDELFEWVKKNEYLQYKANKIADIYNSIEEGDSESLWKAMFSSVMLESFLFYSGFFYPLYLGGQGFLRNSAEIISLILRDESIHGVAVGFFAQNLYKQFSKEKQESLQLWGYELLLDLYQNEMKYTEDIYAETGLSPEVKAYVRYNANKALMNVGFEAMF-PEE-EVNPIVMNGIRNEG-STYDFFSQKGATYAKAKVAPITDDTFNF 320
>gi|126700615|ref|YP_001089512.1| ribonucleoside-diphosphate reductase beta chain [Clostridium difficile 630] >gi|168714123|ref|ZP_02746400.1| ribonucleoside-diphosphate reductase beta chain [Clostridium difficile QCD-63q42] >gi|196126122|ref|ZP_03117871.1| ribonucleoside-diphosphate reductase beta chain [Clostridium difficile ATCC 43255] >gi|115252052|emb|CAJ69888.1| ribonucleoside-diphosphate reductase beta chain [Clostridium difficile 630] (323 aa)
Score = 404, Expect = 1.5e-37, Identities = 95/310 (30%), Positives = 164/310 (52%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLK----SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           +VNWN   D      W +  + FWLPE+I++S D+  WN+L +  +EL  +   GLTLLD+ Q   G  + +  +     + + +    M  +HA+SY SIF T  S+ +I+   +W+    +LQ++A +++  Y      +    S V +  +  FL Y GF+ P YL  +  +  + +II LILRD+ +H  Y G   Q+         +  +++ ++ +LY +++ E E+ N +Y    +  + + F  YNA + L+NLG++  +T +   I P +   LS    + HDFFS  G+ Y  G  EE +D+D+
  S:    11 AVNWNREEDGFTQAFWEQNVKQFWLPEEISVSKDIKVWNELSNKEKELYKKVLGGLTLLDTKQGNNGIPSMMSLTENLQRKAVLSFMGTMEEIHAKSYSSIFMTLLSNLEIDELFEWIETEPTLQRKADLVLAQYENTTNQEGLYLSMVTSVFLESFLFYSGFFYPLYLSGQGKMVASGEIISLILRDESLHGKYIGLLAQEIYDSFDKMDKEMLEEKMYSILYSLMENEIEYTNVIYRESGLEKEVVNFLKYNANRALENLGFEKLYTVD--AINPIVLNGLSTET-KTHDFFSTKGNGYQKGVYEELEDEDF 321
>gi|404605|gb|AAD10549.1| uncertain [Mycoplasma genitalium] (107 aa)
Score = 399, Expect = 6.8e-37, Identities = 75/97 (77%), Positives = 86/97 (88%)
  Q:   243 FDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           F+L+Y++I+LEK++L ELY GF I D AIKFSVYNAGKFLQNLGYDSPFT  ET IKPEIF QLSARADENHDFFSG+GSSY+MG  EET+DDDW+F
  S:    11 FELMYRLIELEKDYLKELYEGFGIVDDAIKFSVYNAGKFLQNLGYDSPFTAAETRIKPEIFAQLSARADENHDFFSGNGSSYVMGVSEETNDDDWNF 107
>gi|75758223|ref|ZP_00738348.1| Ribonucleoside-diphosphate reductase beta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74494277|gb|EAO57368.1| Ribonucleoside-diphosphate reductase beta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] (342 aa)
Score = 394, Expect = 2.5e-36, Identities = 109/315 (34%), Positives = 172/315 (54%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-----IGDDPLK---SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA--GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           K ++VNW   N +    ++N++ Q FWL  +I +S D   W+ L  + +E+  +   GLTLLD+ Q   G +  V   + D ++    NF A M  +HA+SY  IF T C ++++++  DWV     LQK+A ++  +Y        DP +   + VA+  +  FL Y GF+ P +L  +  L  + +II LILRD+ IH    G   Q+    +L   +Q E+ K    LL  +   E ++ N++YA  G ++ ++  KF  YNA K + NLGYD  F  E   + P +   L  +  + HDFFS  G+ Y+   NVEE  D+D+ F
  S:    11 KHKAVNWTKYNTEYIESIYNQMRQQFWLENEIPVSKDKNVWDMLPKDQKEVYKKVLGGLTLLDTKQGGEG-MPLVSLHMEDPQKKAIINFMAMMEDIHAKSYSHIFMTLCENEEVDAVFDWVEENPFLQKKADIITGHYRKLLKPDVDPKELYMAIVASVFLESFLFYSGFFYPLFLAGQGQLTASGEIIALILRDEAIHGVTGGIFAQEIYENQLTEAEQQEVDKEAIQLLEMLYANELDYTNDVYAPLGKDMIEEVNKFLRYNANKAMMNLGYDQYFDDE--YVNPIVQNGLQTKTKQ-HDFFSVKGNGYVKAINVEEVRDEDFVF 334
>gi|27467432|ref|NP_764069.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus epidermidis ATCC 12228] >gi|57866341|ref|YP_187991.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus epidermidis RP62A] >gi|27314975|gb|AAO04111.1|AE016745_210 ribonucleoside-diphosphate reductase minor subunit [Staphylococcus epidermidis ATCC 12228] >gi|57636999|gb|AAW53787.1| ribonucleoside-diphosphate reductase 2, beta subunit [Staphylococcus epidermidis RP62A] (322 aa)
Score = 348, Expect = 4.9e-31, Identities = 95/314 (30%), Positives = 159/314 (50%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHD-WVVNCESLQKRAQVLIPYYIG--------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           M++VNWN   D  ++  W +     W+  +  +S D+ SW  L  + +    +   GLT LD+ QA  G    + ++    ++ +Y+  A M  +HA+SY  IF+T   S + N   D WV+    L+ ++  ++  Y           D   ++V++  +  FL Y GFY P YL  +  +  + +IIR IL D+ IH  ++G   Q    +L   ++ +  + ++ LL ++ D E  + + LY    +A+  + +  YN  K L NLG++  F  EE E  P I   L   + +NHDFFS  G  Y +  NVE   D+D+ F
  S:     1 MKAVNWNTQEDMTNM-FWRQNISQMWVETEFKVSKDIASWKTLTDSEKNTFKKALAGLTGLDTHQADDGMPLIMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDTWVIEEPHLKYKSDKIVENYHKLWGKEASIYDQYIARVSSVFLETFLFYSGFYYPLYLAGQGKMTTSGEIIRKILLDESIHGVFTGLDAQSLRNELSESEKQKADQEMYKLLNELYDNEVSYTHLLYDDIGLAEDVLNYVRYNGNKALSNLGFEPYF--EEREFNPIIENALDT-STKNHDFFSVKGDGYTLALNVEPLRDEDFVF 320
>gi|73663294|ref|YP_302075.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495809|dbj|BAE19130.1| ribonucleoside-diphosphate reductase minor subunit [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (322 aa)
Score = 348, Expect = 5.1e-31, Identities = 97/314 (30%), Positives = 156/314 (49%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHD-WVVNCESLQKRAQVLIPYYIG--------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           M++VNWN   D  ++  W +     W+  +  +S D+ SW  L    +E   +   GLT LD+ QA  G    + ++    ++ +Y+  A M  +HA+SY  IF+T   S + N   D WV+    L+ ++  +I  Y           D   ++V++  +  FL Y GFY P YL  +  +  + +IIR IL D+ IH  ++G   Q    +L   ++ +  + ++ LL  +   E  + + LY    +A+  + +  YN  K L NLG+D  F  EE E  P I   L     +NHDFFS  G  Y +  NVE   D+D+ F
  S:     1 MKAVNWNTQEDMTNM-FWRQNISQMWVETEFKVSKDIASWKTLTDPEKEAFKKALAGLTGLDTHQADDGMPLIMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDKWVIEEPHLKYKSDKIINNYHKLWGKEASIYDQYIARVSSVFLETFLFYSGFYYPLYLAGQGKMTTSGEIIRKILLDESIHGVFTGMDAQSLRNELSESEKLQADQEMYKLLDDLYKNEVAYTHSLYDDIGLAEDVLNYVRYNGNKALSNLGFDPYF--EEREFNPIIENALDT-TTKNHDFFSVKGDGYTLALNVEALKDEDFVF 320
>gi|57014145|gb|AAT68710.2| ribonucleoside reductase beta subunit [Borrelia hermsii] (321 aa)
Score = 347, Expect = 7.1e-31, Identities = 102/316 (32%), Positives = 170/316 (53%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIG--DVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGD--DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDW 337
           +K    ++NWN +N+      W++  + FW+ E+I IS+D   WN LD   +++  +   GLTLLD+ Q ++G   +A   ++L D++ V+    A M  +HA+SY SIFS+  + D+I+    WV    + Q +  +++  Y  I D     K+   +  +  FL Y GF+ P YL  +  + N+ +II LILRD+ +H  + G   Q++  K+  ++QA  ++    +L ++  LE  +  +LY+   +      F  YNA K L NLG+DS F   + ++ P +   L     + HDFFS  G+ YI    VE   DDD+
  S:     1 MKQNREAINWNRLNNSYTKMFWDQNIRQFWVDEEIPISDDKLVWNTLDGEERDVYEKVLGGLTLLDTEQGSVGMPRIALAIDNL-DYKPVLGFMGA-MEHMHAKSYSSIFSSLSNIDRIDHIFGWVKTYRNFQDKLDLILGKYNSIHDRMSLYKALCTSVFLETFLFYSGFFYPLYLAGQGKMVNSGEIINLILRDESVHGVFVGLLAQEEFNKMTFKEQAFAQREATLILERLYYLESAYTKDLYSSIGLEGAVDVFVRYNADKALMNLGFDSAFNIRDIDVNPLVLNGLRTNT-KTHDFFSTKGNGYIKPMKVEPLQDDDF 320
>gi|70727160|ref|YP_254076.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus haemolyticus JCSC1435] >gi|68447886|dbj|BAE05470.1| ribonucleoside-diphosphate reductase minor subunit [Staphylococcus haemolyticus JCSC1435] (322 aa)
Score = 346, Expect = 1.0e-30, Identities = 96/314 (30%), Positives = 156/314 (49%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHD-WVVNCESLQKRAQVLIPYYIG--------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           M++VNWN   D  ++  W +     W+  +  +S D+ SW  L  + +    R   GLT LD+ QA  G    + ++    ++ +Y+  A M  +HA+SY  IF+T   S + N   D WV+    L+ ++  +I  Y           D   ++V++  +  FL Y GFY P YL  +  +  + +IIR IL D+ IH  ++G   Q    +L   ++ +  K ++ LL  +   E  + + LY    +++  + +  YN  K L NLG++  F  EE E  P I   L     +NHDFFS  G  Y +  NVE   D+D+ F
  S:     1 MKAVNWNTQEDMTNM-FWRQNISQMWVETEFKVSKDIASWKTLTEDEKNTFKRALAGLTGLDTHQADDGMPLIMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDTWVIEEPHLKYKSDKIIENYHKLWGKEASIYDQYIARVSSVFLETFLFYSGFYYPLYLAGQGKMTTSGEIIRKILLDESIHGVFTGLDAQSLRNELSENEKQKADKEMYKLLEDLYANEVSYTHMLYDDIGLSEDVLNYVQYNGNKALSNLGFEPYF--EEKEFNPIIENALDT-TTKNHDFFSVKGDGYTLALNVEALQDEDFIF 320
>gi|85726187|gb|ABC79616.1| ribonucleotide reductase beta subunit [Borrelia hermsii DAH] (321 aa)
Score = 345, Expect = 1.2e-30, Identities = 102/316 (32%), Positives = 170/316 (53%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIG--DVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGD--DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDW 337
           +K    ++NWN +N+      W++  + FW+ E+I IS+D   WN LD   +++  +   GLTLLD+ Q ++G   +A   ++L D++ V+    A M  +HA+SY SIFS+  + D+I+    WV    + Q +  +++  Y  I D     K+   +  +  FL Y GF+ P YL  +  + N+ +II LILRD+ +H  + G   Q++  K+  ++QA  ++    +L ++  LE  +  +LY+   +      F  YNA K L NLG+DS F   + ++ P +   L     + HDFFS  G+ YI    VE   DDD+
  S:     1 MKQNREAINWNRLNNSYTKMFWDQNIRQFWVDEEIPISDDKLVWNTLDGEERDVYEKVLGGLTLLDTEQGSVGMPRLALAIDNL-DYKPVLGFMGA-MEHMHAKSYSSIFSSLSNIDRIDHIFGWVKTYRNFQDKLDLILGKYNSIHDRMSLYKALCTSVFLETFLFYSGFFYPLYLAGQGKMVNSGEIINLILRDESVHGVFVGLLAQEEFNKMTFKEQAFAQREATLILERLYYLESAYTKDLYSSIGLEGAVDVFVRYNADKALMNLGFDSAFNIRDIDVNPLVLNGLRTNT-KTHDFFSTKGNGYIKPMRVEPLQDDDF 320
>gi|15923722|ref|NP_371256.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus Mu50] >gi|15926409|ref|NP_373942.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus N315] >gi|21282423|ref|NP_645511.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus MW2] >gi|49482989|ref|YP_040213.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485604|ref|YP_042825.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651569|ref|YP_185668.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus COL] >gi|82750436|ref|YP_416177.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus RF122] >gi|87162072|ref|YP_493420.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus USA300] >gi|88194508|ref|YP_499303.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267192|ref|YP_001246135.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus JH9] >gi|150393241|ref|YP_001315916.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus JH1] >gi|151220913|ref|YP_001331735.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979060|ref|YP_001441319.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus Mu3] >gi|161508997|ref|YP_001574656.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|4490610|emb|CAB38643.1| ribonucleotide reductase minor subunit [Staphylococcus aureus] >gi|13700623|dbj|BAB41920.1| ribonucleoside-diphosphate reductase minor subunit [Staphylococcus aureus subsp. aureus N315] >gi|14246501|dbj|BAB56894.1| ribonucleoside-diphosphate reductase minor subunit [Staphylococcus aureus subsp. aureus Mu50] >gi|14329710|emb|CAC40668.1| ribonucleotide-diphosphate reductase beta chain [Staphylococcus aureus] >gi|21203860|dbj|BAB94559.1| ribonucleoside-diphosphate reductase minor subunit [Staphylococcus aureus subsp. aureus MW2] >gi|49241118|emb|CAG39796.1| ribonucleoside-diphosphate reductase beta chain [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244047|emb|CAG42473.1| ribonucleoside-diphosphate reductase beta chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285755|gb|AAW37849.1| ribonucleoside-diphosphate reductase 2, beta subunit [Staphylococcus aureus subsp. aureus COL] >gi|82655967|emb|CAI80371.1| ribonucelotide diphosphate reductase beta chain [Staphylococcus aureus RF122] >gi|87128046|gb|ABD22560.1| ribonucleoside-diphosphate reductase, beta subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202066|gb|ABD29876.1| ribonucleotide-disphosphate reductase beta chain, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740261|gb|ABQ48559.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149945693|gb|ABR51629.1| Ribonucleoside-diphosphate reductase [Staphylococcus aureus subsp. aureus JH1] >gi|150373713|dbj|BAF66973.1| ribonucleotide-diphosphate reductase beta chain [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721195|dbj|BAF77612.1| ribonucleoside-diphosphate reductase minor subunit [Staphylococcus aureus subsp. aureus Mu3] >gi|160367806|gb|ABX28777.1| ribonucleoside-diphosphate reductase subunit beta [Staphylococcus aureus subsp. aureus USA300_TCH1516] (323 aa)
Score = 342, Expect = 3.1e-30, Identities = 95/314 (30%), Positives = 154/314 (49%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHD-WVVNCESLQKRAQVLIPYYIG--------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           M +VNWN   D  ++  W +     W+  +  +S D+ SW  L    Q+   +   GLT LD+ QA  G    + ++    ++ +Y+  A M  +HA+SY  IF+T   S + N   D WV+    L+ ++  ++  Y           D   ++V +  +  FL + GFY P YL  +  +  + +IIR IL D+ IH  ++G   Q    +L   ++ +  + ++ LL  +   E+ +   LY    I +  + +  YN  K L NLG++  F  EE E  P I   L     +NHDFFS  G  Y++  NVE   DDD+ F
  S:     1 MIAVNWNTQEDMTNM-FWRQNISQMWVETEFKVSKDIASWKTLSEAEQDTFKKALAGLTGLDTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFTTLLPSSETNYLLDEWVLEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETFLFFSGFYYPLYLAGQGKMTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKADQEMYKLLNDLYLNEESYTKMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYF--EEREFNPIIENALDT-TTKNHDFFSVKGDGYVLALNVEALQDDDFVF 320
>gi|94985875|ref|YP_605239.1| ribonucleotide-diphosphate reductase subunit beta [Deinococcus geothermalis DSM 11300] >gi|94556156|gb|ABF46070.1| Ribonucleoside-diphosphate reductase [Deinococcus geothermalis DSM 11300] (319 aa)
Score = 341, Expect = 3.6e-30, Identities = 84/295 (28%), Positives = 137/295 (46%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGS 322
           + NW+ + D      + +     W  E+I I++D   W  L    +    R   GL  +D++Q  +G +  +     DH+ +     FAFM  VHARSY     TF S+ +   A +W+     LQ++  V    Y   D L   +A+ ++   L Y GF+ P YL  +  + +  ++  LI  D+ +H  Y G  +Q++ A LP  +QA ++     L  +  + E  + +E+YA   +A +   F  YN      NLG +  F PEE E+ P +   + A     HDFFS  G+
  S:     5 ATNWSEVGDGFTQAFYIQQQAQLWFSEEIPIASDAADWRALSPAERTCYTRVSAGLNAMDTLQGEVG-MPLLAAGEDDHQRKATLAMFAFMENVHARSYSMANKTFLSASEEREAFEWIEMQPHLQRKITVFRRLYEEGDALTRMLASCLLETALFYSGFFYPLYLAGQGKMSHMGEVFTLICADEALHGSYVGLLFQERFAALPQGEQAAVRARFEQLAREFYENECAYTDEVYAEVGLASEVKTFVRYNFNICCDNLGLERLF-PEE-EVNPLVLNGIRATGGTTHDFFSIKGA 297
>gi|86156146|gb|ABC86791.1| ribonucleotide reductase beta subunit [Borrelia turicatae] (321 aa)
Score = 340, Expect = 4.8e-30, Identities = 99/310 (31%), Positives = 167/310 (53%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIG--DVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGD--DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDW 337
           ++NWN +N+      W++  + FW+ E+I IS+D   WN LD + +++  +   GLTLLD+ Q ++G   +A   ++L    + +      M  +HA+SY SIFS+  + ++I+   DWV    + Q +  +++  Y  I D     K+   +  +  FL Y GF+ P YL  +  + N+ +II LILRD+ +H  + G   Q++  K+   +Q    K    +L ++ DLEK +  +LY+   +      F  YNA K L NLG++  F  ++ ++ P +   L  R D + HDFFS  G+ YI    +E   DDD+
  S:     7 AINWNRLNNGYTKMFWDQNIRQFWVDEEIPISDDKLVWNSLDIDERDVYEKVLGGLTLLDTEQGSVGMPRIALAIDNLA--YKPVLGFMGAMEHMHAKSYSSIFSSLSNIERIDYIFDWVKTYRNFQDKLDLILGKYNNIHDRMSLYKALCTSVFLETFLFYSGFFYPLYLAGQGKMINSGEIINLILRDESVHGVFVGLLAQEEFNKMTSREQEFAYKEAMFILDRLYDLEKAYTKDLYSSIGLESAVDVFVRYNADKALMNLGFEPTFNIQDIDVNPLVLNGL--RTDTKTHDFFSTKGNGYIKPMKIEPLQDDDF 320
>gi|66391280|ref|YP_238601.1| ORF025 [Staphylococcus phage Twort] >gi|62637210|gb|AAX92321.1| ORF025 [Staphylococcus phage Twort] (349 aa)
Score = 338, Expect = 8.7e-30, Identities = 99/324 (30%), Positives = 156/324 (48%)
  Q:    16 EYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +Y KD +K  + +VNWN   D+     W   T +FWLPE   IS D+ SWNKL    ++   +   GLT LD+ Q+  G      +        +YT F F   +HA+SY  IF+T   + + N   ++WV     L+K+AQ +  +Y           D   +KVA+A +   L Y GFY P  L  + ++  +   I  I +D+  H    GY  Q    +L  E+Q++    +++LL  + + E  + + LY    + +  I++  YN  + L NLG+D  F PE     P +  Q +     N DFFS         N ++  D+D+ F
  S:     9 KYYKDKIK-NLEAVNWNE-EDEMANNFWELATTSFWLPEDFDISRDVSSWNKLTDIEKDTYKKVLAGLTGLDTKQSVEGMSLIAHHEPRTRFAQVYTAFDFYESIHAKSYSHIFTTLLLNKETNYLLNEWVEQEPHLKKKAQYIGYFYEKLEQPNPSTFDRYMAKVASAFLESALFYSGFYYPLLLSGQGVMVQSGTTIYKITQDEAYHGVGVGYTAQLDYQELTEEEQSKADALMYELLEVLYENEVSYSHMLYDKLGLTEDVIRYVQYNFNRALANLGFDDYFNPE--PFNPIVNNQTNVDKLSNADFFSTKNDYKRSMNTKDLKDEDFKF 337
>gi|162448128|ref|YP_001621260.1| ribonucleoside-diphosphate reductase, beta chain [Acholeplasma laidlawii PG-8A] >gi|161986235|gb|ABX81884.1| ribonucleoside-diphosphate reductase, beta chain [Acholeplasma laidlawii PG-8A] (369 aa)
Score = 330, Expect = 5.9e-29, Identities = 101/315 (32%), Positives = 152/315 (48%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDH--EQVIYTNF--AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI------------GDDP-----------LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           K    NWN   DD     + +    FW PE +++  DL  W+ L  N Q+   +    LT LD+ Q  IG +  V  SL DH  ++    NF  A    VHA+SY +IF T+ S+ +I+    W     +LQ    +++ YY              +DP            K+ VA+  +  +L Y GFY P +   +  L    +II LILRD+ IH  Y G   Q+       E Q ++ ++V D L ++   + E +  +Y    ++     F  YNA K L NLG+D  F PE  ++ P +   L+    +  D FS  G+ Y     E   D D+ F
  S:    20 KYEGANWNEPEDDYTQHFYEQNLSQFWRPEDVSLQPDLNVWSVLPENIQDAYAKNLLVLTFLDTHQGDIG-MPVVSRSLDDHFHQRKAVLNFMGAMENAVHAKSYSNIFMTYMSNQKIDELFHWGEKHTNLQNIMSLIVGYYKELDRYNYLKQFESNDPGYSETDFNIAQFKAMVASVYLETWLFYSGFYYPLFFYGQGKLMQAGEIINLILRDESIHGLYVGRLAQEVFETFSNELQEQLTQWVHDFLLELYHEQNELVESIYDAVELSHDVKIFVRYNANKALMNLGFDPYFEPE--DVNPVVLNGLNTET-KTMDNFSMKGNGYQKMKSEMLKDSDFVF 357
>gi|57867410|ref|YP_189075.1| ribonucleotide-diphosphate reductase subunit beta [Staphylococcus epidermidis RP62A] >gi|57638068|gb|AAW54856.1| ribonucleoside-diphosphate reductase 2, beta subunit [Staphylococcus epidermidis RP62A] (340 aa)
Score = 329, Expect = 8.9e-29, Identities = 97/315 (30%), Positives = 155/315 (49%)
  Q:    25 KMRSVNWNFINDDKD----LEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYY---IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           K R+ NW     DKD    L  W +  +  W  E+   S DL  W  L ++ QE  V+  +GLT LD+ Q T G      +   +  + ++   + M  +H +SY  IF++     D      +WV   + L K+ +++   Y   +  +P   ++  AM     +  FL + GFY P YL  +  + ++ +IIR I+ D+ IH   +GY  Q    K   E+Q +++K + +L  Q+   E E+   LY    + +  I++  YN  + L NLG+++ F PE     P   V+   R D  NHDFFS  G  Y +  N     D D+DF
  S:     6 KARATNW-----DKDNSIALTYWKQNVKQMWTEEEFKPSKDLSVWKTLSADEQETYVKALSGLTGLDTTQGTEGMPLLAFHYPEEIWRGVFAFMSMMENIHHKSYSHIFTSLLERKDTHYYLKEWVPANKYLNKKTKLITTNYYKLLKPNPTDREIYVAMASSIFLESFLFFSGFYYPLYLAGQGKMVHSGEIIRKIILDETIHGSGTGYAAQVIFDKFSKEEQEDIRKELMELFDQLYFNEVEYAASLYDKLGLTEDVIRYIQYNGNRALMNLGWETVFNPE--PFNP--IVENGLRTDTTNHDFFSVKGDGYTLALNQVPLRDKDFDF 326
>gi|10957415|ref|NP_051641.1| ribonucleotide-diphosphate reductase subunit beta [Deinococcus radiodurans R1] >gi|6460844|gb|AAF12548.1|AE001826_17 ribonucleoside-diphosphate reductase, beta chain [Deinococcus radiodurans R1] (354 aa)
Score = 320, Expect = 1.0e-27, Identities = 87/309 (28%), Positives = 141/309 (45%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDD 336
           + NW+   D+     + + T   W PE+I ++ND  +W  L    +   +    GL  LD++Q  +G + ++++ +  H +     F   M  +HARSY  +  TF ++ +     +WV     LQ +  V+   Y   D       K  V + M+   L Y GF+ P YL  +  + +  +I  LI+ D+ +H  Y     Q+K A +   +QA+ + +  D L  +   E  +  +LYA   +  +  KF  +N      NL    PF  E  +I P +   + AR    HDFFS  GSSY    VE   D D
  S:    29 AANWSEPEDNFSATFYAKYTSQLWFPEEIPLTNDALAWKTLSDEERWTYIHASAGLNALDTLQGEVG-MPRLRDLVDGHIRKATLQFQGMMEDIHARSYSLMNKTFLTASEEREVFEWVRTQPQLQHKIAVIQGVYRDPDVSDLGVWKKLVVSCMLETALFYSGFFYPLYLAGQGQMVSAGEIFNLIILDEALHGVYVALLAQEKFATMNAAEQADAQAWFDDTLQALYSNELAYTEQLYANVGLTGEVKKFIRFNFNVLADNLALPRPFGDE--DINPIVQNGIQARG-TTHDFFSAKGSSYSKMTVEPLTDAD 339
>gi|85057306|ref|YP_456222.1| ribonucleotide-diphosphate reductase subunit beta [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789411|gb|ABC65143.1| ribonucleoside-diphosphate reductase beta chain [Aster yellows witches'-broom phytoplasma AYWB] (350 aa)
Score = 319, Expect = 1.4e-27, Identities = 99/317 (31%), Positives = 154/317 (48%)
  Q:    23 KGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFM----VGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY---------------------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKL--PPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           K   +  NWN + D      + +    FW PE I++  DL +W++L    +    R    LT LD+ Q  +G +  +  SL +HE        FM      VHA+SY +IF ++ ++ +IN    W    +SLQ   QV++  Y                           K+   +  +  +L Y GFY P Y   +  L  + +II LI+RD+ IH  Y G +   ++ +L   P KQ  +K ++ DL+ Q+   +   +N +Y   N+ D   KF  YNA K L NLG+D+ F  E   + P I   L+    +  D FS  G+ Y     E   D+D+ F
  S:    13 KIHFQGANWNVLEDKYTHFFYEQNLSQFWRPEDISLQGDLAAWSELTIEEKTAYSRNLLVLTFLDTYQGDLG-MPIIARSLEEHEHQKKATLNFMGAMENAVHAKSYSNIFMSYLTNKEINQLFLWGNQQKSLQTMMQVIVKVYEALEDQIYLKKQTSLQFIELEFKKTQWKAMAVSVFLETWLFYSGFYYPLYFYGQGKLMQSGEIINLIIRDESIHGVYVG-RLATELYQLFDKPTKQT-LKTWLDDLMQQLYQTKTSLVNAIYHKLNLEDDVNKFVRYNANKALMNLGFDAFFPSE--NVNPVIINGLNTET-KTMDNFSMKGNGYQKMRSEALQDEDFYF 350
>gi|48696469|ref|YP_024511.1| putative ribonucleotide reductase minor subunit [Staphylococcus phage K] >gi|37729163|gb|AAO47530.1| ORF81 [Staphylococcus phage K] >gi|119658118|gb|ABL87153.1| putative ribonucleotide reductase minor subunit [Staphylococcus phage 812] (349 aa)
Score = 313, Expect = 6.6e-27, Identities = 96/314 (30%), Positives = 150/314 (47%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-----QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHD-WVVNCESLQKRAQVLIPYYIGDDPLK----------SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           +++ NWN  +D      W +    FW PE+  +S DL SWN L  + +    +   GLT LD+ Q   G      N ++ HE     Q ++     M  +HA+SY  IF+T  S+ + +   D WV   + L+ +AQ +  YY  D  LK          +KVA+A +   L Y GFY P  L  +  +  +  II  I +D+  H    G   Q     L  E++ +  K  ++LL  +   E  + + LY    +++  I +  YN  + LQNLG +  F PE     P +  Q +     N DFFSG        N+++  D+D+ F
  S:    16 LKATNWNIEDDGMSDIYWEQGISQFWTPEEFDVSRDLSSWNSLTESEKNTYKKVLAGLTGLDTKQGGEG-----MNLVSYHEPRPKYQAVFAFMGGMEEIHAKSYSHIFTTLLSNKETSYLLDTWVEENDFLKVKAQFIGYYY--DQLLKPNPTIFDRYMAKVASAFLESALFYSGFYYPLLLAGRGQMTQSGAIIYKITQDEAYHGSAVGLTAQYDYNLLTEEEKKQADKETYELLDILYTNEVAYTHSLYDPLELSEDVINYVQYNFNRALQNLGREDYFNPE--PYNPIVENQTNVDRLRNVDFFSGKADYEKSTNIKDIKDEDFSF 336
>gi|39938541|ref|NP_950307.1| ribonucleotide-diphosphate reductase subunit beta [Onion yellows phytoplasma OY-M] >gi|39721650|dbj|BAD04140.1| ribonucleotide reductase beta subunit [Onion yellows phytoplasma OY-M] (350 aa)
Score = 309, Expect = 1.8e-26, Identities = 93/317 (29%), Positives = 146/317 (46%)
  Q:    23 KGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFM----VGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY---------------------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           K   +  NWN + D      + +    FW PE I++  DL +W++L    +    R    LT LD+ Q  +G +  +  SL +HE        FM      VHA+SY +IF ++ ++ +IN    W     SLQ   QV++  Y                           ++   +  +  +L Y GFY   Y   +  L  + +II LI+RD+ IH  Y G    +         Q  +K ++ DL+ Q+   +   ++ +Y   N+ D   KF  YNA K L NLG+D+ F  E   + P I   L+    +  D FS  G+ Y     E   D+D+ F
  S:    13 KSPFQGANWNVLEDKYTHFFYEQNLSQFWRPEDISLQGDLAAWSELTLEEKTAYSRNLLVLTFLDTYQGDLG-MPVIARSLEEHEHQKKATLNFMGAMENAVHAKSYSNIFMSYLTNKEINQLFLWGNQQTSLQTMMQVIVKVYEALEDQIYLKKQSSLQFSELEFKKTQWQAMAVSVFLETWLFYSGFYYSLYFYGQGKLMQSGEIINLIIRDESIHGVYVGRLATEIYQLFDKPTQQTLKTWLDDLMQQLYQAQTSLVHAIYHKLNLEDDVNKFVRYNANKALMNLGFDAFFPSE--NVNPVIINGLNTET-KTMDNFSMKGNGYQKMRSEALQDEDFYF 350
>gi|149277655|ref|ZP_01883795.1| ribonucleotide-diphosphate [Pedobacter sp. BAL39] >gi|149231343|gb|EDM36722.1| ribonucleotide-diphosphate [Pedobacter sp. BAL39] (327 aa)
Score = 309, Expect = 2.0e-26, Identities = 94/300 (31%), Positives = 157/300 (52%)
  Q:    25 KMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP-PEK-QAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADE--NHDFFSGSGSSY 324
           + ++VNWN   +D     W +  + FW+  +   S D+ SW  L    Q++  R   GLTLLD++Q+  G    + +      + + +    M  +HA+SY +IF+T  S+ +IN   DWV N + LQ +A  +  YY   D  K           A+ ++  FL Y GF++P +L  +  +  + DII+ I+ D+ IH  + G   Q    KLP PEK +A+++     LL ++ + E ++ +ELY    +  +  ++  YNA K + NLG++  F     E+KP   + L+    E   HDFFS   ++Y
  S:     3 QYKAVNWNTPENDYAGMFWEQNLRQFWVDTEYIPSKDIDSWKSLSPEIQQVYKRALGGLTLLDTLQSHTGMPKLLDHIDGLQNKAVLSFMCMMEAIHAKSYSTIFTTVNSTPEINELFDWVENNKLLQFKASTIDKYYRALDVPKVSNEVLFMGLAASVLLESFLFYSGFFMPLWLAGQGQMVASADIIKKIVADESIHGVFVGLLAQDVYKKLPNPEKCKAKLEA----LLMELYENELKYTDELYTEVGLTAEVKEYVRYNANKAMMNLGFEELF-----EVKPINAIVLNGLNVETTQHDFFSKKSTNY 305
>gi|42519734|ref|NP_965664.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus johnsonii NCC 533] >gi|41584023|gb|AAS09630.1| hypothetical protein LJ_0591 [Lactobacillus johnsonii NCC 533] (313 aa)
Score = 297, Expect = 4.3e-25, Identities = 73/291 (25%), Positives = 142/291 (48%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQV-IYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFF 317
           ++ NWN + +  D   W R+    + P ++ I  D   +  L  N Q +++ +F  LTL  ++Q  +  ++++K    + E+V +Y    ++  ++ ++Y  + + F  S +   A++W      LQK+ ++L   Y   + ++ K A   +   L +  F+ P YL  ++ LP T ++I+  LR   ++  Y+G K+++   KLP ++Q ++  +V+DL  ++ D E   +  LY   ++ D+   +  Y   K L NLG + P  PE  E    I       +    DFF
  S:     8 KANNWNTVEEQVDRSAWARLNDIVYEPRRVPIYKDQKEFLHLPKNEQTVILHSFGSLTLSSTLQMKVA-LSEIKKDAENSEEVAVYNALQYLESINNKAYSYVLAEFSDSKKQEDAYEWANQNPYLQKKMKLLNTVYQSGNTIQKKAAHVFLSTGLYHSSFFGPLYLFGQHKLPRTAELIKYALRITTLNGIYTGIKFRRDFFKLPKKEQKKVHDWVYDLCDKLYDNELRHIKLLYKHTDLEDKVEHYIHYTLNKALMNLGQE-PKYPENVETLDPILTTGLMESAMIEDFF 297
>gi|58338007|ref|YP_194592.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus acidophilus NCFM] >gi|58255324|gb|AAV43561.1| ribonucleotide reductase [Lactobacillus acidophilus NCFM] (311 aa)
Score = 292, Expect = 1.9e-24, Identities = 72/295 (24%), Positives = 137/295 (46%)
  Q:    23 KGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFF 317
           K    ++NWN + D  D   W R+    W P  + +  D   + +L S  +  ++  F+ L+    +Q   G + Q+K +++T  E  +     ++  +  +SY  +     + +++++A DW  N   LQK+  +L   Y   D L+ K    ++   L + GF+ P YL  +  +  T +II+L LR       Y GYK++    KL   +Q ++K ++ +L  +++  E++ +  LY G    + A+ +  Y+  K   NLG+   +      I P +  Q   ++    DFF
  S:     3 KKYYEAINWNDMEDKVDKSAWARLNDIIWEPRHVPVKEDKKEFLQLPSPVRCTLLHVFSALSFSSGLQMKSG-IEQIKVDAITPEEAAVLNALQYLESIANKSYSYVLRELATPEEVDNAFDWANNSPYLQKKIHILNKIYQRGDALQKKAGNVILETALYHSGFFAPLYLFGQGKMVRTAEIIKLALRGTSFSGIYPGYKFRLGYKKLGKTEQEDLKHWIDNLYDELVKNEEKHIRLLYKGTGWTEDALHYMYYSVNKAYLNLGFPGKYPDTSDTINP-VLEQGVIKSAVFEDFF 296
>gi|145953438|ref|ZP_01802446.1| hypothetical protein CdifQ_04003426 [Clostridium difficile QCD-32g58] (224 aa)
Score = 288, Expect = 5.1e-24, Identities = 64/198 (32%), Positives = 106/198 (53%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLK----SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQK 225
           +VNWN   D      W +  + FWLPE+I++S D+  WN+L +  +EL  +   GLTLLD+ Q   G  + +  +     + + +    M  +HA+SY SIF T  S+ +I+   +W+    +LQ++A +++  Y      +    S V +  +  FL Y GF+ P YL  +  +  + +II LILRD+ +H  Y G   Q+
  S:    11 AVNWNREEDGFTQAFWEQNVKQFWLPEEISVSKDIKVWNELSNKEKELYKKVLGGLTLLDTKQGNNGIPSMMSLTENLQRKAVLSFMGTMEEIHAKSYSSIFMTLLSNLEIDELFEWIETEPTLQRKADLVLAQYENTTNQEGLYLSMVTSVFLESFLFYSGFFYPLYLSGQGKMVASGEIISLILRDESLHGKYIGLLAQE 212
>gi|116630259|ref|YP_815456.1| ribonucleotide-diphosphate reductase subunit beta [Lactobacillus gasseri ATCC 33323] >gi|116095841|gb|ABJ60993.1| ribonucleoside-diphosphate reductase class Ib beta subunit [Lactobacillus gasseri ATCC 33323] (320 aa)
Score = 286, Expect = 8.9e-24, Identities = 69/275 (25%), Positives = 132/275 (48%)
  Q:    23 KGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETE 297
           K   ++ NWN + D  D   W R+    + P ++ I  D   ++ L    Q +++ +F  L L  ++Q  +      +++    E  +Y    ++  ++ ++YG   + F +S +Q + A +W      LQK+ ++L   Y  D+ ++ K A   +   L +  F+ P YL  ++ LP T ++I+  LR   ++  Y+G K+++    L  E+Q  + K+V+DL  ++   E   ++ LY    + D+   +  Y   K L NLG + P  PE  E
  S:    10 KSYYKTSNWNAVEDQVDRSAWARLNDIVYEPRRVPIHEDRDEFSHLPKTEQTMLLHSFGSLALSSTLQMKVSLSKIKQDAENSEEAAVYNALQYLESINNKAYGHALTEFSTSNEQRDEAFNWANQNPYLQKKMRLLNTVYQSDNAIQKKAAHVFISTGLYHSSFFGPLYLFGQHKLPRTAELIKYALRITTLNGIYTGIKFRRDFFNLSKEEQKNIHKWVYDLCDRLYANELNHIHLLYEDTGLEDKVEHYIHYTLNKALMNLGQE-PKYPENVE 284
>gi|166981999|ref|ZP_02253446.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus AH187] >gi|168164377|ref|ZP_02599610.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus H3081.97] (193 aa)
Score = 259, Expect = 1.2e-20, Identities = 62/185 (33%), Positives = 95/185 (51%)
  Q:    26 MRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILR 210
           MR+VNWN   DD  L  W +    FW  E+IA+S+D  +W +L    Q    R   GLTLLD+ Q   G    + +      + +      M  VHA+SY  IF+T  + ++I+   +WV N   L+K+A ++  YY           +   + VA+  +  +L Y GF+ P YL  +  L  + +II LI+R
  S:     1 MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWVQLSKEEQIAYKRVLGGLTLLDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFEWVDNHPLLEKKAGIITSYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGKLTASGEIINLIIR 193
>gi|47830|emb|CAA36920.1| unnamed protein product [Salmonella typhimurium] (101 aa)
Score = 247, Expect = 2.9e-19, Identities = 50/101 (49%), Positives = 62/101 (61%)
  Q:   239 KKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           K F  DLL ++ D E  +   LYA     +    F  YNA K L NLGY++ F PE  ++ P I   LS  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     1 KLFALDLLMELYDNEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF 101
>gi|1196947|gb|AAA88620.1| unknown protein (101 aa)
Score = 244, Expect = 6.3e-19, Identities = 49/101 (48%), Positives = 62/101 (61%)
  Q:   239 KKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           K F  DLL ++ D E  +   LYA     +    F  YNA K L NLGY++ F PE  ++ P I   +S  ADENHDFFSGSGSSY+MG   ET+D+DW+F
  S:     1 KLFALDLLMELYDNEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAAVSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF 101
>gi|66394974|ref|YP_240948.1| ORF025 [Staphylococcus phage G1] >gi|62636996|gb|AAX92107.1| ORF025 [Bacteriophage G1] (265 aa)
Score = 224, Expect = 1.4e-16, Identities = 73/226 (32%), Positives = 112/226 (49%)
  Q:   114 FAFMVG---VHARSYGSIFSTFCSSDQINSAHD-WVVNCESLQKRAQVLIPYYIGDDPLK----------SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           FAFM G   +HA+SY  IF+T  S+ + +   D WV   + L+ +AQ +  YY  D  LK          +KVA+A +   L Y GFY P  L  +  +  +  II  I +D+  H    G   Q     L  E++ +  K  ++LL  +   E  + + LY    +++  I +  YN  + LQNLG +  F PE     P +  Q +     N DFFSG        N+++  D+D+ F
  S:    17 FAFMGGMEEIHAKSYSHIFTTLLSNKETSYLLDTWVEENDFLKVKAQFIGYYY--DQLLKPNPTIFDRYMAKVASAFLESALFYSGFYYPLLLAGRGQMTQSGAIIYKITQDEAYHGSAVGLTAQYDYNLLTEEEKKQADKETYELLDILYTNEVAYTHSLYDPLELSEDVINYVQYNFNRALQNLGREDYFNPE--PYNPIVENQTNVDRLRNVDFFSGKADYEKSTNIKDIKDEDFSF 252
>gi|60416882|emb|CAD71202.1| ribonucleoside-diphosphate reductase small subunit [Bacillus subtilis] (140 aa)
Score = 208, Expect = 9.4e-15, Identities = 47/127 (37%), Positives = 72/127 (56%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKR 154
           + NW+   DD     +N+  + FWLPE+IA++ DL +W  L  N Q+  ++   GLTLLD+ Q   G +  +   +  H++    NF  M+   VHA+SY +IF T   ++QIN   +WV N   LQK+
  S:    12 AANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTG-MPIIAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFLTLAPTEQINEVFEWVKNNRFLQKK 139
>gi|172058301|ref|YP_001814761.1| ribonucleoside-diphosphate reductase [Exiguobacterium sibiricum 255-15] >gi|171990822|gb|ACB61744.1| Ribonucleoside-diphosphate reductase [Exiguobacterium sibiricum 255-15] (347 aa)
Score = 206, Expect = 1.4e-14, Identities = 77/296 (26%), Positives = 140/296 (47%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPP-EKQAEMKKFVFDLLYQVIDLE---KEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI--FVQLSARADENHDFFSGSGSSY 324
           VNWN I   +   ++ ++  NFW+P++I++S D+  WN+L    Q+   R    L++LDS+Q   I + A   +  + H   I    A    VH +SY  + S+     + N   D   + + + KR   ++  Y         ++  KS VA+ ++ G   Y GF   + L     +  T  +I  I RD++ H+Y+     +  + + P  +      KFV+    + +DLE    E++     G ++++    +  Y A K L+ +G D  +   + ++ P I  +   S  A ++ DFF     SY
  S:    30 VNWNDIAYPQFYSIYKQLLSNFWIPDEISMSKDMQQWNQLSEREQDAFKRIIGLLSILDSVQTRYILESAMFTSDASIH--AILAIVAQQEVVHNQSYSYVLSSLVPLSEQNRIFDIAKDDDMVMKRNAFILDLYEDFQNDRTPENFAKSLVASIVLEGINFYSGFAFFYNLARHQKMVGTSTMISYIQRDELQHSYFISQLLRAVLTEHPDIDADGSFTKFVYATFERAVDLEIEWSEYVLRDLDGLDVSEMR-DYVKYLANKRLRVIGLDDLYEGHDEDVMPWIRAYSDDSMNATKS-DFFEQKSRSY 335
>gi|146322251|ref|YP_001174720.1| putative ribonucleotide reductase subunit beta [Lactococcus lactis] >gi|145968742|gb|ABQ00020.1| putative ribonucleotide reductase subunit beta [Lactococcus lactis] (317 aa)
Score = 195, Expect = 2.9e-13, Identities = 71/313 (22%), Positives = 134/313 (42%)
  Q:    27 RSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQV-IYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADE-NHDFFSGSGSSYIMGNVEETDDDDWDF 339
           R++NWN + D+ D  VW R T  FWL  +I I ND  +W KL+   Q  +      LT L + Q+  +G++  V+N     ++V I  N  F+  V+ ++Y  I  TF     +  + +WV N   + +    +   Y     +K +  A  + G L Y      F L       N   ++ +I+R++ +H +Y  +K +  + +  P++    K + ++ +   + L    +++ Y        A    +  A   L  +G    F         E+   ++ R +     + S S +     N E  ++ D++F
  S:     9 RAINWNIVEDEFDNAVWERATSLFWLDTRIPIENDFTNWIKLNLEEQGQLKCLLILLTNLSTNQSIEVGEI--VRNGKCSQQEVAILNNIQFIEMVNTKAYNRILLTFDKEINLEKSFEWVDNDSRVLEYLNDINTVYRESSLIKKRFIALCVEGLLNYAYLSHLFELWINKEFNNLGTMLEMIIRNESLHCFYFSHKVKLLLKESDPKEVERFKAWSYETVNHFVKLGLNIIDDFYYLKESKKIAKNLILQEANNILMGIGLKEQFG-----FNDEVLKGINYRLNNLRRHYLSISSNKSTSTNEEIMEESDYEF 317
>gi|166981998|ref|ZP_02253445.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus AH187] >gi|168163180|ref|ZP_02598413.1| ribonucleotide-diphosphate reductase subunit beta [Bacillus cereus H3081.97] >gi|196040733|ref|ZP_03108032.1| ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) [Bacillus cereus NVH0597-99] >gi|196028523|gb|EDX67131.1| ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) [Bacillus cereus NVH0597-99] (133 aa)
Score = 187, Expect = 2.9e-12, Identities = 49/131 (37%), Positives = 74/131 (56%)
  Q:   209 LRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMG-NVEETDDDDWDF 339
           ++D+ IH  + G   Q+  A+L  E Q E++K   +LL ++ ++E  +  E+Y    + +   +F  YNA K L NLG +  F  EE EI P +   L  R D +NHDFFS  G+ Y+   NVE+  DDD+ F
  S:     3 VKDESIHGVFVGILAQQIFAELSAEDQQEVQKETQELLMELYEIEMAYTEEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKF--EEEEINPIVLNGL--RTDTKNHDFFSVKGNGYVKATNVEKLSDDDFVF 131
>gi|119485472|ref|ZP_01619800.1| hypothetical protein L8106_10031 [Lyngbya sp. PCC 8106] >gi|119457228|gb|EAW38354.1| hypothetical protein L8106_10031 [Lyngbya sp. PCC 8106] (359 aa)
Score = 182, Expect = 9.4e-12, Identities = 75/287 (26%), Positives = 137/287 (47%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG--DDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKF------VFDLLYQVIDLEKEFLNELYAGFNI----ADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKP----EIFVQLSARADENHDFFSGSGSSYIMGN 328
           ++ ++ +NFW+PEK+ I+ D+  +  L ++ +       + LT LDSIQ    ++  +K+S+T  E  +          +H +SY  +  T   SD+ +  +++      L  R + +  +Y    D+P       A++  FLL     Y GF   + L ++ L+P + DI ++I RD++ H       YQ    KL PE    M+ F      ++++    +  E  + N +  G NI         +++ Y A   L+++G    +T       P    E F      A    +FF  S +SY+M +
  S:    57 LYKQMRENFWVPEKLDITQDVVDYGNLTTDERRAFDGILSYLTFLDSIQTC--NIPHLKSSITAPEISLCMAEQVSQEAMHNQSYQYMIETIIPSDRRSFVYEFWRTDSVLHNRCEYIARFYQNYIDNPTSENYFVALLADFLLEGLYFYNGFIYFYNLASRMLMPGSADIFKMINRDELSHVRL----YQ----KLIPEA---MQTFPHSVEQIYEMFDTAVQHECRWTNHI-VGRNILGITETSTEQYTKYLANARLRSIGLKPLYTDPRYSKSPYTHLERFSDTKKEAHTKANFFEASVTSYVMSS 351
>gi|156564205|ref|YP_001429715.1| nrd beta subunit [Bacillus phage 0305phi8-36] >gi|154622902|gb|ABS83782.1| nrd beta subunit [Bacillus phage 0305phi8-36] (352 aa)
Score = 182, Expect = 1.1e-11, Identities = 69/263 (26%), Positives = 123/263 (46%)
  Q:    29 VNWNFINDDKDLEVWNRITQ----NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPF 291
           +NWN    D+D E+W  I+Q    NFW P +I +  D   W+ L    Q+  +R  T L  LDS+Q  +  + +V    T+      + F A     H  SY  I S+       N   +  +    L KR ++++  Y    ++P      +  V +  + G   Y GF   ++L ++  +  +  +I  I RD++ H Y+ G   ++ + + P     E  +++ D L + +  EKE+  E+ A     D  +   +  Y A K ++ LG D+ +
  S:    38 LNWN----DED-EIWYDISQTLEANFWRPVEIKMKEDEKMWDSLTPIEQDTFLRVGTALACLDSLQ--VKAILEVIRFTTNSALANISAFIAQQEATHTTSYSYITSSLVRLPVQNQYFNETMKHPVLAKRNKLVLDVYEDFAENPSLQNLFRMLVQSINLEGIYFYSGFAFFYWLASQQKMMKSSTMISYIQRDEMQHAYFIGLLIRRLLTENPELNTQENAQYIVDSLKEAVATEKEWAGEILADIEGLDLEEFDHYIEYLANKRVRQLGMDNIY 307
>gi|23100542|ref|NP_694009.1| ribonucleotide-diphosphate reductase subunit beta [Oceanobacillus iheyensis HTE831] >gi|22778775|dbj|BAC15043.1| ribonucleoside-diphosphate reductase beta subunit [Oceanobacillus iheyensis HTE831] (347 aa)
Score = 181, Expect = 1.2e-11, Identities = 69/269 (25%), Positives = 128/269 (47%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG--DDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEF----LNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETE 297
           +NWN I      +++ R+  N+W  +++ +S+D+  ++ L    Q+  ++    L+ LD+ Q     +  +  +     Q I    A    VH  SY  + S+  S ++ N A       E L KR + L   Y    D+P     LK+ V  +++ G   Y GF   ++L  +N +  T  +I  I RD++ H  +    ++  + + P    AE   +++D   Q ++LE E+    LN+L  G ++ D    +  Y A K L+ +G +  + P+  E
  S:    32 LNWNDIAYPHWYKMYKRLVGNYWQADEVNMSSDVKQFSTLSKEEQDAYLKIIGLLSTLDAPQTRTALLISLY-ATDPSVQSIMAVIAQQEAVHNESYSYVLSSVVSWNEQNEAFQLGRTDELLLKRNEQLTEQYNAFVDNPSMENMLKTLVYTSLLEGMFFYSGFAFFYHLARQNKMVGTSTMISYINRDELEHGRFITELFRATLEENPSHNNAEFIDWIYDRFQQSVELEIEWSHYVLNKL-EGIDMDDMD-GYIKYRANKMLRMMGLEELY-PQHVE 307
>gi|163761839|ref|ZP_02168905.1| Ribonucleoside-diphosphate reductase [Bacillus selenitireducens MLS10] >gi|160357466|gb|EDP84113.1| Ribonucleoside-diphosphate reductase [Bacillus selenitireducens MLS10] (347 aa)
Score = 181, Expect = 1.2e-11, Identities = 76/310 (24%), Positives = 135/310 (43%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENH-DFFSGSGSSYIMGNVEETDDDDWD 338
           +NWN I      +++  +  NFW  ++I + +D+  W +L    Q++ +R  T L  LDS+Q     ++QV + +TD   + I+   A    VH  SY  + S+  +  +             +Q+R  V++  Y      P      +  V +  + G   Y GF   ++L  +  +  T  +I  I RD++ H Y+     +  +   P     E  ++V+D +     LE+E+   + A  +  D  +   +  Y   K L+ LG  + F PE     P I V      ++   DFF     SY     + T D+ +D
  S:    32 LNWNDIAYPHMYDLYQTLLANFWKAQEINMQDDIKQWAELTPAEQDVFLRINTQLASLDSLQTPT--MSQVMDYVTDPSFKAIFAIVAQQEAVHNESYSYVLSSLVNQQEQTRRFQEAKEDPLIQRRNDVILSAYERFRQHPSPQHLFELAVQSLNLEGVYFYAGFAFFYHLARQQKMMKTSTMISYIQRDEMQHAYFMSQFVRILLTDHPELNTRENVQYVYDAMASAAGLEQEWAAVILADIDGIDLGEFNGYVEYLVNKRLRQLGLSNLF-PERDNPMPWIHVFSDTMMNQTKSDFFEQKSRSY----TKVTSDNGFD 345
>gi|60416874|emb|CAD71197.1| ribonucleoside-diphosphate reductase small subunit [Bacillus subtilis] (123 aa)
Score = 179, Expect = 2.4e-11, Identities = 41/112 (36%), Positives = 64/112 (57%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV--GVHARSYGSIFSTFCSSDQIN 139
           + NW+   DD     +N+  + FWLPE+IA++ DL +W  L  N Q+  ++   GLTLLD+ Q   G +  V   +  H++    NF  M+   VHA+SY +IF T   +++IN
  S:     7 AANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTG-MPIVAEHVEGHQRKAVLNFMAMMENAVHAKSYSNIFLTLAPTEKIN 119
>gi|157325080|ref|YP_001468505.1| gp54 [Listeria phage A511] >gi|66732769|gb|AAY53360.1| gp57 [Listeria bacteriophage P100] >gi|66733088|gb|AAY52906.1| gp125 [Listeria phage A511] (343 aa)
Score = 178, Expect = 2.9e-11, Identities = 75/327 (22%), Positives = 137/327 (41%)
  Q:     9 NKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           NKS + I     G+      VNWN I        +  +T N+WLP+++ + +D   +N L    +         L  LDS Q   I ++A+  +  + H   I    A    +H  SY  + ++  +  + N   +      ++ KR   ++  Y         ++ +K+ V ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  V + P  +  E+  +V+      ++LE+ + +E+  G    D  + + +  Y A K L  LG    +          I        +   DFF    SSY   N++   DD
  S:    14 NKSTAIINGEASGI------VNWNDIRYPSFYRAYKELTTNYWLPDEVDMKSDAKQYNHLSEEEKYAFDSIIGLLATLDSPQTRFIYNIAEYVSDASVH--AITAIIAQQEAIHNESYSYVLASITNLQEQNRVFEEARTHPTIIKRNAPIMKSYDDFMNNKTPENMVKALVQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISELIRAIVGENPELQTDELNDYVYASFRHAVELEQAWSSEVLQGIEGIDVEEMLDYVKYRANKMLGMLGLQPMYQGHTENSMTWIKAYADNFTETKTDFFEMRNSSYKKTNLDNGFDD 342
>gi|56419447|ref|YP_146765.1| ribonucleoside-diphosphate reductase beta subunit [Geobacillus kaustophilus HTA426] >gi|56379289|dbj|BAD75197.1| ribonucleoside-diphosphate reductase beta subunit [Geobacillus kaustophilus HTA426] (346 aa)
Score = 176, Expect = 4.7e-11, Identities = 76/307 (24%), Positives = 132/307 (42%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMGNVEETDDD 335
           +NW+ I        + R+  NFW P +I ++ D+  + +L    Q+  ++    L LLDSIQ       +V + +TD     +    A    +H  SY  + S+     + +   D+  N  +L+KR   +   Y    ++P     L+S V   ++ G   Y GF   + L  +  +  T  +I  I RD+ IH       +++ + + P  +  E+  FV +   +  +LE E+  E+      G ++AD       Y A      LG+D PF    T   P  +++     D    DFF      Y    V+   D+
  S:    31 LNWDDIAYPWAYAKYKRMLANFWTPFEINMAQDVKQFPQLTDREQDAFLKIIGLLALLDSIQTDYA--GRVADYITDPSINALMIMLAQQEVIHNHSYSYVLSSLVPKAKQDEVFDFWRNEPTLRKRNDFVTNGYKAFAEEPNVENLLRSIVFDVILEGLFFYSGFAFFYNLARQQKMVATSTMINYINRDEHIHVDLFAKIFKEVLNEYPEYRTPELADFVRNTFMKAAELEIEWAREIIGNDIDGIDLADLEAYIKFY-ANVRAHQLGFDRPFDGYRT--NPLRWIKAYEEVDLGKSDFFEQKPRQYTKVQVDNGFDE 345
>gi|71276518|ref|ZP_00652793.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Dixon] >gi|71900741|ref|ZP_00682863.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] >gi|170729741|ref|YP_001775174.1| ribonucleoside-diphosphate reductase [Xylella fastidiosa M12] >gi|71162695|gb|EAO12422.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Dixon] >gi|71729511|gb|EAO31620.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] >gi|167964534|gb|ACA11544.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa M12] (349 aa)
Score = 175, Expect = 6.1e-11, Identities = 72/307 (23%), Positives = 130/307 (42%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVA---------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           +NWN I        +  ++ NFW+P+++ +  D   + +L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y  DD ++ K A         ++++ G   Y GF   + L  +N +  T  II  I RD++ H  +     +  V + P  +   +  +V       I+LE ++  E+  G +  D  + I++  Y A K    LG ++ +T     + P I        +   DFF    +SY   NV+   DD
  S:    34 LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKIDKRQYGELSAREKNAYDAIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITDLANQNRVFEIARTHPTILKRNAPIMQAY--DDFMREKTAETLLYSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHTKFISEVIRAIVGENPELQTDALTDYVHQAFAHAIELETQWTGEVLNGIDGIDVEEMIRYVKYRANKMAGMLGIETLYTETTDNVMPWIRAYADNFTETKTDFFEMRNASYKKTNVDNCFDD 348
>gi|126654703|ref|ZP_01726237.1| hypothetical protein CY0110_09717 [Cyanothece sp. CCY0110] >gi|126623438|gb|EAZ94142.1| hypothetical protein CY0110_09717 [Cyanothece sp. CCY0110] (352 aa)
Score = 173, Expect = 9.5e-11, Identities = 73/287 (25%), Positives = 136/287 (47%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG--DDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFV---FDLLYQVIDLEKEFLNELYAGFNI----ADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKP-----EIFVQLSARADENHDFFSGSGSSYIMGN 328
           ++ ++ +NFW+P+++ ++ D+  +  L  + +       + LT LDS+Q    ++  +K+S+T  E  +         G+H +SY  +  T    ++    +++      L+ R + +   Y    DDP       A+M  FLL     Y GF   + L ++ L+P + DI ++I RD++ H       YQ    KL PE +      V   +++    ++ E  + N +  G NI         K++ Y A   L+++G + P  PE    K      E F      A    +FF  + +SY+M +
  S:    50 LYQQMRENFWIPQRLDVTQDVTDYANLTDDERYAYDGILSYLTFLDSVQTC--NIPHLKSSITAPEISLCMAEQISQEGMHNQSYQYLIETIIPPERRTQVYEFWRTDTVLKDRCEFIAKLYQKYIDDPTSENYFIALMADFLLEGLYFYNGFIYFYNLASRMLMPGSADIFKMINRDELSHVRL----YQ----KLIPEARKVFPHSVEQIYEMFDMAVNYECRWTNHI-VGNNILGITESSTEKYTKYLANIRLRSIGLE-PLYPEPKYNKSPYTHLERFSDTKKEAHTKANFFEATVTSYVMSS 344
>gi|15837799|ref|NP_298487.1| ribonucleotide-diphosphate reductase subunit beta [Xylella fastidiosa 9a5c] >gi|28198393|ref|NP_778707.1| ribonucleotide-diphosphate reductase subunit beta [Xylella fastidiosa Temecula1] >gi|9106169|gb|AAF84007.1|AE003954_4 ribonucleoside-diphosphate reductase beta chain [Xylella fastidiosa 9a5c] >gi|28056463|gb|AAO28356.1| ribonucleoside-diphosphate reductase beta chain [Xylella fastidiosa Temecula1] (346 aa)
Score = 173, Expect = 1.1e-10, Identities = 72/307 (23%), Positives = 129/307 (42%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVA---------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           +NWN I        +  ++ NFW+P+++ +  D   + +L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y  DD ++ K A         ++++ G   Y GF   + L  +N +  T  II  I RD++ H  +     +  V + P  +   +  +V       I+LE ++  E+  G +  D  + I++  Y A K    LG  + +T     + P I        +   DFF    +SY   NV+   DD
  S:    31 LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKIDKRQYGELSAREKNAYDAIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITDLANQNRVFEIARTHPTILKRNAPIMQAY--DDFMREKTAETLLYSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHTKFISEVIRAIVGENPELQTDALTDYVHQAFAHAIELETQWTGEVLDGIDGIDVEEMIRYVKYRANKMAGMLGIQTLYTETTDNVMPWIRAYADNFTETKTDFFEMRNASYKKTNVDNCFDD 345
>gi|71901120|ref|ZP_00683227.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] >gi|182681036|ref|YP_001829196.1| ribonucleoside-diphosphate reductase [Xylella fastidiosa M23] >gi|71729125|gb|EAO31249.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa Ann-1] >gi|182631146|gb|ACB91922.1| Ribonucleoside-diphosphate reductase [Xylella fastidiosa M23] (349 aa)
Score = 173, Expect = 1.1e-10, Identities = 72/307 (23%), Positives = 129/307 (42%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVA---------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           +NWN I        +  ++ NFW+P+++ +  D   + +L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y  DD ++ K A         ++++ G   Y GF   + L  +N +  T  II  I RD++ H  +     +  V + P  +   +  +V       I+LE ++  E+  G +  D  + I++  Y A K    LG  + +T     + P I        +   DFF    +SY   NV+   DD
  S:    34 LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKIDKRQYGELSAREKNAYDAIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITDLANQNRVFEIARTHPTILKRNAPIMQAY--DDFMREKTAETLLYSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHTKFISEVIRAIVGENPELQTDALTDYVHQAFAHAIELETQWTGEVLDGIDGIDVEEMIRYVKYRANKMAGMLGIQTLYTETTDNVMPWIRAYADNFTETKTDFFEMRNASYKKTNVDNCFDD 348
>gi|16801322|ref|NP_471590.1| ribonucleotide-diphosphate reductase subunit beta [Listeria innocua Clip11262] >gi|16414770|emb|CAC97486.1| lin2258 [Listeria innocua] (349 aa)
Score = 171, Expect = 1.7e-10, Identities = 70/329 (21%), Positives = 137/329 (41%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           + N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  D     ++LE E+  E+  G    D  + + +  Y A K L  LG    +          I        +   DFF    SSY   N++   DD
  S:    18 FPNRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMAAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHDAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYADNFTETKTDFFEMRNSSYKKTNMDNGFDD 348
>gi|16332312|ref|NP_443040.1| hypothetical protein slr0591 [Synechocystis sp. PCC 6803] >gi|1653942|dbj|BAA18852.1| slr0591 [Synechocystis sp. PCC 6803] (355 aa)
Score = 170, Expect = 2.2e-10, Identities = 71/287 (24%), Positives = 140/287 (48%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG--DDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKF------VFDLLYQVIDLEKEFLNELYAGFNI----ADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKP----EIFVQLSARADENHDFFSGSGSSYIMGN 328
           ++ ++ +NFW+P+++ I+ D+  +  L +  +       + LT LDS+Q    ++  +K+S+T  E  +         G+H +SY  +  T   +++ +  +++      L++R + +   Y    D P +     A+M  +LL     Y GF   + L ++ L+P + DI ++I RD++ H       YQ    KL PE    M+ F      ++++  + ++ E  + N +  G NI         +++ Y A   L+ +G D  +T       P    E F      A    +FF  + +SY+M +
  S:    53 LYQQMRENFWIPQRLDITQDVTDYWNLTNEERYAFDGILSYLTFLDSVQTC--NIPHLKSSVTAPEISLCMAEQISQEGMHNQSYQYMIETIIPTEKRDKVYEFWRTDRVLKERCEYIAMLYQKYVDHPTQENYFIALMADYLLEGLYFYNGFIYFYNLASRMLMPGSADIFKMINRDELSHVRL----YQ----KLIPEA---MQVFTHSTDQIYEMFDKAVEFECRWTNHI-VGNNILGITESSTEQYTKYLANSRLRAIGLDPLYTDARYGKSPYTHLERFSDTKKEAHTKANFFEATVTSYVMSS 347
>gi|46908387|ref|YP_014776.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes str. 4b F2365] >gi|47091823|ref|ZP_00229618.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|153168048|ref|ZP_01928079.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes FSL N1-017] >gi|153203255|ref|ZP_01944578.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes HPB2262] >gi|46881658|gb|AAT04953.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes str. 4b F2365] >gi|47019834|gb|EAL10572.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|133726474|gb|EBA28172.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes FSL N1-017] >gi|133734750|gb|EBA36448.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes HPB2262] (349 aa)
Score = 170, Expect = 2.2e-10, Identities = 70/327 (21%), Positives = 136/327 (41%)
  Q:     9 NKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  D     ++LE E+  E+  G    D  + + +  Y A K L  LG    +          I        +   DFF    SSY   N++   DD
  S:    20 NRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHDAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYADNFTETKTDFFEMRNSSYKKTNMDNGFDD 348
>gi|124521170|ref|ZP_01696163.1| ribonucleotide reductase [Bacillus coagulans 36D1] >gi|124497006|gb|EAY44578.1| ribonucleotide reductase [Bacillus coagulans 36D1] (347 aa)
Score = 170, Expect = 2.4e-10, Identities = 79/296 (26%), Positives = 133/296 (44%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG-------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLE---KEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADE----NHDFFSGSGSSY 324
           +NWN +      + + R+  N+W  +++ +S D+  +  L    QE  ++  + L  LDS Q     +A +    TD   Q I    A    VH  SY  I S+  S D+ N A +       L KR + L+  Y         +D +K+ V + ++ G   Y GF   + L  +N +  T  +I  I RD++ H  +     +  +++ P         +V+    + +DLE    E++ +   G ++ + A  F  Y A K L+ +G  S   PE  E  P  +++  A AD       DFF     SY
  S:    32 LNWNDLAYPHWYKTYKRLLGNYWQSDEVNMSTDVKQFPLLSEKEQETFLKIISLLATLDSSQTRTILLASL--YATDPSIQSILAVIAQQEAVHNESYSYILSSVVSLDKQNEAFEIGRKDPVLLKRNKKLMEQYNAFAQQPDVEDIVKTLVYSTLLEGLFFYSGFAFFYNLARQNKMVGTSTMISYINRDELEHGRFISELIRAVLSEHPELNTPAFSDWVYARFRESVDLETEWSEYVLQDVEGIDLEEMA-GFIKYRANKMLRMIGL-SELYPEHVE-NPMKWIR--AYADNFDATKTDFFEQKSRSY 335
>gi|160947324|ref|ZP_02094491.1| hypothetical protein PEPMIC_01258 [Peptostreptococcus micros ATCC 33270] >gi|158446458|gb|EDP23453.1| hypothetical protein PEPMIC_01258 [Peptostreptococcus micros ATCC 33270] (349 aa)
Score = 170, Expect = 2.4e-10, Identities = 98/334 (29%), Positives = 158/334 (47%)
  Q:     3 NKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDL------EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQ-INSAHDWVVNCESLQKRAQVLIPYY----IGDDP---LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKL--------PPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNI--ADQAIKF------SVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENH---DFFSGSGSSYIMGNVEETDDDD 336
           NKK  +N++   IE +K     KM + N   +ND  ++      E +     NFW+PE+I +  DL  +  LD   +    +  + L  LDSIQ    ++  +   +T +E  +  T  A+   +H++SYG +  + CS ++  N  + W  + E L  R + +   Y    +  DP   +K+ VA  ++ G   Y GF   + LG    +P ++  IR I RD+  H +     ++K + +L          EK A  K  +   + Q I   K  L E   G  I   +  IK+      +  N GK     GYD          +PE    +S  +D N    DFF    S+Y   +V + D DD
  S:     4 NKKALFNEN-GDIELSKR----KMINGNTTNLNDFNNVKYTWTTEWYRNAMNNFWIPEEINLFQDLKDYKILDEYEKTAFDKVLSFLIFLDSIQT--ANLPYIGEYITANEINLCLTIQAYQEAIHSQSYGYMLDSICSPEERTNILYQWRDD-EHLLARNKFIGDLYNEFQVNKDPYSLVKTMVANYILEGVYFYSGFMFFYNLGRNGKMPGSVQEIRYINRDENTHLWL----FKKMLLELQNEEPELFTEEKVAVYKDMIKTGVEQEIAWGKYVLGENIPGLTIQMVEDYIKYLGNLRSTALNFGKLYD--GYDE---------EPESMKWVSEYSDPNAIKTDFFEAKPSAYSKSSVIDDDLDD 348
>gi|138894466|ref|YP_001124919.1| ribonucleoside-diphosphate reductase beta subunit [Geobacillus thermodenitrificans NG80-2] >gi|196247935|ref|ZP_03146637.1| Ribonucleoside-diphosphate reductase [Geobacillus sp. G11MC16] >gi|134265979|gb|ABO66174.1| Ribonucleoside-diphosphate reductase beta subunit [Geobacillus thermodenitrificans NG80-2] >gi|196212719|gb|EDY07476.1| Ribonucleoside-diphosphate reductase [Geobacillus sp. G11MC16] (344 aa)
Score = 170, Expect = 2.7e-10, Identities = 74/307 (24%), Positives = 130/307 (42%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG-------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMGNVEETDDD 335
           +NW+ I        + R+  NFW P +I ++ D+  + +L +  Q+  ++    L LLDSIQ       +V + +TD     +    A    +H  SY  + S+     + +   D+  N  +L+KR   +   Y         ++ L+S V   ++ G   Y GF   + L  +  +  T  +I  I RD+ IH       +++ + + P  +  E+  F      +  +LE E+  E+      G ++AD       Y A      LG+D PF    T   P  +++     D    DFF      Y    V+   D+
  S:    29 LNWDDIAYPWAYAKYKRMLANFWTPFEINMAQDVKQFPQLTAREQDAFLKIIGLLALLDSIQTDYA--GRVADYITDPSINALMIMLAQQEVIHNHSYSYVLSSLVPKAKQDEVFDFWRNEPTLRKRNDFVTNGYKAFAEKPNVENLLRSIVFDVILEGLFFYSGFAFFYNLARQQKMVATSTMINYINRDEHIHVDLFAKIFKEVLNEYPEYRTPELADFARSTFMKAAELEIEWAGEIIGNDIDGIDLADLEAYIKFY-ANVRAHQLGFDRPFDGYRT--NPLRWIKAYEEVDLGKSDFFEQKPRQYTKVQVDNGFDE 343
>gi|58580098|ref|YP_199114.1| ribonucleotide-diphosphate reductase subunit beta [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84622097|ref|YP_449469.1| ribonucleotide-diphosphate reductase subunit beta [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58424692|gb|AAW73729.1| ribonucleoside-diphosphate reductase beta chain [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84366037|dbj|BAE67195.1| ribonucleoside-diphosphate reductase beta chain [Xanthomonas oryzae pv. oryzae MAFF 311018] (347 aa)
Score = 170, Expect = 2.7e-10, Identities = 73/327 (22%), Positives = 135/327 (41%)
  Q:     9 NKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           N+S S I     G+      +NWN I        +  ++ NFW+P+++ +  D   +N+L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y         +  ++S + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + +    +  E+  +V       IDLE ++  E+  G +    D+ I++  Y A K    LG +  +      + P I        +   DFF    +SY   N +   DD
  S:    18 NRSTSIINGQTSGI------LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTHPTIIKRNAPIMGAYEDFMREKTAETLIRSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHSKFISELIRAIIGENQALQGDELTDYVHKAFEHAIDLETQWTAEVLDGIDGIDVDEMIRYVKYRANKMAGMLGIEKLYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSDNGFDD 346
>gi|15639047|ref|NP_218493.1| ribonucleotide-diphosphate reductase subunit beta [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025287|ref|YP_001933059.1| ribonucleoside-diphosphate reductase, subunit beta [Treponema pallidum subsp. pallidum SS14] >gi|6093976|sp|O83092|RIR2_TREPA Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|3322311|gb|AAC65049.1| ribonucleoside-diphosphate reductase, subunit beta (nrdB) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189017862|gb|ACD70480.1| ribonucleoside-diphosphate reductase, subunit beta [Treponema pallidum subsp. pallidum SS14] (351 aa)
Score = 169, Expect = 3.0e-10, Identities = 71/282 (25%), Positives = 131/282 (46%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFL--------QNLGYDSPFTPEETEIKPEIFVQLSARADEN---HDFFSGSGSSY 324
           + +   NFW+PE+I +S+D+  +  L +  +    +  + L  LDSIQ    ++  +   +T +E  +  T  AF   VH++SY  +  T CS ++ N       + E L  R + +   Y    DD      LK  +A  ++ G   Y GF   + LG  N +P ++  IR I RD+  H +      Q+   + P    A   +   D++ +  + E +     +  + I DQ    + +    ++        +NLG++  +  E   ++PE    +S  ++ N    DFF    ++Y
  S:    50 YRQAMNNFWIPEEINMSSDVQDYRNLSAIEKTAYDKILSFLIFLDSIQT--ANLPNIGQYITANEINLCLTIQAFQEAVHSQSYSYMLDTICSPEERNDILYQWKDDEHLLARNKFIGNLYNEFQDDKSVLALLKVAIANYVLEGIYFYSGFMFFYNLGRNNKMPGSVQEIRYINRDENTHLWLFRSIIQELQKEEPQVFTARNVRLFRDMIREGCEQEIK-----WGDYVIGDQIPGLNRHMVADYIRYLGNLRCENLGFEPLY--EGHRVEPESMSWVSQYSNANLIKTDFFEAKSTAY 341
>gi|15613065|ref|NP_241368.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus halodurans C-125] >gi|14195134|sp|Q9KFH7|RIR2_BACHD Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|10173115|dbj|BAB04221.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus halodurans C-125] (345 aa)
Score = 169, Expect = 3.1e-10, Identities = 80/303 (26%), Positives = 131/303 (43%)
  Q:    22 LKGKMRSV-NWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADEN---HDFFSGSGSSY 324
           L GK  +V NW+ +       ++  +  NFW P +I +S+D   +  L    QE   +    L  LDS+Q       +    LTD     + +  +F   VH +SY  + S+       +   ++  + + L++R + +I  Y    D+P     L+S V   ++ G   Y GF   + L     + +T  +I  I RD+ +H Y     +++ + + P     E K FV   L +  DLEK++   +      G N  D     S + A K    LG + P+     EIK      + A  D N    DFF      Y
  S:    22 LNGKSSNVLNWDDVRFSWAYPLYKNMLANFWTPFEINMSHDAKQFPTLTETEQEAFKKIIGLLAFLDSVQTDYS--MRAAEYLTDSSLAALMSVLSFQEVVHNQSYSYVLSSLVPKATQDEIFEYWKHDDVLKERNEFIIDGYEKFVDNPTPKTFLESIVYDVILEGLNFYSGFAFFYNLARNQKMVSTSTMINYINRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLMKAADLEKDWFRYIIGDKIPGINPEDMETYIS-FIANKRAVQLGMEKPY----PEIKHNPMKWIRAYEDVNSGKSDFFEQKSRQY 333
>gi|67921622|ref|ZP_00515140.1| Ribonucleoside-diphosphate reductase [Crocosphaera watsonii WH 8501] >gi|67856734|gb|EAM51975.1| Ribonucleoside-diphosphate reductase [Crocosphaera watsonii WH 8501] (321 aa)
Score = 169, Expect = 3.2e-10, Identities = 73/287 (25%), Positives = 135/287 (47%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG--DDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFV---FDLLYQVIDLEKEFLNELYAGFNI----ADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKP-----EIFVQLSARADENHDFFSGSGSSYIMGN 328
           ++ ++ +NFW+P+++ I+ D+  +  L  + +       + LT LDS+Q    ++  +K S+T  E  +         G+H +SY  +  T    ++    +++    + L+ R + +   Y    DD        A+M  FLL     Y GF   + L ++ L+P + DI ++I RD++ H       YQ    KL PE +      V   +++    ++ E  + N +  G NI         K++ Y A   L+++G + P  PE    K      E F      A    +FF  + +SY+M +
  S:    19 LYQQMRENFWIPQRLDITQDVTDYGNLTDDERYAYDGILSYLTFLDSVQTC--NIPHLKTSITAPEISLCMAEQISQEGMHNQSYQYLIETIIPPERRTQVYEFWRTDKLLRDRCEFIAKLYQKYIDDATTENYFIALMADFLLEGLYFYNGFIYFYNLASRMLMPGSADIFKMINRDELSHVRL----YQ----KLIPEARKVFPHSVEQIYEMFDMAVNYECRWTNHI-VGNNILGITESSTEKYTKYLANIRLRSIGLE-PLYPEPKYSKSPYTHLERFSDTKKAAHTKANFFEATVTSYVMSS 313
>gi|194366071|ref|YP_002028681.1| Ribonucleoside-diphosphate reductase [Stenotrophomonas maltophilia R551-3] >gi|194348875|gb|ACF51998.1| Ribonucleoside-diphosphate reductase [Stenotrophomonas maltophilia R551-3] (346 aa)
Score = 168, Expect = 4.5e-10, Identities = 67/307 (21%), Positives = 130/307 (42%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           +NWN I        +  ++ NFW+P+++ +  D   + +L++  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y         +  LKS + ++++ G   Y GF   + +  +N +  T  II  I RD++ H  +     +  + + P  +  E+  +V       I+LE ++ +E+  G +    D+ +++  Y A K    LG +  ++     + P I        +   DFF    +SY   N +   DD
  S:    31 LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKLDARQYGELNAREKNAYDSIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITDLSNQNRIFEIARTHPTIIKRNAPIMGAYDDFMREKTAETLLKSLIQSSILEGINFYSGFAYFYNMVRQNRMNGTGKIISFINRDELAHTKFISELIRAIIGENPELQTNELTAYVHQSFEHAIELETQWSSEVLDGIDGIDVDEMVRYVKYRANKMAGMLGIERLYSDTTDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNADNGFDD 345
>gi|167461830|ref|ZP_02326919.1| ribonucleoside-diphosphate reductase beta subunit [Paenibacillus larvae subsp. larvae BRL-230010] (343 aa)
Score = 166, Expect = 6.2e-10, Identities = 63/258 (24%), Positives = 124/258 (48%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQV-IYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEF----LNELYAGFNIADQAIKFSVYNAGKFLQNLG 286
           +NW+ I   +  +++  +  N W+P +I ++ D   + +L +  QE   +    L +LDS+Q     V  V N  TD   V I         +H +SY  + S+  + +      ++    E L +R   +   Y    D+P      ++ VA  ++ G   Y GF   ++L  +  +  T  +I  I RD+  H Y+ G  ++  +   P    +E  ++V+D + Q + LE+++    LN++  G ++ D + ++  + A K L+ +G
  S:    28 LNWDDIRKPEMYKLYKVLIANHWIPSEIPMNKDKLQFEQLTAQEQETYKKIIGLLAVLDSMQTNF--VTDVGNYFTDSSLVAIAAIINQQEVIHNQSYSYVLSSITNYEVQKEVFEYWKKDEILLERNLFIAELYQRFRDEPTPATFFEAVVADMILEGIFFYSGFAFFYHLARQQKMLGTSQMISYIQRDEAQHAYFFGEVFKLLLTDFPELNTSERIQYVYDTIDQAVKLEEKWAHYVLNQI-DGIDLDDFS-RYIRFIANKRLKTMG 293
>gi|47095728|ref|ZP_00233334.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153180175|ref|ZP_01933314.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes F6900] >gi|153185140|ref|ZP_01935767.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes J0161] >gi|153191694|ref|ZP_01938866.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes J2818] >gi|47015871|gb|EAL06798.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|126942354|gb|EBA20095.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes J0161] >gi|127764936|gb|EBA25291.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes J2818] >gi|133732350|gb|EBA34048.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes F6900] (349 aa)
Score = 166, Expect = 6.6e-10, Identities = 69/329 (20%), Positives = 137/329 (41%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           + N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  +     ++LE E+  E+  G    D  + + +  Y A K L  LG    +          I        +   DFF    SSY   N++   DD
  S:    18 FPNRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPTLSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHEAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYADNFTETKTDFFEMRNSSYKKTNMDNGFDD 348
>gi|16804193|ref|NP_465678.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes EGD-e] >gi|116873587|ref|YP_850368.1| ribonucleotide-diphosphate reductase subunit beta [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153175419|ref|ZP_01930777.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes FSL N3-165] >gi|153197097|ref|ZP_01941396.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes 10403S] >gi|16411624|emb|CAD00232.1| lmo2154 [Listeria monocytogenes] >gi|116742465|emb|CAK21589.1| nrdB [Listeria welshimeri serovar 6b str. SLCC5334] >gi|127633552|gb|EBA22964.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes 10403S] >gi|133729338|gb|EBA31036.1| ribonucleoside-diphosphate reductase, beta subunit [Listeria monocytogenes FSL N3-165] (349 aa)
Score = 166, Expect = 6.8e-10, Identities = 69/329 (20%), Positives = 137/329 (41%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           + N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  +     ++LE E+  E+  G    D  + + +  Y A K L  LG    +          I        +   DFF    SSY   N++   DD
  S:    18 FPNRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHEAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYADNFTETKTDFFEMRNSSYKKTNMDNGFDD 348
>gi|21244791|ref|NP_644373.1| ribonucleotide-diphosphate reductase subunit beta [Xanthomonas axonopodis pv. citri str. 306] >gi|21110489|gb|AAM38909.1| ribonucleoside-diphosphate reductase beta chain [Xanthomonas axonopodis pv. citri str. 306] (347 aa)
Score = 166, Expect = 7.5e-10, Identities = 68/307 (22%), Positives = 128/307 (41%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           +NWN I        +  ++ NFW+P+++ +  D   +N+L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y         +  ++S + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + +    +  E+  +V       IDLE ++  E+  G +    D+ I++  Y A K    LG +  +      + P I        +   DFF    +SY   N +   DD
  S:    32 LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTHPTIIKRNAPIMGAYEDFMREKTAETLIRSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHSKFISELIRAIIGENQALQGDELTDYVHKAFEHAIDLETQWTAEVLDGIDGIDVDEMIRYVKYRANKMAGMLGIEKLYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSDNGFDD 346
>gi|78049716|ref|YP_365891.1| ribonucleotide-diphosphate reductase subunit beta [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78038146|emb|CAJ25891.1| ribonucleoside-diphosphate reductase beta chain [Xanthomonas campestris pv. vesicatoria str. 85-10] (347 aa)
Score = 165, Expect = 8.5e-10, Identities = 68/307 (22%), Positives = 127/307 (41%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           +NWN I        +  ++ NFW+P+++ +  D   +N+L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y         +  ++S + ++++ G   Y GF   + L  +N +  T  II  I RD++ H  +     +  + +    +  E+  +V       IDLE ++  E+  G +    D+ I++  Y A K    LG +  +      + P I        +   DFF    +SY   N +   DD
  S:    32 LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTHPTIIKRNAPIMGAYEDFMREKTAETLIRSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHTKFISELIRAIIGENQALQGDELTDYVHKAFEHAIDLETQWTAEVLDGIDGIDVDEMIRYVKYRANKMAGMLGIEKLYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSDNGFDD 346
>gi|166710317|ref|ZP_02241524.1| ribonucleotide-diphosphate reductase subunit beta [Xanthomonas oryzae pv. oryzicola BLS256] (347 aa)
Score = 164, Expect = 1.3e-09, Identities = 72/327 (22%), Positives = 135/327 (41%)
  Q:     9 NKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           N+S S I     G+      +NWN I        +  ++ NFW+P+++ +  D   +N+L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y         +  ++S + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + +    +  E+  +V       I+LE ++  E+  G +    D+ I++  Y A K    LG +  +      + P I        +   DFF    +SY   N +   DD
  S:    18 NRSTSIINGQTSGI------LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTHPTIIKRNAPIMGAYEDFMREKTAETLIRSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHSKFISELIRAIIGENQALQGDELTDYVHKAFEHAINLETQWTAEVLDGIDGIDVDEMIRYVKYRANKMAGMLGIEKLYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSDNGFDD 346
>gi|66770372|ref|YP_245134.1| ribonucleotide-diphosphate reductase subunit beta [Xanthomonas campestris pv. campestris str. 8004] >gi|188993572|ref|YP_001905582.1| Ribonucleoside-diphosphate reductase beta chain [Xanthomonas campestris pv. campestris] >gi|66575704|gb|AAY51114.1| ribonucleoside-diphosphate reductase beta chain [Xanthomonas campestris pv. campestris str. 8004] >gi|167735332|emb|CAP53546.1| Ribonucleoside-diphosphate reductase beta chain [Xanthomonas campestris pv. campestris] (347 aa)
Score = 163, Expect = 1.6e-09, Identities = 74/327 (22%), Positives = 136/327 (41%)
  Q:     9 NKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVA---------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           N+S + I  +  G+      +NWN I        +  ++ NFW+P+++ +  D   +N+L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y  DD ++ K A         ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + +    +  ++  +V       IDLE  +  E+  G +    D+ I++  Y A K    LG +  +      + P I        +   DFF    +SY   N +   DD
  S:    18 NRSTAIINGSTSGI------LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTHPTIIKRNAPIMGAY--DDFMRDKTAETLIRALIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHSKFISELIRAIIGENQALQGDQLTDYVHKAFEHAIDLETVWTAEVLDGIDGIDVDEMIRYVKYRANKMAGMLGIEKLYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSDNGFDD 346
>gi|149182583|ref|ZP_01861054.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp. SG-1] >gi|148849719|gb|EDL63898.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp. SG-1] (345 aa)
Score = 163, Expect = 1.7e-09, Identities = 69/263 (26%), Positives = 118/263 (44%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG-------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIAD--QAIKFSVYNAGKFLQNLGYDSPF 291
           +NW+ +        + R+  NFW P +I +S D+  +  L    Q+  ++    L LLDSIQ       +V + LTD     +    A    VH  SY  + S+  S ++ +   D+     +L+KR   +   Y G       ++ L S V   ++ G   Y GF   + L     +  T  +I  I RD+ +H       Y++ + + P    AE+K F      +  +LE E+  ++      G  ++D    IKF    A K  + +G+ +PF
  S:    30 LNWDDVRFSWAYPKYKRMLGNFWTPFEINMSKDIKQFPNLTEQEQDTFLKVIGLLALLDSIQTDYA--GKVADYLTDSSLNALMIILAQQEVVHNHSYSYVLSSIVSKNKQDEVFDYWRTEPTLRKRNDFITNGYQGFAENPNIENLLHSIVYDVILEGLFFYSGFAFFYNLARNQKMVATSTMINYINRDEQLHVGLFEKIYKEVLHENPEYDTAELKVFGTQAFKRAAELEIEWGEQIIGNKIDGLLMSDLEAYIKFM---ANKRAEQMGFQAPF 301
>gi|167015276|ref|ZP_02277809.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes FSL J1-194] (343 aa)
Score = 162, Expect = 1.9e-09, Identities = 67/318 (21%), Positives = 132/318 (41%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSY 324
           + N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  D     ++LE E+  E+  G    D  + + +  Y A K L  LG    +          I        +   DFF    SSY
  S:    18 FPNRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHDAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYADNFTETKTDFFEMRNSSY 337
>gi|21233407|ref|NP_639324.1| ribonucleotide-diphosphate reductase subunit beta [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|21115247|gb|AAM43206.1| ribonucleoside-diphosphate reductase beta chain [Xanthomonas campestris pv. campestris str. ATCC 33913] (347 aa)
Score = 161, Expect = 2.4e-09, Identities = 70/307 (22%), Positives = 128/307 (41%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQAT-IGDVAQVKNSLTDHEQVIYTNFAFMVG----VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVA---------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           +NWN I        +  ++ NFW+P+++ +  D   +N+L +  +         L  LDS Q   I +VA+       H        A ++G    +H  SY  + ++       N   +      ++ KR   ++  Y  DD ++ K A         ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + +    +  ++  +V       IDLE  +  E+  G +    D+ I++  Y A K    LG +  +      + P I        +   DFF    +SY   N +   DD
  S:    32 LNWNDIPYPSFYRAYKELSTNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYITDPAAHAN------AAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTHPTIIKRNAPIMGAY--DDFMRDKTAETLIRALIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELAHSKFISELIRAIIGENQALQGDQLTDYVHKAFEHAIDLETVWTAEVLDGIDGIDVDEMIRYVKYRANKMAGMLGIEKLYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSDNGFDD 346
>gi|167462363|ref|ZP_02327452.1| ribonucleoside-diphosphate reductase beta subunit [Paenibacillus larvae subsp. larvae BRL-230010] (343 aa)
Score = 161, Expect = 2.4e-09, Identities = 62/263 (23%), Positives = 121/263 (46%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLE----KEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPF 291
           +NW+         ++  + +NFW+P+++ ++ D+  W+ +L  + ++   +    L  LDS+Q       +V + LTD     + +  +F   VH +SY  + S+     + +   ++    E L++R   L   Y    DDP     ++S V   ++ G   Y GF   + +     +  T  +IR I RD+ IH       +++ +A+ P     E  +FV     +  +LE    +  + + + G    D   K+  + A K +  LG + PF
  S:    27 LNWDDCRFPWAYPMYRNMLRNFWIPDEVPMTADIKQWSTELGDHERDTFKKVIGLLAFLDSVQTDYS--GKVADYLTDSSLSALMSVLSFQEVVHNQSYSYVLSSLVPKSEQDEIFEYWKTDEVLRERNDFLAAGYQRFVDDPTPQTFMESVVYDVILEGLFFYSGFAFFYNMARNGKMLGTNTMIRFINRDEEIHVRLFTQIFRELIAENPELDNEETHEFVRQTFRKAAELEIAWSEYIIGDRFDGVTSRDLD-KYVRFMANKRVNELGIERPF 299
>gi|110806205|ref|YP_689725.1| ribonucleotide-diphosphate reductase subunit beta [Shigella flexneri 5 str. 8401] >gi|110615753|gb|ABF04420.1| ribonucleoside-diphosphate reductase 1, beta subunit, B2 [Shigella flexneri 5 str. 8401] (453 aa)
Score = 160, Expect = 3.2e-09, Identities = 87/301 (28%), Positives = 144/301 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           D +  +++ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  + T +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:   107 DQQKYDIFEKLIEKQLSFFWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVET-WAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDAEVDTDD 447
>gi|160915703|ref|ZP_02077911.1| hypothetical protein EUBDOL_01712 [Eubacterium dolichum DSM 3991] >gi|158432179|gb|EDP10468.1| hypothetical protein EUBDOL_01712 [Eubacterium dolichum DSM 3991] (353 aa)
Score = 158, Expect = 5.5e-09, Identities = 46/173 (26%), Positives = 87/173 (50%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQV------LIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           + +   NFW+PE+I ++ D+  + KL    ++   +T + L  LDSIQ    ++  +   +T +E  +  T  AF   VH++SY  +  + CS  + N+  + W  +   L +   +       + +  G+  +K+ +A  ++ G   Y GF   + LG    +P ++  IR I RD+  H
  S:    52 YRQAMNNFWIPEEINLNQDVKDYRKLSKAEKDAYDKTLSFLIFLDSIQT--ANLPNIGEYITANEVNLCLTIQAFQEAVHSQSYSYMLDSICSPQERNAILYQWKDDPHLLARNKFIGDLYNDFMEHRDGEHLIKTLIANYILEGIYFYSGFMFFYNLGRMGKMPGSVQEIRYINRDENTH 230
>gi|158430770|pdb|2RCC|A Chain A, Crystal Structure Of Putative Class I Ribonucleotide Reductase (Np_241368.1) From Bacillus Halodurans At 1.90 A Resolution >gi|158430771|pdb|2RCC|B Chain B, Crystal Structure Of Putative Class I Ribonucleotide Reductase (Np_241368.1) From Bacillus Halodurans At 1.90 A Resolution >gi|158430772|pdb|2RCC|C Chain C, Crystal Structure Of Putative Class I Ribonucleotide Reductase (Np_241368.1) From Bacillus Halodurans At 1.90 A Resolution (346 aa)
Score = 157, Expect = 8.1e-09, Identities = 81/303 (26%), Positives = 127/303 (41%)
  Q:    22 LKGKMRSV-NWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADEN---HDFFSGSGSSY 324
           L GK  +V NW+ +       ++     NFW P +I  S+D   +  L    QE   +    L  LDS+Q      A     LTD     + +  +F   VH +SY  + S+       +   ++  + + L++R + +I  Y    D+P     L+S V   ++ G   Y GF   + L       +T   I  I RD+ +H Y     +++ + + P     E K FV   L +  DLEK++   +      G N  D     S + A K    LG + P+     EIK      + A  D N    DFF      Y
  S:    23 LNGKSSNVLNWDDVRFSWAYPLYKNXLANFWTPFEINXSHDAKQFPTLTETEQEAFKKIIGLLAFLDSVQTDYSXRA--AEYLTDSSLAALXSVLSFQEVVHNQSYSYVLSSLVPKATQDEIFEYWKHDDVLKERNEFIIDGYEKFVDNPTPKTFLESIVYDVILEGLNFYSGFAFFYNLARNQKXVSTSTXINYINRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLXKAADLEKDWFRYIIGDKIPGINPEDXETYIS-FIANKRAVQLGXEKPY----PEIKHNPXKWIRAYEDVNSGKSDFFEQKSRQY 334
>gi|89097912|ref|ZP_01170799.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp. NRRL B-14911] >gi|89087414|gb|EAR66528.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp. NRRL B-14911] (353 aa)
Score = 157, Expect = 8.5e-09, Identities = 72/308 (23%), Positives = 128/308 (41%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG-------DDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEF----LNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARAD-ENHDFFSGSGSSYIMGNVEETDDDD 336
           +NW+ +        + R+  NFW P +I +S D+  +  L    +E  ++    L LLDSIQ       +V + LTD     +    A    +H  SY  + S+    ++ +   ++     +L KR + +   Y         D  LKS +   ++ G   Y GF   ++L     +  T  +I  I RD+ +H       +++ + + P +   E+ +F      +   LE E+    + +  +G  I D       Y A      LG++ PF  E +   P  +++     D    DFF      Y+  N  +   DD
  S:    37 LNWDDVRFQWAFPKYKRMLANFWTPFEINMSQDIKQFPDLSEEEKEAFLKIIGLLALLDSIQTDYA--GKVADYLTDSSLSALMIILAQQEVIHNHSYSYVLSSIVDKNKQDEVFEFWRTEPALIKRNEFVASGYRNFAESPTVDSLLKSIIFDVVLEGLFFYSGFAFFYHLARNQKMVATSTMINYINRDEQLHVDLFVKIFREILDEYPEQNTKELAEFAESTFREAAYLEIEWARSIIGDKISGILIGDVEEYIRFY-ANVRSNQLGFNRPF--EGSRTNPLRWIKAYEEVDLGKSDFFEQKPRQYVKVNTVDNGFDD 352
>gi|167214910|ref|ZP_02285217.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes FSL R2-503] (339 aa)
Score = 156, Expect = 1.1e-08, Identities = 60/280 (21%), Positives = 123/280 (43%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLG 286
           + N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  D     ++LE E+  E+  G    D  + + +  Y A K L  LG
  S:    21 FPNRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHDAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLG 302
>gi|16761204|ref|NP_456821.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29141101|ref|NP_804443.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25285831|pir||AD0791 ribonucleoside-diphosphate reductase (EC 1.17.4.1) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16503503|emb|CAD07510.1| ribonucleoside-diphosphate reductase 1 beta chain [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136727|gb|AAO68292.1| ribonucleoside-diphosphate reductase 1 beta chain [Salmonella enterica subsp. enterica serovar Typhi Ty2] (376 aa)
Score = 156, Expect = 1.1e-08, Identities = 82/287 (28%), Positives = 130/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   I    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   + +      + +   + AE+    K+  +DL  Q    EKE+ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPAI--VFDDIVTNEQIQKRAEGISAYYDELIEMTSYWHLLGEGTHTVNGKTVVVNLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALHLTGTQHMLNLLRSGVDDPEMAEIAEECKQECYDLFVQAAQQEKEWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 370
>gi|153814165|ref|ZP_01966833.1| hypothetical protein RUMTOR_00374 [Ruminococcus torques ATCC 27756] >gi|145848561|gb|EDK25479.1| hypothetical protein RUMTOR_00374 [Ruminococcus torques ATCC 27756] (353 aa)
Score = 155, Expect = 1.5e-08, Identities = 85/323 (26%), Positives = 148/323 (45%)
  Q:     2 DNKKDYYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDL------EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQ-INSAHDWVVNCESLQKRAQVLIPYY----IGDDP---LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQ--------AEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENH---DFFSGSGSSY 324
           D KK   +K +   +   D LK +M   N   +ND  +L      E + +   NFW+PE+I +S D+  +  L    ++   +  + L  LDSIQ    ++  V   +T +E  +  N   F   VH++SY  +  T CS D+ ++  + W  + E L KR   +   Y    +  D    +K  +A  ++ G   + GF   + L     +P +   IR I RD+  H +     ++  + +L  E          +EMK+ + + + Q I+     +     G N       +  Y      ++LGY +P  P   E +PE    +S  ++ N    DFF    ++Y
  S:     5 DIKKPLPHKPLFNPDGDTDVLKRRMIGGNTTNLNDYNNLKYTWASEWYRQAMNNFWIPEEINLSQDIKDYPNLSPAERKAYDKILSFLVFLDSIQT--ANLPCVGEYITANEVNLCLNIQTFQECVHSQSYSYMLDTICSPDERMDILYQWKTD-EHLLKRNTFIGECYNEFQVKKDARTLVKVMMANFVLEGIYFFSGFMFFYNLSRNGKMPGSAQEIRYINRDENTHLWL----FRNIIIELRKEHPELFDDHMVSEMKELLMEAVRQEIEWACYVIGNEVPGLN-EKMITDYIRYLGNLRWKSLGY-APIYP-GCEREPETMKWVSQYSNANMVKTDFFEARSTAY 343
>gi|16765605|ref|NP_461220.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella typhimurium LT2] >gi|62180851|ref|YP_217268.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161613001|ref|YP_001586966.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167546557|ref|ZP_02342121.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167549728|ref|ZP_02343487.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167556113|ref|ZP_02349129.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167992612|ref|ZP_02573709.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168220645|ref|ZP_02645877.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168225338|ref|ZP_02650569.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168237293|ref|ZP_02662351.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168242393|ref|ZP_02667325.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168261709|ref|ZP_02683682.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168466025|ref|ZP_02699895.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168474475|ref|ZP_02703498.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168817991|ref|ZP_02829991.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442577|ref|YP_002041539.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194449379|ref|YP_002046332.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194735273|ref|YP_002115349.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|1172945|sp|P37427|RIR2_SALTY Ribonucleoside-diphosphate reductase 1 subunit beta (Ribonucleotide reductase 1) (B2 protein) (R2 protein) >gi|510349|emb|CAA51453.1| nrdB [Salmonella typhimurium] >gi|16420817|gb|AAL21179.1| ribonucleoside-diphosphate reductase 1, beta subunit [Salmonella typhimurium LT2] >gi|62128484|gb|AAX66187.1| ribonucleoside-diphosphate reductase 1, beta subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161362365|gb|ABX66133.1| hypothetical protein SPAB_00707 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401240|gb|ACF61462.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194407683|gb|ACF67902.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194710775|gb|ACF89996.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195631367|gb|EDX49927.1| ribonucleoside-diphosphate reductase, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] (376 aa)
Score = 154, Expect = 1.6e-08, Identities = 81/287 (28%), Positives = 130/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   + +      + +   + AE+    K+  +DL  Q    EKE+ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPAV--VFDDIVTNEQIQKRAEGISAYYDELIEMTSYWHLLGEGTHTVNGKTVVVNLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALHLTGTQHMLNLLRSGVDDPEMAEIAEECKQECYDLFVQAAQQEKEWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 370
>gi|56412825|ref|YP_149900.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56127082|gb|AAV76588.1| ribonucleoside-diphosphate reductase 1 beta chain [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (376 aa)
Score = 154, Expect = 1.7e-08, Identities = 81/287 (28%), Positives = 130/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   + +      + +   + AE+    K+  +DL  Q    EKE+ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPAV--VFDDIVTNEQIQKRAEGISAYYDELIETTSYWHLLGEGTHTVNGKTVVVNLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALHLTGTQHMLNLLRSGVDDPEMAEIAEECKQECYDLFVQAAQQEKEWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 370
>gi|117624429|ref|YP_853342.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli APEC O1] >gi|115513553|gb|ABJ01628.1| ribonucleotide-diphosphate reductase beta subunit [Escherichia coli APEC O1] (420 aa)
Score = 154, Expect = 1.8e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    92 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDAEVDTDD 414
>gi|161502570|ref|YP_001569682.1| ribonucleotide-diphosphate reductase subunit beta [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160863917|gb|ABX20540.1| hypothetical protein SARI_00614 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (376 aa)
Score = 154, Expect = 1.9e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKL---PPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++   + +     PE      E K+  +DL  Q    EKE+ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPAV--VFDDIVTNEQIQKRAEGISAYYDELIEMTSYWHLLGVGRHTVNGKTITVNLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGVDDPEMADIAEECKQECYDLFVQAAQQEKEWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 370
>gi|15896521|ref|NP_349870.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium acetobutylicum ATCC 824] >gi|15026352|gb|AAK81210.1|AE007823_4 Ribonucleotide reductase beta subunit [Clostridium acetobutylicum ATCC 824] (344 aa)
Score = 154, Expect = 1.9e-08, Identities = 70/276 (25%), Positives = 129/276 (46%)
  Q:    49 NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIK---------FSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADE-NHDFFSGSGSSY 324
           NFW+PE+I +S DL  + KL  N +    +  + L  LDS+Q    ++  + + +T  E  +  T  AF   VH++SY  +  T CS ++ N       + E L  R + +   Y    ++P     LK+ +   ++ G   Y GF   + L     +P +   IR I RD+  H +      ++   + P     E+KK + D++   ++      NE+  G  +    I+         +  Y   + L+ +G++  +  E  +  P ++V + A A+    DFF    ++Y
  S:    51 NFWIPEEINLSQDLKDYGKLTDNERTAYDKILSFLIFLDSVQT--ANLGNINDYITASEVNLCLTIQAFQEAVHSQSYSYMLDTICSPEKRNEILFQWKDDEVLLSRNKFIGDIYNNFVEEPSDENFLKAIMGNYVLEGIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRNIIKELQKEEPDMFTEEIKKELKDMVKTGVE------NEITWGHYVIGDNIQGINKKLIEDYIKYLGNRRLEAIGFEPIY--EGYDENPALWVDIYADANSVKTDFFEAKSTAY 334
>gi|494379|pdb|1MRR|A Chain A, Substitution Of Manganese For Iron In Ribonucleotide Reductase From Escherichia Coli. Spectroscopic And Crystallographic Characterization >gi|494380|pdb|1MRR|B Chain B, Substitution Of Manganese For Iron In Ribonucleotide Reductase From Escherichia Coli. Spectroscopic And Crystallographic Characterization >gi|494553|pdb|1RIB|A Chain A, Structure And Function Of The Escherichia Coli Ribonucleotide Reductase Protein R2 >gi|494554|pdb|1RIB|B Chain B, Structure And Function Of The Escherichia Coli Ribonucleotide Reductase Protein R2 (375 aa)
Score = 153, Expect = 2.3e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFNTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|42543283|pdb|1PIY|A Chain A, Ribonucleotide Reductase R2 Soaked With Ferrous Ion At Neutral Ph >gi|42543284|pdb|1PIY|B Chain B, Ribonucleotide Reductase R2 Soaked With Ferrous Ion At Neutral Ph >gi|42543506|pdb|1R65|A Chain A, Crystal Structure Of Ferrous Soaked Ribonucleotide Reductase R2 Subunit (Wildtype) At Ph 5 From E. Coli >gi|42543507|pdb|1R65|B Chain B, Crystal Structure Of Ferrous Soaked Ribonucleotide Reductase R2 Subunit (Wildtype) At Ph 5 From E. Coli (375 aa)
Score = 153, Expect = 2.4e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFNTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|194427189|ref|ZP_03059740.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B171] >gi|194436109|ref|ZP_03068211.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 101-1] >gi|194414810|gb|EDX31081.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B171] >gi|194424837|gb|EDX40822.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 101-1] (393 aa)
Score = 152, Expect = 2.7e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    65 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDAEVDTDD 387
>gi|15802782|ref|NP_288809.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 EDL933] >gi|15832372|ref|NP_311145.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. Sakai] >gi|16130170|ref|NP_416738.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like protein [Escherichia coli str. K-12 substr. MG1655] >gi|82544520|ref|YP_408467.1| ribonucleotide-diphosphate reductase subunit beta [Shigella boydii Sb227] >gi|82777644|ref|YP_403993.1| ribonucleotide-diphosphate reductase subunit beta [Shigella dysenteriae Sd197] >gi|89109052|ref|AP_002832.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like [Escherichia coli W3110] >gi|157161718|ref|YP_001459036.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli HS] >gi|168709949|ref|ZP_02742226.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4045] >gi|168733578|ref|ZP_02765855.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4115] >gi|168792852|ref|ZP_02817859.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4042] >gi|170081853|ref|YP_001731173.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like protein [Escherichia coli str. K12 substr. DH10B] >gi|187731010|ref|YP_001881065.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella boydii CDC 3083-94] >gi|188495860|ref|ZP_03003130.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 53638] >gi|195935609|ref|ZP_03080991.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli O157:H7 str. EC4024] >gi|57014104|sp|P69924|RIR2_ECOLI Ribonucleoside-diphosphate reductase 1 subunit beta (Ribonucleotide reductase 1) (B2 protein) (R2 protein) >gi|57014105|sp|P69925|RIR2_ECO57 Ribonucleoside-diphosphate reductase 1 subunit beta (Ribonucleotide reductase 1) (B2 protein) (R2 protein) >gi|12516573|gb|AAG57364.1|AE005456_1 ribonucleoside diphosphage reductase 1, beta subunit, B2 [Escherichia coli O157:H7 EDL933] >gi|146967|gb|AAA24224.1| ribonucleoside diphosphate reductase B2 subunit precursor [Escherichia coli] >gi|1788567|gb|AAC75295.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like protein [Escherichia coli str. K-12 substr. MG1655] >gi|1799582|dbj|BAA16054.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like [Escherichia coli W3110] >gi|13362587|dbj|BAB36541.1| ribonucleoside-diphosphate reductase 1 beta subunit [Escherichia coli O157:H7 str. Sakai] >gi|81241792|gb|ABB62502.1| ribonucleoside-diphosphate reductase 1, beta subunit, B2 [Shigella dysenteriae Sd197] >gi|81245931|gb|ABB66639.1| ribonucleoside-diphosphate reductase 1, beta subunit, B2 [Shigella boydii Sb227] >gi|157067398|gb|ABV06653.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli HS] >gi|169889688|gb|ACB03395.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like protein [Escherichia coli str. K12 substr. DH10B] >gi|187428002|gb|ACD07276.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella boydii CDC 3083-94] >gi|188491059|gb|EDU66162.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli 53638] (376 aa)
Score = 152, Expect = 2.7e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 370
>gi|189403970|ref|ZP_02786340.2| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4501] >gi|189368305|gb|EDU86721.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli O157:H7 str. EC4501] (393 aa)
Score = 152, Expect = 2.8e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    65 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 387
>gi|193068232|ref|ZP_03049196.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E110019] >gi|30041924|gb|AAP17650.1| ribonucleoside-diphosphate reductase 1, beta subunit, B2 [Shigella flexneri 2a str. 2457T] >gi|56383622|gb|AAN43832.2| ribonucleoside-diphosphate reductase 1, beta subunit, B2 [Shigella flexneri 2a str. 301] >gi|192958511|gb|EDV88950.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E110019] (389 aa)
Score = 152, Expect = 2.8e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    61 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDAEVDTDD 383
>gi|26248623|ref|NP_754663.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli CFT073] >gi|74312755|ref|YP_311174.1| ribonucleotide-diphosphate reductase subunit beta [Shigella sonnei Ss046] >gi|91211528|ref|YP_541514.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli UTI89] >gi|110642443|ref|YP_670173.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli 536] >gi|157157492|ref|YP_001463584.1| ribonucleotide-diphosphate reductase subunit beta [Escherichia coli E24377A] >gi|161485800|ref|NP_708125.3| ribonucleotide-diphosphate reductase subunit beta [Shigella flexneri 2a str. 301] >gi|161486465|ref|NP_837840.2| ribonucleotide-diphosphate reductase subunit beta [Shigella flexneri 2a str. 2457T] >gi|191166513|ref|ZP_03028343.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B7A] >gi|191170278|ref|ZP_03031832.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli F11] >gi|194433322|ref|ZP_03065602.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella dysenteriae 1012] >gi|26109028|gb|AAN81231.1|AE016763_190 Ribonucleoside-diphosphate reductase 1 beta chain [Escherichia coli CFT073] >gi|73856232|gb|AAZ88939.1| ribonucleoside-diphosphate reductase 1, beta subunit, B2 [Shigella sonnei Ss046] >gi|91073102|gb|ABE07983.1| ribonucleoside-diphosphate reductase 1 beta chain [Escherichia coli UTI89] >gi|110344035|gb|ABG70272.1| ribonucleoside-diphosphate reductase 1 beta chain [Escherichia coli 536] >gi|157079522|gb|ABV19230.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E24377A] >gi|190903473|gb|EDV63192.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli B7A] >gi|190909794|gb|EDV69379.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli F11] >gi|194418416|gb|EDX34505.1| ribonucleoside-diphosphate reductase, beta subunit [Shigella dysenteriae 1012] (376 aa)
Score = 152, Expect = 2.8e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDAEVDTDD 370
>gi|1942079|pdb|1XIK|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain >gi|1942080|pdb|1XIK|B Chain B, Ribonucleoside-Diphosphate Reductase 1 Beta Chain >gi|15825694|pdb|1JPR|A Chain A, Mn Substituted Ribonucleotide Reductase R2 From E. Coli Oxidized By Nitric Oxide >gi|15825695|pdb|1JPR|B Chain B, Mn Substituted Ribonucleotide Reductase R2 From E. Coli Oxidized By Nitric Oxide >gi|15826771|pdb|1JQC|A Chain A, Mn Substituted Ribonucleotide Reductase R2 From E. Coli Oxidized By Hydrogen Peroxide And Hydroxylamine >gi|15826772|pdb|1JQC|B Chain B, Mn Substituted Ribonucleotide Reductase R2 From E. Coli Oxidized By Hydrogen Peroxide And Hydroxylamine >gi|29726528|pdb|1MXR|A Chain A, High Resolution Structure Of Ribonucleotide Reductase R2 From E. Coli In Its Oxidised (Met) Form >gi|29726529|pdb|1MXR|B Chain B, High Resolution Structure Of Ribonucleotide Reductase R2 From E. Coli In Its Oxidised (Met) Form (375 aa)
Score = 152, Expect = 2.9e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|157879968|pdb|1RNR|A Chain A, Autocatalytic Generation Of Dopa In The Engineered Protein R2 F208y From Escherichia Coli Ribonucleotide Reductase And Crystal Structure Of The Dopa-208 Protein >gi|157879969|pdb|1RNR|B Chain B, Autocatalytic Generation Of Dopa In The Engineered Protein R2 F208y From Escherichia Coli Ribonucleotide Reductase And Crystal Structure Of The Dopa-208 Protein (375 aa)
Score = 151, Expect = 3.4e-08, Identities = 83/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRXYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFNTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|167212815|ref|ZP_02283122.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes LO28] >gi|168266490|ref|ZP_02688455.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes FSL J2-071] (336 aa)
Score = 151, Expect = 3.5e-08, Identities = 59/280 (21%), Positives = 123/280 (43%)
  Q:     7 YYNKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLG 286
           + N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  +     ++LE E+  E+  G    D  + + +  Y A K L  LG
  S:    18 FPNRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHEAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLG 299
>gi|42525851|ref|NP_970949.1| ribonucleotide-diphosphate reductase subunit beta [Treponema denticola ATCC 35405] >gi|41815901|gb|AAS10830.1| ribonucleoside-diphosphate reductase, beta subunit [Treponema denticola ATCC 35405] (351 aa)
Score = 151, Expect = 3.9e-08, Identities = 59/193 (30%), Positives = 93/193 (48%)
  Q:    23 KGKMRSVNWNFINDDKDLEV-----WNR-ITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           K KM   N   +ND  +++      W R    NFW+PE+I ++ D+  + KL    +    +  + L  LDSIQ    ++  V   +T +E  +  T  AF   VH++SY  +  T CS ++         + E L +R + +   Y     D      LK  VA  ++ G   Y GF   + LG  N +P ++  IR I RD+  H
  S:    24 KRKMIGGNTTNLNDFNNMKYSWASDWYRQAMNNFWIPEEINMTTDVQDYRKLSIPEKTAYDKILSFLIFLDSIQT--ANLPNVGQYVTANEVNLCLTIQAFQEAVHSQSYSYMLDTICSPEERTEILYQWKDDEHLLRRNKFIGDLYNEFQSDKSALAFLKVCVANYILEGIYFYSGFMFFYNLGRNNKMPGSVQEIRYINRDENTH 228
>gi|1941986|pdb|1PFR|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain >gi|1941987|pdb|1PFR|B Chain B, Ribonucleoside-Diphosphate Reductase 1 Beta Chain (340 aa)
Score = 150, Expect = 4.7e-08, Identities = 70/249 (28%), Positives = 111/249 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVAFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI 332
>gi|34419511|ref|NP_899524.1| aerobic ribonucleoside diphosphate reductase small subunit [Vibrio phage KVP40] >gi|34333192|gb|AAQ64347.1| aerobic ribonucleoside diphosphate reductase small subunit [Bacteriophage KVP40] (374 aa)
Score = 150, Expect = 5.0e-08, Identities = 69/283 (24%), Positives = 141/283 (49%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY------------------------IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVEET 332
           FW PE++ ++ D   ++++  +W+ +  +     +LLDS+Q    ++A +     +  +   T + F   +H+RSY  I     S+   ++  D +V  +S+  RA+ +  +Y                        + +  +K  +   M     +     Y  F   F    + ++     +++LI RD+ +H        + +  YK   ++A++    Q E +K    +  QV+D EKE+ + L++     G N A    ++  Y A   ++++G +SP+ P      P I        VQ++A+  E         SSY++G ++ T
  S:    48 FWRPEEVDLTLDSQEFDRMPEHWKHVFTQNLKYQSLLDSVQGRAPNIAFLPICSDNSLENWITTWDFSETIHSRSYTHIMRNLYSNP--SAVFDEIVLDKSIMARAEAVTEHYDKLIAETQKLNQLKTMNLDEAHILMQESAVKEALYLCMHAVNALEAIRFYVSFACTFNFAEQGIMEGNAKVMKLIARDEQLHLKGTQALISIWQNYKDDPEMAEISLRLQPEAEK----IFMQVVDQEKEWAHSLFSQGTVPGLN-AQILCEYVEYLADSRMRSVGLNSPY-PRRKHPLPWIRKWLNSDSVQVAAQEAEL--------SSYLVGQIDST 363
>gi|156933156|ref|YP_001437072.1| ribonucleotide-diphosphate reductase subunit beta [Enterobacter sakazakii ATCC BAA-894] >gi|156531410|gb|ABU76236.1| hypothetical protein ESA_00966 [Enterobacter sakazakii ATCC BAA-894] (376 aa)
Score = 150, Expect = 5.3e-08, Identities = 83/301 (27%), Positives = 138/301 (45%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKL---PPEKQA---EMKKFVFDLLYQVIDLEKEFLNELYAGFNI----ADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           D +  E++ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E + KRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++   + +     PE  A   E K+  +DL       EKE+   L+ G ++     D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    30 DQQKYEIFEKLIEKQLSFFWRPEEVDVSRDRIDFQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPAV--VFDDIVTNEQILKRAEGISHYYDDLIEMTSYWHLLGEGTHSVNGKTVTVNLHELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLMRSGEDDPEMAAIAEECKQECYDLFVLAAQQEKEWAEYLFQGGSMIGLNKDILCQYVEYITNIRMQAVGLDLPFKTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEIDHDD 370
>gi|3891582|pdb|1AV8|A Chain A, Ribonucleotide Reductase R2 Subunit From E. Coli >gi|3891583|pdb|1AV8|B Chain B, Ribonucleotide Reductase R2 Subunit From E. Coli (340 aa)
Score = 150, Expect = 5.4e-08, Identities = 70/249 (28%), Positives = 111/249 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI 332
>gi|83754022|pdb|2ALX|A Chain A, Ribonucleotide Reductase R2 From Escherichia Coli In Space Group P6(1)22 (340 aa)
Score = 150, Expect = 5.6e-08, Identities = 70/249 (28%), Positives = 111/249 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI 333
>gi|149190928|ref|ZP_01869191.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio shilonii AK1] >gi|148835283|gb|EDL52257.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio shilonii AK1] (377 aa)
Score = 149, Expect = 7.3e-08, Identities = 85/303 (28%), Positives = 149/303 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+      G N  D   ++  Y +   +Q +G D+ +    +   P I   LS+     A +  +      SSY++G ++ E + DD++
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPGV--VFDDIVENEHILKRAKDIAHYY--DDLIQATNDYHRFGEGTHNIKGEEVKVNLYDLKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMINLLRNGQDDFSFMQIAEECKQDCFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILCQYVEYISNVRMQAVGLDAAYPEATSNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVNADDFE 373
>gi|193062401|ref|ZP_03043496.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E22] >gi|192932067|gb|EDV84666.1| ribonucleoside-diphosphate reductase, beta subunit [Escherichia coli E22] (393 aa)
Score = 149, Expect = 7.4e-08, Identities = 83/287 (28%), Positives = 130/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K   +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    65 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKLECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDAEVDTDD 387
>gi|33358114|pdb|1PIM|A Chain A, Dithionite Reduced E. Coli Ribonucleotide Reductase R2 Subunit, D84e Mutant >gi|33358115|pdb|1PIM|B Chain B, Dithionite Reduced E. Coli Ribonucleotide Reductase R2 Subunit, D84e Mutant >gi|33358116|pdb|1PIU|A Chain A, Oxidized Ribonucleotide Reductase R2-D84e Mutant Containing Oxo-Bridged Diferric Cluster >gi|33358117|pdb|1PIU|B Chain B, Oxidized Ribonucleotide Reductase R2-D84e Mutant Containing Oxo-Bridged Diferric Cluster >gi|42543285|pdb|1PIZ|A Chain A, Ribonucleotide Reductase R2 D84e Mutant Soaked With Ferrous Ions At Neutral Ph >gi|42543286|pdb|1PIZ|B Chain B, Ribonucleotide Reductase R2 D84e Mutant Soaked With Ferrous Ions At Neutral Ph (375 aa)
Score = 148, Expect = 7.6e-08, Identities = 82/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLL+SIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLESIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFNTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|154505112|ref|ZP_02041850.1| hypothetical protein RUMGNA_02625 [Ruminococcus gnavus ATCC 29149] >gi|153794591|gb|EDN77011.1| hypothetical protein RUMGNA_02625 [Ruminococcus gnavus ATCC 29149] (347 aa)
Score = 148, Expect = 8.1e-08, Identities = 70/282 (24%), Positives = 127/282 (45%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPYYIGD------------DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP----PEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENH---DFFSGSGSSY 324
           + +   NFW+PE+I +S D+  +  L  N +    +  + L  LDSIQ    ++  +   +T +E  +  +   F   VH++SY  +  + CS  + N   + W  +   L++        +IGD              LK  +A  ++ G   Y GF   + L     +P +   IR I RD+  H +       +   +LP    PE    +K+ + + + Q I      +    AG    +   ++  Y       NLG+D P  P++T+ +P+    +S  ++ N    DFF    ++Y
  S:    46 YRQAMNNFWIPEEINLSQDIKDYPNLTENERTAYNKILSFLVFLDSIQT--ANLPCIGEYITANEINLCLSIQTFQECVHSQSYSYMLDSICSPVERNDILYQWKNDAHLLRRNT------FIGDLYNEFQEKKDDFTLLKVMMANYILEGIYFYSGFMFFYNLSRNGKMPGSAQEIRYINRDENTHLWLFRNMILEMKKELPELFTPEHIEILKEMLKEGVRQEIAWGHYVIGNQIAGLT-KEMITEYIQYLGNLRFTNLGFD-PIYPDQTQ-EPDSMRWVSQYSNANMVKTDFFEAKSTAY 337
>gi|18311342|ref|NP_563276.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium perfringens str. 13] >gi|110801267|ref|YP_697050.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium perfringens ATCC 13124] >gi|168205189|ref|ZP_02631194.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens E str. JGS1987] >gi|168210336|ref|ZP_02635961.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213271|ref|ZP_02638896.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens CPE str. F4969] >gi|168216675|ref|ZP_02642300.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens NCTC 8239] >gi|169347055|ref|ZP_02865997.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens C str. JGS1495] >gi|182625797|ref|ZP_02953564.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens D str. JGS1721] >gi|18146026|dbj|BAB82066.1| ribonucleoside-diphosphate reductase beta subunit [Clostridium perfringens str. 13] >gi|110675914|gb|ABG84901.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens ATCC 13124] >gi|169296738|gb|EDS78867.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens C str. JGS1495] >gi|170663363|gb|EDT16046.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens E str. JGS1987] >gi|170711548|gb|EDT23730.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|170715235|gb|EDT27417.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens CPE str. F4969] >gi|177908953|gb|EDT71440.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens D str. JGS1721] >gi|182381151|gb|EDT78630.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens NCTC 8239] (344 aa)
Score = 148, Expect = 8.5e-08, Identities = 55/193 (28%), Positives = 94/193 (48%)
  Q:    23 KGKMRSVNWNFINDDKDL------EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQV--LIPYYIGDDPL----KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           K KM + N   +ND  ++      E + +   NFW+PE+I ++ DL  + KL    +    +  + L  LDSIQ    ++  + + +T  E  +  T  AF   VH++SY  +  + CS ++ N     W  +   LQ+   +  L   ++ D  +    KS +A  ++ G   Y GF   + L     +P +   IR I RD+  H
  S:    19 KKKMINGNTTNLNDFNNMKYTWVSEWYRQAMNNFWIPEEINLAQDLKDYKKLTKEEKTAYDKILSFLIFLDSIQT--ANLGNINSYITASEVNLCLTIQAFQEAVHSQSYSYMLDSICSPEERNEILFQWKDDAILLQRNKFIGDLYNNFLEDSSMENFIKSVMANYILEGVYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTH 223
>gi|110802082|ref|YP_699620.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium perfringens SM101] >gi|110682583|gb|ABG85953.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium perfringens SM101] (344 aa)
Score = 147, Expect = 9.7e-08, Identities = 55/193 (28%), Positives = 94/193 (48%)
  Q:    23 KGKMRSVNWNFINDDKDL------EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQV--LIPYYIGDDP----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           K KM + N   +ND  ++      E + +   NFW+PE+I ++ DL  + KL    +    +  + L  LDSIQ    ++  + + +T  E  +  T  AF   VH++SY  +  + CS ++ N     W  +   LQ+   +  L   ++ D      +KS +A  ++ G   Y GF   + L     +P +   IR I RD+  H
  S:    19 KKKMINGNTTNLNDFNNMKYTWVSEWYRQAMNNFWIPEEINLAQDLKDYKKLTKEEKAAYDKILSFLIFLDSIQT--ANLGNINSYITASEVNLCLTIQAFQEAVHSQSYSYMLDSICSPEERNEILFQWKDDAILLQRNKFIGDLYNNFLEDSSIENFIKSVMANYILEGVYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTH 223
>gi|61680624|pdb|1YFD|A Chain A, Crystal Structure Of The Y122h Mutant Of Ribonucleotide Reductase R2 Protein From E. Coli >gi|61680625|pdb|1YFD|B Chain B, Crystal Structure Of The Y122h Mutant Of Ribonucleotide Reductase R2 Protein From E. Coli (375 aa)
Score = 147, Expect = 1.0e-07, Identities = 82/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RS+  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSHTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|4389292|pdb|1BIQ|B Chain B, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Mutant E238a >gi|40889714|pdb|1RSV|A Chain A, Azide Complex Of The Diferrous E238a Mutant R2 Subunit Of Ribonucleotide Reductase >gi|40889715|pdb|1RSV|B Chain B, Azide Complex Of The Diferrous E238a Mutant R2 Subunit Of Ribonucleotide Reductase (375 aa)
Score = 147, Expect = 1.2e-07, Identities = 82/287 (28%), Positives = 130/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RS+  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD  +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSFTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDAALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|40889712|pdb|1RSR|A Chain A, Azide Complex Of The Diferrous F208a Mutant R2 Subunit Of Ribonucleotide Reductase >gi|40889713|pdb|1RSR|B Chain B, Azide Complex Of The Diferrous F208a Mutant R2 Subunit Of Ribonucleotide Reductase (375 aa)
Score = 147, Expect = 1.2e-07, Identities = 82/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RS+  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSFTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRAYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|157144813|ref|YP_001452132.1| ribonucleotide-diphosphate reductase subunit beta [Citrobacter koseri ATCC BAA-895] >gi|157082018|gb|ABV11696.1| hypothetical protein CKO_00540 [Citrobacter koseri ATCC BAA-895] (376 aa)
Score = 146, Expect = 1.4e-07, Identities = 79/287 (27%), Positives = 130/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK ++   +M          Y  F   F    + L+     IIRLI RD+ +H   + +      + +   + AE+    K+  +DL  Q    EKE+ + L+      G N  D   ++  Y     +Q +G + PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDFQSLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPAV--VFDDIVTNEQIQKRAEGISHYYDELIEMTSYWHLLGEGTHNVNGKTVTVNLRALKKQLYLCLMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLTGTQHMLNLLRSGIDDPEMAEIAEESKQACYDLFVQAAQQEKEWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLELPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 370
>gi|3891570|pdb|2AV8|A Chain A, Y122f Mutant Of Ribonucleotide Reductase From Escherichia Coli >gi|3891571|pdb|2AV8|B Chain B, Y122f Mutant Of Ribonucleotide Reductase From Escherichia Coli (340 aa)
Score = 146, Expect = 1.5e-07, Identities = 69/249 (27%), Positives = 111/249 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RS+  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSFTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI 332
>gi|42543295|pdb|1PM2|A Chain A, Crystal Structure Of Manganese Substituted R2-D84e (D84e Mutant Of The R2 Subunit Of E. Coli Ribonucleotide Reductase) >gi|42543296|pdb|1PM2|B Chain B, Crystal Structure Of Manganese Substituted R2-D84e (D84e Mutant Of The R2 Subunit Of E. Coli Ribonucleotide Reductase) (339 aa)
Score = 146, Expect = 1.5e-07, Identities = 69/249 (27%), Positives = 111/249 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLL+SIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLESIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFNTRSNPI 332
>gi|4389291|pdb|1BIQ|A Chain A, Ribonucleoside-Diphosphate Reductase 1 Beta Chain Mutant E238a (375 aa)
Score = 145, Expect = 1.7e-07, Identities = 82/287 (28%), Positives = 130/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RS+  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD  +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSFTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRXYVSFACSFAFAERELMEGNAKIIRLIARDAALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|119774862|ref|YP_927602.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella amazonensis SB2B] >gi|119767362|gb|ABL99932.1| Ribonucleoside-diphosphate reductase [Shewanella amazonensis SB2B] (391 aa)
Score = 145, Expect = 2.1e-07, Identities = 82/278 (29%), Positives = 137/278 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY---AGFNIADQAI-KFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADEN 313
           D +  EV+ ++ +     FW PE++ +S D   + KL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     + D  +   D VVN E + KRA  +  YY                          +    LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H        N   G K   ++A++  E Q E     +DL  +  + EKE+   L+   +   + +Q + ++  Y   + ++++    P+                      P+E E+   +  Q+ A  DEN
  S:    45 DQQRYEVFEKLIEKQLSFFWRPEEVDVSRDKIDFGKLPDHERHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVN-DPSSVFDDIVVN-EEILKRAGDISAYYDELIKLTQIYHLHGEGTHTVDGHVVDVTVRALKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILNIMQGGKDDAEMAEIAIECQQE----AYDLFLRAAEQEKEWAKYLFKDGSMIGLNEQILCQYVEYITNQRMKSVNLPLPYPESTNPLPWMKNWLESDAVQVAPQEVEVSSYLVGQIDASVDEN 384
>gi|68481406|ref|XP_715342.1| hypothetical protein CaO19.5801 [Candida albicans SC5314] >gi|68481537|ref|XP_715277.1| hypothetical protein CaO19.13223 [Candida albicans SC5314] >gi|46436893|gb|EAK96248.1| hypothetical protein CaO19.13223 [Candida albicans SC5314] >gi|46436961|gb|EAK96315.1| hypothetical protein CaO19.5801 [Candida albicans SC5314] (413 aa)
Score = 144, Expect = 2.2e-07, Identities = 55/219 (25%), Positives = 99/219 (45%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGD--VAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQ-INSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E+WN   +   +FW  E+I +S DL  WN KL+ N +  + R        D I   +G+  +      +   E   +  F  M+  +H+ +Y  +  T+    Q  +   + + N   +QK+A   I +   D+ L  +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +  PE        V  ++ + +D+EKE+  +
  S:   109 EIWNFYKKAEASFWTAEEIDLSKDLDDWNNKLNENERYFISRVLAFFAASDGI---VGENLIENFSTEVQLPEAKSFYGFQIMMENIHSETYSLLIETYIKDPQEADYLFNAIANIPCIQKKADWAIKWIQDDEALYGERLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFAHLQNRPSPE-------IVERIITEAVDVEKEYFTD 327
>gi|152971181|ref|YP_001336290.1| ribonucleotide-diphosphate reductase subunit beta [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150956030|gb|ABR78060.1| ribonucleotide-diphosphate reductase beta subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (376 aa)
Score = 143, Expect = 3.2e-07, Identities = 81/287 (28%), Positives = 129/287 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +     +  D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++   + +         E   E K+  +DL       EKE+ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPA--TVFDDIVTNEQIQKRAEGISHYYDSLIEMTSYWHLLGEGTHTVNGKTVTVNLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGSDDPEMAEIAEECKQECYDLFVLAAQQEKEWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFQTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDADD 370
>gi|90409249|ref|ZP_01217354.1| ribonucleotide-diphosphate reductase beta subunit [Psychromonas sp. CNPT3] >gi|90309647|gb|EAS37827.1| ribonucleotide-diphosphate reductase beta subunit [Psychromonas sp. CNPT3] (381 aa)
Score = 142, Expect = 4.3e-07, Identities = 83/278 (29%), Positives = 140/278 (50%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY------------------------IGDDP-------LKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-GFNIADQAI---KFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADEN 313
           D +  EV+ ++ +     FW PE+I +S D   +  L S+ Q + +      TLLDSIQ    ++A +   SL + E  I T ++F   +H+RSY  I      +D      D V N E +QKRA  +  YY                        +  +P       +K K+   M     +     Y  F   F    ++LL     II+LI RD+ +H        N ++  K   ++A++  E  A+ +    D+       EKE+   L+  G  I    +   ++  Y +   +Q +GY++PF                      P+E EI   +  Q+ ++ D +
  S:    30 DQQKFEVFEKLIEKQLSFFWRPEEIDVSRDRIDFMNLPSHEQHIFISNLKYQTLLDSIQGRSPNMALLPIVSLPELETWIET-WSFSETIHSRSYTHILRNL-FTDPSEVFEDIVTNVE-IQKRASDIAQYYDALIHAVQFMQLHGLEQSKIEYLDLDGNPEKLTLRVIKKKLYLCMCSINALEAIRFYVSFACSFAFAERDLLEGNAKIIKLIARDEALHLNSTQQILNIWADGKDDPEMAEIAIECHAKGR----DIFLTAAAQEKEWAAYLFKDGSMIGLNEVILCQYVEYISNVRMQAIGYEAPFEIKNNPIPWINHWLISDNVQVAPQEAEISSYLVGQIDSKVDTD 374
>gi|159030376|emb|CAO91271.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (355 aa)
Score = 141, Expect = 5.3e-07, Identities = 65/287 (22%), Positives = 129/287 (44%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG--DDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFV---FDLLYQVIDLEKEFLNELYAG--FNIADQAI-KFSVYNAGKFLQNLGYDSPFTPEETEIKP----EIFVQLSARADENHDFFSGSGSSYIMGN 328
           ++ ++ +NFW+P+++ I+ D+  +  L    +       + LT LDS+Q    ++  +K S+T  E  +          +H +SY  +  T   SD+    +D+    + L+ R + +   Y    D         A++  +LL     Y GF   + L ++ L+  + D+ ++I RD++ H       YQ    KL PE  A     V   +++    +  E  + N +       I + +  +++ Y A   L+ +G +  +  E+    P    E F           +FF  + +SY+M +
  S:    53 LYQQMRENFWIPQRLDITQDVTEYGHLTDEERYAYDGILSYLTFLDSVQTC--NIPHLKGSVTAPEISLCMAEQISQEAMHNQSYQYLIETIIPSDRRGEVYDFWRTDKVLKDRCEFIASLYQQYIDKQTTESYFIALLADYLLESLYFYNGFIFFYNLASRQLMSGSADVFKMINRDELSHVRL----YQ----KLIPEAMAIFPHSVEQIYEMFDSAVKHECCWTNHIVGNDILGITEYSTEQYTKYLANIRLKAIGLEPLYREEKYNKSPYNHLERFSDTKKEGHTKANFFEATVTSYVMSS 347
>gi|74025554|ref|XP_829343.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] >gi|70834729|gb|EAN80231.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] (337 aa)
Score = 141, Expect = 5.4e-07, Identities = 62/248 (25%), Positives = 114/248 (45%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFT------GLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTF-CSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYD 288
           ++W +  +   NFW  E I + ND+  W KLD   +  +           G+ L + +Q  + +V QV        +  Y     M  +H+ +Y  +  T+    D+       +     ++K+A+  I +        ++ VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+K +  KLP ++       V +++   + +E+EF+ +       G N  +  Q I+F    A + L +LGYD
  S:    36 DIWQKYKKARSNFWAMENIYLGNDMTDWEKLDDGERHFIKHVLAFFAARDGIVLENFVQRFMCEV-QVPEV-----RCFYGFQIAMENIHSETYSVLIDTYVVDPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTSFPTRLVAFAAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKYIVNKLPRDR-------VLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFV---ADRLLVSLGYD 285
>gi|149194868|ref|ZP_01871962.1| ribonucleotide-diphosphate [Caminibacter mediatlanticus TB-2] >gi|149135027|gb|EDM23509.1| ribonucleotide-diphosphate [Caminibacter mediatlanticus TB-2] (346 aa)
Score = 141, Expect = 5.7e-07, Identities = 75/305 (24%), Positives = 138/305 (45%)
  Q:    29 VNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVL--------IPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAI---------KFSVYNAGKFLQNLGYDSPFTPEETEIKP-EIFVQLSARADENHDFFSGSGSSYIMGNVEETD 333
           +N N ++      +W  +  N W P ++ ++ D   + +L    + +  +  + L  +DSIQ T      V   +T  E  +     AF   +H++SY  +  +   ++D+I     W  + E+L+K+ + +        I    GDD  K    VA   + G   Y GF   + L     +  +  +IR I RD+V H       +++   + P     E+ + + D+LY   +LE+++      GF I +  I         +F+ Y A K    +G +  F PE     P   F   S+  ++  +FF G+  +Y  G++   D
  S:    30 INLNKLSYPWAYNLWEMMLANTWFPREVDLTEDARQYRQLLPAEKRMYDKALSQLIFMDSIQ-TNNTPDHVNPWITAPEVNMCLVRQAFEEALHSQSYAVMVDSISLNTDEIYEM--WRAD-ENLRKKNEFIGNVYEEWGIKALNGDDEAKIYMIVANQALEGIYFYNGFAAFYVLARAGKMLGSAQMIRFIQRDEVTHTLLFANIFKEIKKEFPDLFTPEVIRNIKDMLYAAYELERDW------GFYITNDEILGLSKELIDRFTKYLANKRAHAMGLELLF-PEIGLKNPISWFDSFSSFNEQKTNFFEGNVVNYSKGSLNLDD 345
>gi|148978906|ref|ZP_01815226.1| ribonucleotide-diphosphate reductase beta subunit [Vibrionales bacterium SWAT-3] >gi|145962104|gb|EDK27390.1| ribonucleotide-diphosphate reductase beta subunit [Vibrionales bacterium SWAT-3] (377 aa)
Score = 141, Expect = 6.0e-07, Identities = 85/303 (28%), Positives = 148/303 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI--------------------GDD------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQA------EMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY                     G+D       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +  A      E K+  FDL  +  + EKE+   L+      G N  D   ++  Y     +Q +G  + +    +   P I   LS+     A +  +      SSY++G ++ E   DD++
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPEVETWIET-WSFSETIHSRSYTHIIRNIVNDPGL--VFDDIVENEEILKRAKDIAFYYDDLIKLTADYHRYGEGNHNINGEDVKISLHDLKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMINLLRNGQDDFAFMQIAEECKQECFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILCQYVEYITNIRMQAVGLGTAYPEATSNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVKADDFE 373
>gi|84386981|ref|ZP_00990005.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio splendidus 12B01] >gi|86148466|ref|ZP_01066756.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio sp. MED222] >gi|84378271|gb|EAP95130.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio splendidus 12B01] >gi|85833763|gb|EAQ51931.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio sp. MED222] (377 aa)
Score = 141, Expect = 6.2e-07, Identities = 84/303 (27%), Positives = 147/303 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI--------------------GDD------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY                     G+D       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+      G N  D   ++  Y     +Q +G  + +    +   P I   LS+     A +  +      SSY++G ++ E   DD++
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPEVETWIET-WSFSETIHSRSYTHIIRNIVNDPGV--VFDDIVENEEILKRAKDIAFYYDDLIKLTADYHRYGEGNHNINGEDVKISLHDLKKKLYVCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMINLLRNGQDDFEFMQIAEECKQECFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILCQYVEYITNIRMQAVGLGTAYPEATSNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVKADDFE 373
>gi|157375444|ref|YP_001474044.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella sediminis HAW-EB3] >gi|157317818|gb|ABV36916.1| Ribonucleoside-diphosphate reductase [Shewanella sediminis HAW-EB3] (376 aa)
Score = 140, Expect = 7.6e-07, Identities = 82/289 (28%), Positives = 143/289 (49%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQA-TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKV---AKLPPEKQ---AEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVEET-DDDDWD 338
           FW PE+I IS D   W +L  + + + +      TLLDS+ A ++  V     SL + E  + T +AF   +H+RSY  I     +  +     D +V   ++ KRA  +  Y+                          +    LK ++  A+     +     Y  F   F    + LL     II+LI RD+ +H   SG ++  K+       PE      E+++    +   V++ EKE+ + L+      G N A+   ++  Y +   ++ +GY++PF  +   + P I        VQ++ +  E         +SY++G V+ T  DDD+D
  S:    48 FWRPEEIDISKDRADWQRLTESEKHIFISNLKYQTLLDSMAARSVNAVLLPLVSLPEVETWVET-WAFSETIHSRSYTHILRNLFT--EPGEVFDDIVVNPAILKRATSIAKYFDDVILTTQLLQSQGEGSYEVNGETIEVSARKLKERLYLAVCSVNALEAIRFYVSFACSFAFAERELLEGNAKIIKLIARDEALH--LSGTQHILKLWANGNDDPEMVEVCQELREAGRQVFLDVVEQEKEWADYLFKDGSMIGLN-AEILKQYIEYISNNRMEAIGYEAPFAIKNNPL-PWINTYLVSDNVQVAPQESEI--------TSYLVGQVDATVSDDDFD 372
>gi|59711808|ref|YP_204584.1| ribonucleotide-diphosphate reductase subunit beta [Vibrio fischeri ES114] >gi|163727787|ref|ZP_02135272.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio fischeri MJ11] >gi|59479909|gb|AAW85696.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like protein [Vibrio fischeri ES114] >gi|161398688|gb|EDQ22972.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio fischeri MJ11] (377 aa)
Score = 139, Expect = 8.5e-07, Identities = 64/226 (28%), Positives = 110/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ-KKVAKLPP---EKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  +++ ++ +     FW PE++ +S D   +N L  + Q + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     ++  +    D +V  E + KRA+ +  YY                          I    LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   + +     +  +  P   E  AE ++  FDL     + EK++ N L+
  S:    30 DQQKFQIFEKLIEKQLSFFWRPEEVDVSGDRIDYNNLPEHEQHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNNPSV--IFDDIVENEEILKRAKDIAHYYDNLIQATNDYHRFGEGTHVLNGQEITISKRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDESLHLTSTQHMLNLLRTGQDDPEFVEIAAECEQECFDLFKAAAEQEKQWANYLF 292
>gi|156975012|ref|YP_001445919.1| ribonucleotide-diphosphate reductase subunit beta [Vibrio harveyi ATCC BAA-1116] >gi|156526606|gb|ABU71692.1| hypothetical protein VIBHAR_02734 [Vibrio harveyi ATCC BAA-1116] (377 aa)
Score = 139, Expect = 9.8e-07, Identities = 67/226 (29%), Positives = 113/226 (50%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAK------LPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +      L  +   E K+  FDL  +  + EKE+   L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEHILKRAKDIAHYY--DDLIQATNDYHRYGEGEHVLNGETVKVSLYDLKKKLYICLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LNGTQHMINLLRNGQDDFLFMQIAEEEKQECFDLFKEAAEQEKEWAEYLF 292
>gi|27366311|ref|NP_761839.1| ribonucleotide-diphosphate reductase subunit beta [Vibrio vulnificus CMCP6] >gi|37679427|ref|NP_934036.1| ribonucleotide-diphosphate reductase subunit beta [Vibrio vulnificus YJ016] >gi|27362512|gb|AAO11366.1|AE016807_85 Ribonucleotide reductase, beta subunit [Vibrio vulnificus CMCP6] >gi|37198171|dbj|BAC94007.1| ribonucleotide reductase, beta subunit [Vibrio vulnificus YJ016] (377 aa)
Score = 139, Expect = 1.0e-06, Identities = 66/226 (29%), Positives = 112/226 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEHILKRAKDIAHYY--DDLIQLTNDYHRFGEGEHVVNGETIKVSLYELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LNGTQHMINLLRNGQDDFSFMQIAEEAKQQCFDLFKEAAEQEKEWAEYLF 292
>gi|56460472|ref|YP_155753.1| ribonucleotide-diphosphate reductase subunit beta [Idiomarina loihiensis L2TR] >gi|56179482|gb|AAV82204.1| Ribonucleotide reductase, beta subunit [Idiomarina loihiensis L2TR] (377 aa)
Score = 139, Expect = 1.1e-06, Identities = 68/251 (27%), Positives = 123/251 (49%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKV-----AAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-----NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKP 300
           FW PE+I +S D   +NKL ++ + + +      TLLDSIQ    ++A +   SL + E  I T ++F   +H+RSY  I     S D      D V+N E ++ RA  +  YY                          +    +K K+     +   +     Y  F   F    + L+     II+LI RD+ +H     +  + ++Y +   ++  E   E++   +++    +  EK++ + L+      G N      ++  Y A   +Q +G+D+PF  + +   P
  S:    48 FWRPEEIDVSRDRIDFNKLTASEKHVFISNLKYQTLLDSIQGRSPNIALLPIVSLPELETWIET-WSFFETIHSRSYTHILRNLFS-DPSEVFEDIVIN-EQIKIRANDISKYYDDLIFYTQLLQTHGEGDVVVEGKTHTVTQREIKKKLFLCINSVNALEAIRFYVSFACTFAFAERELMEGNAKIIKLIARDENVHLTSTQHILNLWQYGEDDPEMK-EIAEELRDDAYEIFMTAVKQEKQWAHYLFKDGSMIGLN-ESMLCQYVEYIANLRMQAIGFDAPFENQRSNPLP 335
>gi|161617990|ref|YP_001595470.1| ribonucleotide reductase beta subunit [Enterobacteria phage phiEcoM-GJ1] >gi|150416409|gb|ABR68787.1| ribonucleotide reductase beta subunit [Enterobacteria phage phiEcoM-GJ1] (372 aa)
Score = 138, Expect = 1.1e-06, Identities = 76/264 (28%), Positives = 123/264 (46%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY----------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY---AGFNIADQAI-KFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADEN 313
           FW PE++ +S D   + KL +N Q +         LLDSIQ    +   +   S+ + E  I T ++F   +H+RSY  I     +   I    D +V  E ++ RA  +  YY                      I    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H        N  +  K   ++ ++  E + E +K   D   Q    EK++ + L+   +   +  Q +  +  Y     +Q +G D+PF                      P+ETEI   +  Q+ +  D N
  S:    48 FWRPEEVDVSQDRIDYQKLPANEQHIFTSNLRYQILLDSIQGRGPNTVLLPIVSIPELETWIET-WSFSETIHSRSYTHIIRNIVTDPSI--IFDEIVTNEHIKARAIGISQYYDELQQLTALWQLFGEGSHAGHEISLRELKKKLYLCLMSINALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLTGTQHMLNLLASGKDDPEMGEIAAECRQECQKLFEDAAQQ----EKDWADYLFKDGSMIGLNKQILCGYVEYITNIRMQAVGLDAPFKGATNPIPWINAWLNSDAVQVAPQETEISSYLVGQIDSEVDTN 365
>gi|28898709|ref|NP_798314.1| ribonucleotide-diphosphate reductase subunit beta [Vibrio parahaemolyticus RIMD 2210633] >gi|153839553|ref|ZP_01992220.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio parahaemolyticus AQ3810] >gi|28806927|dbj|BAC60198.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio parahaemolyticus RIMD 2210633] >gi|149746934|gb|EDM57922.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio parahaemolyticus AQ3810] (377 aa)
Score = 138, Expect = 1.1e-06, Identities = 85/303 (28%), Positives = 146/303 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+      G N  D   ++  Y     +Q +G  + +    T   P I   LS+     A +  +      SSY++G ++ E   DD++
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEHILKRAKDIAHYY--DDLIQTTNDYHRYGEGEHVLNGETVKVSLYDLKKKLYICLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LNGTQHMINLLRNGQDDFSFMQIAEEAKQDCFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILSQYVEYITNIRMQAVGLPAAYPEATTNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVRADDFE 373
>gi|42543287|pdb|1PJ0|A Chain A, Ribonucleotide Reductase R2-D84eW48F MUTANT SOAKED WITH Ferrous Ions At Neutral Ph >gi|42543288|pdb|1PJ0|B Chain B, Ribonucleotide Reductase R2-D84eW48F MUTANT SOAKED WITH Ferrous Ions At Neutral Ph >gi|42543289|pdb|1PJ1|A Chain A, Ribonucleotide Reductase R2-D84eW48F SOAKED WITH FERROUS Ions At Ph 5 >gi|42543290|pdb|1PJ1|B Chain B, Ribonucleotide Reductase R2-D84eW48F SOAKED WITH FERROUS Ions At Ph 5 (375 aa)
Score = 138, Expect = 1.1e-06, Identities = 81/287 (28%), Positives = 131/287 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ----KKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDD 336
           F+ PE++ +S D   +  L  + + + +      TLL+SIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++     +  A  P   E   E K+  +DL  Q    EK++ + L+      G N  D   ++  Y     +Q +G D PF      I P I        VQ++ +  E         SSY++G ++ E D DD
  S:    47 FFRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLESIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNGKTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLDLPFNTRSNPI-PWINTWLVSDNVQVAPQEVEV--------SSYLVGQIDSEVDTDD 369
>gi|91227184|ref|ZP_01261643.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio alginolyticus 12G01] >gi|91188712|gb|EAS75000.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio alginolyticus 12G01] (377 aa)
Score = 138, Expect = 1.1e-06, Identities = 85/303 (28%), Positives = 146/303 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+      G N  D   ++  Y     +Q +G  + +    T   P I   LS+     A +  +      SSY++G ++ E   DD++
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPAV--VFDDIVENEHILKRAKDIAHYY--DDLIQATNDYHRYGEGEHVLNGETVKVSLYDLKKKLYICLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LNGTQHMINLLRNGQDDFTFMQIAEEAKQDCFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILSQYVEYITNIRMQAVGLPAAYPEATTNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVRADDFE 373
>gi|85711601|ref|ZP_01042658.1| ribonucleotide-diphosphate reductase beta subunit [Idiomarina baltica OS145] >gi|85694461|gb|EAQ32402.1| ribonucleotide-diphosphate reductase beta subunit [Idiomarina baltica OS145] (377 aa)
Score = 138, Expect = 1.2e-06, Identities = 79/290 (27%), Positives = 139/290 (47%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKV-----AAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           FW PE++ +S D   +NKL ++ + + +      TLLDSIQ    ++A +   SL + E  I T ++F   +H+RSY  I      SD      D V+N + ++ RA  +  YY                          +    LK K+     +   +     Y  F   F    + L+     IIRLI RD+ +H        N +   +   ++A++  E   E     +++    +  EK++ + L+      G N      ++  Y A   +Q +GYD+PF  + +   P +        VQ++ +  E   +  G     I  +V+ +D  D+D 
  S:    48 FWRPEEVDVSRDRVDFNKLTASEKHVFISNLKYQTLLDSIQGRSPNIALLPIVSLPELETWIET-WSFFETIHSRSYTHILRNL-FSDPSEIFEDIVIN-DQIKLRANDISRYYDDLIFYTQLWQTHGEGKITVDGEEHNVTRRELKKKLFLCINSVNALEAIRFYVSFACTFAFAERELMEGNAKIIRLIARDENVHLTSTQHMINLWQDGEDDPEMAEIAEELADE----AYEIFMTAVKQEKQWAHYLFRDGSMIGLN-ESMLCQYVEYIANLRMQAIGYDAPFPEQRSNPLPWMNKYLVSDNVQVAPQEAEISSYLVGQ----IDSSVDASDLGDFDL 377
>gi|163803511|ref|ZP_02197381.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio campbellii AND4] >gi|159172687|gb|EDP57538.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio campbellii AND4] (377 aa)
Score = 138, Expect = 1.2e-06, Identities = 66/226 (29%), Positives = 114/226 (50%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAK------LPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +      +  +   E+K+  FDL  +  + EKE+   L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPIVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEHILKRAKDIAHYY--DDLIQATNDYHRYGEGEHLLNGETVKVSLYDLKKKLYICLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDESLH--LNGTQHMINLLRNGQDDFIFMQIAEEVKQECFDLFKEAAEQEKEWAEYLF 292
>gi|54309624|ref|YP_130644.1| ribonucleotide-diphosphate reductase subunit beta [Photobacterium profundum SS9] >gi|46914062|emb|CAG20842.1| putative ribonucleoside-diphosphate reductase, beta subunit [Photobacterium profundum SS9] (377 aa)
Score = 138, Expect = 1.3e-06, Identities = 67/226 (29%), Positives = 108/226 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S D   +N L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   I    D +V  E + KRA  +  YY  DD                             +K K+   MM          Y  F   F    + ++     II+LI RD+ +H        N   G     ++A +  E Q E     FDL  +  + EKE+   L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSGDRIDYNNLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPIVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPAI--VFDDIVENEYIIKRAGDISKYY--DDLIAATSDYHRLGEGKHTVNGETITVNLREIKKKLYVCMMSVNALEAIRFYVSFACSFAFAEREVMEGNAKIIKLIARDEALHLTGTQHILNLLRGRHDDPEMADIAQECQQE----CFDLFKEAAEQEKEWAEYLF 292
>gi|145537171|ref|XP_001454302.1| hypothetical protein GSPATT00020567001 [Paramecium tetraurelia strain d4-2] >gi|124422057|emb|CAK86905.1| unnamed protein product [Paramecium tetraurelia] (507 aa)
Score = 137, Expect = 1.4e-06, Identities = 49/219 (22%), Positives = 98/219 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAF-MVGVHARSYGSIFSTFCSSD-QINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           ++WN   Q   +FW  E+I +  DL  W KL ++ +  +          D I        Q    +   E   +  F   M  +H+ +Y  +  T+ + + + N     + N   +QK+A   + +   +D    + +A A + G    G F   F++  ++L+P       LI RD+ +H  ++   Y+  + KL  ++       V +++   +++EKEF++E
  S:   208 DIWNMYKQHKASFWTAEEIDLYQDLKDWEKLTADEKHFIKYVLAFFAASDGI-VNENLAQQFCTEVQVPEARCFYGFQIAMENIHSETYSLLIDTYITDENEKNYLLHAIDNVPVIQKKAMWAMKWINNNDSFAERLIAFAAVEGIFFSGSFCAIFWIKKRSLMPGLTFSNELISRDEGLHTDFACLLYKHMINKLSIQR-------VHEIISSAVEIEKEFISE 424
>gi|120598753|ref|YP_963327.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella sp. W3-18-1] >gi|124547265|ref|ZP_01706212.1| ribonucleotide reductase [Shewanella putrefaciens 200] >gi|146293170|ref|YP_001183594.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella putrefaciens CN-32] >gi|120558846|gb|ABM24773.1| Ribonucleoside-diphosphate reductase [Shewanella sp. W3-18-1] >gi|124509417|gb|EAY53497.1| ribonucleotide reductase [Shewanella putrefaciens 200] >gi|145564860|gb|ABP75795.1| Ribonucleoside-diphosphate reductase [Shewanella putrefaciens CN-32] (376 aa)
Score = 137, Expect = 1.5e-06, Identities = 68/226 (30%), Positives = 108/226 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +N L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D VVN E L +RA  +  YY                          +    LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H        N   G K   ++ ++  + Q E     +DL  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYNDLPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV-IFDDIVVNKEIL-RRATDIAEYYDHLIKLTQVFNLFGAGTHLIDGEELVVNTRTLKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILNIMQGGKDDPEMGEIAAQCQQE----AYDLFLKAAEQEKEWAKYLF 292
>gi|153835812|ref|ZP_01988479.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio harveyi HY01] >gi|148867435|gb|EDL66832.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio harveyi HY01] (377 aa)
Score = 137, Expect = 1.5e-06, Identities = 66/226 (29%), Positives = 112/226 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S+D   +NKL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSSDRIDYNKLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEHILKRAKDIAHYY--DDLIQATNDYHRYGEGEHVLNGETVKVSLYDLKKKLYICLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LNGTQHMINLLRNGQDDFSFMQIAEEAKQECFDLFKEAAEQEKEWAEYLF 292
>gi|117920413|ref|YP_869605.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella sp. ANA-3] >gi|117612745|gb|ABK48199.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Shewanella sp. ANA-3] (391 aa)
Score = 136, Expect = 2.0e-06, Identities = 70/226 (30%), Positives = 110/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +N L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D VVN E L +RA  +  YY                   I  +P       LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H            G K   ++A++  E Q E     ++L  +  + EKE+   L+
  S:    45 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYNSLPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV-IFDDIVVNQEIL-RRATDIAEYYDHLIKLTQVYHLLGEGTHVIDGEPIEVNTRTLKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILTIMQGGKDDPEMAEIAAECQQE----AYNLFLKAAEQEKEWAKYLF 307
>gi|85059563|ref|YP_455265.1| ribonucleotide-diphosphate reductase subunit beta [Sodalis glossinidius str. 'morsitans'] >gi|84780083|dbj|BAE74860.1| ribonucleoside-diphosphate reductase 1 beta subunit [Sodalis glossinidius str. 'morsitans'] (376 aa)
Score = 136, Expect = 2.1e-06, Identities = 69/249 (27%), Positives = 109/249 (43%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGD--------------------------DPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E + KRA+ +  YY G                             LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H        N     +   ++A++  E Q E     +DL       EKE+ + L+      G N  D   ++  Y     +Q++G D PF      I
  S:    48 FWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSL--VFDDIVTNEEILKRAKDISGYYDGLIELTSYYHLLGEGTHQVNGKTVVVNLHELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALHLTSTQHMLNLMRSGEDDPEMAEIARECQQES----YDLFLLAAQQEKEWASYLFRDGSMIGLN-KDILCQYVEYITNIRMQSVGLDLPFATRSNPI 333
>gi|126174279|ref|YP_001050428.1| ribonucleoside-diphosphate reductase [Shewanella baltica OS155] >gi|125997484|gb|ABN61559.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Shewanella baltica OS155] (376 aa)
Score = 136, Expect = 2.3e-06, Identities = 68/226 (30%), Positives = 107/226 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D VVN E L  RA  +  YY                          +    LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H        +   G K   ++ ++  E Q E     FDL ++  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYGALPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV-IFDDIVVNKEILS-RATDIAAYYDHLIQLTQVFHLLGAGTHVIDGKEVIVNTRTLKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILSIMQGGKDDPEMGEIAAECQQE----AFDLFFKAAEQEKEWAKYLF 292
>gi|149117758|ref|ZP_01844424.1| Ribonucleoside-diphosphate reductase [Shewanella baltica OS223] >gi|153000811|ref|YP_001366492.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella baltica OS185] >gi|160875520|ref|YP_001554836.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella baltica OS195] >gi|146862113|gb|EDK47863.1| Ribonucleoside-diphosphate reductase [Shewanella baltica OS223] >gi|151365429|gb|ABS08429.1| Ribonucleoside-diphosphate reductase [Shewanella baltica OS185] >gi|160861042|gb|ABX49576.1| Ribonucleoside-diphosphate reductase [Shewanella baltica OS195] (386 aa)
Score = 135, Expect = 2.5e-06, Identities = 68/226 (30%), Positives = 107/226 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D VVN E L  RA  +  YY                          +    LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H        +   G K   ++ ++  E Q E     FDL ++  + EKE+   L+
  S:    40 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYGALPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV-IFDDIVVNKEILS-RATDIAAYYDHLIQLTQVFHLLGAGTHVIDGKEVIVNTRTLKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILSIMQGGKDDPEMGEIAAECQQE----AFDLFFKAAEQEKEWAKYLF 302
>gi|160942848|ref|ZP_02090088.1| hypothetical protein FAEPRAM212_00325 [Faecalibacterium prausnitzii M21/2] >gi|158445900|gb|EDP22903.1| hypothetical protein FAEPRAM212_00325 [Faecalibacterium prausnitzii M21/2] (347 aa)
Score = 135, Expect = 2.7e-06, Identities = 74/282 (26%), Positives = 133/282 (47%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPYY-----IGDDP--LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK----QAEMKKFVFDLLYQVIDLEKEF----LNELYAGFNIADQAIKFSVYNAGKF-LQNLGYDSPFTPEETEIKPEIFVQLSARADENH---DFFSGSGSSY 324
           + +   NFW+PE+I +S D+  + +L S  +    +  + L  LDSIQ    ++  +   +T +E  +  +  AF   VH++SY  +  T CS  + N   + W  + E L +R   +   Y       D P  L+  +A  ++ G   Y GF   + L     +P +   IR I RD+  H +     ++  + +L  E+     AE  + + +++ + ++ E  +    + +   G N   Q I   +   G     +LGY + +   E+E  PE    +S  AD N    DFF    ++Y
  S:    46 YRQAMNNFWIPEEINLSQDVKDYPRLLSAERSAYDKILSFLVFLDSIQT--ANLPNIGAYITANEVNLCLSIQAFQECVHSQSYSYMLDTICSPVERNDILYQWKTD-EHLLRRNTFIGDCYNEFQERKDAPTLLRVMMANYILEGIYFYSGFMFFYNLSRNGKMPGSAQEIRYINRDENTHLWL----FRNIITELQKEQPELFTAESVQALREMMREGVEQEIAWGHYVIGDDIPGLN--RQMISDYIRYLGNLRWTSLGYPALYPGFESE--PESMEWVSQYADANMVKTDFFEARSTAY 337
>gi|17551968|ref|NP_497821.1| RiboNucleotide Reductase family member (rnr-2) [Caenorhabditis elegans] >gi|1172941|sp|P42170|RIR2_CAEEL Ribonucleoside-diphosphate reductase small chain (Ribonucleotide reductase small subunit) >gi|3873950|emb|CAA84688.1| C. elegans protein C03C10.3, confirmed by transcript evidence [Caenorhabditis elegans] (381 aa)
Score = 135, Expect = 3.0e-06, Identities = 50/222 (22%), Positives = 98/222 (44%)
  Q:    38 KDLEVWN---RITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSD-QINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           K  ++WN   +   +FW  E++ +  D+  W K++ + Q  + R        D I        +  N +   E   +  F   +  +H+  Y  +  T+   + + N+  + V   E ++K+A   +  +I D      +  +A A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y K   KL  ++       ++D++   + +E+EFL E
  S:    78 KHHDIWNFYKKAVASFWTVEEVDLGKDMNDWEKMNGDEQYFISRILAFFAASDGI-VNENLCERFSNEVQVSEARFFYGFQIAIENIHSEMYSKLIETYIRDETERNTLFNAVDEFEFIKKKADWAL-RWISDKKASFAERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSKLQKKLTQQR-------IYDIIKDAVAIEQEFLTE 298
>gi|113970253|ref|YP_734046.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella sp. MR-4] >gi|114047558|ref|YP_738108.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella sp. MR-7] >gi|113884937|gb|ABI38989.1| Ribonucleoside-diphosphate reductase [Shewanella sp. MR-4] >gi|113889000|gb|ABI43051.1| Ribonucleoside-diphosphate reductase [Shewanella sp. MR-7] (376 aa)
Score = 134, Expect = 3.1e-06, Identities = 70/226 (30%), Positives = 109/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +N L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D VVN E L +RA  +  YY                   I  +P       LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H N         +  K  PE     AE ++  ++L  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYNSLPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV-IFDDIVVNQEIL-RRATDIAEYYDHLIKLTQVYHLLGEGTHVIDGEPIEVNTRTLKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILTIMQAGKDDPEMGEIAAECQQEAYNLFLKAAEQEKEWAKYLF 292
>gi|118087248|ref|XP_418364.2| PREDICTED: hypothetical protein [Gallus gallus] (353 aa)
Score = 134, Expect = 3.2e-06, Identities = 62/254 (24%), Positives = 113/254 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNC----ESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL ++ +  +          D I      VA+    +   E   +  F  ++  VH+  Y  +  T+    +     D++ N       ++K+A   + +    +    +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +   V + P E++      V +++   +++E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    53 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHVLAFFAASDGI-VNENLVARFSQEVQIPEARCFYGFQILIENVHSEMYSLLIDTYIKDPE---KRDFLFNAIETMPCVKKKADWALKWIEDRESTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVNR-PSEER------VREIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFV---ADRLLMELGFSKVFHAE 308
>gi|90581239|ref|ZP_01237037.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio angustum S14] >gi|90437610|gb|EAS62803.1| ribonucleotide-diphosphate reductase beta subunit [Vibrio angustum S14] (377 aa)
Score = 134, Expect = 3.8e-06, Identities = 62/226 (27%), Positives = 112/226 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVL--------------------------IPYYIGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAK------LPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S D  ++N L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     ++  +    D +V  E + KRA  +                          +P+ +    LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE ++  FD+     + EKE+ + L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSGDRINYNNLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPIVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNNPSV--VFDDIVENEHIIKRAGDISKYYDALISATNDYHRYGEGSHSANGVPFTVNLHELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHILNLLRNGHDDPEMAEIAAECEQECFDIFKAAAEQEKEWADYLF 292
>gi|145553335|ref|XP_001462342.1| hypothetical protein GSPATT00027296001 [Paramecium tetraurelia strain d4-2] >gi|124430181|emb|CAK94969.1| unnamed protein product [Paramecium tetraurelia] (355 aa)
Score = 133, Expect = 5.2e-06, Identities = 48/219 (21%), Positives = 98/219 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAF-MVGVHARSYGSIFSTFCSSD-QINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           ++WN   Q   +FW  E+I +  DL  W KL ++ +  +          D I        Q    +   E   +  F   M  +H+ +Y  +  T+ + + + N     + N   +QK+A   + +   +D    + +A A + G    G F   F++  ++L+P       LI RD+ +H  ++   Y+  V K+  ++       + +++   +++EKEF++E
  S:    56 DIWNMYKQHKASFWTAEEIDLYQDLKDWEKLTADEKHFIKYVLAFFAASDGI-VNENLAQQFCTEVQVPEARCFYGFQIAMENIHSETYSLLIDTYITDENEKNYLLHAIDNVPVIQKKAMWAMKWINENDSFAERLIAFAAVEGIFFSGSFCAIFWIKKRSLMPGLTFSNELISRDEGLHTDFACLLYKHLVNKMSNQR-------IHEIISSAVEIEKEFISE 272
>gi|37526941|ref|NP_930285.1| ribonucleotide-diphosphate reductase subunit beta [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36786374|emb|CAE15427.1| ribonucleoside-diphosphate reductase 1 beta chain (ribonucleotide reductase 1) (B2 protein) (R2 protein) [Photorhabdus luminescens subsp. laumondii TTO1] (376 aa)
Score = 132, Expect = 5.7e-06, Identities = 67/251 (26%), Positives = 112/251 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI--------------GDDPLKSKVAAAMMPGF-----------------LLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKP 300
           FW PE++ +S D   +N L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY               G   +  K   A + G                    Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E   E ++  +DL  Q  + EKE+ + L++     G N  D   ++  Y     +Q +G   PF   ET   P
  S:    48 FWRPEEVDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPAV--VFDDIVTNEEILKRAKDISAYYDDLIEMTNHYQLFGEGTHQIAGKTITASLRGLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLLRSGQDDPEMAEIAKECEQQCYDLFVQAAEQEKEWADYLFSEGSMIGLN-KDILCQYVEYITNIRMQAVGLKLPF---ETRSNP 332
>gi|150015087|ref|YP_001307341.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium beijerinckii NCIMB 8052] >gi|149901552|gb|ABR32385.1| Ribonucleoside-diphosphate reductase [Clostridium beijerinckii NCIMB 8052] (344 aa)
Score = 132, Expect = 5.9e-06, Identities = 46/167 (27%), Positives = 82/167 (49%)
  Q:    49 NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           NFW+PE++ +S DL  +  L    +    +  + L  LDSIQ    +++ + N +T  E  +  T  +F   VH++SY  +  + CS ++ N       + + L KR + +   Y    ++P     L++ +A  ++ G   Y GF   + L     +P +   IR I RD+  H
  S:    51 NFWIPEEVNLSQDLKDYQNLLEEERIAYDKILSFLIFLDSIQT--ANLSNINNYITASEINLCLTIQSFQEAVHSQSYSYMLDSICSPEKRNEILYQWKDDDILLKRNKFIGDLYNEFIENPTEYNLLRTLMANYILEGIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTH 223
>gi|89074073|ref|ZP_01160574.1| ribonucleotide-diphosphate reductase beta subunit [Photobacterium sp. SKA34] >gi|89050211|gb|EAR55722.1| ribonucleotide-diphosphate reductase beta subunit [Photobacterium sp. SKA34] (377 aa)
Score = 132, Expect = 6.3e-06, Identities = 64/226 (28%), Positives = 112/226 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVL--------------------------IPYYIGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKL---PPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S D  ++N L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     ++  +    D +V  E + KRA  +                          IP+ +    LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +     PE      E ++  FDL     + EKE+ + L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSGDRINYNNLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPIVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNNPSV--VFDDIVENEHIVKRAGDISKYYDDLITVTNDYNRFGEGNHSANGIPFTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHILNLLRNGHDDPEMVEIATECEQDCFDLFKAAAEQEKEWADYLF 292
>gi|60416888|emb|CAD71206.1| ribonucleoside-diphospate reductase small subunit [Bacillus subtilis] (98 aa)
Score = 132, Expect = 6.5e-06, Identities = 30/87 (34%), Positives = 47/87 (54%)
  Q:    28 SVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF 114
           + NW+   DD     +N+  + FWLPE+IA++ DL +W  L  N Q+  ++   GLTLLD+ Q   G +  V   +  H++    NF
  S:    12 AANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTG-MPIVAEHVDGHQRKAVLNF 97
>gi|160881347|ref|YP_001560315.1| ribonucleoside-diphosphate reductase [Clostridium phytofermentans ISDg] >gi|160430013|gb|ABX43576.1| Ribonucleoside-diphosphate reductase [Clostridium phytofermentans ISDg] (342 aa)
Score = 132, Expect = 6.9e-06, Identities = 72/304 (23%), Positives = 133/304 (43%)
  Q:    31 WNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAI---------KFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDD 334
           WN I  D    ++  +  NFW+PE+I++  D+  +  L    +    +    L  LDSIQ+   ++  +   +T  E     N  AF   +HA+SY  I  T  +    +  +D     + L +R + +   Y    D+P     ++   A  ++ G   Y GF   + L  +  +  T  I + I RD++ H       +Q  + +L  E++    K + + L +++    E  +E+  G  + D  I         ++  Y + + L+ +G +  + PE T+   E     S       DFF    ++Y    V + DD
  S:    29 WNRIKYDWARLIYRTMLNNFWIPEEISLQEDVKQFPYLTDGERNAFDKIIAFLNFLDSIQSE--NLPNISRYITAPEVSSLLNVQAFQEEIHAQSYSYILDTVTNPVTRDRIYDIWREDKYLLERNKFIANIYQRFSDEPSDENFVRVVFANYILEGIYFYSGFSFFYTLARQGKMTATSTIFKYINRDEITHLVL----FQNIMKELRVEQKEMFTKGLEEELREMMRTGVE--HEIAWGQYVTDNQILGINNELIDQYIKYLSNQRLRAVGLEILY-PEITKHPMEWIESFSNINSTKTDFFEAKVTNYTKAAVFDFDD 340
>gi|160937686|ref|ZP_02085046.1| hypothetical protein CLOBOL_02576 [Clostridium bolteae ATCC BAA-613] >gi|158439331|gb|EDP17083.1| hypothetical protein CLOBOL_02576 [Clostridium bolteae ATCC BAA-613] (347 aa)
Score = 131, Expect = 7.1e-06, Identities = 53/209 (25%), Positives = 99/209 (47%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYY-----IGDDP--LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVID 251
           + +   NFW+PE+I +S DL  +  L +  +    +  + L  LDSIQ    ++  +   +T +E  +  T   F   VH++SY  +  + CS  ++    + W  + E L +R   +   Y       DD   L+  +A  ++ G   Y GF   + LG    +P ++  IR I RD+  H +     ++  +A+L  E+       + D+L  +++
  S:    46 YRQAMNNFWIPEEINLSADLKDYKNLTAAERTAYDKILSFLVFLDSIQT--ANLPCIAQYITANEVNLCLTIQGFQEAVHSQSYSYMLDSICSPVERDRILYQWKED-EHLLRRNTFIGNLYNEFQEKKDDVTLLRVIMANYILEGIYFYSGFMFFYNLGRGGKMPGSVQEIRYINRDENTHLWL----FRSMIAELRKEEPQLFTPKMVDMLRSMLE 256
>gi|114563305|ref|YP_750818.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella frigidimarina NCIMB 400] >gi|114334598|gb|ABI71980.1| Ribonucleoside-diphosphate reductase [Shewanella frigidimarina NCIMB 400] (376 aa)
Score = 131, Expect = 7.7e-06, Identities = 66/226 (29%), Positives = 106/226 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +  L  + Q + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     ++  +    D +V  + + KRA  +  YY                          +    LK  +   MM          Y  F   F    + ++     IIRLI RD+ +H N         +  K  PE     AE K+  +DL  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDFGNLPEHEQHIFLSNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNNPSL--VFDDIVQNDEILKRAGDIAAYYDDLINLTQINNLLGEGTHIINGKEITVNSRILKKSLYLCMMSVNALEAIRFYVSFACSFAFAERRVMEGNAKIIRLIARDEALHLNSTQHILALMQGGKDDPEMGEIAAECKQEAYDLFVKAAEQEKEWAKYLF 292
>gi|90412217|ref|ZP_01220223.1| ribonucleotide-diphosphate reductase beta subunit [Photobacterium profundum 3TCK] >gi|90326941|gb|EAS43326.1| ribonucleotide-diphosphate reductase beta subunit [Photobacterium profundum 3TCK] (377 aa)
Score = 131, Expect = 8.3e-06, Identities = 65/226 (28%), Positives = 108/226 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++ +     FW PE++ +S D   +N L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   I    D +V  + + KRA  +  YY  DD                             +K K+   MM          Y  F   F    + L+     II+LI RD+ +H        N   G     ++A +  E Q E     F++  +  + EKE+   L+
  S:    30 DQQKFEIFEKLIEKQLSFFWRPEEVDVSGDRIDYNNLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPIVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPAI--VFDDIVENDYIIKRAGDISKYY--DDLIAATSDYHRLGEGKHTVNGETITVNLREIKKKLYVCMMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALHLTGTQHILNLLRGRHDDPEMADIAQECQQE----CFEIFKEAAEQEKEWAEYLF 292
>gi|118383611|ref|XP_001024960.1| ribonucleoside-diphosphate reductase, beta subunit family protein [Tetrahymena thermophila SB210] >gi|89306727|gb|EAS04715.1| ribonucleoside-diphosphate reductase, beta subunit family protein [Tetrahymena thermophila SB210] (376 aa)
Score = 131, Expect = 9.0e-06, Identities = 51/226 (22%), Positives = 104/226 (46%)
  Q:    34 INDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVA-QVKNSLTDHEQVIYTNFAF-MVGVHARSYGSIFSTFCSSDQINSAHDWVV--NCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           I  +K  E++ +   +FW  ++I +  DL  W +L  N +  +          D I   + ++A Q    +   E   +  F   M  +H+ +Y  +  T+   D++   + +    N   + K+AQ  + +   +D   S+ +A A + G    G F   F+L  ++L+P       LI RD+ +H  ++   Y     KL  E+       +++++ + +++EKEF++E
  S:    73 IKYNKVWEMYKKELASFWTADEIDLYQDLKDWERLTDNERHFIKYVLAFFAASDGI--VLENLAEQFMCEVQIPEARAFYGFQIAMENIHSETYSLLIDTYIK-DEVEKDYLFKASQNVPVIHKKAQWALKWINNNDNFASRLIAFAAIEGIFFSGSFCAIFWLKKRSLMPGLTFSNELISRDEGLHTDFACLLYSMLNKKLTKEE-------IYEIITEAVEIEKEFISE 293
>gi|145953437|ref|ZP_01802445.1| hypothetical protein CdifQ_04003425 [Clostridium difficile QCD-32g58] (104 aa)
Score = 130, Expect = 9.2e-06, Identities = 31/100 (31%), Positives = 57/100 (56%)
  Q:   238 MKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDW 337
           +++ ++ +LY +++ E E+ N +Y    +  + + F  YNA + L+NLG++  +T +   I P +   LS    + HDFFS  G+ Y  G  EE +D+D+
  S:     6 LEEKMYSILYSLMENEIEYTNVIYRESGLEKEVVNFLKYNANRALENLGFEKLYTVD--AINPIVLNGLSTET-KTHDFFSTKGNGYQKGVYEELEDEDF 102
>gi|148380773|ref|YP_001255314.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum A str. ATCC 3502] >gi|153932443|ref|YP_001385057.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum A str. ATCC 19397] >gi|153934989|ref|YP_001388527.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum A str. Hall] >gi|148290257|emb|CAL84376.1| ribonucleoside-diphosphate reductase beta chain [Clostridium botulinum A str. ATCC 3502] >gi|152928487|gb|ABS33987.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum A str. ATCC 19397] >gi|152930903|gb|ABS36402.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum A str. Hall] (342 aa)
Score = 130, Expect = 1.0e-05, Identities = 53/199 (26%), Positives = 92/199 (46%)
  Q:    17 YAKDGLKGKMRSVNWNFINDDKDLEVWNRIT------------QNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           + + G +G    +N N  N    L  WNRI              NFW+PE+I+++ D+  +  L    +    +  + L  LDS+Q+   ++  +   +T  E     N   F   +HA+SY  I  T  +    +  +D     E L +R + +   Y     +P     L++ +A  ++ G   Y GF   + L  +  +  T  I + I RD+V H
  S:     7 FNEKGQRGTESMINGNTTN----LREWNRIKYSWASDFYRTMLNNFWIPEEISLNEDIKQFPYLTDGERNAFDKIISFLNFLDSVQSE--NLPNISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEHLLERNKFIAGIYEKFNKEPEIHNFLRAIMANYILEGIYFYSGFSFFYTLARQGKMTATSTIFKYINRDEVTH 219
>gi|153940168|ref|YP_001392091.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum F str. Langeland] >gi|170756361|ref|YP_001782419.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum B1 str. Okra] >gi|152936064|gb|ABS41562.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum F str. Langeland] >gi|169121573|gb|ACA45409.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium botulinum B1 str. Okra] (342 aa)
Score = 130, Expect = 1.0e-05, Identities = 53/199 (26%), Positives = 92/199 (46%)
  Q:    17 YAKDGLKGKMRSVNWNFINDDKDLEVWNRIT------------QNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           + + G +G    +N N  N    L  WNRI              NFW+PE+I+++ D+  +  L    +    +  + L  LDS+Q+   ++  +   +T  E     N   F   +HA+SY  I  T  +    +  +D     E L +R + +   Y     +P     L++ +A  ++ G   Y GF   + L  +  +  T  I + I RD+V H
  S:     7 FNEKGQRGTESMINGNTTN----LREWNRIKYSWASDFYRTMLNNFWIPEEISLNEDIKQFPYLTDGERNAFDKIISFLNFLDSVQSE--NLPNISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEHLLERNKFIAGIYEKFNKEPEIHNFLRAIMANYILEGIYFYSGFSFFYTLARQGKMTATSTIFKYINRDEVTH 219
>gi|88772960|gb|EAR04232.1| ribonucleotide-diphosphate reductase beta subunit [Alteromonas macleodii 'Deep ecotype'] (376 aa)
Score = 130, Expect = 1.1e-05, Identities = 71/242 (29%), Positives = 118/242 (48%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKN-SLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF 291
           FW PE++ +S D   + KL    + + +      TLLDS+Q    ++A +   SL + E  + T ++F   +H+RSY  I     S D      D VVN E +++RA  +  YY                          I    LK K+   M     +     Y  F   F    + L+     IIRLI RD+ +H        N ++  K   ++A++  E + E +    + + Q    EKE+ + L+      G N  +   ++  Y A + +  +G D+PF
  S:    48 FWRPEEVDVSRDRVDFQKLTDPEKHIFISNLKYQTLLDSVQGRSPNIAFLPIISLPELETWVET-WSFFETIHSRSYTHILRNLFS-DPSEIFEDIVVNDE-IKRRAADISKYYDDLIFATQLWQTQGEGVHTVNGTAYTINMYELKKKLYLCMNSVNALEAIRFYVSFACTFAFAERKLMEGNSKIIRLIARDENLHLSSTQHILNLWAKGKDDPEMAQIAQECKEEARAIFMNAVEQ----EKEWADYLFKTGSMIGLN-KEILCQYVEYIANQRMSAIGLDTPF 326
>gi|149637725|ref|XP_001508783.1| PREDICTED: similar to Ribonucleotide reductase M2 B (TP53 inducible) [Ornithorhynchus anatinus] (401 aa)
Score = 130, Expect = 1.1e-05, Identities = 65/251 (25%), Positives = 107/251 (42%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGY------DSPF 291
           E+W    Q   +FW  E++ +S DLP WNKL S  +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E +      V +++   +++E+EFL E       G N  +  Q I+F    A + L  LG+      D+PF
  S:   101 EIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKSEEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIKDPKKREFLFNAIETMPFVKKKADWSLRWIADRQSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVKK-PSEDK------VKEIIIDAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFV---ADRLLVELGFSKVFHSDNPF 359
>gi|126208467|ref|YP_001053692.1| ribonucleotide-diphosphate reductase subunit beta [Actinobacillus pleuropneumoniae L20] >gi|165976419|ref|YP_001652012.1| ribonucleotide-diphosphate reductase subunit beta [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|126097259|gb|ABN74087.1| ribonucleoside-diphosphate reductase subunit beta [Actinobacillus pleuropneumoniae L20] >gi|165876520|gb|ABY69568.1| ribonucleoside-diphosphate reductase, beta chain [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (376 aa)
Score = 130, Expect = 1.1e-05, Identities = 78/283 (27%), Positives = 136/283 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK---------------------------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDFFS 318
           D +  E++ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD ++                                   ++  ++     Y  F   F    + L+     II+ I RD+ +H        N  +  +   ++A++  E + E     +DL     + EKE+   L+      G N  D  +K+  Y     +Q +G   PF                      P+E E+   +  Q++A+ D N DF S
  S:    30 DQQKYELFEKLIEKQLSFFWRPEEVDVSQDRIDYQSLPEHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAKDISCYY--DDLIRDSQLYTLYGEGCYTVDGKQYQVTLRNLKRQLYLCLMSVNVLEAIRFYVSFACSFAFAERQLMEGNAKIIKFIARDEYLHLTGTQNMLNIIASGQDDPEMAEIAEECKQE----AYDLFVAAAEQEKEWAAYLFKDGSMIGLN-EDILVKYVEYITNIRMQAVGLPRPFAASSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQINAKVDTN-DFDS 373
>gi|50120137|ref|YP_049304.1| ribonucleotide-diphosphate reductase subunit beta [Pectobacterium atrosepticum SCRI1043] >gi|49610663|emb|CAG74108.1| ribonucleoside-diphosphate reductase 1 beta chain [Erwinia carotovora subsp. atroseptica SCRI1043] (376 aa)
Score = 129, Expect = 1.2e-05, Identities = 82/304 (26%), Positives = 135/304 (44%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNV--EETDDDDWDF 339
           D +  E++ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E + KRA+ +  YY                          +    LK ++   +M          Y  F   F    + L+     II+LI RD+ +H        N         ++A++  E Q E     +DL       EKE+   L+      G N  D   ++  Y     +Q +G   PF      I P I        VQ++ +  E         SSY++G +  E +DDD  DF
  S:    30 DQQKYEIFEKLIEKQLSFFWRPEEVDVSRDRIDYQALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSL--VFDDIVANEEILKRAKDISGYYDSLIEMTSYYHLLGEGTHQVNGKTVTVNLHALKKQLYVCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALHLTGTQHMLNLMRSGHDDPEMAQIAEECQQE----CYDLFVLAAQQEKEWAEYLFRDGSMIGLN-KDILCQYVEYITNIRMQGVGLSLPFQTRTNPI-PWINAWLVSDNVQVAPQEVEV--------SSYLVGQIDSEISDDDLSDF 374
>gi|161870162|ref|YP_001599332.1| ribonucleotide-diphosphate reductase subunit beta [Neisseria meningitidis 053442] >gi|161595715|gb|ABX73375.1| ribonucleoside diphosphate reductase I beta chain [Neisseria meningitidis 053442] (384 aa)
Score = 129, Expect = 1.4e-05, Identities = 64/226 (28%), Positives = 109/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMM-----PGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE+I +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   +    D +V  E +  RA+ +  YY                   +G  P       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE++   F L  +  + EKE+   L+
  S:    37 DQQKYEVFEKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGMHNVGGKPVTVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGVDDSEMAEIAAELQDECFQLFKKAAEQEKEWAAYLF 299
>gi|50949848|emb|CAH10473.1| hypothetical protein [Homo sapiens] (297 aa)
Score = 129, Expect = 1.4e-05, Identities = 61/253 (24%), Positives = 106/253 (41%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++ +   +FW  E++ +S DLP WNKL ++ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K PPE++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:     1 MYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PPEER------VREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFV---ADRLLVELGFSKVFQAE 252
>gi|194474072|ref|NP_001124015.1| ribonucleotide reductase M2 B (TP53 inducible) [Rattus norvegicus] >gi|149066498|gb|EDM16371.1| ribonucleotide reductase M2 B (TP53 inducible) (predicted) [Rattus norvegicus] (351 aa)
Score = 129, Expect = 1.4e-05, Identities = 63/254 (24%), Positives = 105/254 (41%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL S  +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKSEEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VMEIIVDAVKIEQEFLTEALPVGLIGMNCVLMKQYIEFV---ADRLLGELGFSKIFQAE 306
>gi|3914640|sp|O15910|RIR2_TRYBB Ribonucleoside-diphosphate reductase small chain (Ribonucleotide reductase small subunit) (Ribonucleotide reductase R2 subunit) >gi|2411479|gb|AAB70705.1| ribonucleotide reductase small subunit [Trypanosoma brucei] (337 aa)
Score = 129, Expect = 1.4e-05, Identities = 57/251 (22%), Positives = 112/251 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPF 291
           ++W +  +   + W  E+I + ND+  W KLD   +  +          D I   + ++A+  +        +  Y     M  +H+ +Y  +  T+    D+       +     ++K+A+  I +        ++ VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+K +  KLP ++       V +++   + +E+EF+ +       G N  +  Q I+F    A + L +LGYD  +
  S:    36 DIWQKYKEAESSIWTVEEIDLGNDMTDWEKLDDGERHFIKHVLAFFAASDGI--VLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVVDPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTSFPTRLVAFAAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKYIVNKLPRDR-------VLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFV---ADRLLVSLGYDRHY 288
>gi|7226528|gb|AAF41664.1| ribonucleoside-diphosphate reductase, beta subunit [Neisseria meningitidis MC58] (384 aa)
Score = 129, Expect = 1.4e-05, Identities = 64/226 (28%), Positives = 109/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMM-----PGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE+I +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   +    D +V  E +  RA+ +  YY                   +G  P       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE++   F L  +  + EKE+   L+
  S:    37 DQQKYEVFEKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGVHNVGGKPVTVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGVDDSEMAEIAAELQDECFQLFKKAAEQEKEWAAYLF 299
>gi|118443949|ref|YP_878438.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium novyi NT] >gi|118134405|gb|ABK61449.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium novyi NT] (342 aa)
Score = 129, Expect = 1.4e-05, Identities = 45/185 (24%), Positives = 88/185 (47%)
  Q:    31 WNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           WN I  +   E++  +  NFW+PE+I+++ D+  +  L    +    +  + L  LDS+Q+   ++  +   +T  E     N   F   +HA+SY  I  T  +    +  +D     ++L +R + +   Y    ++P     L++ +A  ++ G   Y GF   + L  +  +  T  I + I RD++ H
  S:    29 WNRIKYNWANELYRTMLNNFWIPEEISLNEDVKQFPYLTDGERNAFDKIISFLNFLDSVQSE--NLPNISRYITAPEVSSLLNVQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDKNLLERNKFIAGIYQSFNENPTTENFLRTIMANYILEGIYFYSGFSFFYTLARQGKMTATSTIFKYINRDEITH 219
>gi|152997008|ref|YP_001341843.1| ribonucleotide-diphosphate reductase subunit beta [Marinomonas sp. MWYL1] >gi|150837932|gb|ABR71908.1| Ribonucleoside-diphosphate reductase [Marinomonas sp. MWYL1] (377 aa)
Score = 129, Expect = 1.5e-05, Identities = 61/212 (28%), Positives = 102/212 (48%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY------------IG----DDPLKSKVAAAM----------------MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE++ +S D   + +L+ + Q + +      TLLDS+Q    +VA +   SL + E  I T ++F   +H+RSY  I     +        D +V  E + KRA  +  YY            +G    D P +  +  +M                +     Y  F   F    + L+     II+LI RD+ +H        N  +  K   ++A +  E Q E+++   +   Q    EKE+   L+
  S:    48 FWRPEEVDLSTDRKDFQRLEEHEQHIFLSNLKYQTLLDSVQGRSPNVALLPIVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDP--TKIFDDIVTNEEITKRADSVSKYYDRLIEMVNLYNTMGMGTFDVPGRGSIEISMPKLKKALYLTIASVNVLEAIRFYVSFACSFAFAERTLMEGNAKIIKLIARDEALHLTGTQHMLNLMASGKDDPEMAVIAAECQDEVRQIFIEAAEQ----EKEWATYLF 293
>gi|149721713|ref|XP_001493623.1| PREDICTED: ribonucleotide reductase M2 B (TP53 inducible) [Equus caballus] (351 aa)
Score = 129, Expect = 1.5e-05, Identities = 63/254 (24%), Positives = 107/254 (42%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL S+ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   +++E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLTSDEKYFISHVLAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALQWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVNAVEIEQEFLTEALPVDLIGMNCVLMKQYIEFV---ADRLLVELGFSKVFQAE 306
>gi|161353784|ref|NP_274308.2| ribonucleotide-diphosphate reductase subunit beta [Neisseria meningitidis MC58] (377 aa)
Score = 128, Expect = 1.6e-05, Identities = 64/226 (28%), Positives = 109/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMM-----PGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE+I +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   +    D +V  E +  RA+ +  YY                   +G  P       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE++   F L  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGVHNVGGKPVTVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGVDDSEMAEIAAELQDECFQLFKKAAEQEKEWAAYLF 292
>gi|59717937|gb|AAW89342.1| putative ribonucleoside diphosphate reductase I beta chain [Neisseria gonorrhoeae FA 1090] (384 aa)
Score = 128, Expect = 1.6e-05, Identities = 60/226 (26%), Positives = 104/226 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMM-----PGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE+I +S D   +  L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   +    D +V  E +  RA+ +  YY                   +G  P       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE++   F L  +  + EKE+   L+
  S:    37 DQQKYEVFEKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGVHNVGGKPVTVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGVDDPEMAEIAAELQDECFQLFKKAAEQEKEWAAYLF 299
>gi|74025548|ref|XP_829340.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] >gi|70834726|gb|EAN80228.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] (337 aa)
Score = 128, Expect = 1.6e-05, Identities = 57/248 (22%), Positives = 110/248 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYD 288
           ++W +  +   + W  E+I + ND+  W KLD   +  +          D I   + ++A+  +        +  Y     M  +H  +Y  +  T+    D+       +     ++K+A+  I +        ++ VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+K +  KLP ++       V +++   + +E+EF+ +       G N  +  Q I+F    A + L +LGYD
  S:    36 DIWQKYKEAESSIWTVEEIDLGNDMTDWEKLDDGERHFIKHVLAFFAASDGI--VLENLAERFMCEVQVPEVRCFYGFQIAMENIHCETYSVLIDTYVVDPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTSFPTRLVAFAAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKYIVNKLPRDR-------VLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFV---ADRLLVSLGYD 285
>gi|121635003|ref|YP_975248.1| ribonucleotide-diphosphate reductase subunit beta [Neisseria meningitidis FAM18] >gi|120866709|emb|CAM10461.1| ribonucleoside diphosphate reductase I beta chain [Neisseria meningitidis FAM18] (377 aa)
Score = 128, Expect = 1.7e-05, Identities = 64/226 (28%), Positives = 109/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMM-----PGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE+I +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   +    D +V  E +  RA+ +  YY                   +G  P       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE++   F L  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGMHNVGGKPITVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGVDDSEMAEIAAELQDECFQLFKKAAEQEKEWAAYLF 292
>gi|15794398|ref|NP_284220.1| ribonucleotide-diphosphate reductase subunit beta [Neisseria meningitidis Z2491] >gi|121052320|emb|CAM08650.1| ribonucleoside diphosphate reductase I beta chain [Neisseria meningitidis Z2491] (377 aa)
Score = 128, Expect = 1.7e-05, Identities = 64/226 (28%), Positives = 109/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMM-----PGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE+I +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   +    D +V  E +  RA+ +  YY                   +G  P       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE++   F L  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGVHNVGGKPITVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGVDDSEMAEIAAELQDECFQLFKKAAEQEKEWAAYLF 292
>gi|74025550|ref|XP_829341.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] >gi|70834727|gb|EAN80229.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] (337 aa)
Score = 128, Expect = 1.8e-05, Identities = 57/251 (22%), Positives = 112/251 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPF 291
           ++W +  +   + W  E+I + ND+  W KLD   +  +          D I   + ++A+  +        +  Y     M  +H+ +Y  +  T+    D+       +     ++K+A+  I +        ++ VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+K +  KLP ++       V +++   + +E+EF+ +       G N  +  Q I+F    A + L +LGYD  +
  S:    36 DIWQKYKEAESSIWTVEEIDLGNDMTDWEKLDDGERHFIKHVLAFFAASDGI--VLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVVDPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTSFPTRLVAFAAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKYIVNKLPRDR-------VLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFV---ADRLLVSLGYDRHY 288
>gi|161572976|ref|YP_207754.2| ribonucleotide-diphosphate reductase subunit beta [Neisseria gonorrhoeae FA 1090] >gi|194098862|ref|YP_002001926.1| ribonucleotide-diphosphate reductase beta subunit [Neisseria gonorrhoeae NCCP11945] >gi|193934152|gb|ACF29976.1| ribonucleotide-diphosphate reductase beta subunit [Neisseria gonorrhoeae NCCP11945] (377 aa)
Score = 128, Expect = 1.8e-05, Identities = 60/226 (26%), Positives = 104/226 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMM-----PGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE+I +S D   +  L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   +    D +V  E +  RA+ +  YY                   +G  P       LK K+   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++   + +         E  AE++   F L  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEIDVSRDRIDYANLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVENEYITARAEDIACYYDDLIEYTQYYNLLGEGVHNVGGKPVTVSLRGLKKKLYLCLMCVNVLEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGVDDPEMAEIAAELQDECFQLFKKAAEQEKEWAAYLF 292
>gi|117619492|ref|YP_856857.1| ribonucleotide-diphosphate reductase subunit beta [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117560899|gb|ABK37847.1| ribonucleoside-diphosphate reductase, beta subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (377 aa)
Score = 128, Expect = 1.8e-05, Identities = 65/226 (28%), Positives = 109/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------IGDD------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ R+ +     FW PE++ +S+D   +  L  + Q + +      TLLDSIQ    +VA +   S+ + E  I T +AF   +H+RSY  I     ++       D +V  E + KRA  +  +Y                     G D       LK K+   +M          Y  F   F    + L+     II++I RD+ +H   +G ++   + +         E  AE ++  F+L  +    EKE+   L+
  S:    30 DQQKHEVFERLIEKQLSFFWRPEEVDVSHDRIDFQALPPHEQHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WAFSETIHSRSYTHIIRNIVNTPA--QVFDDIVTNEQILKRAGSISHFYDDLIEATALYNLHGEGTHRVAGRDVTITLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALH--LTGTQHMLNLMRSGQDDPEMAEIAAECEQACFELFKEAAIQEKEWAEYLF 292
>gi|167623961|ref|YP_001674255.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella halifaxensis HAW-EB4] >gi|167353983|gb|ABZ76596.1| Ribonucleoside-diphosphate reductase [Shewanella halifaxensis HAW-EB4] (376 aa)
Score = 128, Expect = 2.0e-05, Identities = 78/301 (25%), Positives = 146/301 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSK-----VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIA--DQAI--KFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVEETDDDD 336
           D +  EV+ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   I    D +V  E + KRA  +  YY                          +    +K       V+  ++     Y  F   F    + ++     IIRLI RD+ +H            G K   ++A++      E ++   D+  +  + EKE+   L+   ++   ++ I  ++  Y   + ++++ + SP+  E+T   P +        VQ++ +  E         SSY++G ++ + DDD
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSI--VFDDIVENEEILKRASDIAKYYDHLIKLSQAYHLLGEGSHEIDGEIIEVTTREIKKALYLCMVSVNVLEAIRFYVSFACSFAFAERKVMEGNAKIIRLIARDEALHLNSTQHILKIMQGGKDDPEMAEI----AKECEQTAIDIFVKAAEQEKEWAKYLFKDGSMIGLNETILCQYVEYITNERMKSVNFASPYA-EQTNPLPWMKNWLESDSVQVAPQEVEV--------SSYLVGQIDSSIDDD 369
>gi|113461104|ref|YP_719172.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus somnus 129PT] >gi|170717681|ref|YP_001784756.1| ribonucleoside-diphosphate reductase [Haemophilus somnus 2336] >gi|112823147|gb|ABI25236.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Haemophilus somnus 129PT] >gi|168825810|gb|ACA31181.1| Ribonucleoside-diphosphate reductase [Haemophilus somnus 2336] (376 aa)
Score = 127, Expect = 2.1e-05, Identities = 75/281 (26%), Positives = 131/281 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK---------------------------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDF 316
           D +  E + ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD ++                                   ++   +     Y  F   F    + L+     II+ I RD+ +H   + +      A     + AE+    K+  ++L     + EKE+ + L+      G N  D  +++  Y     +Q +G   PF                      P+E E+   +  Q+ A+ D N DF
  S:    30 DQQKYETFEKLIEKQLSFFWRPEEVDVSQDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRARDISSYY--DDLIRDSQLYGLYGEGTYTVDGKACKVTLRNLKRQLYLCLMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDPEMAEIAEECKQEAYELFVAAAEQEKEWADYLFKDGSMIGLN-KDILVQYVEYITNIRMQAVGLPLPFQARSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQIDAKVDTN-DF 371
>gi|145298925|ref|YP_001141766.1| ribonucleotide-diphosphate reductase subunit beta [Aeromonas salmonicida subsp. salmonicida A449] >gi|142851697|gb|ABO90018.1| ribonucleoside-diphosphate reductase, beta subunit [Aeromonas salmonicida subsp. salmonicida A449] (377 aa)
Score = 127, Expect = 2.2e-05, Identities = 65/226 (28%), Positives = 110/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQ---KKVAKLPPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ R+ +     FW PE++ +S+D   +  L  + Q + +      TLLDSIQ    +VA +   S+ + E  I T +AF   +H+RSY  I     ++       D +V  E + KRA  +  +Y  DD                             LK K+   +M          Y  F   F    + L+     II++I RD+ +H   +G ++     +  +  PE     AE ++  F++  +    EKE+   L+
  S:    30 DQQKHEVFERLIEKQLSFFWRPEEVDVSHDRIDYQALPPHEQHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WAFSETIHSRSYTHIIRNIVNNP--GQVFDDIVTNEQILKRAGSISCFY--DDLIEATALYNLHGEGTHSVAGQMRTITLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALH--LTGTQHMLNLMRTGQDDPEMAEISAECEQACFEIFKEAAIQEKEWAEYLF 292
>gi|2465173|emb|CAA71741.1| ribonucleotide reductase (Class I) [Trypanosoma brucei brucei] (337 aa)
Score = 127, Expect = 2.2e-05, Identities = 57/251 (22%), Positives = 112/251 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPF 291
           ++W +  +   + W  E+I + ND+  W KLD   +  +          D I   + ++A+  +        +  Y     M  +H+ +Y  +  T+    D+       +     ++K+A+  I +        ++ VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+K +  KLP ++       V +++   + +E+EF+ +       G N  +  Q I+F    A + L +LGYD  +
  S:    36 DIWQKYKKAESSIWTVEEIDLGNDMTDWEKLDDGERHFIKHVLAFFAASDGI--VLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVVDPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTSFPTRLVAFAAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKYIVNKLPRDR-------VLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFV---ADRLLVSLGYDRHY 288
>gi|163748931|ref|ZP_02156182.1| ribonucleotide-diphosphate reductase beta subunit [Shewanella benthica KT99] >gi|161331307|gb|EDQ02195.1| ribonucleotide-diphosphate reductase beta subunit [Shewanella benthica KT99] (376 aa)
Score = 127, Expect = 2.3e-05, Identities = 61/226 (26%), Positives = 110/226 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI--------------------GDDPLKSK-----------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   I    D +V  E + KRA  +  YY                     G + L ++           V+  ++     Y  F   F    +N++     IIRLI RD+ +H   + +  +   A +   +  E+    ++  +D+  +  + EKE+   L+
  S:    30 DVQKYEVFEKLIEKQLSFFWRPEEVDVSKDKIDYAALPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSI--IFDDIVKNEEILKRATDIAQYYDDLILLTQAFHLHGEGTHIVNGKELLVTQRTIKKSLYLCMVSVNVLEAIRFYVSFACSFAFAERNVMEGNAKIIRLIARDEALHLNSTQHILKIMRAGVDDPEMGEIAEECEQLAYDIFVKAAEQEKEWAQYLF 292
>gi|24373963|ref|NP_718006.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella oneidensis MR-1] >gi|24348405|gb|AAN55450.1|AE015682_5 ribonucleoside-diphosphate reductase, beta subunit [Shewanella oneidensis MR-1] (376 aa)
Score = 127, Expect = 2.3e-05, Identities = 66/226 (29%), Positives = 107/226 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQV------LI-------------------PYYIGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +N L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D VVN E L++   +      LI                   P  +    LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H            G K   ++ ++  E Q E     ++L  +  + EKE+   L+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYNSLPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV-IFDDIVVNHEILRRATDIAEFYDHLIKLTQIYHLLGEGTHVIDGEPVEVNTRTLKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILTIMQGGKDDPEMGEIAIECQQE----AYNLFLKAAEQEKEWAKYLF 292
>gi|19703451|ref|NP_603013.1| ribonucleoside-diphosphate reductase beta chain [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713529|gb|AAL94312.1| Ribonucleoside-diphosphate reductase beta chain [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (348 aa)
Score = 127, Expect = 2.4e-05, Identities = 52/213 (24%), Positives = 98/213 (46%)
  Q:     3 NKKDYYNKSVSPIEYAKDGLKGKMRSV-NWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           ++K  +N        A+  +KG   ++ N N +      +++  +  NFW+PEK+ ++ D   +  L    +E      + L  LDSIQ    ++  + + +T  E  ++     F   +H++SY  I  +       +  +D   + + L +R   +   Y    D+      A  ++  +LL     Y GF   + L ++N +  T DIIRLI RD++ H
  S:     6 DRKKLFNPEGDDTLNARKIIKGNSTNLFNLNNVRYQWANQLYRTMMANFWIPEKVDLTQDKNDYENLTVPEREAYDGILSFLIFLDSIQTN--NIPNISDHVTAPEVNLLLAIQTFQEAIHSQSYQYIIESILPKQSRDLIYDKWRDDKVLFERNSFIAKIYQDFIDEQSDENFAKVIIANYLLESLYFYNGFNFFYLLASRNKMVGTSDIIRLINRDELSH 225
>gi|34763895|ref|ZP_00144797.1| Ribonucleoside-diphosphate reductase beta chain [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886329|gb|EAA23602.1| Ribonucleoside-diphosphate reductase beta chain [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (245 aa)
Score = 127, Expect = 2.4e-05, Identities = 52/213 (24%), Positives = 98/213 (46%)
  Q:     3 NKKDYYNKSVSPIEYAKDGLKGKMRSV-NWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           ++K  +N        A+  +KG   ++ N N +      +++  +  NFW+PEK+ ++ D   +  L    +E      + L  LDSIQ    ++  + + +T  E  ++     F   +H++SY  I  +       +  +D   + + L +R   +   Y    D+      A  ++  +LL     Y GF   + L ++N +  T DIIRLI RD++ H
  S:     6 DRKKLFNPEGDDTLNARKIIKGNSTNLFNLNNVRYQWANQLYRTMMANFWIPEKVDLTQDKNDYENLTVPEREAYDGILSFLIFLDSIQTN--NIPNISDHVTAPEVNLLLAIQTFQEAIHSQSYQYIIESILPKQSRDLIYDKWRDDKVLFERNSFIAKIYQDFIDEQSDENFAKVIIANYLLESLYFYNGFNFFYLLASRNKMVGTSDIIRLINRDELSH 225
>gi|148323806|gb|EDK89056.1| ribonucleoside-diphosphate reductase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (344 aa)
Score = 127, Expect = 2.6e-05, Identities = 45/175 (25%), Positives = 83/175 (47%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           +++  +  NFW+PEK+ ++ D   +  L    +E      + L  LDSIQ    ++  + + +T  E  ++     F   +H++SY  I  +       +  +D   + + L +R   +   Y    D+      A  ++  +LL     Y GF   + L ++N +  T DIIRLI RD++ H
  S:    41 QLYRTMMANFWIPEKVDLTQDKNDYENLTVPEREAYDGILSFLIFLDSIQTN--NIPNISDHVTAPEVNLLLAIQTFQEAIHSQSYQYIIESILPKQSRDLIYDKWRDDKVLFERNSFIAKIYQDFIDEQSDENFAKVIIANYLLESLYFYNGFNFFYLLASRNKMVGTSDIIRLINRDELSH 221
>gi|73974198|ref|XP_539109.2| PREDICTED: similar to ribonucleotide reductase M2 B (TP53 inducible) isoform 2 [Canis familiaris] (351 aa)
Score = 126, Expect = 2.7e-05, Identities = 63/254 (24%), Positives = 107/254 (42%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL S+ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   +++E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIEDRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFV---ADRLLVELGFSKVFQAE 306
>gi|71892252|ref|YP_277986.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71796358|gb|AAZ41109.1| ribonucleoside-diphosphate reductase 1, beta subunit [Candidatus Blochmannia pennsylvanicus str. BPEN] (376 aa)
Score = 126, Expect = 2.9e-05, Identities = 72/267 (26%), Positives = 120/267 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSK-----VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADEN--HDF 316
           FW PE+I IS D   +  L  + + + +      TLLDSIQ    ++A +        ++    ++F   +H+RSY  I     +   +    D +++ + + KRA+ +  YY                          +    LK K     ++  ++     Y  F   F    + L+     IIRLI RD+ +H        N         ++A +  E Q E     + L     + EK + N L+      G N  D   ++  Y     +Q +G  +PF                      P+E E    +  Q+    DEN  HDF
  S:    48 FWRPEEIDISKDRIDFQSLPDHEKHIFISNLKYQTLLDSIQGRSPNIALLPLISIPELEIWVETWSFFETIHSRSYTHIIRNIVNHPSL--IFDDIISNKEILKRAKDISTYYDNLIELTSYYHILGPGIHQINNNTVAVNLHELKKKLYLCLISVNVLEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEALHLNATQHILNLMRSGSDDPEMADISTECQQES----YALFLMAAEQEKNWANYLFKDGSMIGLN-KDILCQYIEYITNIRMQAIGLRTPFNIKSNVIPWINSWLSSDNVQVAPQEVEASSYLVGQIDPNIDENEFHDF 374
>gi|152993970|ref|YP_001359691.1| ribonucleotide-diphosphate reductase subunit beta [Sulfurovum sp. NBC37-1] >gi|151425831|dbj|BAF73334.1| ribonucleoside-diphosphate reductase, beta subunit [Sulfurovum sp. NBC37-1] (339 aa)
Score = 126, Expect = 3.2e-05, Identities = 63/292 (21%), Positives = 132/292 (45%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQV----IDLEKEFLNELYAG--FNIADQAI-KFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETD 333
           +W  +  N W P+++ ++ D+  + +L    ++   +    L  +DS+Q T   +  +   +T  E  +I    AF   +H++SY  +  +  ++ +    ++       L+ +   +   Y  + ++P    +  AM     + G   Y GF   + L   + +  T  +IR I RD+V H       +Q  +     E+     K + D +YQ+    + LE E+   +  G    + ++ I ++  Y A K L  +G +  +  E      + F Q +   D+  +FF G+ ++Y  G+++  D
  S:    42 LWEMMLNNTWFPKEVDMTRDVNDYKRLTDAEKQAYDKVLAQLIFMDSLQ-TNNIIDNLNPFITAPEVNLILVRQAFEEALHSQSYAVMVDSISTNSE--EIYELWRRDMKLKSKNDAIAKVYEELSENPTDENIVKAMFANQILEGIYFYSGFTYLYTLARSDKMLGTAQMIRFIQRDEVTHLLL----FQNMINATKRERPELFTKELIDDVYQMFRDAVKLECEWGTYITQGQILGLTNEIIEQYIQYLADKRLHAVGLEKIYNVEHPIKWVDNFSQFN---DQKTNFFEGNVTNYSKGSLDLDD 338
>gi|41054952|ref|NP_955770.1| ribonucleotide reductase M2 B (TP53 inducible) [Mus musculus] >gi|81885688|sp|Q6PEE3|RIR2B_MOUSE Ribonucleoside-diphosphate reductase subunit M2 B (TP53-inducible ribonucleotide reductase M2 B) (p53-inducible ribonucleotide reductase small subunit 2-like protein) (p53R2) >gi|34786000|gb|AAH58103.1| Ribonucleotide reductase M2 B (TP53 inducible) [Mus musculus] >gi|74218244|dbj|BAE23760.1| unnamed protein product [Mus musculus] (351 aa)
Score = 126, Expect = 3.3e-05, Identities = 63/254 (24%), Positives = 105/254 (41%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL S+ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E +      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWRMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEDR------VREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFV---ADRLLGELGFSKIFQAE 306
>gi|91793308|ref|YP_562959.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella denitrificans OS217] >gi|91715310|gb|ABE55236.1| Ribonucleoside-diphosphate reductase [Shewanella denitrificans OS217] (376 aa)
Score = 126, Expect = 3.4e-05, Identities = 68/212 (32%), Positives = 101/212 (47%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D VVN E L KRA  +  YY  DD                             LK  +   MM          Y  F   F    + L+     IIRLI RD+ +H            G K   ++A++  E Q +     +DL Y+  + EKE+   L+
  S:    48 FWRPEEVDVSRDKIDFTALPEHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV-IFDDIVVNDEIL-KRAGDIAKYY--DDLIHLTQIFNLHGAGTHLIEGKQVTVNLRVLKKSLYLCMMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILALMQGGKDDPEMAEIAIECQQQ----AYDLFYKAAEQEKEWAKYLF 292
>gi|157776117|ref|XP_001666124.1| hypothetical protein CBG20205 [Caenorhabditis briggsae AF16] >gi|187023588|emb|CAP37241.1| C. briggsae CBR-RNR-2 protein [Caenorhabditis briggsae] (365 aa)
Score = 126, Expect = 3.4e-05, Identities = 58/248 (23%), Positives = 106/248 (42%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQIN-SAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYD 288
           E+W    +   +FW  E++ +  D+  W K++ + Q  + R        D I        +  N +   E   +  F   +  +H+  Y  +  T+   ++      + +   E ++K+A   +  +I D      +  +A A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y     KL  E+       +F+++   + +E+EFL E       G N  +  Q I+F    A   LQ LG D
  S:    65 EIWQFYKKAVASFWTVEEVDLGKDMNDWEKMNGDEQYFISRVLAFFAASDGI-VNENLCERFSNEVKVSEARFFYGFQIAIENIHSEMYSKLIETYIRDEKERMKLFNAIFEFEFIKKKADWAL-RWISDTKASFAERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSMLQNKLSQER-------IFEIIRDAVAIEQEFLTEALPVDMIGMNCRLMSQYIEFV---ADHLLQELGCD 314
>gi|146312444|ref|YP_001177518.1| ribonucleotide-diphosphate reductase subunit beta [Enterobacter sp. 638] >gi|145319320|gb|ABP61467.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Enterobacter sp. 638] (376 aa)
Score = 125, Expect = 3.5e-05, Identities = 66/249 (26%), Positives = 108/249 (43%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D +V  E +QKRA+ +  YY                          +    LK ++   +M          Y  F   F    + L+     IIRLI RD+ +H   +G ++   + +         E   E K+  +DL       EKE+   L+      G N  D   ++  Y     +Q +G + PF      I
  S:    48 FWRPEEVDVSRDRIDFQALPDHEKHIFLSNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPAV--VFDDIVTNEQIQKRAEGISHYYDELIEMTSYWHLLGEGTHSVNGKTVTVNLRALKKQLYLCLMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALH--LTGTQHMLNLLRSGVDDPEMAEIAEECKQECYDLFVLAALQEKEWAEYLFRDGSMIGLN-KDILCQYIEYITNIRMQAVGLELPFKTRSNPI 333
>gi|33152746|ref|NP_874099.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus ducreyi 35000HP] >gi|33148970|gb|AAP96488.1| ribonucleoside-diphosphate reductase, beta chain [Haemophilus ducreyi 35000HP] (376 aa)
Score = 125, Expect = 3.5e-05, Identities = 76/281 (27%), Positives = 135/281 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK---------------------------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDF 316
           D +  E++ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD ++                                   ++  ++     Y  F   F    + L+     II+ I RD+ +H        N  +  +   ++A++  E Q E     +DL     + EKE+   L+      G N  +  +K+  Y     +Q++G   PF                      P+E E+   +  Q+ ++ D N DF
  S:    30 DQQKYELFEKLIEKQLSFFWRPEEVDVSQDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRARDISCYY--DDLIRDSQLYTLYGEGTYQVDGKACAVTLRNLKRQLYLCLMSVNVLEAIRFYVSFACSFAFAERQLMEGNAKIIKFIARDEYLHLAGTQQMLNIIASGQDDPEMAEIAIECQQE----AYDLFVAAAEQEKEWAEYLFKDGSMIGLN-KEILVKYVEYITNIRMQSVGLPLPFATQSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQIDSKVDSN-DF 371
>gi|126646890|ref|ZP_01719400.1| probable ribonucleoside-diphosphate reductase small chain [Algoriphagus sp. PR1] >gi|126576938|gb|EAZ81186.1| probable ribonucleoside-diphosphate reductase small chain [Algoriphagus sp. PR1] (326 aa)
Score = 125, Expect = 3.6e-05, Identities = 47/219 (21%), Positives = 95/219 (43%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDH--EQVIYTNFAFMVG-------VHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E + +   +FW  E+I +  D+  W  L+   +  +          D I         V  +L +H   +V YT   F  G       +H+ +Y  +  T+     + +   + + + + ++K+A   + +    +  +  +A A + G    G F   F+L  + L+P       LI RD+ +H  ++ + Y K V    P      K+ V +++   + +EKEF+ +
  S:    26 EYYKKAEASFWTAEEIDLGQDMVDWKSLNDGERHFISHVLAFFAASDGI---------VNENLAEHFVAEVQYTEAKFFYGFQIAMENIHSETYSLLIDTYIKDPSERDKLFNAIEHIDCVKKKADWALRWIDNGNFQERLIAFAAVEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACHLYTKHVVNPLP------KETVREIIIDAVKIEKEFVTD 239
>gi|74025552|ref|XP_829342.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] >gi|70834728|gb|EAN80230.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma brucei] (337 aa)
Score = 125, Expect = 4.2e-05, Identities = 57/251 (22%), Positives = 112/251 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPF 291
           ++W +  +   + W  E+I + ND+  W KLD   +  +          D I   + ++A+  +        +  Y     M  +H+ +Y  +  T+    D+       +     ++K+A+  I +        ++ VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+K +  KLP ++       V +++   + +E+EF+ +       G N  +  Q I+F    A + L +LGYD  +
  S:    36 DIWQKYKEAESSIWTVEEIDLGNDMTDWEKLDDGERHFIKHVLAFFAASDGI--VLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVVDPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTSFPTRLVAFAAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKYIVNKLPRDR-------VLEIICNAVLIEREFICDALPVRLIGMNSQLMTQYIEFV---ADRLLVSLGYDRHY 288
>gi|110636874|ref|YP_677081.1| ribonucleoside-diphosphate reductase 1, beta subunit [Cytophaga hutchinsonii ATCC 33406] >gi|110279555|gb|ABG57741.1| ribonucleoside-diphosphate reductase 1, beta subunit [Cytophaga hutchinsonii ATCC 33406] (324 aa)
Score = 125, Expect = 4.5e-05, Identities = 51/219 (23%), Positives = 97/219 (44%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC----SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKV-AKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           ++W    Q   +FW  E+I +S DL  W  L+   +  +          D I      V  ++       +  Y     M  +H+ +Y  +  T+       D++ +A D  V C  ++K+A   + +      +++ +A A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y K +  KLP E+       V  ++ + +++EKEF+ +
  S:    25 DIWAMYKQEEASFWTAEEIDLSQDLIDWANLNDGERHFISHVLAFFAASDGIVNENLAVNFLEKVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKEKDRLFNAID-TVPC--VKKKADWALRFIDNGSFIENIIAFAAVEGIFFSGSFCSVFWLKKRGLMPGLSFSNELISRDEGLHCDFACLLYTKYINNKLPAER-------VIQIILEAVEIEKEFVTD 241
>gi|121590730|ref|ZP_01678061.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae 2740-80] >gi|147674333|ref|YP_001216820.1| ribonucleotide-diphosphate reductase subunit beta [Vibrio cholerae O395] >gi|153212320|ref|ZP_01948108.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae 1587] >gi|153222506|ref|ZP_01953228.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MAK 757] >gi|153801907|ref|ZP_01956493.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MZO-3] >gi|153823603|ref|ZP_01976270.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae B33] >gi|153827294|ref|ZP_01979961.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MZO-2] >gi|153829732|ref|ZP_01982399.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae 623-39] >gi|194531877|ref|YP_002067316.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MO10] >gi|9655738|gb|AAF94414.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547411|gb|EAX57522.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae 2740-80] >gi|124116698|gb|EAY35518.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae 1587] >gi|124118843|gb|EAY37586.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MAK 757] >gi|124122552|gb|EAY41295.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MZO-3] >gi|125617831|gb|EAZ46383.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MO10] >gi|126518882|gb|EAZ76105.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae B33] >gi|146316216|gb|ABQ20755.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae O395] >gi|148874766|gb|EDL72901.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae 623-39] >gi|149738785|gb|EDM53127.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae MZO-2] >gi|150422390|gb|EDN14350.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae AM-19226] (389 aa)
Score = 124, Expect = 4.6e-05, Identities = 79/303 (26%), Positives = 143/303 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLK---------------------------------SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   + KL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD ++                                   ++   +     Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+      G N  D   ++  Y     +Q +G +  +        P I   LS+     A +  +      SSY++G ++ E   DD++
  S:    42 DQQKYEIFEKLIEKQLSFFWRPEEVDVSSDRIDYGKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPAV--VFDDIVENEHIIKRAKDIAHYY--DDLIELTNDYHRYGEGQHQINGETITVSLKELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLLRNGMDDFTFLQVAEECKQESFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILCQYVEYITNIRMQAVGLEPAYPAATNNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVSADDFE 385
>gi|145633337|ref|ZP_01789068.1| ribonucleotide-diphosphate reductase beta subunit [Haemophilus influenzae 3655] >gi|144986183|gb|EDJ92773.1| ribonucleotide-diphosphate reductase beta subunit [Haemophilus influenzae 3655] (376 aa)
Score = 124, Expect = 4.6e-05, Identities = 78/281 (27%), Positives = 131/281 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDF 316
           D +  E + ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRAQ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II+ I RD+ +H   + +      A     + AE+    K+  +DL     + EK + + L+      G N  D  +++  Y     +Q +G   PF                      P+E E+   +  Q+ ++ D N DF
  S:    30 DQQKYETFEKLIEKQLSFFWRPEEVDVSQDRIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAQDISSYY--DDLIRDSQLYGLYGEGTYTVDGKKCVVTLRSLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERRLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDPEMAEIAEECKQEAYDLFVAAAEQEKAWADYLFKDGSMIGLN-RDILVQYVEYITNIRMQAVGLPLPFQTRSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQIDSKVDTN-DF 371
>gi|16273547|ref|NP_439802.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae Rd KW20] >gi|42629010|ref|ZP_00154560.1| COG0208: Ribonucleotide reductase, beta subunit [Haemophilus influenzae R2846] >gi|42631890|ref|ZP_00157428.1| COG0208: Ribonucleotide reductase, beta subunit [Haemophilus influenzae R2866] >gi|68250262|ref|YP_249374.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae 86-028NP] >gi|145629252|ref|ZP_01785051.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae 22.1-21] >gi|145631490|ref|ZP_01787259.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae 22.4-21] >gi|145639184|ref|ZP_01794791.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae PittII] >gi|145641092|ref|ZP_01796673.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae R3021] >gi|1172943|sp|P43755|RIR2_HAEIN Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|1574510|gb|AAC23306.1| ribonucleoside diphosphate reductase, beta chain (nrdB) [Haemophilus influenzae Rd KW20] >gi|68058461|gb|AAX88714.1| ribonucleoside-diphosphate reductase beta chain [Haemophilus influenzae 86-028NP] >gi|144978755|gb|EDJ88478.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae 22.1-21] >gi|144982920|gb|EDJ90433.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae R3021] >gi|145271746|gb|EDK11656.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae PittII] >gi|145274253|gb|EDK14118.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae 22.4-21] (376 aa)
Score = 124, Expect = 4.6e-05, Identities = 78/281 (27%), Positives = 131/281 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDF 316
           D +  E + ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRAQ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II+ I RD+ +H   + +      A     + AE+    K+  +DL     + EK + + L+      G N  D  +++  Y     +Q +G   PF                      P+E E+   +  Q+ ++ D N DF
  S:    30 DQQKYETFEKLIEKQLSFFWRPEEVDVSQDRIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAQDISSYY--DDLIRDSQLYGLYGEGTYTVDGKECVVTLRSLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERRLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDPEMAEIAEECKQEAYDLFVAAAEQEKAWADYLFKDGSMIGLN-RDILVQYVEYITNIRMQAVGLPLPFQTRSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQIDSKVDTN-DF 371
>gi|91785256|ref|YP_560462.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia xenovorans LB400] >gi|91689210|gb|ABE32410.1| Ribonucleoside-diphosphate reductase [Burkholderia xenovorans LB400] (411 aa)
Score = 124, Expect = 4.7e-05, Identities = 67/279 (24%), Positives = 119/279 (42%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG 327
           N W+P+++ +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIPY ++  DP             L+S +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + ++  Q ++LE  +  +      +   A  F  Y      +  Q +G D P  P E    P +   +  + + N  FF      Y  G
  S:   111 NHWMPQEVNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VSSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PQLWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLD-PLYPNEENPFPWMSEMIDLKKERN--FFETRVIEYQTG 405
>gi|119472403|ref|ZP_01614521.1| ribonucleotide-diphosphate reductase beta subunit [Alteromonadales bacterium TW-7] >gi|119444925|gb|EAW26223.1| ribonucleotide-diphosphate reductase beta subunit [Alteromonadales bacterium TW-7] (376 aa)
Score = 124, Expect = 4.9e-05, Identities = 64/212 (30%), Positives = 104/212 (49%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKV---AKLPPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE++ +S D   +  L  + + + +      TLLDS+Q    +VA +   S+ + E  I T +AF   +H+RSY  I      S ++    D +V+ + + +RA  +  YY  DD                             LK K+  AMM   +L     Y  F   F    + L+     II+LI RD+ +H   SG ++   +    K  PE     A+ +     +  Q  + EKE+   L+
  S:    48 FWRPEEVDVSKDRLDFQALPEHEKHIFLSNLKYQTLLDSVQGRSPNVALLPIVSIPELETWIET-WAFSETIHSRSYTHIIRNVTQSPEL--IFDDIVSNDKISERADAVTTYY--DDLINSVSLYNLYGEGKHEINGKTVVVNLFELKKKLYLAMMSVNILEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LSGTQHILNIMQDGKDDPEMAIVAAQCRDEAIKMFVQAAEQEKEWAEYLF 292
>gi|71280050|ref|YP_269047.1| ribonucleotide-diphosphate reductase subunit beta [Colwellia psychrerythraea 34H] >gi|71145790|gb|AAZ26263.1| ribonucleotide reductase, beta subunit [Colwellia psychrerythraea 34H] (376 aa)
Score = 124, Expect = 5.4e-05, Identities = 68/242 (28%), Positives = 119/242 (49%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQA-TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIF-STFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKY---QKKVAKLPPEKQ---AEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF 291
           FW PE++ +S D   W  L  + + + +      TLLDS+ A ++  V     SL + E  + T +AF   +H+RSY  I  + F    +I    D +VN  ++ KRA  +  ++                          +    LK ++  A+     +     Y  F   F    + LL     II+LI RD+ +H   +G ++     +  K  PE +    E++     +   V++ EKE+   L+      G N AD   ++  Y + + L  +G+ +PF
  S:    48 FWRPEEVDVSKDRADWQSLTDSEKHIFISNLKYQTLLDSMAARSVNAVLLPLVSLPEVETWVET-WAFSETIHSRSYTHILRNLFTEPGEIFD--DIIVN-PAILKRASSIAKFFDDVILTTQLLQSQGEGTYEVEGKTVEVSTRKLKERLFLAVCSVNALEAIRFYVSFACSFAFAERELLEGNAKIIKLIARDEALH--LTGTQHILNNWRSGKDDPEMKIISEELRDEGLQIFLDVVEQEKEWAQYLFKDGSMIGLN-ADILNQYIEYISNQRLTAIGFGAPF 326
>gi|73542624|ref|YP_297144.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia eutropha JMP134] >gi|72120037|gb|AAZ62300.1| Ribonucleoside-diphosphate reductase [Ralstonia eutropha JMP134] (394 aa)
Score = 124, Expect = 5.4e-05, Identities = 63/247 (25%), Positives = 113/247 (45%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQA---TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+ +W   N L  + + ++ R        DS+ A    +G   Q+  +  +  Q +    AF   +H  +Y  I  +     ++  N+ H+     +S++ + + LIP+   + D   K+              V A +M G   Y GF     +G +N +    +  + ILRD+ +H N+      Q K+   P    AE K  + +L  + +DLE  +  +      +   A  F  Y      +  Q +G D  F  EE
  S:    94 NHWMPQEINMSRDIATWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQI--TAPECRQYLLRQ-AFEEAIHTHAYQYIVESLGLNEAEIFNAYHE----VQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLEN-PHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFPNEE 359
>gi|107021673|ref|YP_620000.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia cenocepacia AU 1054] >gi|116688619|ref|YP_834242.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia cenocepacia HI2424] >gi|105891862|gb|ABF75027.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia AU 1054] >gi|116646708|gb|ABK07349.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia HI2424] (382 aa)
Score = 124, Expect = 5.5e-05, Identities = 69/279 (24%), Positives = 119/279 (42%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG 327
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L  Q ++LE  +  +      +   A  F  Y    + +  Q +G D P  P E    P +   +  + + N  FF      Y  G
  S:    82 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLD-PLYPNEENPFPWMSEMIDLKKERN--FFETRVIEYQTG 376
>gi|126322530|ref|XP_001380256.1| PREDICTED: hypothetical protein [Monodelphis domestica] (361 aa)
Score = 124, Expect = 5.7e-05, Identities = 63/251 (25%), Positives = 108/251 (43%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGY------DSPF 291
           ++W    Q   +FW  E++ +S DLP WNKL S+ +  +          D I      V +    +   E   +  F  ++  +H+  Y  +  T+    Q        +      KR       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +   V K P E++      V +++   +++E+EFL +       G N  +  Q I+F    A + L  LG+      D+PF
  S:    61 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENIHSEMYSLLIDTYIKDPQKREFLFNAIETMPCVKRKADWALQWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVNK-PSEER------VKEIIINAVEIEQEFLTDALPVGLIGINSTLMKQYIEFV---ADRLLVELGFSKVFQSDNPF 319
>gi|187930114|ref|YP_001900601.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12J] >gi|187727004|gb|ACD28169.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12J] (402 aa)
Score = 124, Expect = 5.8e-05, Identities = 63/247 (25%), Positives = 114/247 (46%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQA---TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+ +W   N L  + + ++ R        DS+ A    +G   Q+  +  +  Q +    AF   +H  +Y  I  +     ++  N+ H+     +S++ + + LIP+   + D   K+              V A +M G   Y GF     +G +N +    +  + ILRD+ +H N+      Q K+   P    AE K  + +L  + +DLE  +  +      +   A  F  Y      +  Q +G D+ F  EE
  S:   102 NHWMPQEINMSRDIATWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQI--TAPECRQYLLRQ-AFEEAIHTHAYQYIVESLGLNEAEIFNAYHE----VQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLEN-PHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNEE 367
>gi|78486104|ref|YP_392029.1| ribonucleotide-diphosphate reductase subunit beta [Thiomicrospira crunogena XCL-2] >gi|78364390|gb|ABB42355.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Thiomicrospira crunogena XCL-2] (377 aa)
Score = 124, Expect = 5.8e-05, Identities = 59/212 (27%), Positives = 105/212 (49%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIG-----------------DDPLKSKVAAAM---------MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKV---AKLPPEKQ---AEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE+I +S+D   +  L  + + + +      TLLDS+Q    +VA +   S+ + E  I T ++F   +H+RSY  I     S   +    D +V  E + KRA  +  YY                   +D  + ++  A+         +     Y  F   F    ++L+     II+LI RD+ +H   SG ++   +    K  PE      E ++ V+++  +  + EKE+ + L+
  S:    54 FWRPEEIDLSSDRGEYANLPEHEKHVFISNLKYQTLLDSVQGRSPNVALLPLVSIPELETWIET-WSFSETIHSRSYTHIIRNIVSDPSL--VFDDIVANEEIVKRAISVTVYYDKLINLTNRMYAEEIDLETNDAFRKEIKTALFLTIVSVNVLEAIRFYVSFACSFSFAERSLMEGNAKIIKLIARDEALH--LSGTQHLINILSEGKDDPEMMEIAKENEEKVYEIFREAAEQEKEWADYLF 293
>gi|78065156|ref|YP_367925.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia sp. 383] >gi|77965901|gb|ABB07281.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. 383] (403 aa)
Score = 123, Expect = 6.0e-05, Identities = 69/279 (24%), Positives = 119/279 (42%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG 327
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L  Q ++LE  +  +      +   A  F  Y    + +  Q +G D P  P E    P +   +  + + N  FF      Y  G
  S:   103 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLD-PLYPNEENPFPWMSEMIDLKKERN--FFETRVIEYQTG 397
>gi|194557375|ref|YP_002092401.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia cenocepacia PC184] >gi|124871166|gb|EAY62882.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia cenocepacia PC184] (403 aa)
Score = 123, Expect = 6.2e-05, Identities = 63/247 (25%), Positives = 109/247 (44%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L  Q ++LE  +  +      +   A  F  Y    + +  Q +G D  F  EE
  S:   103 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEE 368
>gi|115350552|ref|YP_772391.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia ambifaria AMMD] >gi|172059584|ref|YP_001807236.1| ribonucleoside-diphosphate reductase [Burkholderia ambifaria MC40-6] >gi|115280540|gb|ABI86057.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria AMMD] >gi|171992101|gb|ACB63020.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria MC40-6] (403 aa)
Score = 123, Expect = 6.3e-05, Identities = 69/279 (24%), Positives = 119/279 (42%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG 327
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L  Q ++LE  +  +      +   A  F  Y    + +  Q +G D P  P E    P +   +  + + N  FF      Y  G
  S:   103 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLD-PLYPNEENPFPWMSEMIDLKKERN--FFETRVIEYQTG 397
>gi|29829569|ref|NP_824203.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces avermitilis MA-4680] >gi|29606677|dbj|BAC70738.1| putative ribonucleoside-diphosphate reductase beta chain [Streptomyces avermitilis MA-4680] (338 aa)
Score = 123, Expect = 6.7e-05, Identities = 75/299 (25%), Positives = 134/299 (44%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGD----DPLKSKVA-----------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK-QAEMKKFVFDLLYQVIDLEKEFLNEL----YAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDDDWDF 339
           E +    +N W  E++ + +D+    KL    Q L+ R        DSI A    +   K+  +   ++  +   F   VH + Y ++  T+    +   +A   V N  S++++A+     +I +    D L++K             AA + G   YG F   ++  ++ LL         + RD+ +H  ++ ++    V K  PE    E+++ V D+L + ++ E +F  +L      G N  +   ++    A + LQ LG    F P      P  F++L     E  +FF    S+Y +  VE T D D DF
  S:    28 ERYRDAIKNTWTVEEVDLHSDVADLAKLTPAEQHLIGRLVAFFATGDSIVANNLVLTLYKHINSPEARLYLSRQLFEEAVHVQFYLTLLDTYLPDPEDRTAAFAAVENIPSIREKAEFCFK-WINEVEKLDRLETKADRRRFLLNLICFAACIEGLFFYGAFAYVYWFRSRGLLHGLATGTNWVFRDETMHMSFA-FEVVDTVRKEEPELFDDELQQQVTDMLREAVEAELQFGRDLCGDGLPGMN-TESMRQYLECVADQRLQRLG----FAPVYGSENPFSFMELQG-VQELTNFFERRASAYQVA-VEGTVDLDEDF 338
>gi|150005609|ref|YP_001300353.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides vulgatus ATCC 8482] >gi|149934033|gb|ABR40731.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides vulgatus ATCC 8482] (349 aa)
Score = 123, Expect = 6.9e-05, Identities = 68/291 (23%), Positives = 132/291 (45%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPY------YIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSG---YKYQKKVAKL-PPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDS-PFTP--EETEIKPEIFVQLSARADENH---DFFSGSGSSYIMGNVEETD 333
           + +   NFW+PE+I ++ D   +  LD   +    +  + L  LDS+Q+   ++  +   +T +E  +  +  AF   VH++SY  +  + CS ++ N   + W  +   L++   +   Y        G   +K+ +A  ++ G   Y GF   + L     +  +   IR I RD+  H +       + +K+   L  P+K    +  + + + Q I+  +  + +   G N      +  + +  ++L NL + S  F P  EE   +PE    +S  ++ N    DFF    ++Y      E D
  S:    48 YRQAMNNFWIPEEINLTQDTKDYPHLDQAERTAYDKILSFLVFLDSLQSN--NLPTISEYITANEVNLCLHIQAFQECVHSQSYSYMLDSICSPEKRNEILYQWKTDGHLLKRNTFIGNCYNEFQESQDGFTLMKTLIANYILEGIYFYSGFMFFYNLSRNGKMSGSAQEIRYINRDENTHLWLFRNIILELKKEEPDLFTPDKVKIYEYMMREGVKQEIEWGQYVIGDNIQGLN------RKMIEDYIQYLGNLRWSSLGFGPLYEENHKEPESMHWVSQYSNANMVKTDFFEAKSTAYAKSTALEDD 348
>gi|149197800|ref|ZP_01874849.1| ribonucleotide-diphosphate reductase beta subunit [Lentisphaera araneosa HTCC2155] >gi|149139021|gb|EDM27425.1| ribonucleotide-diphosphate reductase beta subunit [Lentisphaera araneosa HTCC2155] (376 aa)
Score = 123, Expect = 6.9e-05, Identities = 83/290 (28%), Positives = 137/290 (47%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSK-----VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKV---AKLPPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNV--EETDD--DDWDF 339
           FW PE++ +S D   + KL ++ + + +      TLLDS+Q    +VA +        +     +AF   +H+RSY  I     +    +   D +VN ES+ +RA  +  YY                   I D P       LK +     V+  ++     Y  F   F    + ++     II+LI RD+ +H   +G +   ++    K  PE     AE +  V+ +     + EKE+   L+      G N AD    +  Y     L+  GY + F P      P +   LS+ A +         SSY++G +  E ++D  DD+DF
  S:    48 FWRPEEVDLSRDRADFKKLPAHEKHIFLSNLKYQTLLDSVQGRSPNVAFLPVISIPELETWVETWAFSETIHSRSYTHIIRNIVNDP--SEIFDDIVNNESIIQRASSVSHYYDSFIELQCYYNLLGEGTHMINDVPVVVNMRELKRRLFLTVVSVNVLEAIRFYVSFACSFAFAERAVMEGNAKIIKLIARDEALH--LTGTQQMIQIFREGKDDPEMAEIAAECEGQVYQIFSSAAEQEKEWAKFLFRDGSMIGLN-ADILGDYVEYITNVRLKASGYKNVF-PTTQNPLPWMNSWLSSDAVQVAP-QEVELSSYLVGQIDSEVSEDAFDDFDF 376
>gi|60682187|ref|YP_212331.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides fragilis NCTC 9343] >gi|60493621|emb|CAH08410.1| putative ribonucleoside-diphosphate reductase beta chain [Bacteroides fragilis NCTC 9343] (349 aa)
Score = 123, Expect = 7.3e-05, Identities = 70/291 (24%), Positives = 135/291 (46%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE--LYAGFNIADQAIKFS---VYNAGKFLQNLGYDS-PFTP--EETEIKPEIFVQLSARADENH---DFFSGSGSSYIMGNVEETD 333
           + +   NFW+PE+I ++ D   +  L    +    +  + L  LDS+Q+   ++  +   +T +E  +  +  AF   VH++SY  +  + CS ++ N   + W  + E L +R   +   Y        G   +K+ +A  ++ G   Y GF   + L     +  +   IR I RD+  H +     ++  + +L   K+ E + F  D +    ++ +E + +   +  + I DQ    +   + +   FL NL + S  +TP  E+   +PE    +S  ++ N    DFF    ++Y      E D
  S:    48 YRQAMNNFWIPEEINLTQDTKDYPHLTPAERTAYDKILSFLVFLDSLQSN--NLPTLSEYITANEVNLCLHIQAFQECVHSQSYSYMLDSICSPEERNDILYQWKTD-EHLLRRNTFIGNCYNEFQENRDGFALMKTLIANYILEGIYFYSGFMFFYNLSRNGKMSGSAQEIRYINRDENTHLWL----FRNIILEL---KKEEPELFTPDKVKVYEEMMREGVKQEIAWGQYVIGDQIQGLNRQMISDYIHFLGNLRWSSLGYTPLYEDNRKEPESMHWVSQYSNANMVKTDFFEAKSTAYAKSTALEDD 348
>gi|146090952|ref|XP_001466403.1| ribonucleoside-diphosphate reductase small chain [Leishmania infantum JPCM5] >gi|134070765|emb|CAM69122.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania infantum] (392 aa)
Score = 123, Expect = 7.4e-05, Identities = 45/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   I ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    91 DIWRKYKEQESCIWTVEEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGI--VIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 306
>gi|15290503|gb|AAK92210.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides fragilis] (349 aa)
Score = 123, Expect = 7.5e-05, Identities = 70/291 (24%), Positives = 135/291 (46%)
  Q:    43 WNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE--LYAGFNIADQAIKFS---VYNAGKFLQNLGYDS-PFTP--EETEIKPEIFVQLSARADENH---DFFSGSGSSYIMGNVEETD 333
           + +   NFW+PE+I ++ D   +  L    +    +  + L  LDS+Q+   ++  +   +T +E  +  +  AF   VH++SY  +  + CS ++ N   + W  + E L +R   +   Y        G   +K+ +A  ++ G   Y GF   + L     +  +   IR I RD+  H +     ++  + +L   K+ E + F  D +    ++ +E + +   +  + I DQ    +   + +   FL NL + S  +TP  E+   +PE    +S  ++ N    DFF    ++Y      E D
  S:    48 YRQAMNNFWIPEEINLTQDTKDYPHLTPAERTAYDKILSFLVFLDSLQSN--NLPTLSEYITANEVNLCLHIQAFQECVHSQSYSYMLDSICSPEERNDILYQWKTD-EHLLRRNTFIGNCYNEFQENRDGFALMKTLIANYILEGIYFYSGFMFFYNLSRNGKMSGSAQEIRYINRDENTHLWL----FRNIILEL---KKEEPELFTPDKVKVYEEMMREGVKQEIAWGQYVIGDQIQGLNRQMISDYIHFLGNLRWSSLGYTPLYEDNRKEPESMHWVSQYSNANMVKTDFFEAKSTAYAKSTALEDD 348
>gi|148676854|gb|EDL08801.1| ribonucleotide reductase M2 B (TP53 inducible) [Mus musculus] (297 aa)
Score = 123, Expect = 7.5e-05, Identities = 61/253 (24%), Positives = 104/253 (41%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++ +   +FW  E++ +S DLP WNKL S+ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E +      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:     1 MYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEDR------VREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFV---ADRLLGELGFSKIFQAE 252
>gi|109087114|ref|XP_001100144.1| PREDICTED: similar to ribonucleotide reductase M2 B (TP53 inducible) isoform 3 [Macaca mulatta] >gi|75076588|sp|Q4R741|RIR2B_MACFA Ribonucleoside-diphosphate reductase subunit M2 B >gi|67969468|dbj|BAE01083.1| unnamed protein product [Macaca fascicularis] (351 aa)
Score = 123, Expect = 7.6e-05, Identities = 62/254 (24%), Positives = 106/254 (41%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL ++ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVDAVQIEQEFLTEALPVGLIGMNCILMKQYIEFV---ADRLLVELGFSKIFQAE 306
>gi|20069937|ref|NP_613141.1| ribonucleotide reductase small subunit [Mamestra configurata NPV-A] >gi|20043331|gb|AAM09166.1| ribonucleotide reductase small subunit [Mamestra configurata NPV-A] >gi|33331769|gb|AAQ11077.1| putative ribonucleotide reductase small subunit-like protein [Mamestra configurata nucleopolyhedrovirus A] (313 aa)
Score = 123, Expect = 7.6e-05, Identities = 55/219 (25%), Positives = 100/219 (45%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCS----SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E + R    FW  E++ +S D   +  KL+++ +  ++      +  DSI   I  +  +  ++ + E V +  F A M  VH + YG++           D I +A D   N   ++K+    + +   D    ++  VA A++ G    G F   FY+    ++P       LI RD+ +H  ++   Y  +V  KL  EK       + D+  + +D+EKEF  +
  S:    18 EAYKRAEACFWRMEEVDLSKDYDDFQLKLNNDQRHFIMHVLGFFSAADSI-VNINVLNYMLQTVPELEAVYFYTFQAAMENVHTQMYGTLIIELIPDKKHQDLILNAFD---NVPCVRKKDDWALKWIENDKATFAERLVAFAIVEGVFFSGSFAAIFYIKTLGIMPGLTFSNELISRDEGMHTDFACLYYNTRVKEKLSYEK-------ILDMFKEAVDIEKEFFTD 234
>gi|149911236|ref|ZP_01899859.1| ribonucleotide-diphosphate reductase beta subunit [Moritella sp. PE36] >gi|149805690|gb|EDM65689.1| ribonucleotide-diphosphate reductase beta subunit [Moritella sp. PE36] (376 aa)
Score = 122, Expect = 7.8e-05, Identities = 52/180 (28%), Positives = 89/180 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           D +  E++ ++ +     FW PE++ +S D   + +L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +    +   D +V  E + KRA+ +  YY                          +    +K K+  AM     +     Y  F   F    + L+     II+LI RD+ +H
  S:    30 DQQKYEIFEKLIERQLSFFWRPEEVDVSKDRIDYQQLPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIINDP--SEVFDDIVANEEILKRAKDIAGYYDDLINATQQLHQLGEGTHVVNGETIVVSQRAVKKKLYLAMVSVNVLEAVRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH 242
>gi|161525957|ref|YP_001580969.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia multivorans ATCC 17616] >gi|160343386|gb|ABX16472.1| Ribonucleoside-diphosphate reductase [Burkholderia multivorans ATCC 17616] (396 aa)
Score = 122, Expect = 8.0e-05, Identities = 63/247 (25%), Positives = 108/247 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L  Q ++LE  +  +      +   A  F  Y      +  Q +G D  F  EE
  S:    96 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLFPNEE 361
>gi|194534554|ref|YP_002069765.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae RC385] >gi|150419272|gb|EDN11683.1| ribonucleoside-diphosphate reductase, beta subunit [Vibrio cholerae RC385] (372 aa)
Score = 122, Expect = 8.0e-05, Identities = 79/303 (26%), Positives = 143/303 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLK---------------------------------SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   + KL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD ++                                   ++   +     Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+      G N  D   ++  Y     +Q +G +  +        P I   LS+     A +  +      SSY++G ++ E   DD++
  S:    25 DQQKYEIFEKLIEKQLSFFWRPEEVDVSSDRIDYGKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPAV--VFDDIVENEHIIKRAKDIAHYY--DDLIELTNDYHRYGEGQHQINGETITVSLKELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLLRNGMDDFTFLQVAEECKQESFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILCQYVEYITNIRMQAVGLEPAYPAATNNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVSADDFE 368
>gi|161582009|ref|NP_230900.2| ribonucleotide-diphosphate reductase subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] (377 aa)
Score = 122, Expect = 8.0e-05, Identities = 79/303 (26%), Positives = 143/303 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLK---------------------------------SKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK------QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSAR----ADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           D +  E++ ++ +     FW PE++ +S+D   + KL  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD ++                                   ++   +     Y  F   F    + L+     II+LI RD+ +H   +G ++   + +   +         E K+  FDL  +  + EKE+   L+      G N  D   ++  Y     +Q +G +  +        P I   LS+     A +  +      SSY++G ++ E   DD++
  S:    30 DQQKYEIFEKLIEKQLSFFWRPEEVDVSSDRIDYGKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPAV--VFDDIVENEHIIKRAKDIAHYY--DDLIELTNDYHRYGEGQHQINGETITVSLKELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLLRNGMDDFTFLQVAEECKQESFDLFKEAAEQEKEWAEYLFKDGSMIGLN-KDILCQYVEYITNIRMQAVGLEPAYPAATNNPIPWINAWLSSDNVQVAPQEAEI-----SSYLVGQIDNEVSADDFE 373
>gi|114772484|ref|ZP_01449857.1| ribonucleotide-diphosphate reductase beta subunit [alpha proteobacterium HTCC2255] (376 aa)
Score = 122, Expect = 8.1e-05, Identities = 82/289 (28%), Positives = 132/289 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKE-----FLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFT------PEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVE-ETDDDDWD 338
           FW PE++ +S D   +  L    + + +      TLLDS+Q    ++A +   SL + E  I T ++F   +H+RSY  I      +D  N   D V N E +++RA  +  YY                          I    LK K+   M     +     Y  F   F    + L+     IIRLI RD+ +H        N ++  K   ++A++  E + E +    D+    +  EKE     F N    G N  +    +  Y A + +  +G   PF       P          VQ++ +  E         SSY++G ++ E   DD+D
  S:    48 FWRPEEVDVSKDRMDFQGLSDAEKHIFISNLKYQTLLDSVQGRSPNIALLPIVSLPELETWIET-WSFFETIHSRSYTHILRNL-FTDPSNIFEDIVEN-EEIKRRAADISKYYDDLIFATQLWQTQGEGTHEVNGETHIINMRELKKKLYLCMNSVNALEAIRFYVSFACTFAFAERELMEGNSKIIRLIARDENLHLTSTQHVLNLWAKGKDDPEMAEIAKECEQEAR----DIFLNAVQQEKEWAAFLFNNGSMIGLN-EEILCSYVEYIANQRMAAIGLGQPFDVSSNPLPWMNNYLNSDNVQVAPQESEI--------SSYLVGQIDAEVSADDFD 372
>gi|170726650|ref|YP_001760676.1| ribonucleoside-diphosphate reductase [Shewanella woodyi ATCC 51908] >gi|169811997|gb|ACA86581.1| Ribonucleoside-diphosphate reductase [Shewanella woodyi ATCC 51908] (376 aa)
Score = 122, Expect = 8.2e-05, Identities = 64/226 (28%), Positives = 106/226 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEK---QAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  EV+ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   I    D +V  E + KRA  +  YY                          +    +K  +   MM   +L     Y  F   F    + ++     IIRLI RD+ +H N         +  K  PE      E ++  +D+  +  + EKE+   L+
  S:    30 DVQKYEVFEKLIEKQLSFFWRPEEVDVSKDKIDYAALPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSI--VFDDIVENEEILKRASDIAEYYDTLIKLTQAFHLLGEGTHMIDGRELIVTKREIKKALYLCMMSVNVLEAIRFYVSFACSFAFAERKVMEGNAKIIRLIARDEALHLNSTQHIIKLMQAGKDDPEMGEIAKECEQQAYDIFVKAAEQEKEWARYLF 292
>gi|42544136|ref|NP_056528.2| ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens] >gi|114621161|ref|XP_001153916.1| PREDICTED: ribonucleotide reductase M2 B (TP53 inducible) isoform 2 [Pan troglodytes] >gi|74727333|sp|Q7LG56|RIR2B_HUMAN Ribonucleoside-diphosphate reductase subunit M2 B (TP53-inducible ribonucleotide reductase M2 B) (p53-inducible ribonucleotide reductase small subunit 2-like protein) (p53R2) >gi|7229086|dbj|BAA92434.1| ribonucleotide reductase [Homo sapiens] >gi|7229115|dbj|BAA92493.1| ribonucleotide reductase [Homo sapiens] >gi|45259569|dbj|BAD12267.1| p53-inducible ribonucleotide reductase small subunit 2 [Homo sapiens] >gi|52545612|emb|CAB70703.2| hypothetical protein [Homo sapiens] >gi|63055293|gb|AAY29059.1| ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens] >gi|80473666|gb|AAI08262.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens] >gi|109659128|gb|AAI17497.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens] >gi|119612247|gb|EAW91841.1| ribonucleotide reductase M2 B (TP53 inducible), isoform CRA_b [Homo sapiens] >gi|120660296|gb|AAI30629.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens] >gi|190689549|gb|ACE86549.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic construct] >gi|190690911|gb|ACE87230.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic construct] (351 aa)
Score = 122, Expect = 8.2e-05, Identities = 62/254 (24%), Positives = 106/254 (41%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL ++ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFV---ADRLLVELGFSKVFQAE 306
>gi|157869457|ref|XP_001683280.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania major] >gi|68224164|emb|CAJ04657.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania major] (392 aa)
Score = 122, Expect = 8.3e-05, Identities = 45/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   I ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    91 DIWRKYKEQESCIWTVEEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGI--VIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 306
>gi|53713986|ref|YP_099978.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides fragilis YCH46] >gi|52216851|dbj|BAD49444.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides fragilis YCH46] (349 aa)
Score = 122, Expect = 8.3e-05, Identities = 70/285 (24%), Positives = 133/285 (46%)
  Q:    49 NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE--LYAGFNIADQAIKFS---VYNAGKFLQNLGYDS-PFTP--EETEIKPEIFVQLSARADENH---DFFSGSGSSYIMGNVEETD 333
           NFW+PE+I ++ D   +  L    +    +  + L  LDS+Q+   ++  +   +T +E  +  +  AF   VH++SY  +  + CS ++ N   + W  + E L +R   +   Y        G   +K+ +A  ++ G   Y GF   + L     +  +   IR I RD+  H +     ++  + +L   K+ E + F  D +    ++ +E + +   +  + I DQ    +   + +   FL NL + S  +TP  E+   +PE    +S  ++ N    DFF    ++Y      E D
  S:    54 NFWIPEEINLTQDTKDYPHLTPAERTAYDKILSFLVFLDSLQSN--NLPTLSEYITANEVNLCLHIQAFQECVHSQSYSYMLDSICSPEERNDILYQWKTD-EHLLRRNTFIGNCYNEFQENRDGFALMKTLIANYILEGIYFYSGFMFFYNLSRNGKMSGSAQEIRYINRDENTHLWL----FRNIILEL---KKEEPELFTPDKVKVYEEMMREGVKQEIAWGQYVIGDQIQGLNRQMISDYIHFLGNLRWSSLGYTPLYEDNRKEPESMHWVSQYSNANMVKTDFFEAKSTAYAKSTALEDD 348
>gi|145634465|ref|ZP_01790175.1| ribonucleotide-diphosphate reductase beta subunit [Haemophilus influenzae PittAA] >gi|145268445|gb|EDK08439.1| ribonucleotide-diphosphate reductase beta subunit [Haemophilus influenzae PittAA] (376 aa)
Score = 122, Expect = 8.6e-05, Identities = 78/281 (27%), Positives = 131/281 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDF 316
           D +  E + ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRAQ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II+ I RD+ +H   + +      A     + AE+    K+  +DL     + EK + + L+      G N  D  +++  Y     +Q +G   PF                      P+E E+   +  Q+ ++ D N DF
  S:    30 DQQKYETFEKLIEKQLSFFWRPEEVDVSQDRIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAQDISSYY--DDLIRDSQLYGLYSEGTYTVDGKECVVTLRSLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERRLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDLEMAEIAEECKQEAYDLFVAAAEQEKAWADYLFKDGSMIGLN-RDILVQYVEYITNIRMQAVGLPLPFQTRSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQIDSKVDTN-DF 371
>gi|157371509|ref|YP_001479498.1| ribonucleotide-diphosphate reductase subunit beta [Serratia proteamaculans 568] >gi|157323273|gb|ABV42370.1| Ribonucleoside-diphosphate reductase [Serratia proteamaculans 568] (376 aa)
Score = 122, Expect = 8.6e-05, Identities = 73/263 (27%), Positives = 122/263 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKY----QKKVAKLP--PEKQAEMKKFVFDLLYQVIDLEKEFLNELY-----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           D +  E++ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T ++F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II+LI RD+ +H   +G ++     +  A  P   E   E ++  +DL     + EKE+   L+      G N  D   ++  Y     +Q +G   PF      I
  S:    30 DQQKHEIFEKLIEKQLSFFWRPEEVDVSRDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWIET-WSFSETIHSRSYTHIIRNIVNDPAI--VFDDIVTNEEILKRAKDISGYY--DDLIEMTGYYHLLGEGTHQVNGKTVTVTLRALKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH--LTGTQHMLNLMRSGADDPEMAEIAVECQQQCYDLFVLAAEQEKEWAEYLFRDGSMIGLN-KDILCQYVEYITNIRMQAVGLGLPFATRSNPI 333
>gi|109898789|ref|YP_662044.1| ribonucleotide-diphosphate reductase subunit beta [Pseudoalteromonas atlantica T6c] >gi|109701070|gb|ABG40990.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Pseudoalteromonas atlantica T6c] (376 aa)
Score = 122, Expect = 8.7e-05, Identities = 67/242 (27%), Positives = 109/242 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF 291
           FW PE++ +S D   + KL  + + + +      TLLDSIQ    ++A +        +     ++F   +H+RSY  I          +S    +V  E ++KRA  +  YY  DD                             LK K+   M     +     Y  F   F    + L+     IIRLI RD+ +H        N ++  K   ++A++  E + E      D + Q    EKE+   L+      G N  D   ++  + A   +  +G D PF
  S:    48 FWRPEEVDVSKDRVDFQKLSESEKHIFISNLKYQTLLDSIQGRSPNIAFLPIISIPELETWTETWSFFETIHSRSYTHILRNLFGDP--SSIFSDIVENEQIKKRAADISKYY--DDLIFYTQLWQTLGEGTHTINGEEHVVTMRTLKIKLFLCMNSVNALEAIRFYVSFACTFAFAERELMEGNSKIIRLISRDENLHLTSTQHILNLWAKGKDDPEMAEIALEYKEEATNIFLDAVNQ----EKEWAEYLFQNGSMIGLN-KDILCQYVEFIANHRMSAIGLDQPF 326
>gi|46143780|ref|ZP_00134247.2| COG0208: Ribonucleotide reductase, beta subunit [Actinobacillus pleuropneumoniae serovar 1 str. 4074] (336 aa)
Score = 122, Expect = 8.8e-05, Identities = 68/256 (26%), Positives = 120/256 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK---------------------------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF 291
           D +  E++ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD ++                                   ++  ++     Y  F   F    + L+     II+ I RD+ +H        N  +  +   ++A++  E + E     +DL     + EKE+   L+      G N  D  +K+  Y     +Q +G   PF
  S:    30 DQQKYELFEKLIEKQLSFFWRPEEVDVSQDRIDYQSLPEHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAKDISCYY--DDLIRDSQLYTLYGEGCYTVDGKQYQVTLRNLKRQLYLCLMSVNVLEAIRFYVSFACSFAFAERQLMEGNAKIIKFIARDEYLHLTGTQNMLNIIASGQDDPEMAEIAEECKQE----AYDLFVAAAEQEKEWAAYLFKDGSMIGLN-EDILVKYVEYITNIRMQAVGLPRPF 326
>gi|21959884|gb|AAM86526.1|AE013899_3 ribonucleoside-diphosphate reductase 1, beta subunit, B2 [Yersinia pestis KIM] >gi|45435621|gb|AAS61179.1| ribonucleoside-diphosphate reductase 1 beta chain [Yersinia pestis biovar Microtus str. 91001] (391 aa)
Score = 122, Expect = 9.1e-05, Identities = 57/212 (26%), Positives = 96/212 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE+I +S D   +N L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II++I RD+ +H   +G ++   + +L        E   E ++  +DL       EKE+   L+
  S:    63 FWRPEEIDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEEILKRAKDISAYY--DDLIEMTSYYHLLGEGTHQVNGKTVVVKLRDLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALH--LTGTQHILNLMRLGEDDPEMAEIAEECQQQCYDLFVLAAQQEKEWAEYLF 307
>gi|189349324|ref|YP_001944952.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia multivorans ATCC 17616] >gi|189333346|dbj|BAG42416.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia multivorans ATCC 17616] (403 aa)
Score = 122, Expect = 9.1e-05, Identities = 63/247 (25%), Positives = 108/247 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L  Q ++LE  +  +      +   A  F  Y      +  Q +G D  F  EE
  S:   103 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLFPNEE 368
>gi|77956355|ref|ZP_00820461.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia bercovieri ATCC 43970] (376 aa)
Score = 122, Expect = 9.5e-05, Identities = 58/212 (27%), Positives = 96/212 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE+I +S D   +N L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II++I RD+ +H        N     +   ++A++  E Q++     +DL       EKE+   L+
  S:    48 FWRPEEIDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPAI--VFDDIVTNEEILKRAKDISAYY--DDLIEMTSYYHLLGEGSHQVNGKTVVVNLRELKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALHLTGTQHILNLMRSGEDDPEMAEIAEECQSQ----CYDLFVLAAQQEKEWAEYLF 292
>gi|75041724|sp|Q5R9G0|RIR2B_PONAB Ribonucleoside-diphosphate reductase subunit M2 B >gi|55729743|emb|CAH91600.1| hypothetical protein [Pongo abelii] (351 aa)
Score = 122, Expect = 9.6e-05, Identities = 62/254 (24%), Positives = 106/254 (41%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL ++ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFV---ADRLLVELGFSKVFQAE 306
>gi|7023557|dbj|BAA92005.1| unnamed protein product [Homo sapiens] (351 aa)
Score = 122, Expect = 9.6e-05, Identities = 62/254 (24%), Positives = 106/254 (41%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++W    Q   +FW  E++ +S DLP WNKL ++ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVDAVKIEQEFLTEALPVGLIGVNCILMKQYIEFV---ADRLLVELGFSKVFQAE 306
>gi|146418573|ref|XP_001485252.1| hypothetical protein PGUG_02981 [Pichia guilliermondii ATCC 6260] >gi|146390725|gb|EDK38883.1| hypothetical protein PGUG_02981 [Pichia guilliermondii ATCC 6260] (418 aa)
Score = 122, Expect = 9.7e-05, Identities = 50/219 (22%), Positives = 94/219 (42%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E+W    +   +FW  E+I +  D+  WN +L+ N +  + R        D I      V      +   E   +  F  M+  +H+ +Y  +  T+     + +   + + N   ++K+A   + +   DD L  +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +  PE        V  ++ + +D+EKEF  +
  S:   110 EIWKMYKKAEASFWTAEEIDLGKDMHDWNNRLNDNERYFISRILAFFAASDGI-VNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKEADFLFNAIENIPCIKKKADWALRWINDDDALFGERLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLSFSNELICRDEGLHTDFACLLFSHLQNRPDPE-------IVEKIITEAVDIEKEFFTD 328
>gi|76875271|emb|CAI86492.1| ribonucleoside-diphosphate reductase 1, beta subunit [Pseudoalteromonas haloplanktis TAC125] (359 aa)
Score = 122, Expect = 9.9e-05, Identities = 53/166 (31%), Positives = 84/166 (50%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           FW PE++ +S D   +  L  + + + +      TLLDS+Q    +VA +   SL + E  I T +AF   +H+RSY  I      + ++    D +V+ + + +RA  +  YY  DD                             LK K+  AMM   +L     Y  F   F    + L+     II+LI RD+ +H
  S:    31 FWRPEEVDVSKDRLDFQALPDHEKHIFLSNLKYQTLLDSVQGRSPNVALLPIVSLPELETWIET-WAFSETIHSRSYTHIIRNVTQAPEL--IFDDIVSNDKISERADAVTKYY--DDLINSVSLYNLYGEGKHEINGKSVVVNLFELKKKLYLAMMSVNILEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH 225
>gi|71648907|ref|XP_813233.1| ribonucleoside-diphosphate reductase small chain, putative [Trypanosoma cruzi strain CL Brener] >gi|70878098|gb|EAN91382.1| ribonucleoside-diphosphate reductase small chain, putative [Trypanosoma cruzi] (337 aa)
Score = 122, Expect = 9.9e-05, Identities = 47/217 (21%), Positives = 98/217 (45%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ-VKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  ++    W  E+I +S+DL  W K++   +  +          D I   + ++AQ     +   E   +  F   +  VH+ +Y  +  T+ + +++ +     +     +QK+A   I +         + VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+  +  KLP E+       + +++   +D+E+EF+
  S:    36 DIWKKYKESESSIWTVEEIDLSSDLADWEKMNEGEKFFIKHVLAFFAASDGI--VLENLAQRFMTEVQVPEVRCFYGFQIAIENVHSETYSVLLDTYITDTEEKDRMLHAISTIPCIQKKANWAIRWIRSSSSFAERLVAFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYENYIVNKLPKER-------IREIICSAVDIEREFI 251
>gi|71416121|ref|XP_810103.1| ribonucleoside-diphosphate reductase small chain, putative [Trypanosoma cruzi strain CL Brener] >gi|70874586|gb|EAN88252.1| ribonucleoside-diphosphate reductase small chain, putative [Trypanosoma cruzi] (337 aa)
Score = 121, Expect = 1.0e-04, Identities = 47/217 (21%), Positives = 98/217 (45%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ-VKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +   + W  E+I +S+DL  W K++   +  +          D I   + ++AQ     +   E   +  F   +  VH+ +Y  +  T+ + +++ +     +     +QK+A   I +         + VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y+  +  KLP E+       + +++   +D+E+EF+
  S:    36 DIWKKYKEAESSIWTVEEIDLSSDLADWEKMNEGEKFFIKHVLAFFAASDGI--VLENLAQRFMTEVQVPEVRCFYGFQIAIENVHSETYSVLLDTYITDTEEKDRMLHAISTIPCIQKKANWAIRWIRSSSSFAERLVAFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYENYIVNKLPTER-------IREIICSAVDIEREFI 251
>gi|121598515|ref|YP_991780.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia mallei SAVP1] >gi|124385654|ref|YP_001027273.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia mallei NCTC 10229] >gi|126439848|ref|YP_001060484.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 668] >gi|126451145|ref|YP_001082790.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia mallei NCTC 10247] >gi|126453692|ref|YP_001067748.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 1106a] >gi|134280207|ref|ZP_01766918.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 305] >gi|166998593|ref|ZP_02264451.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia mallei PRL-20] >gi|167721297|ref|ZP_02404533.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei DM98] >gi|167740266|ref|ZP_02413040.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 14] >gi|167817486|ref|ZP_02449166.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 91] >gi|167847373|ref|ZP_02472881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei B7210] >gi|167895962|ref|ZP_02483364.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 7894] >gi|167904346|ref|ZP_02491551.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei NCTC 13177] >gi|167912606|ref|ZP_02499697.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 112] >gi|194318123|ref|YP_002013977.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei ATCC 10399] >gi|194520444|ref|YP_002056052.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei S13] >gi|194523011|ref|YP_002058544.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei FMH] >gi|194569622|ref|YP_002104625.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 406e] >gi|121227325|gb|ABM49843.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei SAVP1] >gi|124293674|gb|ABN02943.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei NCTC 10229] >gi|126219341|gb|ABN82847.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 668] >gi|126227334|gb|ABN90874.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 1106a] >gi|126244015|gb|ABO07108.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei NCTC 10247] >gi|134248214|gb|EBA48297.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 305] >gi|147747021|gb|EDK54098.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei FMH] >gi|157808756|gb|EDO85926.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 406e] >gi|160694736|gb|EDP84744.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei ATCC 10399] >gi|169656868|gb|EDS88265.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei S13] (403 aa)
Score = 121, Expect = 1.0e-04, Identities = 63/247 (25%), Positives = 108/247 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L    +DLE  +  +      +   A  F  Y    + +  Q +G D  F  EE
  S:   103 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEE 368
>gi|162139926|ref|YP_339935.2| ribonucleotide-diphosphate reductase subunit beta [Pseudoalteromonas haloplanktis TAC125] (376 aa)
Score = 121, Expect = 1.0e-04, Identities = 53/166 (31%), Positives = 84/166 (50%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           FW PE++ +S D   +  L  + + + +      TLLDS+Q    +VA +   SL + E  I T +AF   +H+RSY  I      + ++    D +V+ + + +RA  +  YY  DD                             LK K+  AMM   +L     Y  F   F    + L+     II+LI RD+ +H
  S:    48 FWRPEEVDVSKDRLDFQALPDHEKHIFLSNLKYQTLLDSVQGRSPNVALLPIVSLPELETWIET-WAFSETIHSRSYTHIIRNVTQAPEL--IFDDIVSNDKISERADAVTKYY--DDLINSVSLYNLYGEGKHEINGKSVVVNLFELKKKLYLAMMSVNILEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH 242
>gi|109087118|ref|XP_001099964.1| PREDICTED: similar to ribonucleotide reductase M2 B (TP53 inducible) isoform 1 [Macaca mulatta] (297 aa)
Score = 121, Expect = 1.1e-04, Identities = 60/253 (23%), Positives = 105/253 (41%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++ +   +FW  E++ +S DLP WNKL ++ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:     1 MYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVDAVQIEQEFLTEALPVGLIGMNCILMKQYIEFV---ADRLLVELGFSKIFQAE 252
>gi|83719302|ref|YP_441701.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia thailandensis E264] >gi|83653127|gb|ABC37190.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia thailandensis E264] (377 aa)
Score = 121, Expect = 1.1e-04, Identities = 63/247 (25%), Positives = 108/247 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L    +DLE  +  +      +   A  F  Y    + +  Q +G D  F  EE
  S:    77 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEE 342
>gi|76808925|ref|YP_334881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 1710b] >gi|194528000|ref|YP_002063523.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei JHU] >gi|76578378|gb|ABA47853.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia pseudomallei 1710b] >gi|147752010|gb|EDK59077.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei JHU] (376 aa)
Score = 121, Expect = 1.1e-04, Identities = 63/247 (25%), Positives = 108/247 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L    +DLE  +  +      +   A  F  Y    + +  Q +G D  F  EE
  S:    76 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEE 341
>gi|153885881|ref|ZP_02007037.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D] >gi|151577803|gb|EDN42203.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D] (402 aa)
Score = 121, Expect = 1.1e-04, Identities = 63/247 (25%), Positives = 113/247 (45%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQA---TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + ++ R        DS+ A    +G   Q+  +  +  Q +    AF   +H  +Y  I  +     ++  N+ H+     +S++ + + LIP+   + D   K+              V A +M G   Y GF     +G +N +    +  + ILRD+ +H N+      Q K+   P    AE K  + +L  + +DLE  +  +      +   A  F  Y      +  Q +G D+ F  EE
  S:   102 NHWMPQEINMSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQI--TAPECRQYLLRQ-AFEEAIHTHAYQYIVESLGLNEAEIFNAYHE----VQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLEN-PHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNEE 367
>gi|161360601|ref|ZP_02106463.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 1106b] >gi|161373419|ref|ZP_02112974.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 1710a] >gi|167825888|ref|ZP_02457359.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei 9] >gi|167924622|ref|ZP_02511713.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei BCC215] >gi|194505238|ref|YP_002034809.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 1655] >gi|194508156|ref|YP_002020691.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei Pasteur 52237] >gi|157938651|gb|EDO94321.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei Pasteur 52237] >gi|184211125|gb|EDU08168.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia pseudomallei 1655] (372 aa)
Score = 121, Expect = 1.2e-04, Identities = 63/247 (25%), Positives = 108/247 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L    +DLE  +  +      +   A  F  Y    + +  Q +G D  F  EE
  S:    72 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEE 337
>gi|73544537|ref|XP_848163.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania major strain Friedlin] >gi|70800114|gb|AAZ09955.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania major strain Friedlin] (388 aa)
Score = 121, Expect = 1.2e-04, Identities = 45/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   I ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    87 DIWRKYKEQESCIWTVEEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGI--VIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 302
>gi|146090970|ref|XP_001466408.1| ribonucleoside-diphosphate reductase small chain [Leishmania infantum JPCM5] >gi|134070770|emb|CAM69127.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania infantum] (388 aa)
Score = 121, Expect = 1.2e-04, Identities = 45/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   I ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    87 DIWRKYKEQESCIWTVEEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGI--VIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 302
>gi|116326775|ref|YP_803312.1| hypothetical protein TNAV2c_gp089 [Trichoplusia ni ascovirus 2c] >gi|102231783|gb|ABF70606.1| hypothetical protein [Trichoplusia ni ascovirus 2c] (269 aa)
Score = 121, Expect = 1.3e-04, Identities = 50/218 (22%), Positives = 93/218 (42%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAF-MVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDP--LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           ++ +   +FW  E++ +S DL  W+KL  + +  +          D I      V +    +   E   +  F   M  VH+  Y  +  T+   SD+ +   + +     ++K+A   + +   +     +  VA A + G    G F   F+L  + LLP       LI RD+ +H  ++   Y   V K PP  +      V ++L + + +EK+FL +
  S:     1 MYKKAEASFWTVEEVDLSKDLSDWDKLKDDEKHFIKHILAFFAASDGI-VNENLVERFSQEVQITEARCFYGFQIAMENVHSEMYSLLIDTYIRDSDERDYLFNAIETLPCIKKKADWALKWISSNSANFAERIVAFAAVEGIFFSGSFASIFWLKKRGLLPGLTFSNELISRDEGLHTDFACLMYNYVVQK-PPNSR------VIEILKEAVVIEKDFLTD 214
>gi|16121504|ref|NP_404817.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis CO92] >gi|51595597|ref|YP_069788.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pseudotuberculosis IP 32953] >gi|108806924|ref|YP_650840.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Antiqua] >gi|108812924|ref|YP_648691.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Nepal516] >gi|145599749|ref|YP_001163825.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Pestoides F] >gi|149366796|ref|ZP_01888830.1| ribonucleoside-diphosphate reductase 1 beta chain [Yersinia pestis CA88-4125] >gi|153950490|ref|YP_001401734.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pseudotuberculosis IP 31758] >gi|161484771|ref|NP_670275.2| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis KIM] >gi|161511422|ref|NP_992302.2| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis biovar Microtus str. 91001] >gi|162418296|ref|YP_001605847.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia pestis Angola] >gi|165924721|ref|ZP_02220553.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165938305|ref|ZP_02226863.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166009974|ref|ZP_02230872.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211802|ref|ZP_02237837.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167400353|ref|ZP_02305866.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419574|ref|ZP_02311327.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167424117|ref|ZP_02315870.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470792|ref|ZP_02335496.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis FV-1] >gi|170025073|ref|YP_001721578.1| ribonucleoside-diphosphate reductase [Yersinia pseudotuberculosis YPIII] >gi|186894660|ref|YP_001871772.1| ribonucleotide reductase [Yersinia pseudotuberculosis PB1/+] >gi|51588879|emb|CAH20493.1| ribonucleoside-diphosphate reductase 1 beta chain [Yersinia pseudotuberculosis IP 32953] >gi|108776572|gb|ABG19091.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Yersinia pestis Nepal516] >gi|108778837|gb|ABG12895.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Yersinia pestis Antiqua] >gi|115346983|emb|CAL19874.1| ribonucleoside-diphosphate reductase 1 beta chain [Yersinia pestis CO92] >gi|145211445|gb|ABP40852.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Yersinia pestis Pestoides F] >gi|149291170|gb|EDM41245.1| ribonucleoside-diphosphate reductase 1 beta chain [Yersinia pestis CA88-4125] >gi|152961985|gb|ABS49446.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pseudotuberculosis IP 31758] >gi|162351111|gb|ABX85059.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis Angola] >gi|165913683|gb|EDR32302.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165923781|gb|EDR40913.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991370|gb|EDR43671.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166207573|gb|EDR52053.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962315|gb|EDR58336.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050302|gb|EDR61710.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167056966|gb|EDR66729.1| ribonucleoside-diphosphate reductase, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169751607|gb|ACA69125.1| Ribonucleoside-diphosphate reductase [Yersinia pseudotuberculosis YPIII] >gi|186697686|gb|ACC88315.1| ribonucleotide reductase [Yersinia pseudotuberculosis PB1/+] (376 aa)
Score = 121, Expect = 1.3e-04, Identities = 57/212 (26%), Positives = 96/212 (45%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLP------PEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE+I +S D   +N L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II++I RD+ +H   +G ++   + +L        E   E ++  +DL       EKE+   L+
  S:    48 FWRPEEIDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEEILKRAKDISAYY--DDLIEMTSYYHLLGEGTHQVNGKTVVVKLRDLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALH--LTGTQHILNLMRLGEDDPEMAEIAEECQQQCYDLFVLAAQQEKEWAEYLF 292
>gi|114621164|ref|XP_001153859.1| PREDICTED: hypothetical protein isoform 1 [Pan troglodytes] >gi|119612248|gb|EAW91842.1| ribonucleotide reductase M2 B (TP53 inducible), isoform CRA_c [Homo sapiens] >gi|194385642|dbj|BAG65196.1| unnamed protein product [Homo sapiens] (297 aa)
Score = 120, Expect = 1.3e-04, Identities = 60/253 (23%), Positives = 105/253 (41%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           ++ +   +FW  E++ +S DLP WNKL ++ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   + +E+EFL E       G N  +  Q I+F    A + L  LG+   F  E
  S:     1 MYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFV---ADRLLVELGFSKVFQAE 252
>gi|53720599|ref|YP_109585.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia pseudomallei K96243] >gi|53726102|ref|YP_104055.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia mallei ATCC 23344] >gi|67643593|ref|ZP_00442338.1| COG0208: Ribonucleotide reductase, beta subunit [Burkholderia mallei GB8 horse 4] >gi|52211013|emb|CAH37001.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia pseudomallei K96243] >gi|52429525|gb|AAU50118.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia mallei ATCC 23344] (350 aa)
Score = 120, Expect = 1.3e-04, Identities = 63/247 (25%), Positives = 108/247 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE +  + +L    +DLE  +  +      +   A  F  Y    + +  Q +G D  F  EE
  S:    50 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEE 315
>gi|77976962|ref|ZP_00832426.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia intermedia ATCC 29909] (376 aa)
Score = 120, Expect = 1.4e-04, Identities = 57/212 (26%), Positives = 95/212 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDL-------EKEFLNELY 261
           FW PE+I +S D   +N L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY                          +    LK ++   +M          Y  F   F    + L+     II++I RD+ +H   +G ++   + +   E   EM +   +   Q  DL       EKE+   L+
  S:    48 FWRPEEIDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEILKRAKDISAYYDDLIEMTSYYHLLGEGTHQVNGKTVIVNLHELKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALH--LTGTQHILNLMR-SGEDDPEMAEIAIECQQQCYDLFVLAAQQEKEWAEYLF 292
>gi|22549454|ref|NP_689227.1| putative ribonucleotide reductase small subunit-like protein [Mamestra configurata nucleopolyhedrovirus B] >gi|22476633|gb|AAM95039.1| putative ribonucleotide reductase small subunit-like protein [Mamestra configurata nucleopolyhedrovirus B] (313 aa)
Score = 120, Expect = 1.4e-04, Identities = 62/246 (25%), Positives = 111/246 (45%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNF-AFMVGVHARSYGSIFSTFC----SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKV-AKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLG 286
           E + R    FW  E++ +S D   +  KL+++ +  ++      +  DSI   I  +  +  ++ + E V +  F A M  VH + YG++  T        D I +A D   N   ++K+    + +        ++  VA A++ G    G F   FY+    ++P       LI RD+ +H  ++   Y  +V  KL  E        + D+  + +D+EKEF  +       G N AD   ++  + A + L  LG
  S:    18 EAYKRAEACFWRMEEVDLSKDYDDFQLKLNNDQRHFIMHVLGFFSAADSI-VNINVLDYMLQTVPELEAVYFYTFQAAMENVHTQMYGTLIITLIPDKKQQDLILNAFD---NISCVRKKDDWALKWTKNKKLTLAERLVAFAIVEGVFFSGSFAAIFYIKTLGIMPGLTFSNELISRDEGMHTDFACLYYNTRVNEKLSYET-------ILDMFKEAVDIEKEFFTDALPVALLGMN-ADMMCEYIEFVADRLLLQLG 264
>gi|123441721|ref|YP_001005705.1| ribonucleotide-diphosphate reductase subunit beta [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122088682|emb|CAL11484.1| ribonucleoside-diphosphate reductase 1 beta chain [Yersinia enterocolitica subsp. enterocolitica 8081] (376 aa)
Score = 120, Expect = 1.5e-04, Identities = 58/212 (27%), Positives = 95/212 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE+I +S D   +N L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II++I RD+ +H        N     +   ++A++  E Q +     +DL       EKE+   L+
  S:    48 FWRPEEIDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEILKRAKDISAYY--DDLIEMTSYYHLLGEGTHQVNGKTVVVNLRELKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALHLTGTQHILNLMRSGEDDPEMAEIAEECQQQ----CYDLFVLAAQQEKEWAEYLF 292
>gi|113869188|ref|YP_727677.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia eutropha H16] >gi|113527964|emb|CAJ94309.1| Ribonucleoside-diphosphate reductase beta subunit [Ralstonia eutropha H16] (395 aa)
Score = 120, Expect = 1.5e-04, Identities = 63/247 (25%), Positives = 112/247 (45%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQA---TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + ++ R        DS+ A    +G   Q+  +  +  Q +    AF   +H  +Y  I  +     ++  N+ H+     +S++ + + LIP+   + D   K+              V A +M G   Y GF     +G +N +    +  + ILRD+ +H N+      Q K+   P    AE K  + +L  + +DLE  +  +      +   A  F  Y      +  Q +G D  F  EE
  S:    95 NHWMPQEINMSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQI--TAPECRQYLLRQ-AFEEAIHTHAYQYIVESLGLNEAEIFNAYHE----VQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLEN-PHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFPNEE 360
>gi|8101697|gb|AAF72618.1|AF252539_2 ribonucleotide reductase small subunit M2 [Leishmania mexicana amazonensis] (345 aa)
Score = 120, Expect = 1.5e-04, Identities = 45/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   I ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    44 DIWRKYKEQESCIWTVEEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGI--VIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 259
>gi|73974200|ref|XP_858061.1| PREDICTED: similar to ribonucleotide reductase M2 B (TP53 inducible) isoform 3 [Canis familiaris] (338 aa)
Score = 120, Expect = 1.5e-04, Identities = 52/219 (23%), Positives = 92/219 (42%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL---KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           ++W    Q   +FW  E++ +S DLP WNKL S+ +  +          D I      V +    +   E   +  F  ++  VH+  Y  +  T+    +        +      K+       +I D      +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +Q  V K P E++      V +++   +++E+EFL E
  S:    51 DIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGI-VNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIEDRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK-PSEER------VREIIVNAVEIEQEFLTE 268
>gi|77960361|ref|ZP_00824236.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia mollaretii ATCC 43969] (376 aa)
Score = 120, Expect = 1.5e-04, Identities = 58/212 (27%), Positives = 95/212 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE+I +S D   +N L  + + + +      TLLDSIQ    +VA +        +     ++F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II++I RD+ +H        N     +   ++A++  E Q +     +DL       EKE+   L+
  S:    48 FWRPEEIDVSRDRIDYNALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPAI--VFDDIVTNEEILKRAKDISAYY--DDLIEMTSYYHLLGEGSHQVNGKTVVVNLRELKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALHLTGTQHIINLMRSGEDDPEMAEIAEECQQQ----CYDLFVLAAQQEKEWAEYLF 292
>gi|15229476|ref|NP_189000.1| RNR2/RNR2A (RIBONUCLEOTIDE REDUCTASE 2A); ribonucleoside-diphosphate reductase [Arabidopsis thaliana] >gi|27735240|sp|P50651|RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A (Ribonucleotide reductase small subunit A) (Ribonucleoside-diphosphate reductase R2A subunit) (Protein R2at) (AtRNR2) >gi|13937232|gb|AAK50108.1|AF372971_1 AT3g23580/MDB19_7 [Arabidopsis thaliana] >gi|9294514|dbj|BAB02776.1| ribonucleotide reductase [Arabidopsis thaliana] >gi|23505945|gb|AAN28832.1| At3g23580/MDB19_7 [Arabidopsis thaliana] (341 aa)
Score = 120, Expect = 1.6e-04, Identities = 55/254 (21%), Positives = 107/254 (42%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAF-MVGVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFL------NELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           E++ +   +FW  E++ +S D+  W  L  + +  +          D I       A+  N +   E   +  F   M  +H+  Y  +  TF   S + +   + +     + K+A+  + +         + VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y     +LP EK       V+ ++++ +++E EF+      + +    N+  Q I+F    A + L  LG +  +  E
  S:    41 EMYKKAEASFWTAEEVDLSTDVQQWEALTDSEKHFISHILAFFAASDGIVLE-NLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFIKDSKEKDRLFNAIETIPCISKKAKWCLDWIQSPMSFAVRLVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPLEK-------VYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFV---ADRLLVTLGCERTYKAE 292
>gi|194564289|ref|YP_002099312.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia dolosa AUO158] >gi|124895913|gb|EAY69793.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia dolosa AUO158] (403 aa)
Score = 120, Expect = 1.6e-04, Identities = 64/247 (25%), Positives = 110/247 (44%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAK---LPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+      S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+       PE +AE++    +L  Q ++LE  +  +      +   A  F  Y      +  Q +G D  F  EE
  S:   103 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTPEFRAEIR----ELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLFPNEE 368
>gi|121606275|ref|YP_983604.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas naphthalenivorans CJ2] >gi|120595244|gb|ABM38683.1| Ribonucleoside-diphosphate reductase [Polaromonas naphthalenivorans CJ2] (387 aa)
Score = 120, Expect = 1.6e-04, Identities = 63/247 (25%), Positives = 111/247 (44%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTF-CSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEE 295
           N W+P+++ ++ D+  W   N L  + + LV+R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +I +A++ V   +S++ + Q LIP+   I D   K+              V A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE K  +  L  + ++LE  +  +       G N A     +  Y A +    +G ++ F  EE
  S:    87 NHWMPQEVNMTRDIALWKDPNGLSDDERRLVMRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYITESLGLDEGEIFNAYNEV---QSIKDKDQFLIPFIEAISDPGFKTGTLESDQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLEN-PQLWTAEFKAEINALFMKAVELEYRYAEDTMPRGVLGLN-ASMFKGYLRYIANRRATQIGLETLFPNEE 352
>gi|127512873|ref|YP_001094070.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella loihica PV-4] >gi|126638168|gb|ABO23811.1| Ribonucleoside-diphosphate reductase [Shewanella loihica PV-4] (376 aa)
Score = 120, Expect = 1.6e-04, Identities = 74/278 (26%), Positives = 135/278 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY---AGFNIADQAI-KFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADEN 313
           D +  EV+ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   +    D +V  E + KRA  +  YY                          +    +K  +   MM   +L     Y  F   F    + L+     IIRLI RD+ +H            G K   ++A++      E ++   D+  +  + EKE+   L+   +   + +Q + ++  Y   + ++++   SP+                      P+E E+   +  Q+ A  DE+
  S:    30 DIQKYEVFEKLIEKQLSFFWRPEEVDVSKDKIDYAALPDHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSV--VFDDIVQNEEILKRASDIADYYDNLIELSQIYHLMGEGTHEINGKTVEVTTRAIKKALYLCMMSVNVLEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALHLNSTQHILKLMQGGKDDPEMAEI----AKECEQTAIDIFVKAAEQEKEWAKYLFKDGSMIGLNEQILCQYVEYITNERMKSVNLVSPYADQSNPLPWMKNWLESDSVQVAPQEVEVSSYLVGQIDASVDES 369
>gi|163781846|ref|ZP_02176846.1| ribonucleotide reductase beta chain [Hydrogenivirga sp. 128-5-R1-1] >gi|159883066|gb|EDP76570.1| ribonucleotide reductase beta chain [Hydrogenivirga sp. 128-5-R1-1] (350 aa)
Score = 120, Expect = 1.6e-04, Identities = 63/280 (22%), Positives = 119/280 (42%)
  Q:    49 NFWLPEKIAISNDLPSWNKLDSNWQELVVR-TFTGLTLLDSIQ-------ATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGY-------DSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGN 328
           NFW+PE+I +  D   + ++ S+++        + L  LDS Q       A +    +V+ +LT  E        F   +HA SY  I  +     + +  +++    E L++R +V+   Y         ++ +K+ +   ++     Y GF   + LG +  + NT+  I+ I RD++ H             + P     E+KK++ +     ID E +     +  +   DQ +  +     ++++ LG          P  PE TE   +         +   DFF     +Y   N
  S:    58 NFWIPEEIPLMEDKKQYERVLSDYERRAYELVLSFLIALDSFQVDMLKDFARMISAPEVEMALTAQE--------FQESIHAYSYQFILESVVDPIKADEIYNYWREDEKLKERNEVVAEVYNEFIRKPSEENFIKAVIGNYILESLYFYSGFAFFYTLGRQGKMTNTVQQIKYINRDELTHVTLFRNMILNLQKEQPELFSPEIKKWIAEYFRYAIDQEIK-----WGQYVTQDQILGINNQLIDRYIKYLGNLRITQIGLEPLYPEITENPMKWIDDFRKINNTKTDFFQRKPQTYAKAN 346
>gi|169860859|ref|XP_001837064.1| hypothetical protein CC1G_00200 [Coprinopsis cinerea okayama7#130] >gi|116501786|gb|EAU84681.1| hypothetical protein CC1G_00200 [Coprinopsis cinerea okayama7#130] (386 aa)
Score = 120, Expect = 1.7e-04, Identities = 63/292 (21%), Positives = 123/292 (42%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSG--YKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEET 332
           E+W    R   +FW  E+I +S+D+  W+KL +  +  + R        D I      V +  + +   E   +  F  M+  VH+ +Y  +  T+    ++ +     +    S+Q++A+  + +        ++  VA A++ G    G F   F++  + LLP       LI RD+ +H  ++   + Y +K     P         +  ++ + +++EKEF                   ++A + L +LG D  +  +     P  F++L +  +   +FF    S Y   NV  T
  S:    52 EIWTHYKRAQASFWTAEEIDLSHDMMDWSKLTNAERHFLSRILAFFASSDGI-VNENLVERFSSEVQVPEARCFYGFQVMIENVHSETYSLLIDTYIKDPEERDFLFRAIETIPSIQRKAEWALTWTSDKSTTFAERLVAFAVVEGVFFSGSFAAIFWMRKRGLLPGLTFSNELISRDEGMHTDFACLLFAYLRK----RPHSDT-----ILAIVTEAVEIEKEF-------------------FSADRLLTSLGNDKHYHVD----NPFDFMELIS-MEGKANFFEKRVSDYAKANVSPT 318
>gi|50311465|ref|XP_455757.1| unnamed protein product [Kluyveromyces lactis] >gi|49644893|emb|CAG98465.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] (401 aa)
Score = 120, Expect = 1.7e-04, Identities = 59/245 (24%), Positives = 111/245 (45%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINS-AHDWVVNCESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPE---------KQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAI-------KFSVYNAGKFLQNL 285
           E + R   +FW  E+I +S DL  W N+++ N +  + R        D I      V      +   E   +  F  M+  +H+ +Y  +  T+    + +    + +     ++++A+  I +   DD L  +  VA A + G    G F   F+L  K L+P       LI RD+ +H  ++   +     K  PE          + E + F+  L   ++ +  + +N+ Y  F +AD+ +        F+V N   F++N+
  S:    98 EAYKRAEASFWTAEEIDLSKDLHDWNNRMNENERFFISRILAFFAASDGI-VNENLVENFSAEVQAPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESEFLFNAIETIPQIKEKAEWAIRWIQDDDALFGERLVAFAAVEGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPNPEIVEKIITEAVEIEKRYFMDALPVSLLGMNADLMNQ-YVEF-VADRLLVALGNKKYFNVTNPFDFMENI 360
>gi|1710401|sp|P49730|RIR2_TOBAC Ribonucleoside-diphosphate reductase small chain (Ribonucleotide reductase small subunit) (Ribonucleoside-diphosphate reductase R2 subunit) >gi|1044912|emb|CAA63194.1| ribonucleotide reductase R2 [Nicotiana tabacum] (329 aa)
Score = 119, Expect = 1.8e-04, Identities = 56/254 (22%), Positives = 109/254 (42%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVA-QVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE----LYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           E++ +   +FW  E++ +S+D   W  L    +  +          D I   + ++A +    +   E   +  F   +  +H+  Y  +  ++   SD+ +     V     ++K+A+  + +  G +    + VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y     KL  E+   +K  V D     +++E+EF+ +       G N  D   K+  + A + L  LGYD  +  +
  S:    29 EMYKKALASFWTAEEVDLSSDTRHWETLTPGERHFITHVLAFFAASDGI--VLENLAGRFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLESYIKDSDEKSRLFRAVETNPCVEKKAKWALRWIDGSETFAERLVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRTKLTEER---VKGIVAD----AVEIEREFVCDALPCALVGMN-GDLMSKYIEFVADRLLDALGYDKLYNAQ 280
>gi|15211879|emb|CAC51109.1| ribonucleotide reductase small subunit [Bacillus sp. BSG40] (86 aa)
Score = 119, Expect = 1.8e-04, Identities = 29/75 (38%), Positives = 43/75 (57%)
  Q:   151 LQKRAQVLIPYYIG----DDP--LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQK 225
           LQK+A+ ++  Y      DD    K+ VA+  +  FL Y GFY P Y   +  L  + +I+ LI+RD+ IH  Y G   Q+
  S:     4 LQKKARTIVSIYKAVEKNDDISLFKAMVASVFLESFLFYSGFYYPLYFYGQGKLMQSGEIVNLIIRDEAIHGVYVGLLAQE 84
>gi|94499220|ref|ZP_01305758.1| ribonucleotide-diphosphate reductase beta subunit [Oceanobacter sp. RED65] >gi|94428852|gb|EAT13824.1| ribonucleotide-diphosphate reductase beta subunit [Oceanobacter sp. RED65] (376 aa)
Score = 119, Expect = 1.9e-04, Identities = 70/249 (28%), Positives = 116/249 (46%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKV---AKLPPEK---QAEMKKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     S    +   D +V+ E + KRA+ +  YY                          +    LK K+   M     +     Y  F   F    +  +     II+LI RD+ +H   +G ++  ++    K  PE      E KK V ++  +    EK++   L+      G N  D   ++  Y   + L  +G D+ F   +  I
  S:    48 FWRPEEVDLSTDRKDFAALPEHEKHIFLSNLKYQTLLDSIQGRSPNVALLPIVSLPELETWIET-WSFSETIHSRSYTHIIRNVISDP--SKVFDDIVSNEYITKRAESVTKYYDDLIEGVTYYQNLGEGDHEINGETIHVSLRDLKRKLYLTMASVNVLEAIRFYVSFACSFAFAERTKMEGNAKIIKLIARDEALH--LTGTQHMMQIWALGKDDPEMGEIANECKKQVIEIFREAAQQEKDWAEYLFKDGSMIGLN-KDILCQYVEYITNQRLGAIGLDNIFETRQNPI 333
>gi|68485781|ref|XP_713171.1| hypothetical protein CaO19.9424 [Candida albicans SC5314] >gi|68485874|ref|XP_713125.1| hypothetical protein CaO19.1868 [Candida albicans SC5314] >gi|46434604|gb|EAK94008.1| hypothetical protein CaO19.1868 [Candida albicans SC5314] >gi|46434651|gb|EAK94054.1| hypothetical protein CaO19.9424 [Candida albicans SC5314] (394 aa)
Score = 119, Expect = 2.0e-04, Identities = 49/219 (22%), Positives = 97/219 (44%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSI---QATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFST-FCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           + + +   +FW  E++ +S DL  WN K++ N +  + R        D I          A+V+       + +Y     M  +H+ +Y  +  T F   ++ +   + + N   ++K+A   I +   +D L ++  VA A + G    G F   F+L  + L+P       LI RD+ IH  Y+   +          K     + +  ++ + +D+EKE+ ++
  S:    93 QFYKKSLASFWTAEELDLSKDLDDWNNKMNENERFFISRVLAFFAASDGIVNENLVENFCAEVQ---IPEAKSVYKFQIMMENIHSETYSLLIETYFKDPEEADFLFNAIDNIPFIRKKADWAIRWIQSEDALYAERLVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELICRDEGIHTDYACLLFSYL-------KNKPSSEIIEKIITEAVDIEKEYFSD 308
>gi|21672460|ref|NP_660527.1| ribonucleotide-diphosphate reductase subunit beta [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25091143|sp|Q8K9W4|RIR2_BUCAP Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide reductase small subunit) >gi|21623075|gb|AAM67738.1| ribonucleoside-diphosphate reductase 1 beta chain [Buchnera aphidicola str. Sg (Schizaphis graminum)] (376 aa)
Score = 119, Expect = 2.1e-04, Identities = 48/166 (28%), Positives = 84/166 (50%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYI--------------GDDPLKSK-----------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           FW PE+I +S D   ++ L SN + + +      TLLDSIQ    ++A +   S+ + E  I T ++F   +H+RSY  I     ++  I    D +++ +++  RAQ +  YY               G+  +  K                 ++  ++     Y  F   F    + ++     IIRLI RD+ +H
  S:    48 FWRPEEIDLSKDRIDFDNLPSNEKHIFISNLKYQTLLDSIQGRSPNIAFLPIVSIPELETWIET-WSFSETIHSRSYTHIIRNIINNPSI--VFDDIISNKNINDRAQDISIYYDELIRITAYWHLLGEGNHKINEKKVEINLKLLKRRLYLCLISVNVLEAIRFYVSFACSFAFAEREIMEGNAKIIRLIARDEALH 242
>gi|22788780|ref|NP_690492.1| ribonucleotide reductase [Heliothis zea virus 1] >gi|22671540|gb|AAN04367.1|AF451898_72 Rr2 [Heliothis zea virus 1] (333 aa)
Score = 119, Expect = 2.1e-04, Identities = 54/219 (24%), Positives = 99/219 (45%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGD--VAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSA-HDWVVNCESLQKRAQVLIPYYIGDDPLKSK---VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E++ +   +FW  E++ +S DL  W  +L    +E +          D I   + D  + +    LT  E   +  F  M+  VH+  Y ++   +    Q      + +    S++K+AQ +I  +I DD        VA A + G    G F   F+L  + L+P        I RD+ +H  ++   ++     L PE ++  +K V +++   + +E+EFL E
  S:    32 EMYKKAQASFWTVEEVDLSKDLYDWETRLTETEREFISHILAFFAGSDGI---VNDNLLTRFSQELTIPEVSCFYGFQIMIENVHSEMYSTLIDMYIRDPQRKHMLFNAIDTVPSIRKKAQWVI-RWIDDDKSSYADRLVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTHSNEFISRDEGLHCDFAILLFRN---YLRPECRSSDEK-VINIVTDAVRIEQEFLTE 250
>gi|149279601|ref|ZP_01885730.1| ribonucleoside-diphosphate reductase 1, beta subunit [Pedobacter sp. BAL39] >gi|149229637|gb|EDM35027.1| ribonucleoside-diphosphate reductase 1, beta subunit [Pedobacter sp. BAL39] (324 aa)
Score = 118, Expect = 2.2e-04, Identities = 54/247 (21%), Positives = 103/247 (41%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGY 287
           E++ +   +FW  E+I +S+D   W+ L+   +  +       +  D I      V  +        +  Y     M  +H+ +Y  +  T+    ++ +     +     ++K+A+  + +    +  +  VA A + G    G F   F+L  + L+P       LI RD+  H  ++   Y     KL  E        V  ++   +++EKEF+ +       G N  +  Q I+F    A ++LQ LGY
  S:    27 EMYKKSEASFWTAEEIDLSDDQKHWDNLNDGERHFISHILAFFSASDGIVNENLAVNFMSEVQLPEARCFYGFQIMMENIHSETYALLIDTYIKDPEEKDRLFHAIETVPCVKKKAEWALRWIDNGNFAERLVAFAAVEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGSHCEFACLLYSMLKNKLSEEH-------VHGIIRDAVEIEKEFVTDALPVALIGMNAKLMSQYIEFV---ADRWLQELGY 270
>gi|124268397|ref|YP_001022401.1| ribonucleotide-diphosphate reductase subunit beta [Methylibium petroleiphilum PM1] >gi|124261172|gb|ABM96166.1| Ribonucleoside-diphosphate reductase [Methylibium petroleiphilum PM1] (403 aa)
Score = 118, Expect = 2.2e-04, Identities = 55/208 (26%), Positives = 99/208 (47%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTF-CSSDQINSAHDWVVNCESLQKRAQVLIPYYIGD--DP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEF 256
           N W+P+++ +S D+ +W   N L  + + ++ R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +I +A++ V   +S++ + + LIP +IG   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE K  +  L  + ++LE  +
  S:   103 NHWMPQEVNMSRDIATWKDPNGLSEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDESEIFNAYNEV---QSIRDKDEFLIP-FIGAIMDPNFHTGTLENDRTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLEN-PQLWTAEFKAEIKALFMKAVELEYRY 326
>gi|3914644|sp|O46310|RIR2_LEIAM Ribonucleoside-diphosphate reductase small subunit (Ribonucleotide reductase small subunit) (Ribonucleotide reductase M2 subunit) >gi|2828563|gb|AAC08302.1| ribonucleotide reductase M2 subunit [Leishmania mexicana amazonensis] (345 aa)
Score = 118, Expect = 2.3e-04, Identities = 45/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   I ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    44 DIWRKYKEQESCIWTVEEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGI--VIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWPVRWIGSSASFQQRLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 259
>gi|148825799|ref|YP_001290552.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae PittEE] >gi|148715959|gb|ABQ98169.1| ribonucleotide-diphosphate reductase subunit beta [Haemophilus influenzae PittEE] (376 aa)
Score = 118, Expect = 2.4e-04, Identities = 75/266 (28%), Positives = 123/266 (46%)
  Q:    51 WLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDF 316
           W PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRAQ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II+ I RD+ +H   + +      A     + AE+    K+  +DL     + EK + + L+      G N  D  +++  Y     +Q +G   PF                      P+E E+   +  Q+ ++ D N DF
  S:    49 WRPEEVDVSQDRIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAQDISSYY--DDLIRDSQLYGLYGEGTYTVDGKECVVTLRSLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERRLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDPEMAEIAEECKQEAYDLFVAAAEQEKAWADYLFKDGSMIGLN-RDILVQYVEYITNIRMQAVGLPLPFQTRSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQIDSKVDTN-DF 371
>gi|94312018|ref|YP_585228.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia metallidurans CH34] >gi|93355870|gb|ABF09959.1| ribonucleotide reductase [Ralstonia metallidurans CH34] (395 aa)
Score = 118, Expect = 2.4e-04, Identities = 63/247 (25%), Positives = 112/247 (45%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQA---TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + ++ R        DS+ A    +G   Q+  +  +  Q +    AF   +H  +Y  I  +     ++  N+ H+     +S++ + + LIP+   + D   K+              V A +M G   Y GF     +G +N +    +  + ILRD+ +H N+      Q K+   P    AE K  + +L  + +DLE  +  +      +   A  F  Y      +  Q +G D  F  EE
  S:    95 NHWMPQEINMSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQI--TAPECRQYLLRQ-AFEEAIHTHAYQYIVESLGLNEAEIFNAYHE----VQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLEN-PHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDQLFPNEE 360
>gi|154337607|ref|XP_001565036.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134062075|emb|CAM45178.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania braziliensis] (392 aa)
Score = 118, Expect = 2.6e-04, Identities = 44/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   + ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    91 DIWRKYKEQESCIWTVEEIDLGNDMKDWVALNDGERHFIKHVLAFFAGSDGI--VVENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 306
>gi|154340038|ref|XP_001565976.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134063294|emb|CAM45500.1| ribonucleoside-diphosphate reductase small chain, putative [Leishmania braziliensis] (388 aa)
Score = 118, Expect = 2.6e-04, Identities = 44/217 (20%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   + ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +QK+A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    87 DIWRKYKEQESCIWTVEEIDLGNDMKDWVALNDGERHFIKHVLAFFAGSDGI--VVENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQKKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 302
>gi|157961884|ref|YP_001501918.1| ribonucleotide-diphosphate reductase subunit beta [Shewanella pealeana ATCC 700345] >gi|157846884|gb|ABV87383.1| Ribonucleoside-diphosphate reductase [Shewanella pealeana ATCC 700345] (376 aa)
Score = 117, Expect = 3.0e-04, Identities = 77/301 (25%), Positives = 147/301 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY------------IGD----------DPLKSKVAAAM---------MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKK----FVFDLLYQVIDLEKEFLNELYAGFNIA--DQAI--KFSVYNAGKFLQNLGYDSPFTPEETEIKPEI-------FVQLSARADENHDFFSGSGSSYIMGNVEETDDDD 336
           D +  EV+ ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I     +   I    + +V  E + KRA  +  YY            +G+          +  K ++  A+         +     Y  F   F    + ++     IIRLI RD+ +H   + +  +   A     + AE+ K       D+  +  + EKE+   L+   ++   ++ I  ++  Y   + ++ + + SP+  E+T   P +        VQ++ +  E         SSY++G ++ + DD+
  S:    30 DQQKYEVFEKLIEKQLSFFWRPEEVDVSRDKIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPELETWIET-WSFSETIHSRSYTHIIRNIVNDPSI--VFNDIVENEEILKRASDIANYYDHLIKLSQAYHLLGEGSHEIDGEIIEVTKREIKKALYLCMVSVNVLEAIRFYVSFACSFAFAERKVMEGNAKIIRLIARDEALHLNSTQHILKIMHAGKDDPEMAEIAKECEQTAIDIFIKAAEQEKEWAKYLFKDGSMIGLNETILCQYVEYITNERMKAVNFASPYA-EQTNPLPWMKNWLESDSVQVAPQEVEV--------SSYLVGQIDSSIDDN 369
>gi|15211865|emb|CAC51101.1| ribonucleotide reductase small subunit [Bacillus sp. M1918] (86 aa)
Score = 117, Expect = 3.0e-04, Identities = 29/75 (38%), Positives = 42/75 (56%)
  Q:   151 LQKRAQVLIPYYIG----DDP--LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQK 225
           LQK+A+ ++  Y      DD    K  VA+  +  FL Y GFY P Y   +  L  + +I+ LI+RD+ IH  Y G   Q+
  S:     4 LQKKARTIVSVYKSIKKNDDISLFKGMVASVFLESFLFYSGFYYPLYFYGQGKLMQSGEIVNLIIRDEAIHGVYVGLLAQE 84
>gi|84998662|ref|XP_954052.1| ribonucleotide reductase R2 subunit or ribonucleoside-diphosphate reductase small chain, putative [Theileria annulata strain Ankara] >gi|65305050|emb|CAI73375.1| ribonucleotide reductase R2 subunit or ribonucleoside-diphosphate reductase small chain, putative [Theileria annulata] (322 aa)
Score = 117, Expect = 3.1e-04, Identities = 48/200 (24%), Positives = 82/200 (41%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCS------------------SDQINSAHDWVVNCESLQKR-----AQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKK 240
           E + +   +FW  E+I  S D   W+KL+ + +  +          D I      +  +++      Q  Y+    +  +H+ +Y  +   +                     D+ N A  W+ +  S  +R        LI YY         VA A + G L  G F   F+L  + L+P       LI RD+ +H  +  + Y     KLP E   ++ K
  S:    39 EWYKKAQASFWTAEEIDFSMDYNHWHKLNKDERHFITNVLAFFAASDGIVLENLALKFLRDVKIPEAQSFYSFQIAVENIHSETYSLLIENYVKDEAEKRRLFMAIETIDAVKDKANWAKKWITDENSFAERIVSNFKNKLINYY-------RIVAYAAVEGILFSGSFCALFWLKKRGLMPGLTFSNELIARDEGLHADFGCFIYHNLKHKLPEEAVQQIIK 254
>gi|11878241|gb|AAG40862.1| ribonucleotide reductase [Emericella nidulans] (406 aa)
Score = 117, Expect = 3.1e-04, Identities = 58/246 (23%), Positives = 106/246 (43%)
  Q:    14 PIEYAKDGLKGKMRSVNWNFINDD---------KDLEVWN---RITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           P+E +K  L  K    N   + ++         K  E+W    +   +FW  E+I +S DL  W N+L+ + +  + R        D I      + +    +   E   +  F  M+  +HA +Y  +  T+     Q     D +     ++K+A   I +    +   ++  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +         KK V D++ + + +EKEFL +
  S:    57 PVEPSKAALDVKAIEANEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNNRLNEDERYFISRVLAFFAASDGI-VNENLLERFSGEVQIPEARCFYGFQIMIENIHAETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIKWIQDKESTFAQRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNWR-------PSKKVVEDIIVEAVAIEKEFLTD 311
>gi|67515571|ref|XP_657671.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4] >gi|40746089|gb|EAA65245.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4] (406 aa)
Score = 117, Expect = 3.1e-04, Identities = 58/246 (23%), Positives = 106/246 (43%)
  Q:    14 PIEYAKDGLKGKMRSVNWNFINDD---------KDLEVWN---RITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           P+E +K  L  K    N   + ++         K  E+W    +   +FW  E+I +S DL  W N+L+ + +  + R        D I      + +    +   E   +  F  M+  +HA +Y  +  T+     Q     D +     ++K+A   I +    +   ++  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +         KK V D++ + + +EKEFL +
  S:    57 PVEPSKAALDVKAIEANEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNNRLNEDERYFISRVLAFFAASDGI-VNENLLERFSGEVQIPEARCFYGFQIMIENIHAETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIKWIQDKESTFAQRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNWR-------PSKKVVEDIIVEAVAIEKEFLTD 311
>gi|58260834|ref|XP_567827.1| ribonucleotide reductase small subunit [Cryptococcus neoformans var. neoformans JEC21] >gi|134117207|ref|XP_772830.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50255448|gb|EAL18183.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57229908|gb|AAW46310.1| ribonucleotide reductase small subunit, putative [Cryptococcus neoformans var. neoformans JEC21] (430 aa)
Score = 117, Expect = 3.2e-04, Identities = 64/292 (21%), Positives = 126/292 (43%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGD--VAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINS-AHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEET 332
           E+W        +FW  E++   +DL  W +++    +  ++R        D I   +G+  V+Q    +   E   + +F  M+  VH+ +Y  +  T+    Q        + N   ++++A   + Y   + P +++ VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y     +   ++       V  ++ + + +EK+FL +       G N A    ++  + A + + +LGY   +         E+ + L  +A    +FF    S+Y   NV  T
  S:   119 EIWQAYKHAQASFWTAEELDFGHDLIDWHDRMTEQERFFILRILAFFAASDGI---VGENIVSQFALEVQIAEARAFYSFQSMIEQVHSETYSLLIETYVRDAQEKDFLFRGMTNIPCIKQKADWALKYITDELPFRTRLVAFACVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGMHTDFACLLYNHLKHRCSTDE-------VHHIVSEALVIEKQFLTDALPCALIGIN-AHLMCQYMEFVADRLVVDLGYPKIYNATNPFDWMEL-ISLQGKA----NFFESRVSAYQKANVSRT 407
>gi|19113338|ref|NP_596546.1| ribonucleotide reductase small subunit Suc22 (PMID 8479429) [Schizosaccharomyces pombe] >gi|9297110|sp|P36603|RIR2_SCHPO Ribonucleoside-diphosphate reductase small chain (Ribonucleotide reductase small subunit) >gi|3378511|emb|CAA20100.1| ribonucleotide reductase small subunit Suc22 (PMID 8479429) [Schizosaccharomyces pombe] (391 aa)
Score = 117, Expect = 3.7e-04, Identities = 67/299 (22%), Positives = 128/299 (42%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAH-DWVVNCESLQKRAQVLIPYYIGDDPLKS--KVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSY----IMGNVEETDDDDWDF 339
           E+W    +   +FW  E+I +S DL  W NKL+++ +  +          D I      + +  + +   E      F  M+  +H+ +Y  +  T+    +    H D ++   S++ +A+  + +   +D   +   VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +          K    +K V  ++ + +D+EKE+  +       G N  D   ++  + A + L  LG D  +        P  F++  + A +  +FF    S Y    +M   +  + DD  F
  S:    85 EIWQFYKKAEASFWTAEEIDLSKDLVDWDNKLNADERYFISTVLAYFAASDGI-VNENLLERFSSEVQIPEARCVYGFQIMIENIHSETYSLLLDTYIREPKEKQRHFDAILTMGSIKAKAKWALRWINDEDSTYAIRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLMFSHL-------KHRPGRKVVEAIIVEAVDIEKEYFTDALPVSLLGMN-KDLMCQYIEFVADRLLVALGNDKYYNV----TNPFDFMENISLAGKT-NFFEKKVSDYQIAGVMSGTKRAEKDDHTF 385
>gi|153092766|gb|EDN73809.1| ribonucleoside-diphosphate reductase [Mannheimia haemolytica PHL213] (376 aa)
Score = 117, Expect = 3.7e-04, Identities = 53/180 (29%), Positives = 87/180 (48%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           D +  E++ ++ +     FW PE++ +S D   + +L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD                             LK ++   MM          Y  F   F    + L+     II+ I RD+ +H
  S:    30 DQQKYEIFEKLIEKQLSFFWRPEEVDVSQDRIDYAQLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAKDISAYY--DDLIRDSQLYSLYGEGSYQVDGKTCEVSLRSLKRQLYLCMMSVNALEAIRFYVSFACSFAFAERQLMEGNAKIIKFIARDEALH 242
>gi|33593916|ref|NP_881560.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella pertussis Tohama I] >gi|33598411|ref|NP_886054.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella parapertussis 12822] >gi|33603351|ref|NP_890911.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella bronchiseptica RB50] >gi|33563990|emb|CAE43255.1| ribonucleoside-diphosphate reductase beta chain [Bordetella pertussis Tohama I] >gi|33574540|emb|CAE39187.1| ribonucleoside-diphosphate reductase beta chain [Bordetella parapertussis] >gi|33577475|emb|CAE34740.1| ribonucleoside-diphosphate reductase beta chain [Bordetella bronchiseptica RB50] (398 aa)
Score = 117, Expect = 3.8e-04, Identities = 72/310 (23%), Positives = 131/310 (42%)
  Q:    18 AKDGLKGKMRSVNWNFINDDKDLE---------VWNR---ITQNFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTF-CSSDQINSAHDWVVNCESLQKRAQVLIPYYIG-DDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG 327
           A D   G+++  +   IN + D+           W +      N W+P++I +S D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +I +A++ V    S++ + + LIP+     DP             LKS +  A +M G   Y GF     LG +N +    +    ILRD+ +H  +          + P     E ++ + +L  + ++LE  +  +      +   A  F  Y    A +  Q +G + P  P+E    P +   +  + + N  FF      Y  G
  S:    55 ASDATAGRVKVADKRIINGETDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLDLDEAEIFNAYNEV---PSIRAKDEFLIPFIDAIADPNFHTGTPEADQKLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTIKLENPHLWTPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIE-PLFPQEENPFPWMAEMIDLKKERN--FFETRVIEYQTG 392
>gi|119944866|ref|YP_942546.1| ribonucleotide-diphosphate reductase subunit beta [Psychromonas ingrahamii 37] >gi|119863470|gb|ABM02947.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Psychromonas ingrahamii 37] (381 aa)
Score = 116, Expect = 3.9e-04, Identities = 78/262 (29%), Positives = 131/262 (50%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIF-STFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------------------IGDDPLKSKV-----AAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY---AGFNIADQAI-KFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARAD 311
           FW PE+I +S D   +  L  + Q + +      TLLDSIQ    ++A +   SL + E  I T ++F   +H+RSY  I  + F    +I    D V N E +QKRA  +  YY                               +    +K K+     +   +     Y  F   F    ++LL     II+LI RD+ +H        N ++  K   ++A++  E  AE +    ++  Q    EK++   L+   +   + +Q + ++  Y A   +Q +GY   F                      P+ETEI   +  Q+ ++ D
  S:    48 FWRPEEIDVSRDRIDFLNLPDHEQHIFISNLKYQTLLDSIQGRSPNIALLPIVSLPELETWIET-WSFSETIHSRSYTHILRNLFTEPAEI--FEDIVTNVE-IQKRATDISGYYDALIHATQFMQLHGLEQTDIDYINLENQVEKLNLRAIKKKLYLCICSVNALEAIRFYVSFACSFAFAERDLLEGNAKIIKLIARDEALHLNSTQQILNLWADGKDDPEMAEIAIECFAEGR----EIFLQAAQQEKDWAKYLFKDGSMIGLNEQILSQYVEYIANLRMQAIGYAPEFEVKSNPIPWINNWLVSDNVQVAPQETEISSYLVGQIDSKVD 372
>gi|88804335|ref|ZP_01119855.1| probable ribonucleoside-diphosphate reductase small chain [Robiginitalea biformata HTCC2501] >gi|88785214|gb|EAR16383.1| probable ribonucleoside-diphosphate reductase small chain [Robiginitalea biformata HTCC2501] (328 aa)
Score = 116, Expect = 4.0e-04, Identities = 45/219 (20%), Positives = 91/219 (41%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSD-QINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKK-VAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E + +    FW  E+I +  DL  WN   S+ ++  ++                      N +   E   +  F  M+  +H+ +Y  +  T+   + + N     + N  +++K+A   + +       +  +A A + G    G F   F+L  + L+P       LI RD+ +H  Y+ + +    V K+P E+       +  ++   +D+E+EF+ E
  S:    28 EWYKKCEACFWTAEEIDLHQDLSDWNNKLSDDEKYFIKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKDEKEKNVLFQAIENFPAIKKKADWALKWIESPSFAERLIAFAAVEGIFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDYAVHLHNNHLVNKVPKER-------ITQIITNALDIEREFITE 242
>gi|145596896|ref|YP_001161193.1| ribonucleoside-diphosphate reductase [Salinispora tropica CNB-440] >gi|145306233|gb|ABP56815.1| Ribonucleoside-diphosphate reductase [Salinispora tropica CNB-440] (350 aa)
Score = 116, Expect = 4.1e-04, Identities = 70/290 (24%), Positives = 129/290 (44%)
  Q:    48 QNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIY-TNFAFMVGVHARSYGSIFSTFCSSDQIN-SAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVA--------------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY----AGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG-NVEETDDDDW 337
           +N W  E++ + +DL    KL S  + LV R        D+I A    V  +   +   E  +Y +   F   VH + Y ++  T+   ++   +A   V N  S+ ++A+    +      L+                  AA + G   YG F   ++L ++ LL         + RD+ +H  ++        A+ P    A++++ V +++ + +D E +F  +L     +G ++AD   ++  + A + L  LG      P      P  F++L     E  +FF    S+Y MG +   T DDD+
  S:    47 KNTWTVEEVDLHSDLGDLAKLSSAERHLVSRLVAFFATGDTIVAN-NLVLNLYQHVNSPEGRLYLSRQLFEEAVHVQFYLNLLDTYVPEEKERFAAFAAVENIPSIARKAEFCFRWIDSIFELRELRTQADRRAFLLNLICFAACIEGLFFYGAFAYVYFLRSRGLLNGLASGTNWVFRDESMHMAFAFDVVDTVRAEEPDLFDADLERQVKEMVAEAVDCEVQFAEDLLEQGVSGLSLADMR-EYLQHVADRRLVTLG----IAPMYGSANPFAFMELQ-DVQELSNFFERRVSAYQMGVSGSVTFDDDF 350
>gi|156839886|ref|XP_001643629.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM 70294] >gi|156114248|gb|EDO15771.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM 70294] (394 aa)
Score = 116, Expect = 4.1e-04, Identities = 53/217 (24%), Positives = 100/217 (46%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDH--------EQVIYTNFAFMV-GVHARSYGSIFSTFC----SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           E + +   +FW  E+I +S DL  WN KL+SN +  + R        D I         V  +LT++        E   +  F  M+  +H+ +Y  +  T+      SD + +A D++     ++++A+  + +   D+ L  +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     K  P         V  ++ + +++EK + 
  S:    91 EAYKKAEASFWTAEEIDLSKDLSDWNDKLNSNERFFISRVLAFFAASDGI---------VNENLTENFSVEVKVPEARCFYGFQIMIENIHSETYSLLIDTYIKDPKESDFLFNAIDYI---PQIKEKAEWALRWINNDEALFGERLVAFASIEGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFASLLFSHLDNKPDP-------AIVEKIVTEAVEIEKRYF 304
>gi|3220181|gb|AAC23560.1| ribonucleotide reductase M2 subunit [Leishmania mexicana amazonensis] (354 aa)
Score = 116, Expect = 4.1e-04, Identities = 43/217 (19%), Positives = 95/217 (43%)
  Q:    41 EVWNRITQN---FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQ--VKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFL 257
           ++W +  +     W  E+I + ND+  W  L+   +  +          D I   + ++AQ  + +      +  Y     M  +H+ +Y  +  T+   S +++   H  +     +Q++A+  + +       + + +  A + G    G F   F+L  + L+P       LI RD+ +H  ++   Y   +  KLP E+       V +++   +++E+EF+
  S:    53 DIWRKYKEQESCIWTVEEIDLGNDMKDWAALNDGERHFIKHVLAFFAGSDGI--VVENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHA-IQTIPCIQRKAEWAVRWIGSSASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKHKLPRER-------VLEIIVDAVNIEREFI 268
>gi|150024561|ref|YP_001295387.1| ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium psychrophilum JIP02/86] >gi|149771102|emb|CAL42569.1| Ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium psychrophilum JIP02/86] (325 aa)
Score = 116, Expect = 4.2e-04, Identities = 61/295 (20%), Positives = 120/295 (40%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSD-QINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKK-VAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETDDD 335
           E +  +  +FW  E+I +S DL  WN   SN +   V+                      N +   E   +  F  M+  +H+ +Y  +  T+   + + +   + +    +++K+A   + +   D   +  +A A + G    G F   ++L  + L+P       LI RD+ +H  ++ + +    V K+P E+       +  ++   +++E+EF+ E      I   A+  + Y    A + L  LG D     E     P  F+ + +   +  +FF    + Y    V  TD +
  S:    27 EFYKSMEASFWTAEEIDLSQDLNDWNNKLSNDERYFVKHILAFFAASDGIVNENLAENFVNEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKDEVEKDELFNALEVFPAIKKKADWALQWIESDSFAERLIAFAAVEGIFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGVHCDFAVHLHNHHLVNKVPKER-------IRSIIVDALNIEREFITESLPVSLIGMNAVLMTQYLEFVADRLLVELGCDR----EYNTANPFDFMDMISLQGKT-NFFEKKVAEYQKAGVMNTDSE 315
>gi|118602534|ref|YP_903749.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567473|gb|ABL02278.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (378 aa)
Score = 116, Expect = 4.3e-04, Identities = 63/226 (27%), Positives = 108/226 (47%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSS-----DQINSAHDWVVNCESLQKRAQVLIPY---YI--GDDPLKSK-------------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           D +  E++ ++T+     FW PE+I +S D   ++KL  N + + V       LLDS+Q    ++A +   SL + E  I T ++F   +H+RSY  I     +      D I    + +   ES  K    LI Y   Y+  G   LK +                   ++  ++     Y  F   F    + ++     II++I RD+ +H        N  S  K    + K+  E Q E    V  +  +  + EK++   L+
  S:    30 DKQKFEIFEKLTEKQLSFFWRPEEIDVSKDKIDFSKLLPNEKHIFVSNLQYQILLDSVQGRAPNIAFLPIVSLPEVENWIET-WSFSETIHSRSYTHIIRAIINEPGVIFDDIMKTDEIIQRAESASKHYDGLIKYTQAYLLHGTGKLKIQEEEVSIDLYCLKKQLYLTIMSVNILEAVRFYVSFACSFAFAERKVMEGNAKIIKMIARDEALHLTGTQHMLNLMSSGKDDLDMQKISKECQDE----VITMFREACEQEKDWAEYLF 292
>gi|152979144|ref|YP_001344773.1| ribonucleotide-diphosphate reductase subunit beta [Actinobacillus succinogenes 130Z] >gi|150840867|gb|ABR74838.1| Ribonucleoside-diphosphate reductase [Actinobacillus succinogenes 130Z] (376 aa)
Score = 116, Expect = 4.3e-04, Identities = 75/281 (26%), Positives = 130/281 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY---IGDDPLKS----------------------------KVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARADENHDF 316
           D +  E + ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY   I D  L S                             ++   +     Y  F   F    + L+     II+ I RD+ +H   + +      A     + AE+    K+  +DL     + EK + + L+      G N  D  +++  Y     +Q +G   PF                      P+E E+   +  Q+ ++ D + DF
  S:    30 DQQKYETFEKLIEKQLSFFWRPEEVDVSQDRIDYAALPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSI--VFDDIVTNEEIIKRAKDISAYYDDLIRDSQLYSLYGEGTYQVDGKECAVTLRNLKKRLYLCLMSVNALEAIRFYVSFACSFAFAERQLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDPEMAEIAEECKQEAYDLFVAAAEQEKAWADYLFKDGSMIGLN-KDILVQYVEYITNIRMQAVGLPLPFEARSNPIPWINAWLVSDNVQVAPQEVEVSSYLVGQIDSKVDAD-DF 371
>gi|15602584|ref|NP_245656.1| ribonucleotide-diphosphate reductase subunit beta [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721013|gb|AAK02803.1| NrdB [Pasteurella multocida subsp. multocida str. Pm70] (376 aa)
Score = 116, Expect = 4.4e-04, Identities = 66/263 (25%), Positives = 118/263 (44%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK---------------------------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEI 298
           D +  E + ++ +     FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY  DD ++                                   ++   +     Y  F   F    + L+     II+ I RD+ +H   + +      +     + AE+    K+  +DL     + EKE+ + L+      G N  D  +++  Y     +Q +G   PF      I
  S:    30 DQQKYETFEKLIEKQLSFFWRPEEVDVSQDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSV--IFDDIVTNEEIIKRAKDISAYY--DDLIRDSQLYTLYGEGTYNVDGQDCVVTLRNLKRQLYLCLMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIKFIARDEALHLTGTQHILNIMASGQDDPEMAEIVEECKQEAYDLFVAAAEQEKEWADYLFKDGSMIGLN-RDILVQYVEYITNIRMQAVGLPLPFQARSNPI 333
>gi|91787004|ref|YP_547956.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas sp. JS666] >gi|91696229|gb|ABE43058.1| Ribonucleoside-diphosphate reductase [Polaromonas sp. JS666] (406 aa)
Score = 116, Expect = 4.4e-04, Identities = 64/247 (25%), Positives = 112/247 (45%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTF-CSSDQINSAHDWVVNCESLQKRAQVLIPYY-IGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEE 295
           N W+P+++ ++ D+  W   N L  + + LV R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +I +A++ V   +S++ + Q LIP+  +  DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE K  +  L  + ++LE  +  +       G N A     +  Y A +    +G ++ F  EE
  S:   106 NHWMPQEVNMTRDIALWKDPNGLTEDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYITESLGLDEAEIFNAYNEV---QSIKDKDQFLIPFIEVISDPHFKTGTTEADQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLEN-PHLWTAEFKAEIKALFLKAVELEYRYAEDTMPRGVLGLN-ASMFKGYLRYIANRRATQIGLETLFPNEE 371
>gi|19074323|ref|NP_585829.1| RIBONUCLEOSIDE DIPHOSPHATE REDUCTASE SMALL CHAIN [Encephalitozoon cuniculi GB-M1] >gi|51701822|sp|Q8SRR2|RIR2_ENCCU Ribonucleoside-diphosphate reductase small chain (Ribonucleotide reductase small subunit) >gi|19068965|emb|CAD25433.1| RIBONUCLEOSIDE DIPHOSPHATE REDUCTASE SMALL CHAIN [Encephalitozoon cuniculi GB-M1] (325 aa)
Score = 116, Expect = 4.4e-04, Identities = 57/246 (23%), Positives = 111/246 (45%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGD---DPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYS---GYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLG 286
           +++ +   +FW  E++++  D+  W KL++  +  +          D I   +  V +    +   E   +  F   +  +H+  Y  +  T+   +D+ N   D +    S++++A   I  +I D   D     VA A + G    G F   F+L  + L+P       LI RD+ +H  ++    Y  +KK  ++        K+ V D     +++EK+FL+E       G N  +   ++  + A + L+NLG
  S:    30 KMYKKAESSFWTVEEVSLDKDIDDWGKLNAKERHFISYVLAFFAASDGI-VNLNLVERFSTEVKVLEARFFYGFQMAIENIHSEMYSLLIDTYIRDNDEKNFLFDAIRTIPSVKEKADWAI-RWIEDKNSDFATRLVAFACVEGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHCEFACLLHYHLKKKCNRI--------KEVVMD----AVEIEKKFLSESLPVNLIGMN-CNLMCRYIEFVADRLLENLG 272
>gi|167405027|ref|ZP_02309794.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes FSL J2-003] (253 aa)
Score = 116, Expect = 4.5e-04, Identities = 45/210 (21%), Positives = 93/210 (44%)
  Q:     9 NKSVSPIEYAKDGLKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYY 218
           N+S S I     G+      +NWN I        +  ++ N+W+P+++ + +D   +  L    +         L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +
  S:    23 NRSTSIINGETSGI------LNWNDIPYPSFYRAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKF 232
>gi|17547523|ref|NP_520925.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia solanacearum GMI1000] >gi|17429827|emb|CAD16511.1| putative transmembrane ribonucleoside reductase (small chain) oxidoreductase protein [Ralstonia solanacearum] (400 aa)
Score = 115, Expect = 5.0e-04, Identities = 62/247 (25%), Positives = 113/247 (45%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQA---TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEE 295
           N W+P++I +S D+  W   N L  + + ++ R        DS+ A    +G   Q+  +  +  Q +    AF   +H  +Y  I  +     ++  N+ H+     +S++ + + LIP+   + D   K+              V A +M G   Y GF     +G +N +    +  + ILRD+ +H N+      Q K+   P    AE K  + +L  + +DLE  +  +      +   A  F  Y      +  Q +G D+ F  E+
  S:   100 NHWMPQEINMSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQI--TAPECRQYLLRQ-AFEEAIHTHAYQYIVESLGLNEAEIFNAYHE----VQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLEN-PHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNED 365
>gi|115387427|ref|XP_001211219.1| ribonucleoside-diphosphate reductase small chain [Aspergillus terreus NIH2624] >gi|114195303|gb|EAU37003.1| ribonucleoside-diphosphate reductase small chain [Aspergillus terreus NIH2624] (401 aa)
Score = 115, Expect = 5.1e-04, Identities = 52/219 (23%), Positives = 93/219 (42%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E+W    +   +FW  E+I +S DL  W N+L+ + +  +          D I      V +    +   E   +  F  M+  +H+ +Y  +  T+     Q     D + N   + K+A   I +    +    +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +  P KQ      V D++ + + +EKEFL +
  S:    91 EIWQMYKKAEASFWTAEEIDLSKDLHDWNNRLNEDERYFISHVLAFFAASDGI-VNENLVERFSGEVQIPEARCFYGFQIMIENIHSETYSLLIDTYIKEPKQRTYLFDAIDNIPCIAKKADWAIKWIQDQESTFGQRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNNR--PSKQV-----VEDIIVEAVAIEKEFLTD 309
>gi|297449|emb|CAA46231.1| ribonucleotide reductase, small subunit [Schizosaccharomyces pombe] >gi|447147|prf||1913428B ribonucleotide reductase:SUBUNIT=small (391 aa)
Score = 115, Expect = 5.2e-04, Identities = 66/299 (22%), Positives = 128/299 (42%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINSAH-DWVVNCESLQKRAQVLIPYYIGDDPLKS--KVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSY----IMGNVEETDDDDWDF 339
           E+W    +   +FW  E+I +S DL  W NKL+++ +  +          D I      + +  + +   E      F  M+  +H+ +Y  +  T+    +    H D ++   S++ +A+  + +   +D   +   VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +          K    +K +  ++ + +D+EKE+  +       G N  D   ++  + A + L  LG D  +        P  F++  + A +  +FF    S Y    +M   +  + DD  F
  S:    85 EIWQFYKKAEASFWTAEEIDLSKDLVDWDNKLNADERYFISTVLAYFAASDGI-VNENLLERFSSEVQIPEARCVYGFQIMIENIHSETYSLLLDTYIREPKEKQRHFDAILTMGSIKAKAKWALRWINDEDSTYAIRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLMFSHL-------KHRPGRKLLKPIIVEAVDIEKEYFTDALPVSLLGMN-KDLMCQYIEFVADRLLVALGNDKYYNV----TNPFDFMENISLAGKT-NFFEKKVSDYQIAGVMSGTKRAEKDDHTF 385
>gi|167344337|ref|ZP_02290178.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes FSL J1-208] (265 aa)
Score = 115, Expect = 5.3e-04, Identities = 46/204 (22%), Positives = 93/204 (45%)
  Q:    83 LTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLG 286
           L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  D     ++LE E+  E+  G    D  + + +  Y A K L  LG
  S:    23 LATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTDELVEYTHDAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLG 234
>gi|149248382|ref|XP_001528578.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces elongisporus NRRL YB-4239] >gi|146448532|gb|EDK42920.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces elongisporus NRRL YB-4239] (422 aa)
Score = 115, Expect = 5.7e-04, Identities = 48/219 (21%), Positives = 95/219 (43%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           +++ +   +FW  E+I +  D+  W NKL+ N +  + R        D I      V      +   E   +  F  M+  +H+ +Y  +  T+     + +   + + N   ++K+A   I +   D+ L ++  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +  P       K V  ++ + +++EKEF  +
  S:   121 QMYKKAEASFWTAEEIDLGKDMHDWKNKLNENERFFISRILAFFAASDGI-VNENLVENFSAEVQIPEAKSFYGFQIMMENIHSETYSLLIDTYIKDPKEADFLFNAIDNIPQIKKKADWAIRWINDDNALFAERLVAFAAVEGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLENRPDP-------KIVEKIISEAVEIEKEFFTD 336
>gi|119478853|ref|XP_001259462.1| ribonucleotide reductase small subunit RnrA, putative [Neosartorya fischeri NRRL 181] >gi|119407616|gb|EAW17565.1| ribonucleotide reductase small subunit RnrA, putative [Neosartorya fischeri NRRL 181] (405 aa)
Score = 115, Expect = 5.7e-04, Identities = 49/219 (22%), Positives = 96/219 (43%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           +++ +   +FW  E+I +S DL  W N+L+ + +  +          D I      + +  N +   E   +  F  M+  +H+ +Y  +  T+     Q     D +     + K+AQ  + +    +   ++  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +  P+     KK V D++ + + +E+EFL E
  S:    95 QMYKKAEASFWTAEEIDLSKDLHDWNNRLNDDERYFISHVLAFFAASDGI-VNENLLERFSNEVQVPEARCFYGFQIMIENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIAKKAQWAMRWISDKESTFAQRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNHR--PD-----KKVVEDIIVEAVAIEQEFLTE 310
>gi|186477386|ref|YP_001858856.1| ribonucleoside-diphosphate reductase [Burkholderia phymatum STM815] >gi|184193845|gb|ACC71810.1| Ribonucleoside-diphosphate reductase [Burkholderia phymatum STM815] (407 aa)
Score = 115, Expect = 5.9e-04, Identities = 68/279 (24%), Positives = 120/279 (43%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPY-YIGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAK---LPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMG 327
           N W+P++I +S D+  W   N L  + + ++ R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +  N+ H+     +S++ + + LIP+ +   DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+       PE +AE++    ++    +DLE  +  +      +   A  F  Y      +  Q +G D P  P E    P +   +  + + N  FF      Y  G
  S:   107 NHWMPQEINMSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VQSIRDKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTPEFRAEIR----EIFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGID-PLYPNEENPFPWMSEMIDLKKERN--FFETRVIEYQTG 401
>gi|73852496|ref|YP_293780.1| ribonucleoside-diphosphate reductase small chain [Emiliania huxleyi virus 86] >gi|72415212|emb|CAI65449.1| ribonucleoside-diphosphate reductase small chain [Emiliania huxleyi virus 86] (325 aa)
Score = 115, Expect = 6.1e-04, Identities = 60/266 (22%), Positives = 110/266 (41%)
  Q:    22 LKGKMRSVNWNFINDDKDLEVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVA-KLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIADQAIKFSVY---NAGKFLQNLGY 287
           ++ K R V +  +++D   E + +   + W   +I IS D   W KL  N Q  +          D I      V    + +   E   +     M+  VHA +Y  +  +     D+  +    +   +S++ +A   + +   +     + +A A++ G    G F   F+L  + ++P       LI RD+ +H  ++   Y+  +  KLP E        V D++   ++LE+ F+ E      I   A   S Y    A + L +LGY
  S:     7 IENKDRFVLFPIVHEDI-YEEYKKAEASLWGVSEIDISTDKTDWPKLTENEQHFIKYILAFFATADGIVFE-NLVTNFASEIQYPEARCFYGVQMMIENVHAETYSMMLQSLVEDKDEQRNLFRAIRTIQSIKNKADWALKWMNNERSFAERLIAFAVVEGIFFSGAFCAIFWLKKRAIMPGLTFSNELISRDEGLHTDFACMLYRNHIIHKLPYET-------VLDIITNAVELERLFICEALPVSLIGINAESMSTYIKFVADRLLISLGY 270
>gi|88859281|ref|ZP_01133921.1| ribonucleotide-diphosphate reductase beta subunit [Pseudoalteromonas tunicata D2] >gi|88818298|gb|EAR28113.1| ribonucleotide-diphosphate reductase beta subunit [Pseudoalteromonas tunicata D2] (376 aa)
Score = 115, Expect = 6.2e-04, Identities = 52/166 (31%), Positives = 84/166 (50%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------------------IGDDP-------LKSKVAAAMMPGFLL-----YGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  I T ++F   +H+RSY  I        ++    D +V+ + +++RA  +  YY                   I D         LK K+  A+M   +L     Y  F   F    + L+     II+LI RD+ +H
  S:    48 FWRPEEVDVSKDRVDFENLPDHEKHIFLSNLKYQTLLDSIQGRSPNVALLPIVSLPELETWIET-WSFSETIHSRSYTHIIRNVTKQPEL--IFDDIVDNDKIKERADEVTRYYDDLIEYTSIYNLYGEGKHQINDQTVVINLFELKKKLYRAIMSVNILEAIRFYVSFACSFAFAERELMEGNAKIIKLIARDEALH 242
>gi|83746810|ref|ZP_00943858.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia solanacearum UW551] >gi|83726579|gb|EAP73709.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia solanacearum UW551] (402 aa)
Score = 115, Expect = 6.3e-04, Identities = 54/208 (25%), Positives = 99/208 (47%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQA---TIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEF 256
           N W+P++I +S D+  W   N L  + + ++ R        DS+ A    +G   Q+  +  +  Q +    AF   +H  +Y  I  +     ++  N+ H+     +S++ + + LIP+   + D   K+              V A +M G   Y GF     +G +N +    +  + ILRD+ +H N+      Q K+   P    AE K  + +L  + +DLE  +
  S:   102 NHWMPQEINMSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQI--TAPECRQYLLRQ-AFEEAIHTHAYQYIVESLGLNEAEIFNAYHE----VQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLEN-PHLWTAEFKAEITELFKKAVDLEYRY 325
>gi|4836362|gb|AAD30422.1|AF117061_1 ribonucleotide reductase R2 subunit [Aedes albopictus] (398 aa)
Score = 115, Expect = 6.4e-04, Identities = 57/248 (22%), Positives = 105/248 (42%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAF-MVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFN--IADQAIKFSVYNAGKFLQNLGYD 288
           +++ +   +FW  E++ +S DL  W KL S  +  +          D I   +  V +    +   E   +  F   M  VH+  Y  +  T+   S +     + + N   ++K+A   + +         +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   ++  V K   E+       V +++ + + +E+EFL +       G N  +  Q I+F    A + L  LG D
  S:   101 QMYKKAEASFWTVEEVDLSKDLADWEKLKSGEKHFISHVLAFFAASDGI-VNVNLVERFSQEVQVTEARCFYGFQIAMENVHSEMYSLLIDTYIRDSKEREYLFNAIDNLPCVKKKADWALNWISSKQANFGERVVAFAAVEGIFFSGTFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFKYLVQKPSQER-------VIEIIREAVLIEQEFLTKALPVDLLGMNCELMSQYIEFE---ADRLLLELGID 347
>gi|840719|emb|CAA54549.1| ribonucleotide reductase R2 [Arabidopsis thaliana] (340 aa)
Score = 114, Expect = 6.6e-04, Identities = 53/254 (20%), Positives = 107/254 (42%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAF-MVGVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK-VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFL------NELYAGFNIADQAIKFSVYNAGKFLQNLGYDSPFTPE 294
           E++ +   +FW  E++ +S D+  W  L  + +  +          D I   + ++A+  N +   E   +  F   M  +H+  Y  +  TF   S + +   + +     + K+A+  + +         + VA A   G    G F   F+L  + L+P       LI RD+ +H  ++          +P EK       V+ ++++ +++E EF+      + +    N+  Q I+F    A + L  LG +  +  E
  S:    41 EMYKKAEASFWTAEEVDLSTDVQQWEALTDSEKHFISHILAFFAASDGI--VLENLARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFIKDSKEKDRLFNAIETIPCISKKAKWCLDWIQSPMSFAVRLVAFACAEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLISLLQLHVPLEK-------VYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFV---ADRLLVTLGCERTYKAE 291
>gi|150863757|ref|XP_001382334.2| small subunit of ribonucleotide reductase [Pichia stipitis CBS 6054] >gi|149385013|gb|ABN64305.2| small subunit of ribonucleotide reductase [Pichia stipitis CBS 6054] (417 aa)
Score = 114, Expect = 6.8e-04, Identities = 52/219 (23%), Positives = 96/219 (43%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSWN-KLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           EVW    +   +FW  E+I +S D+  WN +L+ N +  + R        D I      V      +   E   +  F  M+  +H+ +Y  +  ++     + +   + + N   ++K+A   + +   DD L  +  VA A + G    G F   F+L  K L+P       LI RD+ +H  ++   +    + L     AE+   V  ++ + + +EKEF  +
  S:   110 EVWQMYKKAEASFWTAEEIDLSKDITDWNNRLNDNERFFISRILAFFAASDGI-VNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDSYIKDPKEADFLFNAIDNIPCIRKKADWALRWISDDDALFGERLVAFAAVEGIFFSGSFASIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLF----SHLQNRPDAEI---VEKIITEAVKIEKEFFTD 328
>gi|156545974|ref|XP_001606963.1| PREDICTED: similar to ENSANGP00000013211 [Nasonia vitripennis] (388 aa)
Score = 114, Expect = 7.7e-04, Identities = 45/218 (20%), Positives = 93/218 (42%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCS-SDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           ++ +   +FW  E++ +S D+  WN+L+ N +  +          D I      V +    +   E   +  F   +  +H+  Y  +  T+ S + Q     + +     + K+A   + +   D    ++  +A A + G    G F   F+L  + L+P       LI RD+ +H  ++   ++  V K P E++      V  ++   + +E+EFL +
  S:    90 MYKKAEASFWTVEEVDLSKDMADWNRLNDNERHFISHVLAFFAASDGI-VNENLVERFSQEVQVTEARCFYGFQVAIENIHSEMYSLLIDTYISDASQRQFLFNAIETLPCVAKKANWALNWISHDSATFAERVIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHIVQK-PSEER------VISIIKDAVTIEQEFLTD 303
>gi|148244629|ref|YP_001219323.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Vesicomyosocius okutanii HA] >gi|146326456|dbj|BAF61599.1| ribonucleoside-diphosphate reductase beta subunit [Candidatus Vesicomyosocius okutanii HA] (378 aa)
Score = 114, Expect = 7.8e-04, Identities = 49/180 (27%), Positives = 89/180 (49%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSS-----DQINSAHDWVVNCESLQKR-------AQVLIPYYIGDDPLKSK-----------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           D +  E++ ++T+     FW PE+I +S D   + KL  N + + +       LLDS+Q+   ++A +   SL + E  I T ++F   +H+RSY  I     +      D I    + +   ES+ K         Q  + + IG   ++ K                 ++  ++     Y  F   F    + ++     IIR+I RD+ +H
  S:    30 DKQKFEIFEKLTEKQLSFFWRPEEIDVSKDKIDFAKLLPNEKHIFISNLQYQILLDSVQSRSPNIAFLPIVSLPELENWIET-WSFSETIHSRSYTHIIRAIVNEPGIVFDDIMKIDEIIQRAESVSKHYNELIKCTQAYLLHGIGKFKVQDKEILIDLYCLKKQLYLTIMSVNILEAVQFYVSFACSFAFAERKVMEGNAKIIRMIARDEALH 242
>gi|169779219|ref|XP_001824074.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83772813|dbj|BAE62941.1| unnamed protein product [Aspergillus oryzae] (405 aa)
Score = 114, Expect = 7.9e-04, Identities = 50/219 (22%), Positives = 93/219 (42%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPL--KSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E+W    +   +FW  E+I +S DL  W N+L+ + +  + R        D I      + +    +   E   +  F  M+  +HA +Y  +  T+     Q     D +     ++K+A   I +    +    +  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +  P+        V D++ + + +EKEFL +
  S:    93 EIWQMYKKAEASFWTAEEIDLSKDLHDWHNRLNDDERFFISRVLAFFAASDGI-VNENLLERFSGEVQIPEARCFYGFQIMIENIHAETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIRWIQDQESTFGQRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNNRPDPQ-------IVEDVIVEAVSIEKEFLTD 311
>gi|94676795|ref|YP_588829.1| ribonucleotide-diphosphate reductase subunit beta [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|94219945|gb|ABF14104.1| ribonucleoside-diphosphate reductase, beta subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (376 aa)
Score = 114, Expect = 8.3e-04, Identities = 49/166 (29%), Positives = 74/166 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------------------IGDDPLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH 215
           FW PE++ IS D   +  L  + + + +      TLLDSIQ    +VA +        +     +AF   +H+RSY  I     +   +    D V N E L KRA+ +  +Y                          +    LK K+   +M          Y  F   F    + L+     IIRLI RD+ +H
  S:    48 FWRPEEVDISLDRIDYQALPQHEKHIFISNIKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHSRSYTHIIRNIVNDPSL-VFDDIVTNTEIL-KRAKDIAAFYDDLIQMTSYFHLFGEGNHSINGKLVIVNQHELKKKLYLCLMSINALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEALH 242
>gi|82703584|ref|YP_413150.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosospira multiformis ATCC 25196] >gi|82411649|gb|ABB75758.1| Ribonucleoside-diphosphate reductase [Nitrosospira multiformis ATCC 25196] (408 aa)
Score = 113, Expect = 8.5e-04, Identities = 73/285 (25%), Positives = 128/285 (44%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQAT---IGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC--SSDQINSAHDWVVNCESLQKRAQVLIPYY-IGDDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYA----GFNIADQAIKFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETD 333
           N W+P++I +S D+  W   N L  + + +V R        DS+ A    +G    V N   +  Q +    AF   +H  +Y  I  +      +  N+ H+      S++++ + LIP+     DP             LKS +  A +M G   Y GF     LG +N +  + +  + ILRD+ +H N+      Q K+   P     E +  +  L+ + ++LE  +  +       G N A    ++  Y A +  Q +G D  + P  +   P +   +  + ++N  FF    + Y  G V   D
  S:   108 NHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHVTNP--ECRQYLLRQ-AFEEAIHTHAYQYIVESLGLDEGEIFNAYHE----VRSIREKDEFLIPFIDTLTDPSFRTGTLEADQKLLKSLIVFACIMEGLFFYVGFIQILALGRQNKMTGSAEQYQYILRDESMHCNFGIDVVNQIKMEN-PHLWTKEFRSEISALMQKAVELEYRYAEDTMPRGVLGLN-APMFKEYLRYIANRRCQQIGLDILY-PGASNPFPWMSEMIDLKKEKN--FFETRVTEYQTGGVLNWD 408
>gi|91763118|ref|ZP_01265082.1| ribonucleotide-diphosphate reductase beta subunit [Candidatus Pelagibacter ubique HTCC1002] >gi|91717531|gb|EAS84182.1| ribonucleotide-diphosphate reductase beta subunit [Candidatus Pelagibacter ubique HTCC1002] (342 aa)
Score = 113, Expect = 9.1e-04, Identities = 61/284 (21%), Positives = 120/284 (42%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNK-LDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIY---------TNFAFMVGVHARSYG----------SIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLN---ELYAGFNIADQAIKFSV-YNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSY 324
           + W    +  WLPE++ + +D+  W K L  + + L+ + F   T  D          +V+N    H   ++         T FA M  VH  +Y           S +S F    ++   +D++ N +   K+          D  L   V +A   G  L+  F +       N +     I+   +RD+ +H       +++ + + P     E+K  ++     +I+ E  F++   E+     +  Q +K  + + A + L  LG +  +   + +  P  ++     A E+ +FF G  + Y
  S:    43 DAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSEKNLLTQIFRFFTQAD---------VEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAFMKYKEMKDKYDYMQNFDMSSKK----------DIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIANRRLSQLGLEPIY---DVDKNPLTWLDSMLNAVEHMNFFEGRSTEY 328
>gi|91081999|ref|XP_969259.1| PREDICTED: similar to AGAP006818-PA [Tribolium castaneum] (374 aa)
Score = 113, Expect = 9.3e-04, Identities = 50/219 (22%), Positives = 94/219 (42%)
  Q:    41 EVWNRITQ---NFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSSDQINS-AHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           ++W++  Q   +FW  E++ +S DL  W NKL+S+ +  +          D I      V +    +   E   +  F   +  +H+  Y  +  T+ S  Q      + +     ++K+A   + +    +    +  VA A + G    G F   F+L  +NL+P       LI RD+ +H  ++   +   V K   E+       +  ++   + +EKEFL E
  S:    74 DIWDKYKQAEASFWTTEEVDLSKDLDDWKNKLNSDERYFISHVLAFFAASDGI-VNENLVERFSQEVQVTEARCFYGFQIAIENIHSEMYSMLIETYISEPQEKEFLFNAIETLPCVKKKADWALLWINSKNATFGERIVAFAAVEGIFFSGSFASIFWLKKRNLMPGLTFSNELISRDEGLHCDFACLMFSHLVQKPSKER-------IQSIIQDAVKIEKEFLTE 292
>gi|71083845|ref|YP_266565.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Pelagibacter ubique HTCC1062] >gi|71062958|gb|AAZ21961.1| ribonucleoside-diphosphate reductase beta chain [Candidatus Pelagibacter ubique HTCC1062] (337 aa)
Score = 113, Expect = 9.4e-04, Identities = 61/284 (21%), Positives = 120/284 (42%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNK-LDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIY---------TNFAFMVGVHARSYG----------SIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLN---ELYAGFNIADQAIKFSV-YNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSY 324
           + W    +  WLPE++ + +D+  W K L  + + L+ + F   T  D          +V+N    H   ++         T FA M  VH  +Y           S +S F    ++   +D++ N +   K+          D  L   V +A   G  L+  F +       N +     I+   +RD+ +H       +++ + + P     E+K  ++     +I+ E  F++   E+     +  Q +K  + + A + L  LG +  +   + +  P  ++     A E+ +FF G  + Y
  S:    38 DAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSEKNLLTQIFRFFTQAD---------VEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAFMKYKEMKDKYDYMQNFDMSSKK----------DIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIANRRLSQLGLEPIY---DVDKNPLTWLDSMLNAVEHMNFFEGRSTEY 323
>gi|77975442|ref|ZP_00830977.1| COG0208: Ribonucleotide reductase, beta subunit [Yersinia frederiksenii ATCC 33641] (376 aa)
Score = 113, Expect = 9.5e-04, Identities = 56/212 (26%), Positives = 94/212 (44%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYYIGDD----------------------------PLKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH--------NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE+I +S D   +  L  + + + +      TLLDSIQ    ++A +        +     ++F   +H+RSY  I     +   I    D +V  E + KRA+ +  YY  DD                             LK ++   +M          Y  F   F    + L+     II++I RD+ +H        N     +   ++A++  E Q +     +DL       EKE+   L+
  S:    48 FWRPEEIDVSRDRIDYQNLPEHEKHIFISNLKYQTLLDSIQGRSPNIALLPIISIPELETWVETWSFSETIHSRSYTHIIRNIVNDPAI--VFDDIVTNEEILKRAKDISAYY--DDLIEMTSYYHLLGEGTHQVNGKTVVVNLRELKKQLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIKMIARDEALHLTGTQHILNLMRSGEDDPEMAEIAEECQQQ----CYDLFVLAAQQEKEWAEYLF 292
>gi|51891459|ref|YP_074150.1| ribonucleoside-diphosphate reductase beta subunit [Symbiobacterium thermophilum IAM 14863] >gi|51855148|dbj|BAD39306.1| ribonucleoside-diphosphate reductase beta subunit [Symbiobacterium thermophilum IAM 14863] (346 aa)
Score = 113, Expect = 9.6e-04, Identities = 42/195 (21%), Positives = 97/195 (49%)
  Q:    48 QNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHD-WVVNCESLQKRAQVLIPYYI-GDDP-----LKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-----NYYSGYKYQKKVAKLPPEKQAEMKKFV 242
           +NFW+PE++ + +D   + +L ++ Q    R  + +  +DSI      +  + N +T  E  +  +   F   +H++SYG +  +   +++    +D W  + + L++   +   + +  D+P     +++ +A  ++ G   Y GF   + L     +  T   I+ I RD++ H     N  +G + Q++     P+  A+++  +
  S:    52 RNFWIPEEVPLLDDAKQYLELTADEQWAYDRMLSFVIFMDSILTV--SMPNLINYVTAPEINMCLSIHNFHEALHSKSYGYVLESVVPAERRQYIYDLWREDRQLLERNRYIANTFQLFADNPTDEHFVRACMAQYVLEGIYFYSGFAFFYALARMGKMKGTATEIQFINRDEITHVAVFQNILNGLR-QERPQLFTPQLDADLRAMI 256
>gi|118049413|ref|ZP_01517964.1| ribonucleotide reductase [Comamonas testosteroni KF-1] >gi|118003280|gb|EAV17433.1| ribonucleotide reductase [Comamonas testosteroni KF-1] (363 aa)
Score = 113, Expect = 9.9e-04, Identities = 53/208 (25%), Positives = 98/208 (47%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTF-CSSDQINSAHDWVVNCESLQKRAQVLIPYYIG-DDP-------------LKSKVA-AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEF 256
           N W+P+++ ++ D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +I +A++ V   +S++ + + LIP+     DP             LKS +  A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE K+ + +L  + ++LE  +
  S:    63 NHWMPQEVNMTRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDESEIFNAYNEV---QSIRDKDEFLIPFIEAIMDPNFHTGTPETDQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLEN-PHLWTAEFKQEITELFQRAVELEYRY 286
>gi|70997335|ref|XP_753417.1| ribonucleotide reductase small subunit RnrA [Aspergillus fumigatus Af293] >gi|66851053|gb|EAL91379.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus fumigatus Af293] >gi|159126856|gb|EDP51972.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus fumigatus A1163] (405 aa)
Score = 113, Expect = 1.0e-03, Identities = 49/219 (22%), Positives = 97/219 (44%)
  Q:    41 EVWN---RITQNFWLPEKIAISNDLPSW-NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMV-GVHARSYGSIFSTFCSS-DQINSAHDWVVNCESLQKRAQVLIPYYIGDDPLKSK--VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNE 259
           E+W    +   +FW  E+I +S DL  W N+L+ + +  +          D I      + +  N +   E   +  F  M+  +H+ +Y  +  T+     Q     D +     ++K+AQ  + +    +   ++  VA A + G    G F   F+L  + L+P       LI RD+ +H  ++   +     +  P+     KK + D++ + + +E+EFL +
  S:    92 EIWQMYKKAEASFWTAEEIDLSKDLHDWNNRLNDDERYFISHVLAFFAASDGI-VNENLLERFSNEVQVPEARCFYGFQIMIENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKAQWAMRWISDKESTFAQRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNHR--PD-----KKVIEDIIVEAVAIEQEFLTD 310
>gi|52425023|ref|YP_088160.1| ribonucleotide-diphosphate reductase subunit beta [Mannheimia succiniciproducens MBEL55E] >gi|52307075|gb|AAU37575.1| NrdF protein [Mannheimia succiniciproducens MBEL55E] (376 aa)
Score = 113, Expect = 1.1e-03, Identities = 73/276 (26%), Positives = 128/276 (46%)
  Q:    36 DDKDLEVWNRITQN----FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY---IGDDP-----------------------LKSKVAAAMMP-----GFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEM----KKFVFDLLYQVIDLEKEFLNELYA-----GFNIADQAIKFSVYNAGKFLQNLGYDSPF---------------------TPEETEIKPEIFVQLSARAD 311
           D +  E + ++ +     FW PE++ ++ D   +  L  + + + +      TLLDSIQ    +VA +   S+ + E  I T + F   +H+RSY  I     +   +    D +V  E + KRA+ +  YY   I D                         LK ++   +M          Y  F   F    + L+     II+ I RD+ +H   + +      A     + AE+    K+  +DL     + EK + + L+      G N  D  +++  Y     +Q +G   PF                      P+E EI   +  Q+ ++ D
  S:    30 DQQKYETFEKLIEKQLSFFWRPEEVDVAQDRIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPELETWIET-WTFSETIHSRSYTHIIRNIVNDPSV--VFDDIVTNEEIIKRAKDISAYYDDLIRDSQLYNLFGEGTYKVEGKECKVTLRNLKKQLYLCLMSVNALEAIRFYVSFACSFAFAERQLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDPEMAEIAEECKQEAYDLFLAAAEQEKAWADYLFKDGSMIGLN-KDILVQYVEYITNIRMQAVGLPLPFQARSNPIPWINAWLVSDNVQVAPQEVEISSYLIGQIDSKVD 367
>gi|11595816|emb|CAB90708.2| class Ia ribonucleotide-diphosphate reductase small subunit chain [Streptomyces clavuligerus NRRL 3585] (322 aa)
Score = 113, Expect = 1.1e-03, Identities = 51/220 (23%), Positives = 100/220 (45%)
  Q:    41 EVWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYYIGD---DPLKSKVA-----------AAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEK-QAEMKKFVFDLLYQVIDLEKEFLNEL 260
           E +    +N W  E++ + +D+P   KL    Q L+ R        DSI A    +   K+  +   ++  +   F   VH + Y ++  T+    +  N+A   V N  S++++AQ    +       D L+++             AA + G   YG F   ++  ++ LL         + RD+ +H  ++ ++    V K  PE     +++ V D+L + ++ E +F  +L
  S:    29 ERYRDAIKNTWTVEEVDLHSDVPDLAKLSPGEQHLIGRLVAFFATGDSIVANNLVLTLYKHINSPEARLYLSRQLFEEAVHVQFYLTLLDTYLPDPEDRNAAFAAVENIPSIREKAQFCFRWMDSVEKLDQLETQADRRRFLLNLICFAACIEGLFFYGAFAYVYWFRSRGLLHGLATGTNWVFRDETMHMNFA-FEVVDTVRKEEPELFDDALQQQVTDMLKEAVEAELQFSRDL 263
>gi|91775577|ref|YP_545333.1| ribonucleotide-diphosphate reductase subunit beta [Methylobacillus flagellatus KT] >gi|91709564|gb|ABE49492.1| ribonucleoside-diphosphate reductase class Ia beta subunit [Methylobacillus flagellatus KT] (377 aa)
Score = 112, Expect = 1.2e-03, Identities = 56/212 (26%), Positives = 103/212 (48%)
  Q:    50 FWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVK-NSLTDHEQVIYTNFAFMVGVHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY--------------IGDDPLKSK-----------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKL---PPE---KQAEMKKFVFDLLYQVIDLEKEFLNELY 261
           FW PE++ +S D   +  L  + + + +      TLLDSIQ    +VA +   SL + E  + T +AF   +H+RSY  I     S   +    D +V  E++  RA  +  YY               GD  +  +                 ++  ++     Y  F   F    + ++     IIRLI RD+ +H   +G ++   + +     PE     +E++   F++  +  + EK++ + L+
  S:    48 FWRPEEVDVSQDRIDYQGLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLPELETWVET-WAFSETIHSRSYTHIIRNIVSDPAL--IFDDIVRNENIVARASDISAYYDDLIHYTMLYSQLGKGDHVINGETKTVNLRELKKLLYLCLMSVNILEAIRFYVSFACSFAFAERKVMEGNAKIIRLIARDEALH--LTGTQHMLNIMRSGQDDPEFAGIASELQDECFEMFKRAAEQEKKWADYLF 292
>gi|120609557|ref|YP_969235.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120588021|gb|ABM31461.1| Ribonucleoside-diphosphate reductase [Acidovorax avenae subsp. citrulli AAC00-1] (387 aa)
Score = 112, Expect = 1.2e-03, Identities = 52/208 (25%), Positives = 97/208 (46%)
  Q:    49 NFWLPEKIAISNDLPSW---NKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVGVHARSYGSIFSTF-CSSDQINSAHDWVVNCESLQKRAQVLIPYY--IGDDPLKSK-------------VAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIH-NYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEF 256
           N W+P+++ ++ D+  W   N L  + + +V R        DS+ A    +   ++      +      AF   +H  +Y  I  +      +I +A++ V   +S++ + + LIP+   I D   K+              V A +M G   Y GF     LG +N +    +  + ILRD+ +H N+      Q K+   P    AE K+ +  L  + ++LE ++
  S:    87 NHWMPQEVNMTRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVESLGLDESEIFNAYNEV---DSIRHKDEFLIPFIEAIMDPDFKTGTPETDQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLEN-PHLWTAEFKEEIKGLFMKAVELEYQY 310
>gi|152989800|ref|YP_001355522.1| ribonucleotide-diphosphate reductase subunit beta [Nitratiruptor sp. SB155-2] >gi|151421661|dbj|BAF69165.1| ribonucleoside-diphosphate reductase, beta subunit [Nitratiruptor sp. SB155-2] (341 aa)
Score = 112, Expect = 1.3e-03, Identities = 65/292 (22%), Positives = 130/292 (44%)
  Q:    42 VWNRITQNFWLPEKIAISNDLPSWNKLDSNWQELVVRTFTGLTLLDSIQATIGDVAQVKNSLTDHE-QVIYTNFAFMVGVHARSYGSIFSTFC-SSDQINSAHDWVVNCESLQKRAQVLIPYY-IGDDPLKSKVAAAM-----MPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQV----IDLEKEFLNELYAG--FNIADQAI-KFSVYNAGKFLQNLGYDSPFTPEETEIKPEIFVQLSARADENHDFFSGSGSSYIMGNVEETD 333
           +W  +  N W P+++ ++ D   +  L    +    +    L  +DS+Q T   +  V   +T  E  +I    AF   +H++SY  +  +   ++D+I     W  + +  QK   +   Y  +  +P    +  AM     + G   Y GF   + L     +  +  +IR I RD+V H       +Q  +  +  E+     K + D +Y++    +DLE  +   +  G    + D+ I ++  Y A   L+ +G +  +  E      + F + +   D+  +FF G+ ++Y  G+++  D
  S:    44 LWEMMLANTWFPKEVDMTQDARDYKLLTDAEKLAYDKVLAQLIFMDSLQ-TNNLIDNVNPYITAPEINLILVRQAFEEALHSQSYAVMVDSISQNTDEIYEL--WREDLQLKQKNDYIAHVYEELAANPSDENIVKAMFANQILEGIYFYSGFTYMYTLARSGKMLGSAQMIRFIQRDEVTHLLI----FQNMINTVKKERPELFTKELIDDVYKMFEGAVDLETSWGKYITQGQILGLTDEIIEQYIKYLADDRLKRVGLEPMYNVEHPIKWVDDFSKFN---DQKTNFFEGNVTNYSKGSLDFDD 340
>gi|167058260|ref|ZP_02280517.1| ribonucleotide-diphosphate reductase subunit beta [Listeria monocytogenes FSL F2-515] (271 aa)
Score = 112, Expect = 1.4e-03, Identities = 45/204 (22%), Positives = 93/204 (45%)
  Q:    83 LTLLDSIQATIGDVAQVKNSLTDHEQVIYTNFAFMVG---VHARSYGSIFSTFCSSDQINSAHDWVVNCESLQKRAQVLIPYY-------IGDDPLKSKVAAAMMPGFLLYGGFYLPFYLGAKNLLPNTLDIIRLILRDKVIHNYYSGYKYQKKVAKLPPEKQAEMKKFVFDLLYQVIDLEKEFLNELYAGFNIAD--QAIKFSVYNAGKFLQNLG 286
           L  LDS Q     +  +   +TD    ++ N A +     +H  SY  + ++  +  + N   +      ++ KR + ++  Y        G+  +K+ + ++++ G   Y GF   + L  +N +  T  II  I RD++ H+ +     +  + + P  +  E+ ++  +     ++LE E+  E+  G    D  + + +  Y A K L  LG
  S:     9 LATLDSPQTRF--IYNIAEYITD--PAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIMDAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRDELAHSKFISEVIRAILGENPELQTEELVEYTHEAFRHAVELETEWSEEVLQGIEGIDVEEMVDYVKYRANKMLGMLG 220