>gi|26553541|ref|NP_757475.1| permease [Mycoplasma penetrans HF-2] >gi|26453547|dbj|BAC43879.1| predicted permeases [Mycoplasma penetrans HF-2] (1786 aa)
Score = 8000, Expect = 0.0e+00, Identities = 1786/1786 (100%), Positives = 1786/1786 (100%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTNRVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNTPFFISKSDWWTDQSYDLQGSSIDSVLSGFKTVDGTDDQPDIANILSSFYVDSSVSLSLDKEIDWNIASLTPWYDYMRILRDKNYLTNTVTNNSKDFVFSIHLNNDKLTTLQKETLEYVKAKYGIQKYIDLTSFVYTVNSLWIKDAALSYFDSNSTEYNEINKLSFNSLNELALTYGDYSGLSIVKTWLKNYGDDKLITIDKELKQYEKEYLSYQQMSQLSNIEYNVQKSFTLSDFKSYQTFLVSLKGGSYGDNNQTDDINQIVLSDGSSIVNSYDFLSEKYSYLKPESYVDDLQESNSTKYEDISNALLSAEIIGGASQPKLADNGYSINEQGKYLINLIRLIKDTYLSGVQSGDSSTDASKIIPLATKIINQYDGNTEGSVSGTINVNDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTNRVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNTPFFISKSDWWTDQSYDLQGSSIDSVLSGFKTVDGTDDQPDIANILSSFYVDSSVSLSLDKEIDWNIASLTPWYDYMRILRDKNYLTNTVTNNSKDFVFSIHLNNDKLTTLQKETLEYVKAKYGIQKYIDLTSFVYTVNSLWIKDAALSYFDSNSTEYNEINKLSFNSLNELALTYGDYSGLSIVKTWLKNYGDDKLITIDKELKQYEKEYLSYQQMSQLSNIEYNVQKSFTLSDFKSYQTFLVSLKGGSYGDNNQTDDINQIVLSDGSSIVNSYDFLSEKYSYLKPESYVDDLQESNSTKYEDISNALLSAEIIGGASQPKLADNGYSINEQGKYLINLIRLIKDTYLSGVQSGDSSTDASKIIPLATKIINQYDGNTEGSVSGTINVNDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS
  S:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTNRVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNTPFFISKSDWWTDQSYDLQGSSIDSVLSGFKTVDGTDDQPDIANILSSFYVDSSVSLSLDKEIDWNIASLTPWYDYMRILRDKNYLTNTVTNNSKDFVFSIHLNNDKLTTLQKETLEYVKAKYGIQKYIDLTSFVYTVNSLWIKDAALSYFDSNSTEYNEINKLSFNSLNELALTYGDYSGLSIVKTWLKNYGDDKLITIDKELKQYEKEYLSYQQMSQLSNIEYNVQKSFTLSDFKSYQTFLVSLKGGSYGDNNQTDDINQIVLSDGSSIVNSYDFLSEKYSYLKPESYVDDLQESNSTKYEDISNALLSAEIIGGASQPKLADNGYSINEQGKYLINLIRLIKDTYLSGVQSGDSSTDASKIIPLATKIINQYDGNTEGSVSGTINVNDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
>gi|26553542|ref|NP_757476.1| permease [Mycoplasma penetrans HF-2] >gi|26453548|dbj|BAC43880.1| predicted permeases [Mycoplasma penetrans HF-2] (1793 aa)
Score = 5179, Expect = 0.0e+00, Identities = 1127/1786 (63%), Positives = 1436/1786 (80%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSIS-SSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTNRVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNTPFFISKS----DWWTDQSYDLQGSSIDSVLSGFKTVDGTDDQPDIANILSSFYVDSSVSLSLDKEIDWNIASLTPWYDYMRILRDKNYLTNTVTNNSKDFVFSIHLNNDKLTTLQKETLEYVKAKYGIQKYIDLTSFVYTVNSLWIKDAALSYFDSNSTEYNEINKLSFNSLNE-LALTYGDYSGLSIVKTWLKNYGDDKLITIDKELKQYEKEYLSYQQMSQLSNIEYNVQKSFTLSDFKSYQTFLVSLKGGSYGDNNQTDDINQIVLSDGSSIVNSYDFLSEKYSYLKPESYVDDLQESNSTKYEDISNALLSAEIIGGASQPKLADNGYSINEQGKYLINLIRLIKDTYLSGVQ---SGDSSTDASKIIP-----LATKIINQYDGNTEGSVSGTINVNDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFS+NIS+SY+++ +SS G++A LETKD  LKN  L YD+DSLN+L  I  +S+G YF+SL++YA +  SFIYP TNLYHSSFTKQ +  NYIFAYYT ++  N YF G G+N  DS+YK RARGIL SYGNL IP  S +WRA+GLELG+ DL+ I+Y+I+PLTGQT I++++N VNTLGYFS+G+++STI+   GNLKYPTN+T  S ++     K Y++KN +T+TPFF+ ++    +WWTDQ+YDL GS+++ + S F+TV+ T D PDI NI+SS Y+ SSV+LSLDK IDWNIASLTP+YDYMRI+RDK YLT   T  ++D + S+HL+  KL+TLQ++T ++V+ KYG+QKYIDLTSF+YTVN   +K A L+  + ++    EI  LS +SL   L  T+G  +G  I+ TWL+NYG++KLIT+ KEL +YE+E+LSY+++S   N  Y  QKSFTLSDFK+ Q+FLVS KGG   + N+ + IN + +  GS I N YDFLS KY YL  E Y DD Q++NSTKYEDISN LLS   IGG SQ ++   GYSIN  G YLINL++ I D+Y++G     + ++S+++SK++      LA KI++ Y+G T  +VSG+INVNDYYHLFA+ATPQNY++Y N+D  D+NSSY+F+NN QNL Y+F    G+TP +Y S+A L APYGN+IVVN+ WL+SNQKSV+P ++W K LLMNS EF  WK NL   YKV INSL+FIIIGSG SFENSFP+VS+ESPIPNP+ EG  YVDD+GY SLLYTNS  NQDIYFAI+F    KVDL  +NS M+ Y   AYLSS + + TNLLTARISYP++IA Y+N+F  IL+ VL+VIGIYLSSLL+KIYVEKN++ LA+AKANGIS+ QI++SLSVFG  AA ISG++GY+ A+  QG+F+GIL+NFW+IPI    FS IGL   I  LY+AFLLF  +GV +TFR+PINELLSS+EE+KVNKLLYL+KS+K   F L KFRI+L+LSKLTRFILFV+LCSAG+SII VG+AIPRKFETSQ +TL N++Y Y YNLQTPSEQSGLYK QEY  LG  DE  GI++I+ N MF+   NPY+ + TS  Q+ +DL+ALRDL GNVI Y NG+ KYF+N LLPSYV +++F  D +LFRN +VSKWL+DF+IS+AGIY+NAW FVS AFP +LISRINAISNNFL++VLEVPELK IND+++YI +NSSGN+VL+   VLDL+NV++T+SIRFN+EFLK+IGM+YGN +LSS+DAKI+FGIVPFR + +N LTE+YTYLDA LND +VRIPS+RN+GK  L +I ++I+GIK+DS++VTL+ D+  +LNS L +P E + D +  YP V+N+GAAY+YDLE+G++FKID+ N+YTRYTD M   NP K++KLK+VGISSD+F T +YISQ+NAN ILGLNF+QGATI+G+S Y  N  + TTVLGDWSSGVL    + T+  Y + +  YP  YVPFNGVFSKEENPLLVNSL+LENTSGLWGNYSSF D+ FA LVS VG+ +++N+  PYS +G+++L+    +S+  +  +   +S++M+I SLQ+WLQ+N GTPSIVAINSFEYF T+FDTY TIF TL+ IETL+ICLF+PLIIII+MI+SSVMM+DFR+LVAILKTLGYSD+ENLLSIL+IFVPV+LISLIVGI ++A+LS  FNFM+FNAASIYL+P IDW++YL+G IAI GIV INFIFV++YLKKQNL+NSIS
  S:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLDEYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDI--SGKTYRVKNNNTDTPFFVGETGYGKEWWTDQNYDLNGSNLNEIFSKFQTVEQTTDTPDIVNIMSSAYIQSSVALSLDKNIDWNIASLTPYYDYMRIMRDKRYLTQETTGKNQDLIVSVHLDMSKLSTLQRQTFDFVREKYGVQKYIDLTSFLYTVNGQSVKTALLASPNLSAELKKEIEGLSVDSLLPILKQTFGTTTGYEILITWLENYGNEKLITVKKELLKYEREFLSYKELSTFDNFTYKTQKSFTLSDFKTSQSFLVSHKGG-VSNPNENNSINDLQILSGSKITNGYDFLSSKYDYLNKEVYSDDEQKTNSTKYEDISNTLLSTTRIGGGSQQEIETGGYSINPNGDYLINLVKFINDSYVTGETENTNANNSSESSKLLSDRIKELAKKIVDHYNGTT-ANVSGSINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFD-NNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVE-TEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYG-NGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSIS 1793
>gi|26554065|ref|NP_757999.1| permease [Mycoplasma penetrans HF-2] >gi|26454073|dbj|BAC44403.1| predicted permiase [Mycoplasma penetrans HF-2] (1818 aa)
Score = 3134, Expect = 0.0e+00, Identities = 790/1785 (44%), Positives = 1161/1785 (65%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYD-SLNSLQSISSSN----GVYFSSLEDYAE-IEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSS--NNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTNRVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNTPFFISKSDWW-TDQSYDLQGSSIDSVLSGFKTVDGTDDQPDIANILSSFYVDSSVSLSLDKEIDWNIASLTPWYDYMRILRDKNYLTNTVTNNS-------------KDFVFSIHLNNDKLTTLQKETLEYVKAKYGIQKYIDLTSFVYTVNSLWIKDAALSYFDSNSTEYNEINKLSFNSLNELALTYG-------DYSGLSIVKTWLKNYGDDKLITIDKELKQYEKEYLSYQQMSQLSNIEYNVQKSFTLSDFKSYQTFLVSLKG-GSYGDNNQTDDINQIVLSDGSSIVNSYDFLSEKYSYLKPESYVDDLQESNSTKYEDISNALLSAEIIGGASQPKLADNGYSINEQGKYLINLIRLIKDTYLSGVQS----GDSSTDASKIIPLATKIINQYD-GNTEGSVSGTINVNDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGK----KKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKA--------------INDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLS--SNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWS--SGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFN--DAAFATLVSFV-----GVKHVLNLVTPYSAKGVAEL--------SAYYGLSTTDKYS-----LSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSI 1785
           M QLIKQV KSFK S++LLIGL FI FAI+FA FSSLYF++NI  S S++ S+S    +I+ T    L + +L YD D + N  Q  +S N     VYFSS E+  + ++KSF Y  T L+HSSF K  S  NYIFAYY  +++  +NP+FT  GIN  + +Y  RARG+L SYG   IPSES+KWRA+GL L  SDLQ IVY ++PLTG+T I+S+     T+GYF++G+LNST++   GN+ YP+N+TA   S+    +K Y+ KNG   TPFF SK DWW  D S+DL     D +L   +         D+ N+L S   +   ++SL   I+W++A  +P+Y+Y++ILRD  YLT    +N+             KD+VF++HLN + L+ L++ETL YVK+ YG + Y DL SFVYTVN  WIK       DS+ T    ++  SF +L++L   Y          S   IVK W++NY + KL  +   L  YEKEY++  ++S +SNIE+N Q+S+T+SD KS  T+LVS K      D  Q++++N++V++ G+ + NSY +L              D   S     ED ++ + + E            N Y++N  G YL+NL++   ++ ++G+         ++D   +  LA  I+NQY  G+T  + + ++N NDYYHLF++ +P            D +   +   N QN+  +   + G  P  +        PYG+A+V   +WL  N+KS++   EW KA+ M+S ++ EW +NLS + K+ INS  F IIG+G S EN++PV S+ +P+PN  TE  IY++D GY ++L T+S + +D YFA+   NN   +L  V S +   +   Y S+ + NN NLLT RI  P+++  Y+ IF  ILIVV+ +IG+YL  LLIKIY+EKN+I LA+AKANG+S+ +I  ++S+FG+  A  +GI+GY+ A F Q +FLG++ N+WFIPI +H FS IG I     +YLAFLLF  +GV +TFR PIN+LLS T ELK+NK LYL+KS       +++FRI LS +K++RF L V+LCS GIS I+ G +IP+KF  SQ  T ++  Y Y ++LQTP++Q+GLYK Q+Y DLGITDE  GI+++Y N  +    +PY+T+   +    +DL+ALRD +GNVI Y N      K+YFTN LLPSY++      D   FRN + +KWL+D+ I++A + +N WDFVS++F +DLISRI+A+SN+F+  ++   +                 +++ K ++  +++G W +++++V+   N  N   IRFNDEFLKFIGMVYGNK+LS+ D+K+ FGIVPF +L+  SN+ TETYTYL +  N  ++ IP+ +NDG  +L+ I+ +I GIKE+SKYV L+D++  N++SLLS  +  S+DG   YPV+IN G+AYKY L++G+ F + ++NTY RYT ++  ++P   +K K+VGIS+DSF    Y +QE AN+ILGLNF QGA I G+S      ++  T+LGD S  +       S+ D+K+ V   + P++YVPFNG+F+ EE PL  +SL LE  SG+WGNY+ F   DA  A+  ++       +  +LN V PY  K ++ L          Y+   T D  +     LS   +   ++ SL   LQ+  G  ++VAI +  YF  LF TYTTIF +LL +E +LI L VP+II  IMI+SS  ++DFRK++A+LKTLGY DRE L SI++ ++ ++L+S+ +GI ++A L T F  +IFN +SI+L+ AI W+ +++G   I  I+I N ++++V  KKQNL+NSI
  S:     1 MTQLIKQVFKSFKRSVVLLIGLLFIGFAIIFAFFSSLYFTSNIDYSSSSLNSASNLGTSIVSTNSSDLNSSSLSYDIDGAFNEYQKPTSDNNQTSSVYFSSYEEKVQNMDKSFAYTPTYLHHSSFVKDTSSRNYIFAYYNGSTNKDSNPFFTQAGINDANQLYTKRARGVLYSYGIASIPSESSKWRAWGLFLDDSDLQNIVYAVDPLTGETQIDSN-QMATTMGYFNDGYLNSTMTVREGNMIYPSNVTATKASDITGNNKAYRYKNGDYYTPFFSSKDDWWVNDFSWDL-AQGWDWILQMLQ------QGADVFNLLPSMSKNIKNTISLSPNINWDLAVFSPYYEYLKILRDGRYLTKNGNSNTDNKPTNGNDIIQFKDYVFNVHLNMNNLSQLERETLNYVKSTYGAKTYNDLVSFVYTVNGSWIKSKLKENVDSSQT--TNVDNNSFETLSDLNTQYTLRSNDKEKISAKDIVKAWIRNYSESKLSELSSSLLTYEKEYIA-SKLSTVSNIEFNNQRSYTISDSKSSITYLVSRKDYDPTNDKYQSNNVNKLVMTSGTRLENSYKYL--------------DAANSLFNTVEDTTSRIPAVE------PDNKEINSYALNANGNYLMNLVKFTNESIVAGITDVPIIDGMASDYQTVRNLAANILNQYGIGDTPSTTAPSVNANDYYHLFSIVSP------------DFSKDNIVTTNDQNISLSIQVKWGGAPAHFPGSVTYVTPYGSAVVTTQKWLELNKKSIVDPQEWAKAVYMDSADYVEWLNNLSDDKKIVINSKSFAIIGTGISAENAYPVTSITNPLPNFSTESLIYLNDQGYRTILATSSLITEDSYFAVASTNNSD-NLASVQSAVRNLVSTPYSSNDIVNNNNLLTMRIGVPKMMTTYIQIFTSILIVVISIIGVYLCYLLIKIYIEKNQISLAIAKANGVSSLKIIFAVSMFGLVVAVFAGIVGYLSALFLQSIFLGVIGNYWFIPISQHLFSPIGFISGTAIIYLAFLLFVSLGVWKTFRKPINDLLSITTELKINKFLYLLKSSFTNASVISRFRIGLSFTKMSRFFLLVLLCSVGISFISTGVSIPQKFTKSQTDTQNSINYKYSFDLQTPTQQTGLYKVQDYADLGITDESLGIYSMYANKNYTGYTDPYQTLFEKEGSSGKDLLALRDSSGNVIEYTNSDGTKYKRYFTNLLLPSYIAQFGIQKDPHFFRNSVGTKWLLDYTINIASLSLNIWDFVSSSFSSDLISRIDALSNDFVNQIMAATDANGNTYLAEKNEIGNGTVDNPKPFLSLDTNGIWQINASNVMSSLNATNVDDIRFNDEFLKFIGMVYGNKELSAADSKMAFGIVPFNNLNDESNNQTETYTYLTSTFNSPNITIPASKNDGISKLSGIDVEILGIKENSKYVKLIDEDENNISSLLST-TSASADGNTVYPVIINVGSAYKYGLKVGQEFDVLVSNTYDRYTKKIAGEDPSVDVKFKVVGISADSFGAQFYTNQEYANKILGLNFDQGAIIYGTSKKTQWNQVEATILGDESLMAKEEVNIESNGDHKFKVNYVAPPSNYVPFNGIFTAEETPLQTSSLTLEMVSGIWGNYNYFKRGDAINASFNNYFVSGDSSIGDILNAVIPYDQKTLSVLIEKFKTANPNYFASITVDDTNRRTTVLSYLRTTYNSVSSLAELLQTTFGNNNMVAIQNLTYFDILFGTYTTIFNSLLTVENMLIILIVPIIIFTIMIISSTTLNDFRKMLAVLKTLGYKDREILNSIIVSYLLILLVSIGIGIGLLAGLLTVFQLLIFNLSSIFLTSAISWIPFVFGASGILAILIFNILYITVLFKKQNLRNSI 1817
>gi|13508423|ref|NP_110373.1| suggestion: membrane transporter component [Mycoplasma pneumoniae M129] >gi|2496460|sp|P75109|Y684_MYCPN Uncharacterized ABC transporter permease MG468 homolog >gi|1673819|gb|AAB95806.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (1882 aa)
Score = 1246, Expect = 2.8e-134, Identities = 349/1129 (30%), Positives = 589/1129 (52%)
  Q:   654 NDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKA---ILSAPYGNAIVVNDQWLSSNQKSVIPVS---EWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFA-----IKFKNNGKVDLEYVNSRMNKYL-----DNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPM-FEWQINPYKTISTSDSQETRDLMALR--DLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWV-LDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNP-VKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTS-GLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTD--------KYSLSVAMSNNMTILSLQSWLQ----SNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLK 1782
           N+Y  L +  TP+           D N   L   N Q L    + + G+ PL+  +     ++  P  +  VV+ QWL  + K V+P+     W +AL  N +    W ++L   YK +IN L F I+G G S E  +PV+S  SP+PN + EG I++++ GY S+L+     +++ Y+A     IK K  G+  ++ V S++  YL     D A+    +     L TAR  +P ++  Y+ I ++++   L ++ +YL+ LLIK +++KN+   ++ +A G ST +    +SVF    A  S   G + A+  +    GI++ +WFI +  ++F+ I   G++  +++ F     I   + F  P+N L+    E K +  L+L+K +   +  L KFR+SL +S+L+R   +V L S  + +I +   IP+KF  +Q++T+ N+ ++YR NLQTP+EQSG Y  Q Y+  G TD+  GI  +Y++      Q    +    +D +   +L  L+  D  GN I + NGK+    N LLPS+        D   FR+  +SKWLIDF I V G  IN W+ V  + P  +   ++A S+ FL+ VL   +     ++  ++ +N   N++ LD+  VL   NV N   ++FN++FLKF+  VYG+ +LS  D+K+T+GIVP        + ETYTY+         +   L  D    LT       GI  DSK+V L D    +L SL+S  SE++        V++N G  Y  + +IG+   I   NT TRY+++ +   P   T+K ++VG+S+D+F   +YI+Q  AN++L LN   G  ++     D      +              TSST      I+   PT YVPFNGVFSKE NP LV+  L+ N++ G+WGN++ F +  F  LV     K ++  + P     + +L+   G +  D        K  +    S   +  SL S  +     NI  P++    +    Q + +    +F T+  ++  L+   +P I I  +++   M+ + +++   LK++GY D +NL+S+L  F+P  ++SL++ I ++A L      ++F  A ++L+   +++ Y+ G++     + +   +  + L+   LK
  S:   755 NNYVALLSYFTPE---------FQDPNE--LVVTNRQKLDIPIIFKNGVNPLTLPTDQQSLVVQTPEAHGAVVSQQWLFKHDKEVLPLEGEYSWKEAL-ENPKNLPNWLNDLPDKYKFSINGLTFAILGVGESVETGYPVLSTNSPLPNSQDEGLIFLNEQGYRSVLFAVPAASEENYYAFKSDDIKAKFPGQDPIQVVASKLKGYLNVPDSDLAFNVKDISKFQYLTTARNYFPDLVQNYLAIASVVIAAFLSILALYLTILLIKSFIKKNQTEFSIIRAGGFSTAKFIAGMSVFAGIVALASSFFGVLFAFLLERQVKGIISRYWFIALPANSFNWISFFGSMLLIFVIFQFISWIAFKQLFSKPVNVLIDQGNETKFSVFLHLLKRKSYTMTPLGKFRVSLIISRLSRLFTYVGLSSIALLLIGIAGTIPQKFGAAQSNTVLNRNFNYRLNLQTPTEQSGWYAIQPYSRFGQTDDSLGIKALYKDKGDQIQQQQQQQQQQGNDKEHPYNLKELKISDRGGNPIKH-NGKEIELGNLLLPSFGGAQQLNTDENFFRHASLSKWLIDFPIRVGGANINPWEIVEKSIPKQITQLLSASSDQFLIAVL-TDDYFNNLNNNGFLTRNPRTNFIQLDAARVLTQINVFNPGGVKFNEQFLKFLTKVYGDPELSYQDSKLTYGIVPV----DPQIEETYTYVQGPF---GFKETELNPDSPYTLT-------GISPDSKFVNLTDSGGNSLRSLISSDSEMN--------VIVNAGFQYANNTKIGDFIFIQPKNTATRYSEKFLKSPPKTPTVKFRVVGVSTDAFGQELYINQNIANRLLKLNGFDGRGVIKDVVKDGQSTDDSGGTSSGGGSCGGGSTSSTTKDKYKIEYVKPTGYVPFNGVFSKELNPSLVSKALVLNSNIGVWGNFTDFGN-NFTNLVKGKENK-IITSILPSDPDILKQLAKEKGENGVDSMTYENLRKKVIEKYTSEWSSTQSLASGARGIFGDNIMVPALKLDAAGASAQIIRNNAEVLFNTVNQVDGFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKSIGYKDSQNLVSLLCFFIPAFVLSLLISIAILAGLLVGVQALVFGVAQVFLTNVFEFLPYMVGIVLFGATIFVIGSYFWIKLRSAELK 1879
Score = 99, Expect = 3.4e-01, Identities = 63/265 (23%), Positives = 113/265 (42%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTN--------RVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNT 265
           M    KQ+ KS K    LL G+ F+ F+I+F   S L  SNN+ ++Y+ +   +  S  +        K  +  Y  +     +        +FS ++   E + +FI+P       S +++   +       T +S NNP      +N  D ++  R RGIL +YG   I +E   ++   +   ++   Y     +  +   N N+ ++          N LGYF +G +   I   +G  ++P +       +T    K  +IK  S+ T
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSILQLSNNLVNTYTALVQKTNSSDIVAPA---IFKESSPVYKTELKEEKR--------HFSKIK-LTEKKINFIWPYQESDFGSDSEKKDST-------TKSSDNNP--RKGDVNDKDKLFLARKRGILKAYGEANI-AEKRIYKGLAVSFQNT---YSFTGTDQESNNLNQNTVSDPQNLIYDKEGNLLGYFVDGLILDGIPLRAGIARFPGDKGKGEDKKTT--KKKSEIKQASSAT 246
>gi|1209522|gb|AAC43650.1| orf1882fr (1848 aa)
Score = 1222, Expect = 1.9e-131, Identities = 344/1098 (31%), Positives = 575/1098 (52%)
  Q:   654 NDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKA---ILSAPYGNAIVVNDQWLSSNQKSVIPVS---EWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFA-----IKFKNNGKVDLEYVNSRMNKYL-----DNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPM-FEWQINPYKTISTSDSQETRDLMALR--DLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWV-LDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNP-VKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTS-GLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTD--------KYSLSVAMSNNMTILSLQSWLQ----SNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           N+Y  L +  TP+           D N   L   N Q L    + + G+ PL+  +     ++  P  +  VV+ QWL  + K V+P+     W +AL  N +    W ++L   YK +IN L F I+G G S E  +PV+S  SP+PN + EG I++++ GY S+L+     +++ Y+A     IK K  G+  ++ V S++  YL     D A+    +     L TAR  +P ++  Y+ I ++++   L ++ +YL+ LLIK +++KN+   ++ +A G ST +    +SVF    A  S   G + A+  +    GI++ +WFI +  ++F+ I   G++  +++ F     I   + F  P+N L+    E K +  L+L+K +   +  L KFR+SL +S+L+R   +V L S  + +I +   IP+KF  +Q++T+ N+ ++YR NLQTP+EQSG Y  Q Y+  G TD+  GI  +Y++      Q    +    +D +   +L  L+  D  GN I + NGK+    N LLPS+        D   FR+  +SKWLIDF I V G  IN W+ V  + P  +   ++A S+ FL+ VL   +     ++  ++ +N   N++ LD+  VL   NV N   ++FN++FLKF+  VYG+ +LS  D+K+T+GIVP        + ETYTY+         +   L  D    LT       GI  DSK+V L D    +L SL+S  SE++        V++N G  Y  + +IG+   I   NT TRY+++ +   P   T+K ++VG+S+D+F   +YI+Q  AN++L LN   G  ++     D      +              TSST      I+   PT YVPFNGVFSKE NP LV+  L+ N++ G+WGN++ F +  F  LV     K ++  + P     + +L+   G +  D        K  +    S   +  SL S  +     NI  P++    +    Q + +    +F T+  ++  L+   +P I I  +++   M+ + +++   LK++GY D +NL+S+L  F+P  ++SL++ I ++A L      ++F  A ++L+   ++
  S:   755 NNYVALLSYFTPE---------FQDPNE--LVVTNRQKLDIPIIFKNGVNPLTLPTDQQSLVVQTPEAHGAVVSQQWLFKHDKEVLPLEGEYSWKEAL-ENPKNLPNWLNDLPDKYKFSINGLTFAILGVGESVETGYPVLSTNSPLPNSQDEGLIFLNEQGYRSVLFAVPAASEENYYAFKSDDIKAKFPGQDPIQVVASKLKGYLNVPDSDLAFNVKDISKFQYLTTARNYFPDLVQNYLAIASVVIAAFLSILALYLTILLIKSFIKKNQTEFSIIRAGGFSTAKFIAGMSVFAGIVALASSFFGVLFAFLLERQVKGIISRYWFIALPANSFNWISFFGSMLLIFVIFQFISWIAFKQLFSKPVNVLIDQGNETKFSVFLHLLKRKSYTMTPLGKFRVSLIISRLSRLFTYVGLSSIALLLIGIAGTIPQKFGAAQSNTVLNRNFNYRLNLQTPTEQSGWYAIQPYSRFGQTDDSLGIKALYKDKGDQIQQQQQQQQQQGNDKEHPYNLKELKISDRGGNPIKH-NGKEIELGNLLLPSFGGAQQLNTDENFFRHASLSKWLIDFPIRVGGANINPWEIVEKSIPKQITQLLSASSDQFLIAVL-TDDYFNNLNNNGFLTRNPRTNFIQLDAARVLTQINVFNPGGVKFNEQFLKFLTKVYGDPELSYQDSKLTYGIVPV----DPQIEETYTYVQGPF---GFKETELNPDSPYTLT-------GISPDSKFVNLTDSGGNSLRSLISSDSEMN--------VIVNAGFQYANNTKIGDFIFIQPKNTATRYSEKFLKSPPKTPTVKFRVVGVSTDAFGQELYINQNIANRLLKLNGFDGRGVIKDVVKDGQSTDDSGGTSSGGGSCGGGSTSSTTKDKYKIEYVKPTGYVPFNGVFSKELNPSLVSKALVLNSNIGVWGNFTDFGN-NFTNLVKGKENK-IITSILPSDPDILKQLAKEKGENGVDSMTYENLRKKVIEKYTSEWSSTQSLASGARGIFGDNIMVPALKLDAAGASAQIIRNNAEVLFNTVNQVDGFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKSIGYKDSQNLVSLLCFFIPAFVLSLLISIAILAGLLVGVQALVFGVAQVFLTNVFEF 1848
Score = 99, Expect = 3.3e-01, Identities = 63/265 (23%), Positives = 113/265 (42%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTN--------RVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNT 265
           M    KQ+ KS K    LL G+ F+ F+I+F   S L  SNN+ ++Y+ +   +  S  +        K  +  Y  +     +        +FS ++   E + +FI+P       S +++   +       T +S NNP      +N  D ++  R RGIL +YG   I +E   ++   +   ++   Y     +  +   N N+ ++          N LGYF +G +   I   +G  ++P +       +T    K  +IK  S+ T
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSILQLSNNLVNTYTALVQKTNSSDIVAPA---IFKESSPVYKTELKEEKR--------HFSKIK-LTEKKINFIWPYQESDFGSDSEKKDST-------TKSSDNNP--RKGDVNDKDKLFLARKRGILKAYGEANI-AEKRIYKGLAVSFQNT---YSFTGTDQESNNLNQNTVSDPQNLIYDKEGNLLGYFVDGLILDGIPLRAGIARFPGDKGKGEDKKTT--KKKSEIKQASSAT 246
>gi|12045327|ref|NP_073138.1| ABC transporter, permease protein [Mycoplasma genitalium G37] >gi|6136529|sp|Q49460|Y468_MYCGE Uncharacterized ABC transporter permease MG468 >gi|3845063|gb|AAC72488.1| ABC transporter, permease protein [Mycoplasma genitalium G37] >gi|166078936|gb|ABY79554.1| ABC transporter, permease protein [synthetic Mycoplasma genitalium JCVI-1.0] (1783 aa)
Score = 1132, Expect = 5.7e-121, Identities = 333/1099 (30%), Positives = 566/1099 (51%)
  Q:   684 LFNNNTQNLVYNFVTRGGLTPL---SYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVS---EWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIK---FKNNGKVD-LEYVNSRMNKYLDN-----AYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQIN--PYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWV-LDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPV--KTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVN-SLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLV--TPYSAKGVAELSAYYGLSTTDKYSLSVAMSN---------NMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLK 1782
           L   N Q L      + G+ PL   +     ++  P  +  VV+ QWL  + K ++P      W  AL      F  W ++L   YK +IN L F I+G G S E  +PV+SL+SP+PN + E  I+V+D  Y S+L+     NQ+ Y+A K    K +   D ++++ +R+  YLD      A+    +     L TAR  +P ++  Y+ I + ++ + L+++ +YL  LLIK +++KN+   ++ +A G ST +  + +SVF    A +S  LG + A+  +G   GI+N +WFI + E++F+ +   G+    +  F     I   + F  P+N L+    E K + LL+L+K +   +  LTKFR+SL +S+ +R   +V L S  + +I +   IP+KF  +Q ST  N+ ++Y+ NLQTP+EQSG Y  Q Y+  G+TD   GI  +Y   +     N  PYK  +          + L++     I   +G +    N LLPSY        D   FR+  +SKW+IDF I V G  IN W+ V  + P  +   ++A S+ FL++VL       +N +  ++I+N   N + LD++ VL   +V N   ++FND FL F+  VYG+ +L+  D+K+ FGIVP        + ETYTY++         +            N    + GI  +S +V L+D    +L +L+S   E++        V++N G  Y  ++ IG+   I   NT TRY+++ + K P+   T+  K+VG+S+D+F   +YI+Q  AN +L L+ +QG  I+     DV +K               T   S  +    I    P  YVPFNGVFSKE  P L+N +L+L +  G+WGN++ F +  F  LV     K + +++   P     +A+       ++ +  SL   + N         N+   +  S   +NI  P +    +    Q + +    +F T+  ++  L+   +P I I  +++   M+ + +++   LK +GY D +NL+S+L  F+P  +++L++ I V+A +      ++FN A ++L+   +++ Y+ G++     + +   +  + L+   LK
  S:   705 LIETNRQMLEIPITVKNGVNPLILPTDQQNLVVQTPEAHGAVVSQQWLFRHNKEILPQEGEYAWKTAL-QTPNNFPNWLNDLPDRYKFSINGLTFAILGIGESVETGYPVLSLQSPLPNTQDEALIFVNDQAYRSILFAVPAANQENYYAFKSTDLKQHTDQDPVQFIANRLEGYLDVPRSDLAFNVKDISKFNYLTTARNYFPDLVQSYLAIVSTVIAIFLIILALYLIILLIKSFIKKNQTEFSIIRAGGFSTTKFIVGMSVFAGIVAIVSSFLGVLFAFLLEGQVKGIINRYWFIALPENSFNWLSFFGSFFITFFVFEFISWIAFKQLFSKPVNVLIDQGNETKFSVLLHLLKHKSHTMSPLTKFRVSLIVSRFSRLFTYVGLSSVALLLIGIAGTIPQKFSAAQTSTSLNRNFNYKLNLQTPTEQSGWYAIQPYSHFGVTDNNNGIKTLYNESVQANSQNEHPYKPSN----------LKLKNRQDQPIKAADGTELELGNLLLPSYGGAQQLNTDENFFRHASLSKWIIDFPIRVGGSNINPWEIVEKSIPKQITQLLSASSDQFLISVLTDDFFNNLN-ANGFLIRNPRTNQIQLDASRVLTTIDVFNPGGVKFNDSFLSFMLKVYGDFELAKQDSKLNFGIVPV----DPAIEETYTYVEGPFGFQEDNLDE----------NSPYTLTGINPESSFVNLIDGSGNSLRNLISSDQEMN--------VIVNAGFQYANNINIGDYVYIKPKNTATRYSEKFL-KAPLNNSTVAFKVVGVSTDAFGQELYINQHIANNLLKLSGNQGRGII----RDVIKK---------------TNGQSQSSDEYEIDYVKPNGYVPFNGVFSKELKPSLLNKALVLNSIIGVWGNFTDFGN-NFQNLVRNKLDKVITSILPTDPEIINKLAQEKQIINTTSMNYESLRKELVNKYKTEWNSVNLLSQNASSIFGNNIIAPVLNIDAAGTSAQIIRNNAEVLFNTVNQVDAFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKAIGYRDVQNLISLLTFFIPAFVLALLISIGVLAGVLIGIQAVVFNVAQVFLTNVFEFLPYMVGIVLFGVTIFVIGSYFWIKLRSAELK 1780
Score = 136, Expect = 1.5e-05, Identities = 90/384 (23%), Positives = 172/384 (44%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLE-DYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDI-NPLTGQTNINSSTNRV-----NTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSK----NYQIKNGSTNTPFFISKSDWWTDQSYDLQGSSIDSVLSGFKTVDGTDDQPDIANILSSFYVDSSVSLSLDKEIDWNIASLTPWYDYMRILRDKNYLTNTVTNNSKDFVFSIHLNNDKLTTLQKETLEYVK 384
           M    KQ+ KS K    LL G+ F+ F+I+F   S +  SNN+ S+Y+T+ S +  S  +       LK     Y       + S+++ +G YFS ++ D  +I   F Y   +    S    GS  N           N        +N  D ++  R RGIL +YG   I +E   ++   +   ++D  +   DI + +T +  I+   N +     N LGYF++G +  TIS  +G  ++P +   ++ ++     K    N   K+ + N+ +  +  D    +S + +  + D  +S      G ++    AN   + Y +  + L +D    +    + P+ + +     + + T   + +++ F  + +L+  KL  L  E L++++
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSIVQLSNNLVSTYTTLVSKTNSSDIVAPA---ILKEANPVY-------IASLTNDSG-YFSKIKIDDKKINYLFPYQENDFGSDSGQSNGSGDN----------QNKTIPRKGDVNEKDKLFLARKRGILKAYGEANI-AEKRIYKGLAVSFNNTD-SFNGSDISDSITNRHIISDPQNLIYDASGNLLGYFADGLIKETISLRAGIARFPGDKGKSTGTQVKITQKQQTNNDPQKDSTVNSLYKTNNKDKVWFKSDETKADNTD--ISANYLFTGGNEA---ANWFPNLYANIPIDLEIDPGSQF-WKDVNPFKEIV-----EEFQTQKESKDNQSFTLTFNLDISKLNKLDNEQLKWLE 361
>gi|66880419|ref|ZP_00405400.1| hypothetical protein MgenG_01000026 [Mycoplasma genitalium G-37] (574 aa)
Score = 677, Expect = 2.6e-68, Identities = 188/563 (33%), Positives = 292/563 (51%)
  Q:  1001 FRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQIN--PYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWV-LDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPV--KTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVN-SLLLENTSGLWGNYSSFND 1563
           F  P+N L+    E K + LL+L+K +   +  LTKFR+SL +S+ +R   +V L S  + +I +   IP+KF  +Q ST  N+ ++Y+ NLQTP+EQSG Y  Q Y+  G+TD   GI  +Y   +     N  PYK  +          + L++     I   +G +    N LLPSY        D   FR+  +SKW+IDF I V G  IN W+ V  + P  +   ++A S+ FL++VL       +N +  ++I+N   N + LD++ VL   +V N   ++FND FL F+  VYG+ +L+  D+K+ FGIVP        + ETYTY++         +            N    + GI  +S +V L+D    +L +L+S   E++        V++N G  Y  ++ IG+   I   NT TRY+++ + K P+   T+  K+VG+S+D+F   +YI+Q  AN +L L+ +QG  I+     DV +K               T   S  +    I    P  YVPFNGVFSKE  P L+N +L+L +  G+WGN++ F +
  S:     2 FSKPVNVLIDQGNETKFSVLLHLLKHKSHTMSPLTKFRVSLIVSRFSRLFTYVGLSSVALLLIGIAGTIPQKFSAAQTSTSLNRNFNYKLNLQTPTEQSGWYAIQPYSHFGVTDNNNGIKTLYNESVQANSQNEHPYKPSN----------LKLKNRQDQPIKAADGTELELGNLLLPSYGGAQQLNTDENFFRHASLSKWIIDFPIRVGGSNINPWEIVEKSIPKQITQLLSASSDQFLISVLTDDFFNNLN-ANGFLIRNPRTNQIQLDASRVLTTIDVFNPGGVKFNDSFLSFMLKVYGDFELAKQDSKLNFGIVPV----DPAIEETYTYVEGPFGFQEDNLDE----------NSPYTLTGINPESSFVNLIDGSGNSLRNLISSDQEMN--------VIVNAGFQYANNINIGDYVYIKPKNTATRYSEKFL-KAPLNNSTVAFKVVGVSTDAFGQELYINQHIANNLLKLSGNQGRGII----RDVIKK---------------TNGQSQSSDEYEIDYVKPNGYVPFNGVFSKELKPSLLNKALVLNSIIGVWGNFTDFGN 517
>gi|31544225|ref|NP_852803.1| hypothetical protein MGA_0654 [Mycoplasma gallisepticum R] >gi|31541069|gb|AAP56371.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (1361 aa)
Score = 600, Expect = 2.3e-59, Identities = 279/1181 (23%), Positives = 541/1181 (45%)
  Q:   605 IRLIKDTYLSGVQSGDSSTDASKIIPLATKIINQYDGNTEGSVSGTINVNDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKY----------LDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGV---VRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISR--------INAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVY---GNKQLSSLDAKITFGIVPFRDLSSNDLTE------TYTYLDAIL-NDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKN-----PVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKE------ENPLLVNSLLLENTSGLWGNYSSFNDAAFATLV--SFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMS--NNMTILSLQSWLQSNIGTPSI-------VAINSFEYFQTLFD----------TYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSI 1785
           ++ I +  L+G+    ++ + +  +  ATK++N    N                       Q    +++++    N+++  N   +  +     R  + P SY   AI+SA         D  +    + +I     ++ + +N   F E  + +S  YK+ I+   ++I+G+G S E  +P+ S  + IPNP  +   YV+D GY+ L   ++ + +  +I    K +N  +   +    ++N++          L +AY ++ + N  NL  AR ++   +   +   +++L+ +++++ + +  L++K Y++KNR  L +  ANG +  +I+LS+++F    + I G+ GY++ Y  Q + +   ++FWFIP+    FSA  L   + S +L  ++F V      V   R  + + L +  E KV+K+   IK     L  + +FRIS++ + + +  L  IL +A + ++    +    ++ ++N T     Y Y  +L TP++QSGL  YQE+ DLG TD             +E   N +   S +D  ++                       ++N  +     I   ++ +   +N + SK  +D+ I +  +  N W   S+  P++  +         + AI+NN   N L+ P   A ND   YI      N  L+ N V +++     S      EF+ F+   +    N     +D KIT+ ++     +  D+ +       YT +D +  ND   +I  ++N  K   TN++      ++D     L+D+ N+ +N  L   ++ +       P++IN+  A     ++G++    I N   R +D++   N       + +K K++GISS +    +Y S + AN++LG            S++++  KL                                    PFNG +S +        PL   S LL +TS       S ++     ++  S +  +  L+  TPY+     +LS+       D  +L VA+    N+   +   W +      S+       V++     + T+ +           +  I +T L I+ ++I + VP++ +I++++S++++ + +K+   +K LG+SDR  + S L I++PV +  L+VG  +   L   +N +I  +ASI L   I     L  +  + GI  I+F      L+K  +   I
  S:   249 LKTILNVVLTGINPNTNNPNLANFVQAATKVVNNQPLNNN-------------------EQQRIQEFIDTETNPINNNWSINFQWKYQIVPLSIR-LINPNSYF--AIVSASNWKHDQQTDGKMIFQDQEMI-----DQLMSLNGDAFLERFNTISDRYKIQIDQTSYLILGTGVSPEFIYPIYSFTNFIPNPVNQRIYYVNDYGYSRLREAFSTNPIETNIVGRFKDRNLSQAQRQLALDKINQWASINMAWPPNLKSAYFANDISNILNLRAARTTFIPSLLNTIKNTSLMLMAIIILLALMVGILIVKSYIDKNRQTLGILLANGFNKTKINLSMAIFSFIPSLIGGMAGYILGYILQEVAINAFSSFWFIPVELRRFSATAL---VTSFFLPVIIFGVTSFLVSVYLMRKNVVDSLKNDSEYKVSKISVYIKKPIAILSVMNRFRISIAFNSMWKLFLLCILSAATMVVLIFSLSTLNVYDKAKNDTFGANNYKYYVDLATPTQQSGLIMYQEFKDLGKTDAALA--------GWEDHKNYFLANSRTDPNQSG----------------------WSNLHIVGLNDIIDQSSKVTYLKNYVQSKIGLDYLIGLGVLSANPWSLSSSLMPSNQAAASEKSYEIFLQAIANNVYRN-LKTP---ADNDPSYYI--RIVFNPQLNRN-VYEINQDQALSGGILKPEFIHFLIQQFENISNNTYGLVDYKITYNVIGLGAKTIGDIKDKESPKFAYTRIDTVTDNDQKFQIKGIKNWIKT--TNLDDV---DRKDYLGPILIDNNNKVINQKLFNQTDDN-------PIIINEFVAKNNHWKVGDTIDFTITNRVDRISDKLNIINHDEYLKNQKVKFKVIGISSSARDNDLYTSYDLANKLLGF-----------SDFEIEHKL------------------------------------PFNGYYSDDLDAFERSTPLFSESGLLPSTSNF-----SVDNKQLQKIIRNSILNYQSTLSTSTPYN-----QLSSTRQAYVDDYKALLVALGEVKNLDGNNFHQWTELKADNQSVSDYIKKLVSVYGSLPYNTMINFLYNSSSNRAIFENISKTSLTIQNVIIAMIVPIVTLIVILISNMLIDELKKIAIRMKALGFSDRAIIFSFLSIYIPVFIFGLLVGGPLSLILVNIYNLIILKSASIALFTTISITHILGALTGVMGIFSISFFTNWYTLRKMKIAQEI 1358
>gi|13507819|ref|NP_109768.1| ABC transporter membrane protein [Mycoplasma pneumoniae M129] >gi|2496282|sp|P75613|Y080_MYCPN Uncharacterized ABC transporter permease MG064 homolog >gi|1673728|gb|AAB95723.1| Probably ABC transporter membrane protein subunit [Mycoplasma pneumoniae M129] (1386 aa)
Score = 480, Expect = 2.1e-45, Identities = 253/1048 (24%), Positives = 476/1048 (45%)
  Q:   738 VSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGY----NSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKY------LDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIG----------LIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQN-STLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVS-INSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWV-----LDSNSVLDLSNVANTSSIR-----------------FNDEFLKFIGMVYGNKQLSSLDAKIT-FGIVPFRDLSSNDLTETYTYLDAI------LNDSSVRIP--SLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDD---ENRNLNSLL-SQPSEISSDGFETYP--VVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYV----PFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQ------SWLQSNI-------------GTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSI 1785
           ++ WN+   +   EFE     +   YK+ ++ ++++I+G G + +  +PV S    IPN   E   YV+  GY    +S L   +E        +    N   DL+ +N    K       L  AY ++   N  NLL AR  +   +   +++ +  L + ++++ I+++ L++  Y++KN   + + KANG+S  +I+LSL +F +    +   +GY +    Q + + + +N+WFIP    +FS +G          ++  I SL++ +L+          R  + ++L    E KV+ L    K        +T+FR++L+ +   + +   ++ +  + I+ +  A    F+ +Q  +TL+   + Y + L +P+EQSGL K+Q + +LG TD+                              T D + L +    + + +  KK  + N  + ++V+    F+NDI    N++ SK  +D+ +    +  N W       P +  S  N    NFL  ++ +      N+   YI Q      V     +DS+  L   N  + + I+                  +++F KF+   Y    L     K     +  F   + N +   Y+  +A+      L  + + +P  ++ N     L         +  D+  +  + D   +N NL  +L +   EI +    + P  ++IN  AA KY L+ G    + I+N Y R   +++N++P  T    IVGI++   +   Y S + A  +L                                                    YP +++    PFN  ++    P    S  L + SGL+   SSF  AA  T+++ V +K  +      S   V + +A    +   KY+ S   +N M    LQ      S L S+              G P    I+     Q     +  I  T   I+T  I + +P+I++I+++VS+ ++ + +K+   LK LGYS+ + LLS L I++P+ +  L++ I +   L    N +IF++A+I L   +++ + +  ++ ++G++ I F+   + L K  +   I
  S:   366 INHWNRIKRLPFNEFEREFQKIDKRYKMLVDKIEYLILGVGITPDFVYPVFSESLLIPNTANEQLYYVNQTGYERTASSFLTNPTETG-----IVARLPNLNHDLDVINQWAVKNMSWPPNLKAAYSNTDTTNILNLLAARTVFIPNLINTISLVSSFLTIAILLVAIFVTILILVSYLKKNTEQIGILKANGVSGRKINLSLLIFSLIPGIVGSFIGYTLGISMQNVAINLFSNYWFIPTQTSSFSVLGLLFFALLVVLMMSGI-SLFVGWLIL---------RQDVVKILKHDSEFKVSHLGLWAKWLFAKFGIMTRFRVALAFNAPWKLVFLTLMSALTMMILNLSFATKDAFQVAQTKTTLTQSNHQYEFELASPTEQSGLLKWQLFAELGATDDR-----------------------------TTDAVKLANRRMEIQSVDESKK--WKNQQVINFVTDATGFSNDINYLENIVQSKIGLDYSLGFGNVSSNPWKLSETLMPANQASASNTAFQNFLKAIIVIDP----NEGGKYIKQTKDEVTVRFLYEIDSSKALKNGNTKSVNKIQKSTAAPQAQQGQSNQLMLDNDFAKFL---YKQFNLIKEGGKADPVDLNNFDFANQNQIKRFYSKYNALPPVDYKLAFNVIGLPKETIANQKDAPLFGFLTLQAQLGNDAIKIKGIKDWKLDNTNLGPVLRTNEDEIINQRLFSKPNGIIINSSAAKKYRLKEGSQLHVKIHNGYKRVNAKLVNQDPTLTATFNIVGINNSVHEPEFYTSYKTAATLL---------------------------------------------------QYPNEWIEKQLPFNSFYANSILPF-TQSTSLFSESGLFPGTSSF--AANNTVLTEV-IKKTIEGGKTNSKTDVQKRAAQ--ATANGKYNSS--QNNKMNYERLQKALGITSDLDSSKAGEYATILERVYDGLPYNSTISFISNVQANDALFANIANTTQQIQTAAIGIIIPIIMLIVLLVSTTLIQELKKIAIRLKALGYSNPKILLSFLSIYLPLFIFGLLISIPISIYLIALHNQVIFSSAAILLEATLNFPTVILSMLVLSGVLSITFVLNWLELNKIKIAKEI 1383
>gi|12044916|ref|NP_072726.1| ABC transporter, permease protein, putative [Mycoplasma genitalium G37] >gi|6226729|sp|P47310|Y064_MYCGE Uncharacterized ABC transporter permease MG064 >gi|3844662|gb|AAC71282.1| ABC transporter, permease protein, putative [Mycoplasma genitalium G37] >gi|166079075|gb|ABY79693.1| ABC transporter, permease protein, putative [synthetic Mycoplasma genitalium JCVI-1.0] (1331 aa)
Score = 469, Expect = 3.9e-44, Identities = 192/750 (25%), Positives = 354/750 (47%)
  Q:   721 IVVNDQWLSSNQ--KSVIP-VSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYN---SLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMN--KYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRT--FRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNST-LSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEV-PELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSS--IRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSS-NDLTETYTY---LDAILNDSSVRIPSLRNDGK------------RRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSE--ISSDGFETY---PVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQIL 1470
           IV    W    Q  K V P ++ W     +   +FE     +   YK++I+++D+++IG G S +  +PV S    +PN + E   YV+  GY    S   TN      +   I  +++     ++    M+    +  AY SS   N  NLL AR  +   +   +N+ A+ L + ++ + I +S L++  Y++KN   + + KANG+S  +I+LSL +FG+  A +  I GY      Q + + + +N+WFIP    +FS +GL+    SL++  ++  +  +V +   +  + ++L    E KV++L    K        +T+FR++L+ +   + +   ++ S  + I+ +  A    FE +Q+ T L+N+ + Y + L + + QSGL K+Q + +LG TD+                           S+ +  L   R    NV   ++ K +   NFL  +    + F+ND+    N++ SK  +D+ +    I  N W       PT+  S  N    NFL  ++ + P   +    ++         + +DS+  L  +N  N S   +  ND+F KF+   +   + S   +      + F +  +  D    Y     LD  L+ + + +P     G+                N   +I GIK+         D+  NL  +LS  +   I+ + F+ Y   P+++N  AA KY L IG    I +NN++ R  ++++N++P+     ++VGI++ +     + S   A ++L
  S:   317 IVAPGNWTYQQQLGKEVYPDINNWESIKKLPLEQFESEFLKIDQKYKISIDNIDYLVIGVGISPDFVYPVFSASLIVPNIENEQLYYVNQTGYERTFSSFLTNPVETAIVARLINLESDLNTINQWAVENMSWPTNIKAAYSSSDTTNILNLLAARTVFIPNLINTINLVALFLTIAILTVAIIVSILILISYLKKNTEQIGILKANGLSGKKINLSLLIFGLIPAIVGAISGYSFGIGFQDVAIHLFSNYWFIPTATSSFSVVGLL--FFSLFVILIMSSISLLVGSIILKKDVVKILKHDSEFKVSRLGLSSKKLFARFGIMTRFRVALAFNAPWKLVFLTLMSSFTMMILNLSFATKDSFENAQSKTNLTNQNHQYEFELASATTQSGLLKWQLFAELGTTDKR--------------------------SESSVKLANKRMDISNVDASKDWKNQQVINFLSDA----SGFSNDLNYLENIVQSKIGLDYSLGFNNIVSNPWRLSETLMPTNQASASNTAFQNFLKAIITINPSQGSQFIKQTQDPLTKRFIYAIDSDKALKNNNEQNGSQNHLTLNDDFAKFLYSQFELIKKSGNASNEDLNAIDFENPQTIRDFYNKYNALPPLDYKLSFNVIGLPKETIAGQIDTPKYGFLTLHGEYQNTPIKIKGIKD-------WKDKVDNLGPVLSDQNNHIINQELFKNYSFDPLIVNNSAAKKYQLAIGSEINIAVNNSFKRIDNKIINQDPLVNATFRVVGINNSAHDPEFFTSYSTAFKVL 1062
Score = 100, Expect = 2.5e-01, Identities = 28/105 (26%), Positives = 58/105 (55%)
  Q:  1678 VSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLK 1782
           VS+ ++ + +K+   LK LGYS+ + L S L I++P+    L++ I     L    N +IF ++SI+L   + + S +  ++ +  + +++  FV  +L+   +K
  S:  1221 VSTTLIQELKKIAIRLKALGYSNLKILASFLSIYIPLFAFGLLISIPFSIYLIALHNEVIFASSSIFLDAFLSFESAIGSMLVL--LAVLSITFVLNWLELNKIK 1323
>gi|195869135|ref|ZP_03004494.2| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659701|gb|EDX53081.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (1575 aa)
Score = 436, Expect = 2.2e-40, Identities = 114/389 (29%), Positives = 207/389 (53%)
  Q:   725 DQWLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           D +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ K         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   321 DAFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 728
Score = 129, Expect = 9.5e-05, Identities = 58/205 (28%), Positives = 102/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI     +  +Y   +NA QILG++ S  A       YD
  S:  1101 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1292
Score = 110, Expect = 1.5e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1423 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1538
>gi|195867653|ref|ZP_03079655.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660710|gb|EDX53965.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (1575 aa)
Score = 432, Expect = 8.1e-40, Identities = 113/387 (29%), Positives = 206/387 (53%)
  Q:   727 WLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ K         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   323 FLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 728
Score = 129, Expect = 9.6e-05, Identities = 58/205 (28%), Positives = 102/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI     +  +Y   +NA QILG++ S  A       YD
  S:  1101 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1292
Score = 110, Expect = 1.5e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1423 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1538
>gi|188592408|ref|ZP_03005776.1| hypothetical protein Uureaserovar_00370 [Ureaplasma urealyticum serovar 10] (1547 aa)
Score = 432, Expect = 8.3e-40, Identities = 113/387 (29%), Positives = 206/387 (53%)
  Q:   727 WLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ K         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   295 FLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 700
Score = 129, Expect = 9.5e-05, Identities = 58/205 (28%), Positives = 102/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI     +  +Y   +NA QILG++ S  A       YD
  S:  1073 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1264
Score = 110, Expect = 1.6e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1395 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1510
>gi|188568597|ref|ZP_03005390.1| hypothetical protein Uurealyserovar_00335 [Ureaplasma urealyticum serovar 2] (1547 aa)
Score = 432, Expect = 8.3e-40, Identities = 113/387 (29%), Positives = 206/387 (53%)
  Q:   727 WLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ K         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   295 FLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAISIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 700
Score = 126, Expect = 2.4e-04, Identities = 58/205 (28%), Positives = 101/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI        +Y   +NA QILG++ S  A       YD
  S:  1073 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQGIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1264
Score = 110, Expect = 1.6e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1395 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1510
>gi|188530882|ref|ZP_03005165.1| hypothetical protein Uurese_01000004_0200001960 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] (1547 aa)
Score = 432, Expect = 8.3e-40, Identities = 113/387 (29%), Positives = 206/387 (53%)
  Q:   727 WLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ K         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   295 FLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 700
Score = 129, Expect = 9.5e-05, Identities = 58/205 (28%), Positives = 102/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI     +  +Y   +NA QILG++ S  A       YD
  S:  1073 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1264
Score = 110, Expect = 1.6e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1395 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1510
>gi|185179146|ref|ZP_02964863.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|189009911|ref|ZP_03004070.2| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|184208925|gb|EDU05968.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188997855|gb|EDU66952.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (1540 aa)
Score = 429, Expect = 1.8e-39, Identities = 112/387 (28%), Positives = 206/387 (53%)
  Q:   727 WLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ +         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   288 FLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKRESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 693
Score = 129, Expect = 9.5e-05, Identities = 58/205 (28%), Positives = 102/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI     +  +Y   +NA QILG++ S  A       YD
  S:  1066 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1257
Score = 110, Expect = 1.6e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1388 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1503
>gi|188039436|ref|ZP_02998199.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 8] (1547 aa)
Score = 429, Expect = 1.8e-39, Identities = 112/387 (28%), Positives = 206/387 (53%)
  Q:   727 WLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ +         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   295 FLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKRESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSEYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 700
Score = 129, Expect = 9.5e-05, Identities = 58/205 (28%), Positives = 102/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI     +  +Y   +NA QILG++ S  A       YD
  S:  1073 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1264
Score = 110, Expect = 1.6e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1395 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1510
>gi|171920966|ref|ZP_02932100.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188024199|ref|ZP_02996912.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|171902990|gb|EDT49279.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188018850|gb|EDU56890.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] (1575 aa)
Score = 429, Expect = 1.8e-39, Identities = 112/387 (28%), Positives = 206/387 (53%)
  Q:   727 WLSSNQKSVIPVSEWNKALL--MNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSL--LYTNSEVNQDIYFAIKFKNNGKVDLEYV-------NSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           +LSS+ K   P+  W KAL+   + + FE+W ++L   Y V I++  ++I+ SG + +  +P++S  S IPNPK EG +Y +  GY  +   + ++   +++   I  + +  VD+  +       N R+ +         LD AYL     N+      R+ +   I   +  F+I++ + ++V+ +++  ++I  ++ +N+I + ++ ANG++ W+I LS    G+    + G+ GY+VAYF Q + + I + +W IP     F    LI  I   +L F     I    + R P   L+  TE  K++K++++IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   323 FLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKRESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPINLMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 728
Score = 129, Expect = 9.6e-05, Identities = 58/205 (28%), Positives = 102/205 (49%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           S++ +++F+  + + + +   S  D  + ITF ++ F  L+ N+ T      E Y ++DA +N         + + ++       +I GI ++SK V L+ ++ + +N LL   ++           +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI     +  +Y   +NA QILG++ S  A       YD
  S:  1101 SVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNK-KQINHLLFNEND-------EQVAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYVKKQ----ITLKVVGIIDTYQEIEIYTGIKNAAQILGMHSSPYADKSLYEGYD 1292
Score = 110, Expect = 1.5e-02, Identities = 34/116 (29%), Positives = 67/116 (57%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDW 1751
           + + E    LF    T  +T+  +E ++I L + +II++++++S   +SD  K+  +LK +GY+D +N    LM F+P ++I  I+ I ++  +   F+ MIFN+ ++ L+    W
  S:  1423 LKNVEVVDVLFAVLETASKTIQTVEIVVILLILFIIILVLVLMSINSLSDILKVAKLLKNMGYNDLKNAQLFLMAFLPPLIIGSIISIPLVVLVMQAFSEMIFNSLNVLLTTGFIW 1538
>gi|13357877|ref|NP_078151.1| hypothetical protein UU317 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|11356796|pir||G82905 conserved hypothetical UU317 [imported] - Ureaplasma urealyticum >gi|6899294|gb|AAF30726.1|AE002129_2 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (1575 aa)
Score = 420, Expect = 1.8e-38, Identities = 113/394 (28%), Positives = 213/394 (54%)
  Q:   720 AIVVNDQWLSSNQKSVIPVSEWNKALLMNSRE--FEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLL--YTNSEVNQDIYFAIKFKNNGKVDL-------EYVNSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           A+V    +LS++ K   P+  W KAL+ +  +  FE+W ++L   Y + I++  ++I+ SG + +  +P++S  S IPNPK EG +YV+  GY  +   + ++ +  ++   I  + +  VD+       + +N ++ K         LD AYL     N+      R+ +   I   +  F++++ + ++++ I++  ++I  ++ +N+I + ++ ANG+  W+I LS +  G+    I G+ GY+ AYF Q + + I + +W IP     F+   LI  I   +L F +  V     + R P  +L+  TE  K++K++Y+IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   316 ALVGLGAFLSNHNKQKYPMYLWQKALVDHEEQQSFEKWFNSLDEKYIIHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYVNLNGYARIYDAFRSNPIENNLQIRITNQKHQSVDISILKKIVKNLNDQIKKDAIMNWPTSLDAAYLKDDTNNHITPSPLRLVFINKITNTIQTFSVLITLFILILTIFVIVIIINRFLAQNKINIGISIANGVPRWKIILSFAFIGLIPCVIGGLCGYLTAYFTQNLAINIFSGYWLIPTVLENFNFGALITVIIFPFLLFFILIVGLGYWSIRKPPIDLMRGTETFKISKIVYVIKFPFKYISGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTIDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 728
Score = 134, Expect = 2.5e-05, Identities = 62/205 (30%), Positives = 100/205 (48%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           SI+ +++F+  + + + +   S  D  + ITF +V F  L+ ND T      E Y ++DA +N        + N       N   +I GI ++SK V L+ ++ +  N L ++  E  +        +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI        +Y   +NA +ILG++ S  A       YD
  S:  1101 SIKLDNDFINLVLLTHPSINPSYADVWSGITFNMVGFDYLTKNDKTQLNEFDEPYIWIDAQIN-------KINNQKYEEAKN--PKIIGIIKNSKLVHLLSNKKQINNLLFNKNDEQVA--------IINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYIKKQ----ITLKVVGIIDTYQGIEIYTGIKNAAEILGMHSSPYADKSLYDEYD 1292
>gi|186701641|ref|ZP_02971343.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700881|gb|EDU19163.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (1540 aa)
Score = 420, Expect = 2.0e-38, Identities = 113/394 (28%), Positives = 213/394 (54%)
  Q:   720 AIVVNDQWLSSNQKSVIPVSEWNKALLMNSRE--FEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLL--YTNSEVNQDIYFAIKFKNNGKVDL-------EYVNSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           A+V    +LS++ K   P+  W KAL+ +  +  FE+W ++L   Y + I++  ++I+ SG + +  +P++S  S IPNPK EG +YV+  GY  +   + ++ +  ++   I  + +  VD+       + +N ++ K         LD AYL     N+      R+ +   I   +  F++++ + ++++ I++  ++I  ++ +N+I + ++ ANG+  W+I LS +  G+    I G+ GY+ AYF Q + + I + +W IP     F+   LI  I   +L F +  V     + R P  +L+  TE  K++K++Y+IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   281 ALVGLGAFLSNHNKQKYPMYLWQKALVDHEEQQSFEKWFNSLDEKYIIHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYVNLNGYARIYDAFRSNPIENNLQIRITNQKHQSVDISILKKIVKNLNDQIKKDAIMNWPTSLDAAYLKDDTNNHITPSPLRLVFINKITNTIQTFSVLITLFILILTIFVIVIIINRFLAQNKINIGISIANGVPRWKIILSFAFIGLIPCVIGGLCGYLTAYFTQNLAINIFSGYWLIPTVLENFNFGALITVIIFPFLLFFILIVGLGYWSIRKPPIDLMRGTETFKISKIVYVIKFPFKYISGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTIDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 693
Score = 134, Expect = 2.6e-05, Identities = 62/205 (30%), Positives = 100/205 (48%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           SI+ +++F+  + + + +   S  D  + ITF +V F  L+ ND T      E Y ++DA +N        + N       N   +I GI ++SK V L+ ++ +  N L ++  E  +        +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI        +Y   +NA +ILG++ S  A       YD
  S:  1066 SIKLDNDFINLVLLTHPSINPSYADVWSGITFNMVGFDYLTKNDKTQLNEFDEPYIWIDAQIN-------KINNQKYEEAKN--PKIIGIIKNSKLVHLLSNKKQINNLLFNKNDEQVA--------IINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYIKKQ----ITLKVVGIIDTYQGIEIYTGIKNAAEILGMHSSPYADKSLYDEYD 1257
>gi|170761957|ref|YP_001752399.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920330|ref|ZP_02691358.2| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508697|ref|ZP_02958185.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168827534|gb|ACA32796.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902751|gb|EDT49040.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675619|gb|EDT87524.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (1549 aa)
Score = 420, Expect = 2.1e-38, Identities = 113/394 (28%), Positives = 213/394 (54%)
  Q:   720 AIVVNDQWLSSNQKSVIPVSEWNKALLMNSRE--FEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLL--YTNSEVNQDIYFAIKFKNNGKVDL-------EYVNSRMNK--------YLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGIT 1113
           A+V    +LS++ K   P+  W KAL+ +  +  FE+W ++L   Y + I++  ++I+ SG + +  +P++S  S IPNPK EG +YV+  GY  +   + ++ +  ++   I  + +  VD+       + +N ++ K         LD AYL     N+      R+ +   I   +  F++++ + ++++ I++  ++I  ++ +N+I + ++ ANG+  W+I LS +  G+    I G+ GY+ AYF Q + + I + +W IP     F+   LI  I   +L F +  V     + R P  +L+  TE  K++K++Y+IK     +    K+ I+LS S +TR I+F I+ +     I   +    K + + ++TL  K+Y Y  +L TP++Q G Y       +G T
  S:   290 ALVGLGAFLSNHNKQKYPMYLWQKALVDHEEQQSFEKWFNSLDEKYIIHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYVNLNGYARIYDAFRSNPIENNLQIRITNQKHQSVDISILKKIVKNLNDQIKKDAIMNWPTSLDAAYLKDDTNNHITPSPLRLVFINKITNTIQTFSVLITLFILILTIFVIVIIINRFLAQNKINIGISIANGVPRWKIILSFAFIGLIPCVIGGLCGYLTAYFTQNLAINIFSGYWLIPTVLENFNFGALITVIIFPFLLFFILIVGLGYWSIRKPPIDLMRGTETFKISKIVYVIKFPFKYISGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTIDATLQTKKYRYGIDLITPTDQGGQYISLSTNQIGST 702
Score = 134, Expect = 2.6e-05, Identities = 62/205 (30%), Positives = 100/205 (48%)
  Q:  1283 SIRFNDEFLKFIGMVYGNKQLSSLD--AKITFGIVPFRDLSSNDLT------ETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYD 1487
           SI+ +++F+  + + + +   S  D  + ITF +V F  L+ ND T      E Y ++DA +N        + N       N   +I GI ++SK V L+ ++ +  N L ++  E  +        +IN+ AA  Y+L+IG+ F    NN   RYT   + K     I LK+VGI        +Y   +NA +ILG++ S  A       YD
  S:  1075 SIKLDNDFINLVLLTHPSINPSYADVWSGITFNMVGFDYLTKNDKTQLNEFDEPYIWIDAQIN-------KINNQKYEEAKN--PKIIGIIKNSKLVHLLSNKKQINNLLFNKNDEQVA--------IINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYIKKQ----ITLKVVGIIDTYQGIEIYTGIKNAAEILGMHSSPYADKSLYDEYD 1266
>gi|71894623|ref|YP_278731.1| putative ABC transporter permease protein [Mycoplasma synoviae 53] (2638 aa)
Score = 376, Expect = 2.4e-33, Identities = 256/1053 (24%), Positives = 452/1053 (42%)
  Q:   724 NDQWLSSNQKSV----IPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLL--YTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMN---------KYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLL----YLIKSRKIPLFALTKFRISLSLSKLTRFILF--VILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKY--------QEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLS-SNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNK-NPVK-----TIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENP-LLVNSLLLENTSGLWGNYSSFNDAAFATL--VSFVGVKHVLNLVTPYS-AKGVAELSAYYGLSTTDKYSLSVAMSNNMTIL------------SLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYL 1776
           N  WL  N K +    IP +      L+NS         L  +  + +N + FIIIG   + +  +PV+  E+   + K++G IYV+  G++ +   Y N+ V + +   I  +   +   E  N+  N           +   YL++ L       + R+     I   +N   I L  +L+         +IK Y+      + +  + G S W+I  S++ F I   F  GILGYVV + +Q   + ++ N+W +PI    FS + L+  +   +LA  +      + + R    +L+S   E+K+ ++      L KS+KI     TKF  SL  +   +   F   I  ++ ++I    +     F+ + N T  N+ Y+Y+Y+L+TP+ +S  YK         Q Y  LG + E       Y  P F   IN   T   + + E  D   L   + N I    G      N +  S    +S  N I + RN+I      + + +   +  N+    +N       S+IN           +V     I D  + +IQN    W    N   +       ++  + +E+ +F  ++ G K+L     K    ++ F  +   N   ETYTY  AI ND+S+                   +YG + DSK + + D+ N N+   ++   + + D  E  P++IN+ A YKY L+  +   + I NT  R+ ++   + NP +     T K KIV IS     T   I  + AN I  L+                                              K ++  D  PFNG+ SK E P LL++S  L + S  WG  ++ +  + + +  V+         L  P    +GV + + Y         + +   ++   I             ++  +L +    P ++  ++ +         T    T+ VI T +  +F    I+I++I S++++++  K +AI   LGYS++E +     IF+P +L++ ++ I +  ++   F+  +   ASI +   I+ V+    + A  G+V+  F   SV L
  S:  1632 NYAWLQQNNKKIYSGEIPDNPIKMLALLNS---------LPEDNILNVNGVKFIIIGQEITADYLYPVIDEENLQVDTKSQGIIYVNQNGFDRIRNSYRNNVVKEYVVSKIPGETTDEQKSEIRNNIENYVQETIDDSAKIQRTYLTNELDGINPERSLRVRIIDSIISSINKSLIALTGILIFFVTVSVIFIIKRYIFNKNKVIGILISQGYSPWEIVFSMTTFSIFIIFFGGILGYVVGFTSQAAVIHVIKNYWTLPIVTLNFSWVSLLVTLMIPFLAITVLIYSITISSLRFKSIDLMSGVYEVKLGRVQRIFSSLFKSKKIT----TKFSASLIFNSFWKLFSFGTSIFLTSIVTIFAFTATT--VFDKAINETYKNRLYNYKYDLKTPTVESNAYKTFNGSTLDNQLYVPLGHSSEINSYAGDYFRPGFSNSIN---TNFANGNPEYNDPHVLTQFSLN-IRINGGVSVDPFNLIFNSLP--DSQKNKIIVIRNIIGK----ELEKTQDNLVYNS----NNEIDISKTSKIN-----------KVGFFGYIPD--NLVIQNGK-FWYFQYNDAKNEYERVQITTGAYRNEYRQF--LINGYKKLYEDPKKTQDFLISFGGIYLDNRFDETYTYAQAIFNDNSI------------------NLYGYRPDSKQIQVYDN-NVNILKKINDEFDANPDLNEPIPLIINEVARYKYLLQRNQIITLKIENTTDRFKEKFDKEINPNRELSDNTYKFKIVDISKTYINTEFIIPHQAANLITKLD----------------------------------------------KLNFGEDTGPFNGILSKNEIPSLLLSSASLYSYSNFWGVVAAIDTNSMSRIDKVALFNSLFGSKLTNPNDFTEGVLKTNGYSDFEIAKFINPNFNQNDRNAIYDNYHQTINNPDGAINKFLAAYNDMPYVIVASNLDAKNIELSFTTITANTVKVIITFVSIIFFITSIVILIIFSTILINENTKNIAIWSILGYSNKEKVKMFFGIFIPFILVAFLLAIPLAIAIMQIFSITLTYVASIAIPSMINAVN----IFATLGVVLGVFSITSVIL 2622
>gi|144575197|gb|AAZ44020.2| putative ABC transporter permease protein [Mycoplasma synoviae 53] (2636 aa)
Score = 375, Expect = 2.8e-33, Identities = 256/1053 (24%), Positives = 452/1053 (42%)
  Q:   724 NDQWLSSNQKSV----IPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLL--YTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMN---------KYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLL----YLIKSRKIPLFALTKFRISLSLSKLTRFILF--VILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKY--------QEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLS-SNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNK-NPVK-----TIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENP-LLVNSLLLENTSGLWGNYSSFNDAAFATL--VSFVGVKHVLNLVTPYS-AKGVAELSAYYGLSTTDKYSLSVAMSNNMTIL------------SLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYL 1776
           N  WL  N K +    IP +      L+NS         L  +  + +N + FIIIG   + +  +PV+  E+   + K++G IYV+  G++ +   Y N+ V + +   I  +   +   E  N+  N           +   YL++ L       + R+     I   +N   I L  +L+         +IK Y+      + +  + G S W+I  S++ F I   F  GILGYVV + +Q   + ++ N+W +PI    FS + L+  +   +LA  +      + + R    +L+S   E+K+ ++      L KS+KI     TKF  SL  +   +   F   I  ++ ++I    +     F+ + N T  N+ Y+Y+Y+L+TP+ +S  YK         Q Y  LG + E       Y  P F   IN   T   + + E  D   L   + N I    G      N +  S    +S  N I + RN+I      + + +   +  N+    +N       S+IN           +V     I D  + +IQN    W    N   +       ++  + +E+ +F  ++ G K+L     K    ++ F  +   N   ETYTY  AI ND+S+                   +YG + DSK + + D+ N N+   ++   + + D  E  P++IN+ A YKY L+  +   + I NT  R+ ++   + NP +     T K KIV IS     T   I  + AN I  L+                                              K ++  D  PFNG+ SK E P LL++S  L + S  WG  ++ +  + + +  V+         L  P    +GV + + Y         + +   ++   I             ++  +L +    P ++  ++ +         T    T+ VI T +  +F    I+I++I S++++++  K +AI   LGYS++E +     IF+P +L++ ++ I +  ++   F+  +   ASI +   I+ V+    + A  G+V+  F   SV L
  S:  1630 NYAWLQQNNKKIYSGEIPDNPIKMLALLNS---------LPEDNILNVNGVKFIIIGQEITADYLYPVIDEENLQVDTKSQGIIYVNQNGFDRIRNSYRNNVVKEYVVSKIPGETTDEQKSEIRNNIENYVQETIDDSAKIQRTYLTNELDGINPERSLRVRIIDSIISSINKSLIALTGILIFFVTVSVIFIIKRYIFNKNKVIGILISQGYSPWEIVFSMTTFSIFIIFFGGILGYVVGFTSQAAVIHVIKNYWTLPIVTLNFSWVSLLVTLMIPFLAITVLIYSITISSLRFKSIDLMSGVYEVKLGRVQRIFSSLFKSKKIT----TKFSASLIFNSFWKLFSFGTSIFLTSIVTIFAFTATT--VFDKAINETYKNRLYNYKYDLKTPTVESNAYKTFNGSTLDNQLYVPLGHSSEINSYAGDYFRPGFSNSIN---TNFANGNPEYNDPHVLTQFSLN-IRINGGVSVDPFNLIFNSLP--DSQKNKIIVIRNIIGK----ELEKTQDNLVYNS----NNEIDISKTSKIN-----------KVGFFGYIPD--NLVIQNGK-FWYFQYNDAKNEYERVQITTGAYRNEYRQF--LINGYKKLYEDPKKTQDFLISFGGIYLDNRFDETYTYAQAIFNDNSI------------------NLYGYRPDSKQIQVYDN-NVNILKKINDEFDANPDLNEPIPLIINEVARYKYLLQRNQIITLKIENTTDRFKEKFDKEINPNRELSDNTYKFKIVDISKTYINTEFIIPHQAANLITKLD----------------------------------------------KLNFGEDTGPFNGILSKNEIPSLLLSSASLYSYSNFWGVVAAIDTNSMSRIDKVALFNSLFGSKLTNPNDFTEGVLKTNGYSDFEIAKFINPNFNQNDRNAIYDNYHQTINNPDGAINKFLAAYNDMPYVIVASNLDAKNIELSFTTITANTVKVIITFVSIIFFITSIVILIIFSTILINENTKNIAIWSILGYSNKEKVKMFFGIFIPFILVAFLLAIPLAIAIMQIFSITLTYVASIAIPSMINAVN----IFATLGVVLGVFSITSVIL 2620
>gi|193216518|ref|YP_001999760.1| ABC transporter permease protein [Mycoplasma arthritidis 158L3-1] >gi|193001841|gb|ACF07056.1| ABC transporter permease protein [Mycoplasma arthritidis 158L3-1] (2777 aa)
Score = 356, Expect = 4.5e-31, Identities = 246/1037 (23%), Positives = 472/1037 (45%)
  Q:   723 VNDQWLSSNQKSVIP--VSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLK----NNTNLL----TARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGA--IGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKL---LYLIKSR-KIPLFALTKFRISLSLSKLTR-FILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDI--ELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAI----------SNNFLVNVLEVPE--LKAINDSKSYIIQNSSG---------NWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDA---ILNDSSVRIPSLRND----GKRRLTN-IEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNK-NPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPL-LVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVL-------------------NLVTPYSAKGVAELSAYYGL----------STTD--KYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVI 1759
           VN  +L  N K +    +S++    L N    +E+ ++L + YK+ +N+++++IIG  T+ +  +PVV+ E+   + KT+  +YV+  G++ +           Y  IK       ++  +   +N  + N   S+  K      ++ L    + RI+    +   +    +I I++L+VI I++   +IK Y+E     + +  A G  T +I+LS + FG   A I GI GY+     Q   + I +++W +      F+ + L+ A  +  L ++ L+F  I      R P+ E+++   EL +N +   +Y+I  R  I +    KF IS+ L+   + F LF+   S  + ++   S+    F+ S + T  N+ Y Y+ +L++P+ + G Y    + DL      R ++                           DL      NG+ + YEN       NFL P       F +D+    F  V+++K  +D  + ++ + ++ WD      P    +R+  I          + N +   +   E    A+ D + Y    ++G          + L SN+ L   +   + S R+          V  N Q SS ++ +       R+     L + Y  +D     +    V      N+     K  LTN  E +IYG +EDSKY+ ++D    +L+  L Q S  S    E  P+V+N  +A +  L +G+  + D+ N   R+  +++    P    + ++VGIS          S++  ++ILG++              + ++L      +        P    +N    I+K +   Y  FNG+ S ++ P+  +++L   + SG WG  ++F+    +    +   K+V                    N     + K   E+  + G+           TTD  K+    + + N      +S    NI   +   +NS +         ++I +T+ VI T++I +   + I+I++I++++M++  R  +A    LGY++ E +      F+P +L++  + I     L T FN  + + + I L   ++  + +  V+
  S:  1717 VNQAYLDKNNKEIYTGDISKY----LNNPLAMKEFIASLPSKYKIKVNTIEYLIIGKETTADYLYPVVNEENIQVDTKTQALVYVNQRGFDRIRSAYPTFAIKEYVLIKMPKASDKEINKMRDELNGVISNITSSANKKVYKTTESDYLNPERSIRITAVMSVVNIIQKAQVISIIMLIVIVIFIVYFVIKRYIENRHKVIGILCAQGYKTSEIALSFAAFGWLPAAIGGIAGYITGLSLQLGAMRIFSSYWTLENNTIPFNVLSLLIAMILPVLGISALIF-AITYYAVRRKPV-EMMNGLVELSINNVSQKIYMIFRRWNIKM----KFVISMILNNFWKLFSLFLGFSSTSLIMMFFLSS-GNVFDRSISQTYKNRNYRYKLDLESPTTEGGPYVTYNHNDL-----SRLLY------------------------VPSDLAGKASSNGSQLDYEN------PNFLRPG----GGFNSDVIPRKFDPVVLTKSSLDLKLDLS-VELSPWDITYANMPETQRARVLQIFERVSMKMQATQNLITGEVNSGEGGYIAVKDLEKYKRDKAAGRPEDLSNRKGYFLFSNNRLSGDDDVASKSFRY----------VAWNPQSSSYESSVKVTTSAHREKYREFLVDAYKKIDVPDFYVAFGGVYWNEATNERYTYAKLGLTNGQETRIYGYQEDSKYIKVLDKNGNDLSKKLDQWSGPS----EPIPLVVNNVSAKRLGLSVGDIIEGDLLNHVDRFVHKLVQTAAPQTRYRFRVVGISDTYINDEFVASKKILDRILGMD-------------TLTKRLRDARRSELDQLNALYPEKKEEN----IRK-FNKKYEAFNGILSVDKTPVQTIDTLTTYSASGYWGATATFDTEGASAEAKWAFFKNVFISNPKLKFTSLFEHAINAYNEAHGTNKKYEEEMRKFLGIDDPAVFEEIKETTDISKFQKIASDAINKFYAPQESIYGKNIMYGASFDVNSKDIEAGFI---SSISKTINVILTVVIIVSFIISIVILVIITNIMIASNRISIATFSVLGYNNFEKIFLFFFSFIPSILLACGLMIPATLGLITIFNNFVLSTSQIVLPLTLNISTVIISVV 2748
>gi|26554476|ref|NP_758410.1| ABC transporter membrane protein [Mycoplasma penetrans HF-2] >gi|26454486|dbj|BAC44814.1| probably ABC transporter membrane protein [Mycoplasma penetrans HF-2] (1485 aa)
Score = 315, Expect = 2.7e-26, Identities = 118/514 (22%), Positives = 225/514 (43%)
  Q:   722 VVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFK----NNGKVDLEYVNSRMNKYL------DNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRT---FRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISN 1235
           +V+  +L +  K  +   +W   L      F  W ++LS N    I++  F+I+G+G + +  +P+VS  + +P+  TE  +Y +  GY+ ++ +    +Q+ +   KF     N     L  +NS    Y+      + AY+     N  +    R+ +   I   +   +  L   ++++ I ++ ++IK  +E NR  L + +ANG    +I L + +  +     + +LGY++    Q + + +L +FW +P      S I       +L++  LLF  I +V +        +E +    + K+ K+   +K   +    + + R +++ S L R IL  ++ +  +S +T    I   F+ S   T   + Y+Y  NL TP+ QSG Y    Y   G T  +   F+             Y       SQ   +  +  + + +  T  +   K F N+ L S   +N+ T+++   +N   +K   D  +    +  N W   S   PT+  S  N   N
  S:   385 IVSTNYLETLGKRPVNYQDWVSHLSDKQASFNAWLNSLSEN-TFEIDNQTFVILGTGITPDFMYPIVSFSNLVPDSNTEQVVYTNSSGYSKMINSFRGNDQETFLVGKFSTRNSNLNNQTLAQINSITTNYMAWPSNINAAYMYDDTSNTMSPTALRVIFIPQIVTTITSVSGFLTTFILILSIIIAVVIIKRCIETNRNSLGIMQANGYKKREIILGMCLLILIPVLAASVLGYILGISLQTVAINLLGSFWTLPT---EISGISFASMFLTLFIVALLFLAIVIVFSSICLLGETSEFMKDDAKYKMTKVASALKKPFVKFSIIDRLRAAIAFSSLWRLILLSLMSALLVSSLTFSINILDSFKDSAEKTYGIRNYNYALNLLTPTLQSGQYYTVPYQQQGKTLNKTTYFDT------SLATGTYDQSDNYISQRYWETGSAYNTDASSNTLFSDNLKKFGNYQLISQDDLNAQTSELYYLKNKTTTKAFADITLGAGSVSSNPWTLASQLMPTNNTSYANKAFN 901
>gi|66880418|ref|ZP_00405399.1| hypothetical protein MgenG_01000025 [Mycoplasma genitalium G-37] (258 aa)
Score = 306, Expect = 3.1e-25, Identities = 78/229 (34%), Positives = 135/229 (58%)
  Q:   746 LMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIK---FKNNGKVD-LEYVNSRMNKYLDN-----AYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFS 974
           +     F  W ++L   YK +IN L F I+G G S E  +PV+SL+SP+PN + E  I+V+D  Y S+L+     NQ+ Y+A K    K +   D ++++ +R+  YLD      A+    +     L TAR  +P ++  Y+ I + ++ + L+++ +YL  LLIK +++KN+   ++ +A G ST +  + +SVF    A +S  LG + A+  +G   GI+N +WFI + E++F+
  S:     1 MQTPNNFPNWLNDLPDRYKFSINGLTFAILGIGESVETGYPVLSLQSPLPNTQDEALIFVNDQAYRSILFAVPAANQENYYAFKSTDLKQHTDQDPVQFIANRLEGYLDVPRSDLAFNVKDISKFNYLTTARNYFPDLVQSYLAIVSTVIAIFLIILALYLIILLIKSFIKKNQTEFSIIRAGGFSTTKFIVGMSVFAGIVAIVSSFLGVLFAFLLEGQVKGIINRYWFIALPENSFN 238
>gi|71893801|ref|YP_279247.1| hypothetical protein MHJ_0450 [Mycoplasma hyopneumoniae J] (2660 aa)
Score = 299, Expect = 1.8e-24, Identities = 241/1064 (22%), Positives = 448/1064 (42%)
  Q:   713 LSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFK---NNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTA----RISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTN--DIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNF---LVNVLEVPE-LKAINDSKSYIIQNSSGN----WVL----DSNS--VLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDL--TETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLN---------------------------------FSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYL 1776
           L+   G  + VN  +L  N+K V     +   +  ++ + E+    L   Y +    L +II+G+  S +  +PV+  ++   + + +   YV+  G++   ++        YF I+ K   N  K   +  +     +  N+   +   N  + L      RI     I    +   I L + L ++ ++  + +IK Y+  N   L + +A G S ++I+ S    G   AF+ G LG++  +F +     +++ FW   I  + F  I  + ++   +    +   + +    R     LLS   E+  +K    +         + KF ISL ++ + + I  +I       ++    +    F+ S   T  N+ Y+Y+ NL +P+++ G        DLG                        K +     + T       ++N N   Y             PS   INS     D E    V++S+  ++  ++ A    + +D V    P  L + I AISN     +  V  +PE +K       Y++ +S  N    W      D N     ++S    +++    D + KF+   Y N Q++  D  I+F  + F + ++ +L   + YTY+D+               G +  T    +IYG    ++  ++++ +++  N+LL++  +      E YP++IN   A K++L IG   ++ I N   RY ++ + K P K  K  I+GIS     + +  SQ  AN++LGL+                                 +S      GSS   V+Q      +G + + + A   + TD     ++ +           ++K+E   L+N    +N    W N SS  D A  T  SFV      N   P   K +   +  YG                +  + L      NI T      N    F  LF     I          ++ +F+ + +II++I++S ++++ ++ +AIL  LGY+++  +     I++P++LIS ++ I  +      FN  I    SI+LS  +   ++        GI+++ FIFV  +L
  S:  1638 LNNASGYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPGTNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILVLFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLSGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFWKSKIVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIKKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLG------------------------KNLYVPAGENT-------EVNYNSPNYFRPGN--------PSVFGINSKNGLVDSESRNPVVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKYLVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNN---RDAYRKFLVDSYLNNQVAK-DFTISFAGIEFSENANENLPKNQVYTYIDSFY-------------GAKNNTESSIKIYGYNPKTEKNSIIEIKDKYNNNLLAEIEKYPIKD-EIYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNK-IKKLPQKKAKFVIIGISDTYINSELITSQAIANKLLGLDQFENILKNYNLSPFNGIILSNPEIEQISKSFSLYSPSGYWAGSSKISVDQLNKDDTIG-FFANIFAFSENETDKTKGALQIAG----------YTKQEILDLIN-FDKKNQEKPWLNSSSALDFASLTNPSFV------NQNIPEIKKALKNFNEIYG--------------ETIYQIGLTGLEAKNIET------NFISNFANLFGAGINI----------VVIIFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2643
>gi|144227641|gb|AAZ44536.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (2651 aa)
Score = 299, Expect = 2.0e-24, Identities = 241/1064 (22%), Positives = 448/1064 (42%)
  Q:   713 LSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFK---NNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTA----RISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTN--DIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNF---LVNVLEVPE-LKAINDSKSYIIQNSSGN----WVL----DSNS--VLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDL--TETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLN---------------------------------FSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYL 1776
           L+   G  + VN  +L  N+K V     +   +  ++ + E+    L   Y +    L +II+G+  S +  +PV+  ++   + + +   YV+  G++   ++        YF I+ K   N  K   +  +     +  N+   +   N  + L      RI     I    +   I L + L ++ ++  + +IK Y+  N   L + +A G S ++I+ S    G   AF+ G LG++  +F +     +++ FW   I  + F  I  + ++   +    +   + +    R     LLS   E+  +K    +         + KF ISL ++ + + I  +I       ++    +    F+ S   T  N+ Y+Y+ NL +P+++ G        DLG                        K +     + T       ++N N   Y             PS   INS     D E    V++S+  ++  ++ A    + +D V    P  L + I AISN     +  V  +PE +K       Y++ +S  N    W      D N     ++S    +++    D + KF+   Y N Q++  D  I+F  + F + ++ +L   + YTY+D+               G +  T    +IYG    ++  ++++ +++  N+LL++  +      E YP++IN   A K++L IG   ++ I N   RY ++ + K P K  K  I+GIS     + +  SQ  AN++LGL+                                 +S      GSS   V+Q      +G + + + A   + TD     ++ +           ++K+E   L+N    +N    W N SS  D A  T  SFV      N   P   K +   +  YG                +  + L      NI T      N    F  LF     I          ++ +F+ + +II++I++S ++++ ++ +AIL  LGY+++  +     I++P++LIS ++ I  +      FN  I    SI+LS  +   ++        GI+++ FIFV  +L
  S:  1629 LNNASGYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPGTNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILVLFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLSGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFWKSKIVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIKKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLG------------------------KNLYVPAGENT-------EVNYNSPNYFRPGN--------PSVFGINSKNGLVDSESRNPVVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKYLVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNN---RDAYRKFLVDSYLNNQVAK-DFTISFAGIEFSENANENLPKNQVYTYIDSFY-------------GAKNNTESSIKIYGYNPKTEKNSIIEIKDKYNNNLLAEIEKYPIKD-EIYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNK-IKKLPQKKAKFVIIGISDTYINSELITSQAIANKLLGLDQFENILKNYNLSPFNGIILSNPEIEQISKSFSLYSPSGYWAGSSKISVDQLNKDDTIG-FFANIFAFSENETDKTKGALQIAG----------YTKQEILDLIN-FDKKNQEKPWLNSSSALDFASLTNPSFV------NQNIPEIKKALKNFNEIYG--------------ETIYQIGLTGLEAKNIET------NFISNFANLFGAGINI----------VVIIFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2634
>gi|72080785|ref|YP_287843.1| hypothetical protein MHP7448_0453 [Mycoplasma hyopneumoniae 7448] (2666 aa)
Score = 297, Expect = 3.4e-24, Identities = 239/1064 (22%), Positives = 457/1064 (42%)
  Q:   713 LSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFK---NNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTA----RISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTN--DIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNF---LVNVLEVPE-LKAINDSKSYIIQNSSGN----WVL----DSNS--VLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDL--TETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFND-----AAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQS----------NIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYL 1776
           L+   G  + VN  +L  N+K V     +   +  ++ + E+    L   Y +    L +II+G+  S +  +PV+  ++   + + +   YV+  G++   ++        YF I+ K   N  K   +  +     +  N+   +   N  + L      RI     I    +   I L + L ++ ++  + +IK Y+  N   L + +A G S ++I+ S    G   AF+ G LG++  +F +     +++ FW   I  + F  I  + ++   +    +   + +    R     LLS   E+  +K    +         + KF ISL ++ + + I  +I       ++    +    F+ S   T  N+ Y+Y+ NL +P+++ G        DLG                        K +     + T       ++N N   Y             PS   INS     D +    V++S+  ++  ++ A    + +D V    P  L + I AISN     +  V  +PE +K       Y++ +S  N    W      D N     ++S    +++    D + KF+   Y N Q+S  D  I+F  + F + ++ +L   + YTY+D+               G +  T    +IYG    ++  ++++ +++  N+LL++  +      E YP++IN   A K++L IG   ++ I N   RY ++ + K P K  K  I+GIS     + +  SQ  AN++LGL+  Q   I+ + N           L  ++  +L+ P          I KS+   Y P    +    + + V+ L  ++T G + N  +F++        A  ++    + +L+L+     K   E       S  D  SL+     N  I  ++  L++           IG   + A N    F + F         ++VI      +F+ + +II++I++S ++++ ++ +AIL  LGY+++  +     I++P++LIS ++ I  +      FN  I    SI+LS  +   ++        GI+++ FIFV  +L
  S:  1644 LNNASGYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPGTNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILVLFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLAGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFWKSKIVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIRKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLG------------------------KNLYVPAGENT-------EVNYNSPNYFRPGN--------PSVFGINSKNGLVDSKSRNPVVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKYLVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNN---RDAYRKFLVDSYLNNQVSK-DFTISFAGIEFSENANENLPKNQVYTYIDSFY-------------GAKNNTESSIKIYGYNPKTEKNSIIEIKDKYNNNLLAEIEKYPIKD-EIYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNK-IKKLPQKKAKFVIIGISDTYINSELITSQAIANKLLGLD--QFENILKNYN-----------LSPFNGIILSNPEIEQ------ISKSFSL-YSPSG--YWAGSSKISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLIN--FDKKNQEKPWLNSASALDFASLTNPSFVNQNIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINIVVI------IFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2649
>gi|144575465|gb|AAZ53820.2| ABC transporter permease protein [Mycoplasma hyopneumoniae 7448] (2651 aa)
Score = 295, Expect = 5.3e-24, Identities = 239/1064 (22%), Positives = 457/1064 (42%)
  Q:   713 LSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFK---NNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTA----RISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTN--DIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNF---LVNVLEVPE-LKAINDSKSYIIQNSSGN----WVL----DSNS--VLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDL--TETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFND-----AAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQS----------NIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYL 1776
           L+   G  + VN  +L  N+K V     +   +  ++ + E+    L   Y +    L +II+G+  S +  +PV+  ++   + + +   YV+  G++   ++        YF I+ K   N  K   +  +     +  N+   +   N  + L      RI     I    +   I L + L ++ ++  + +IK Y+  N   L + +A G S ++I+ S    G   AF+ G LG++  +F +     +++ FW   I  + F  I  + ++   +    +   + +    R     LLS   E+  +K    +         + KF ISL ++ + + I  +I       ++    +    F+ S   T  N+ Y+Y+ NL +P+++ G        DLG                        K +     + T       ++N N   Y             PS   INS     D +    V++S+  ++  ++ A    + +D V    P  L + I AISN     +  V  +PE +K       Y++ +S  N    W      D N     ++S    +++    D + KF+   Y N Q+S  D  I+F  + F + ++ +L   + YTY+D+               G +  T    +IYG    ++  ++++ +++  N+LL++  +      E YP++IN   A K++L IG   ++ I N   RY ++ + K P K  K  I+GIS     + +  SQ  AN++LGL+  Q   I+ + N           L  ++  +L+ P          I KS+   Y P    +    + + V+ L  ++T G + N  +F++        A  ++    + +L+L+     K   E       S  D  SL+     N  I  ++  L++           IG   + A N    F + F         ++VI      +F+ + +II++I++S ++++ ++ +AIL  LGY+++  +     I++P++LIS ++ I  +      FN  I    SI+LS  +   ++        GI+++ FIFV  +L
  S:  1629 LNNASGYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPGTNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILVLFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLAGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFWKSKIVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIRKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLG------------------------KNLYVPAGENT-------EVNYNSPNYFRPGN--------PSVFGINSKNGLVDSKSRNPVVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKYLVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNN---RDAYRKFLVDSYLNNQVSK-DFTISFAGIEFSENANENLPKNQVYTYIDSFY-------------GAKNNTESSIKIYGYNPKTEKNSIIEIKDKYNNNLLAEIEKYPIKD-EIYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNK-IKKLPQKKAKFVIIGISDTYINSELITSQAIANKLLGLD--QFENILKNYN-----------LSPFNGIILSNPEIEQ------ISKSFSL-YSPSG--YWAGSSKISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLIN--FDKKNQEKPWLNSASALDFASLTNPSFVNQNIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINIVVI------IFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2634
>gi|54020519|ref|YP_115962.1| hypothetical protein mhp452 [Mycoplasma hyopneumoniae 232] >gi|53987692|gb|AAV27893.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (2651 aa)
Score = 293, Expect = 1.1e-23, Identities = 236/1064 (22%), Positives = 462/1064 (43%)
  Q:   713 LSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNN------TNLLTARISYPRVIAGYVNIFA---IILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTN--DIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNF---LVNVLEVPE-LKAINDSKSYIIQNSSGN----WVL----DSNS--VLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDL--TETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFND-----AAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQS----------NIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYL 1776
           L+   G  + VN  +L  N+K V     +   +  ++ + E+    L   Y +    L +II+G+  S +  +PV+  ++   + + +   YV+  G++   ++        YF I+ K     + E   + ++ ++   + S++ ++        +L   R    +V    +  F+   I L + L ++ ++  + +IK Y+  N   L + +A G S ++I+ S    G   AF+ G LG++  +F +     +++ FW   I  + F  I  + ++   +    +   + +    R     LLS   E+  +K    +         + KF ISL ++ + + I  +I       ++    +    F+ S   T  N+ Y+Y+ NL +P+++ G        DLG                        K +     + T       ++N N   Y             PS   INS     D +    V++S+  ++  ++ A    + +D V    P  L + I A SN     +  V  +PE +K       Y++ +S  N    W      D N     ++S    +++    D + KF+   Y N Q+S  D  I+F  + F + ++ +L   + YTY+D+               G +  T    +IYG    ++  ++++ +++  N+LL++  +      E YP++IN   A K++L IG   ++ I N   RY ++ + K P K  K  I+GIS     + +  SQ  AN++LGL+  Q   I+ + N           L  ++  +L+ P          I KS+   Y P    +    + + V+ L  ++T G + N  +F++        A  ++    + +L+L+     K   E       S  D  SL+     N  I  ++  L++           IG   + A N    F + F         ++VI      +F+ + +II++I++S ++++ ++ +AIL  LGY+++  +     I++P++LIS ++ I  +      FN  I    SI+LS  +   ++        GI+++ FIFV  +L
  S:  1629 LNNASGYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPG--TNREKFRADIDSFIGKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILVLFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLAGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFWKSKIVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIKKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLG------------------------KNLYVPAGENT-------EVNYNSPNYFRPGN--------PSVFGINSKNGLVDSKTRNPVVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFATSNKVVHQIEKVQNIPEKIKQKQPYFKYLVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNN---RDAYRKFLVDSYLNNQVSK-DFTISFAGIEFSENANENLPKNQVYTYIDSFY-------------GAKNNTESSIKIYGYNPKTEKNSIIEIKDKYNNNLLAEIEKYPIKD-EIYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNK-IKKLPQKKAKFVIIGISDTYINSELITSQAIANKLLGLD--QFENILKNYN-----------LSPFNGIILSNPEIEQ------ISKSFSL-YSPSG--YWAGSSKISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLIN--FDKKNQEKPWLNSASALDFASLTNPSFVNQNIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINIVVI------IFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2634
>gi|15829245|ref|NP_326605.1| ABC transporter permease [Mycoplasma pulmonis UAB CTIP] >gi|14090189|emb|CAC13947.1| ABC TRANSPORTER PERMEASE PROTEIN [Mycoplasma pulmonis] (2599 aa)
Score = 285, Expect = 8.0e-23, Identities = 99/428 (23%), Positives = 198/428 (46%)
  Q:   673 NSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIV-VNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWK-SNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFK-NNGKVDLEYVNSRMNKYLDNA------YLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSG 1100
           NS   +     +F  N +  +Y F+    +T    L   ++     + +V VN  +L  N K++     +   +  N++ F E+   N   ++ + +N   FII+G+ T+ +  +PVV   +   N   +  +YV+  G+  +   +   N   Y  +K +    ++  + + S +++  D +      YL++ +       + R++ PR+I   V+ F   +I++L+ +       ++  Y++   + + +  + G S  QISLS++VF +  A   G+ GYVV    QG+ + + +NFW +      FS + L+ A+   +L   +  ++  +   R    +L+S    +KV      I          TKF  SL ++   + +      +   +II  G +I + F  S +ST  N+ YS++ NL TP+ + G
  S:  1527 NSRKKNDEQELVFGINFKKTIYEFID--AVTYPHTLDNVVVFNDVASYLVKVNQAYLVKNNKTI-----YTGEIPTNNKLFNEFLLKNKDESWMLNVNGSQFIIVGTDTTSDYLYPVVDENNLQVNTSQQAIVYVNQKGFERVKTFSESPNIKEYILVKAEPKKERLLADQIESYISQQTDQSVGIKKTYLNNEIDPINPERSIRVATPRLIISSVSNFNFYIIIILITLVAISIIFIVHRYIKNKSLVIGILISQGYSPLQISLSMTVFAMFTAVFGGVFGYVVGNNLQGLLMNVFSNFWTLERHTEKFSIVSLMVAVFLPFLGMSILIILTSLWILRKKPIDLMSGITAIKVGSFSRRINRLFSKRNVKTKFSASLLVNSFFKLLSLAFAITITSTIIMFGISINKVFSKSIDSTYKNRHYSFKLNLATPTLEGG 1956
Score = 162, Expect = 1.4e-08, Identities = 38/113 (33%), Positives = 64/113 (56%)
  Q:  1361 IYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLN 1473
           IYG K DSK++ ++D+ + +L   +++    + DG + YPVV+N  ++ KY L IG +F + I N  TRY+ ++  +N    +  ++VGI+          SQE  N+I  LN
  S:  2219 IYGYKSDSKFIKIIDENDVDLMQEIAKFETKTIDGKKVYPVVVNTVSSKKYKLGIGSTFGVSILNKATRYSHQIKQENFDNNVIFEVVGINPTFINEEFITSQEIVNEITDLN 2331
Score = 122, Expect = 7.0e-04, Identities = 28/91 (30%), Positives = 53/91 (58%)
  Q:  1688 KLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKK 1778
           K +AI   LGY+++E L+    IFVP ++ ++++  + + ++   FNF + NAASI L  ++ +   L   +A+A I+ +  IF  + + K
  S:  2499 KNIAIFAILGYNNKERLILFFSIFVPFIIFAILLSSVFVLAIIFTFNFFLINAASIALPLSLKFWHMLVTFLAVAAIISVTSIFSWIGINK 2589
>gi|188568885|ref|ZP_03005600.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 2] (2263 aa)
Score = 250, Expect = 8.8e-19, Identities = 115/462 (24%), Positives = 212/462 (45%)
  Q:   671 YVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSN-LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVN-------SRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIG-SLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQI 1132
           YV++    +N     N N+   V N+          +L    L  PY    V+ND+    N + +       K +   ++++  W +  +S   KV IN   F IIG+  S E  FP ++    + N +    +YV+D G+  L    + V    Y+ +K   N    L+  N         ++    N Y  +   N   +   R  +   +   V   A+ LIV+++++GIY  +  IK  + KN++ L   +A G++ WQ  LS + F    + I  I+GY VAY  Q + + + +++W IPI E  F ++G I AI  +L L     C   +    + P  E +      K+NK +   K+  +   A+   + +  ++ L R ++ +++ S+   I ++ +     F  S + T + ++Y Y  +L +P+EQ G Y   ++ ++G+ +E   +  I +N   E +I
  S:   811 YVSTSYIKANQKTAKNTNSYKEVGNYE--------DFLEA--LKLPYR---VINDE---PNYREITLADGSKKRI---AKDYYSWINYVVSPANKVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVNTNNFNLLQKNNVYNQIKSELLSAKKGNIYKKTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMLGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQ-FVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQNVKIEVKI 1261
Score = 176, Expect = 3.7e-10, Identities = 142/619 (22%), Positives = 279/619 (45%)
  Q:  1168 KYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAG----IYINAWDFVSNAFPTDLISR--------INAISNNFLVNVLE---------VPEL-------------------KAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDS--KYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLL-LENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGT----PSIVAINS---FEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           K  +N   PS  +      +I  F + ++SK  +D +ISV      I  N W F     P   I+R        ++    NF   +++         VP                     K+ ND  ++ ++  +G W ++    +    +    +  F  EFL+ I  +Y  K    L  K     V   D  +    + YTYL   L     +     N+ K    N E+  +   + S    ++L++D+  NL  L+   +  +    E + ++IN+  A KY L I + F+ +INN   R +++  N   V   K K+VGI+       + I+Q+ AN+++G +             D  +++                    +N + +I+         FNG F+KE++P+  N++    + SGL    S   D+    L+  +G  +V N+   +      +L+     ++ DK  +S    + + +  L   +    G     PS  A+++    E F ++ D      +T   +   +I   +P ++III++V+S + ++ R+L+AI+K LG  D +N+ + + I+  V L+++++   +   +   +   IF A +I L  +I W  ++     +  +++  ++ +    KK NL  +++
  S:  1654 KMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVK-INGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAGLKFVNIEDEKTQ---QPYTYL---LGQMQTKTKKFGNEIKILGINYEKNKFIDDKPSPTTQLSLINDQGVNLIDLIKDDNVNN----EVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD-------------DYRERM------------------QVENGHPIIEAR------EFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMSKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLVLLFAWLQMLYKTKKLNLPKALN 2259
>gi|188518370|ref|ZP_03003877.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188530636|ref|ZP_03004983.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188998162|gb|EDU67259.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (2263 aa)
Score = 247, Expect = 2.2e-18, Identities = 114/462 (24%), Positives = 211/462 (45%)
  Q:   671 YVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSN-LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVN-------SRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIG-SLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQI 1132
           YV++    +N     N N+   V N+          +L    L  PY    V+ND+    N + +       K +   ++++  W +  +S   KV IN   F IIG+  S E  FP ++    + N +    +YV+D G+  L    + V    Y+ +K   N    L+  N         ++    N Y  +   N   +   R  +   +   V   A+ LIV+++++GIY  +  IK  + KN++     +A G++ WQ  LS + F    + I  I+GY VAY  Q + + + +++W IPI E  F ++G I AI  +L L     C   +    + P  E +      K+NK +   K+  +   A+   + +  ++ L R ++ +++ S+   I ++ +     F  S + T + ++Y Y  +L +P+EQ G Y   ++ ++G+ +E   +  I +N   E +I
  S:   811 YVSTSYIKANQKTAKNTNSYKEVGNYE--------DFLEA--LKLPYR---VINDE---PNYREITLADGSKKRI---AKDYYSWINYVVSPANKVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVNTNNFNLLQKNNVYNQIKSELLSAKKGNIYKKTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMFGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQ-FVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQNVKIEVKI 1261
Score = 176, Expect = 3.7e-10, Identities = 142/619 (22%), Positives = 279/619 (45%)
  Q:  1168 KYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAG----IYINAWDFVSNAFPTDLISR--------INAISNNFLVNVLE---------VPEL-------------------KAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDS--KYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLL-LENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGT----PSIVAINS---FEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           K  +N   PS  +      +I  F + ++SK  +D +ISV      I  N W F     P   I+R        ++    NF   +++         VP                     K+ ND  ++ ++  +G W ++    +    +    +  F  EFL+ I  +Y  K    L  K     V   D  +    + YTYL   L     +     N+ K    N E+  +   + S    ++L++D+  NL  L+   +  +    E + ++IN+  A KY L I + F+ +INN   R +++  N   V   K K+VGI+       + I+Q+ AN+++G +             D  +++                    +N + +I+         FNG F+KE++P+  N++    + SGL    S   D+    L+  +G  +V N+   +      +L+     ++ DK  +S    + + +  L   +    G     PS  A+++    E F ++ D      +T   +   +I   +P ++III++V+S + ++ R+L+AI+K LG  D +N+ + + I+  V L+++++   +   +   +   IF A +I L  +I W  ++     +  +++  ++ +    KK NL  +++
  S:  1654 KMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVK-INGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAGLKFVNIEDEKTQ---QPYTYL---LGQMQTKTKKFGNEIKILGINYEKNKFIDDKPSPTTQLSLINDQGVNLIDLIKDDNVNN----EVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD-------------DYRERM------------------QVENGHPIIEAR------EFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMSKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLVLLFAWLQMLYKTKKLNLPKALN 2259
>gi|188039204|ref|ZP_02998014.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 8] (2263 aa)
Score = 247, Expect = 2.2e-18, Identities = 114/462 (24%), Positives = 211/462 (45%)
  Q:   671 YVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSN-LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVN-------SRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIG-SLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQI 1132
           YV++    +N     N N+   V N+          +L    L  PY    V+ND+    N + +       K +   ++++  W +  +S   KV IN   F IIG+  S E  FP ++    + N +    +YV+D G+  L    + V    Y+ +K   N    L+  N         ++    N Y  +   N   +   R  +   +   V   A+ LIV+++++GIY  +  IK  + KN++     +A G++ WQ  LS + F    + I  I+GY VAY  Q + + + +++W IPI E  F ++G I AI  +L L     C   +    + P  E +      K+NK +   K+  +   A+   + +  ++ L R ++ +++ S+   I ++ +     F  S + T + ++Y Y  +L +P+EQ G Y   ++ ++G+ +E   +  I +N   E +I
  S:   811 YVSTSYIKANQKTAKNTNSYKEVGNYE--------DFLEA--LKLPYR---VINDE---PNYREITLADGSKKRI---AKDYYSWINYVVSPANKVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVNTNNFNLLQKNNVYNQIKSELLSAKKGNIYKKTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMFGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQ-FVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQNVKIEVKI 1261
Score = 176, Expect = 3.6e-10, Identities = 142/619 (22%), Positives = 279/619 (45%)
  Q:  1168 KYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAG----IYINAWDFVSNAFPTDLISR--------INAISNNFLVNVLE---------VPEL-------------------KAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDS--KYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLL-LENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGT----PSIVAINS---FEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           K  +N   PS  +      +I  F + ++SK  +D +ISV      I  N W F     P   I+R        ++    NF   +++         VP                     K+ ND  ++ ++  +G W ++    +    +    +  F  EFL+ I  +Y  K    L  K     V   D  +    + YTYL   L     +     N+ K    N E+  +   + S    ++L++D+  NL  L+   +  +    E + ++IN+  A KY L I + F+ +INN   R +++  N   V   K K+VGI+       + I+Q+ AN+++G +             D  +++                    +N + +I+         FNG F+KE++P+  N++    + SGL    S   D+    L+  +G  +V N+   +      +L+     ++ DK  +S    + + +  L   +    G     PS  A+++    E F ++ D      +T   +   +I   +P ++III++V+S + ++ R+L+AI+K LG  D +N+ + + I+  V L+++++   +   +   +   IF A +I L  +I W  ++     +  +++  ++ +    KK NL  +++
  S:  1654 KMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVK-INGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAGLKFVNIEDEKTQ---QPYTYL---LGQMQTKTKKFGNEIKILGINYEKNKFIDDKPSPTTQLSLINDQGVNLIDLIKDDNVNN----EVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD-------------DYRERM------------------QVENGHPIIEAR------EFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMNKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLVLLFAWLQMLYKTKKLNLPKALN 2259
>gi|188592701|ref|ZP_03005990.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 10] (2263 aa)
Score = 247, Expect = 2.2e-18, Identities = 114/462 (24%), Positives = 211/462 (45%)
  Q:   671 YVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSN-LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVN-------SRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIG-SLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQI 1132
           YV++    +N     N N+   V N+          +L    L  PY    V+ND+    N + +       K +   ++++  W +  +S   KV IN   F IIG+  S E  FP ++    + N +    +YV+D G+  L    + V    Y+ +K   N    L+  N         ++    N Y  +   N   +   R  +   +   V   A+ LIV+++++GIY  +  IK  + KN++     +A G++ WQ  LS + F    + I  I+GY VAY  Q + + + +++W IPI E  F ++G I AI  +L L     C   +    + P  E +      K+NK +   K+  +   A+   + +  ++ L R ++ +++ S+   I ++ +     F  S + T + ++Y Y  +L +P+EQ G Y   ++ ++G+ +E   +  I +N   E +I
  S:   811 YVSTSYIKANQKTAKNTNSYKEVGNYE--------DFLEA--LKLPYR---VINDE---PNYREITLADGSKKRI---AKDYYSWINYVVSPANKVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVNTNNFNLLQKNNVYNQIKSELLSAKKGNIYKKTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMFGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQ-FVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQNVKIEVKI 1261
Score = 176, Expect = 3.8e-10, Identities = 142/619 (22%), Positives = 279/619 (45%)
  Q:  1168 KYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAG----IYINAWDFVSNAFPTDLISR--------INAISNNFLVNVLE---------VPEL-------------------KAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDS--KYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLL-LENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGT----PSIVAINS---FEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           K  +N   PS  +      +I  F + ++SK  +D +ISV      I  N W F     P   I+R        ++    NF   +++         VP                     K+ ND  ++ ++  +G W ++    +    +    +  F  EFL+ I  +Y  K    L  K     V   D  +    + YTYL   L     +     N+ K    N E+  +   + S    ++L++D+  NL  L+   +  +    E + ++IN+  A KY L I + F+ +INN   R +++  N   V   K K+VGI+       + I+Q+ AN+++G +             D  +++                    +N + +I+         FNG F+KE++P+  N++    + SGL    S   D+    L+  +G  +V N+   +      +L+     ++ DK  +S    + + +  L   +    G     PS  A+++    E F ++ D      +T   +   +I   +P ++III++V+S + ++ R+L+AI+K LG  D +N+ + + I+  V L+++++   +   +   +   IF A +I L  +I W  ++     +  +++  ++ +    KK NL  +++
  S:  1654 KMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVK-INGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAGLKFVNIEDEKTQ---QPYTYL---LGQMQTKTKKFGNEIKILGINYEKNKFIDDKPSPTTQLSLINDQGVNLIDLIKDDNVNN----EVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD-------------DYRERM------------------QVENGHPIIEAR------EFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMSKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLVLLFAWLQMLYKTKKLNLPKALN 2259
>gi|13358107|ref|NP_078381.1| hypothetical protein UU543 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|11356824|pir||B82877 conserved hypothetical UU543 [imported] - Ureaplasma urealyticum >gi|6899548|gb|AAF30956.1|AE002153_4 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (1413 aa)
Score = 244, Expect = 5.2e-18, Identities = 90/377 (23%), Positives = 184/377 (48%)
  Q:   749 SREFEEWKSN-LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNN-------GKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIG-SLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYEN 1125
           ++++  W +  +S   K+ IN   F IIG+  S E  FP ++    + N +    +YV+D G+  L   ++ V    Y+ +K   N         V  E  +  ++    N Y  +   N   +   R  +   +   +   A+ LIV+++++GIY  +  IK  + KN++     +A G+S WQ+  S + F    + I  I+GY ++Y  Q + + + +++W IPI +  F ++G I AI  +L L     C + +    ++   E +      K+NK +   K+  +   A+   + +  ++ L R ++ +++ S+   I ++ +     F  S + T + ++Y Y  +L +P+EQ G Y   ++ ++G+++E   +  I +N
  S:    20 AKDYYSWINYVVSPANKIEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTISASVPILEYYTLKVNTNDLNLLQKNNVYNEIKSELLDSKKGNIYKRTDKDNPYPIYVKRTFFLTQLRNLIIAIALSLIVLILLLGIYFVTSSIKNMINKNKVMFGAMQAQGVSRWQVWFSFAPFYTIPSLIVLIIGYSISYEIQPLIMRLFSSYWLIPIPDQ-FVSVGWIFAIPIALTLILGFICWVLIYYILKHSTAETMKGDAGFKINKFIIKTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYQYAVDLYSPTEQGGFYYISKFDEMGVSNEYAPLKQIVKN 404
Score = 165, Expect = 7.3e-09, Identities = 146/619 (23%), Positives = 270/619 (43%)
  Q:  1168 KYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAG----IYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAIND---SKSYIIQNSSGNWVL-----------------DSNSVLDLSN-----------VANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQ--IYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLL-LENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGT----PSIVAINS---FEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYL--YGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           K  +N   PS  +      +I  F + ++SK  +D +ISV      I  N W F     P   I+R      + L    +    + IN    +K Y + N   N ++                 D N+     N           +    +  F  EFL+ I  +Y  K    L  K     V   D     + + YTYL   L     +     N+ K    N E+   I G    +  ++L++D+  NL  L+      +         V+ Q    KY L+I + F+  INN   R +++  N       K K+VGI+       + I+Q+ AN+++G +             D  +++                    +N Y +I++        FNG F+KE+ P+  N++    + +GL    S   D+    L+  +G  +V ++   +      +L+     ++ DK  ++    + + +  L   +    G     PS  A+++    E F ++ D   T F  LL I    I   +P ++III++V+S + ++ R+L+AI+K LG  D  N+ + + I+  V L+++++   +   +   +   IF A +I L  +I W  ++  YG + I  +++  ++ +    KK NL  +++
  S:   804 KMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKTFGYEIINGKKINKLYDVPNFEDNGIIHQISLWTKNGLPPKSENDENAFFIKQNGQWKINEKPGVLTEQGAAEFLPEFLRLITQMYTFKTTRYLQYKAGLKFVNIED---EKVQQPYTYL---LGKMQTKTKRFANEIKILGINYEKNKFINGKPSPTTQLSLINDQGVNLIDLIKNDDPNNEIHNIIINKVVAQ----KYHLKINDVFEYQINNHIKRLSNKFNNTPENYKTKFKVVGINDSLMDEQLIINQKVANKLIGFD-------------DYRRRI------------------QIENGYPIIEER------EFNGFFTKEKEPIFFNNMASFYSPTGL----SPAIDSWPQNLLENIG-GNVQSINIYWIFYYSWDLANSILNASFDKNKITWEPFSEINLDKLLKKIGKIFGKEANLPSFKAVDANIENEIFASVVD--KTSFTLLLNI----ITAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFRNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVISYGFVGI--VLLFAWLQMLYKTKKLNLPKALN 1409
>gi|170761857|ref|YP_001752627.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|168827434|gb|ACA32696.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] (2263 aa)
Score = 238, Expect = 2.0e-17, Identities = 90/377 (23%), Positives = 184/377 (48%)
  Q:   749 SREFEEWKSN-LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNN-------GKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIG-SLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYEN 1125
           ++++  W +  +S   K+ IN   F IIG+  S E  FP ++    + N +    +YV+D G+  L   ++ V    Y+ +K   N         V  E  +  ++    N Y  +   N   +   R  +   +   +   A+ LIV+++++GIY  +  IK  + KN++     +A G+S WQ+  S + F    + I  I+GY ++Y  Q + + + +++W IPI +  F ++G I AI  +L L     C + +    ++   E +      K+NK +   K+  +   A+   + +  ++ L R ++ +++ S+   I ++ +     F  S + T + ++Y Y  +L +P+EQ G Y   ++ ++G+++E   +  I +N
  S:   870 AKDYYSWINYVVSPANKIEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTISASVPILEYYTLKVNTNDLNLLQKNNVYNEIKSELLDSKKGNIYKRTDKDNPYPIYVKRTFFLTQLRNLIIAIALSLIVLILLLGIYFVTSSIKNMINKNKVMFGAMQAQGVSRWQVWFSFAPFYTIPSLIVLIIGYSISYEIQPLIMRLFSSYWLIPIPDQ-FVSVGWIFAIPIALTLILGFICWVLIYYILKHSTAETMKGDAGFKINKFIIKTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYQYAVDLYSPTEQGGFYYISKFDEMGVSNEYAPLKQIVKN 1254
Score = 154, Expect = 1.2e-07, Identities = 145/619 (23%), Positives = 268/619 (43%)
  Q:  1168 KYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAG----IYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAIND---SKSYIIQNSSGNWVL-----------------DSNSVLDLSN-----------VANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQ--IYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLL-LENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGT----PSIVAINS---FEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYL--YGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
           K  +N   PS  +      +I  F + ++SK  +D +ISV      I  N W F     P   I+R      + L    +    + IN    +K Y + N   N ++                 D N+     N           +    +  F  EFL+ I  +Y  K    L  K     V   D     + + YTYL   L     +     N+ K    N E+   I G    +  ++L++D+  NL  L+      +         V+ Q    KY L+I + F+  INN   R +++  N       K K+VGI+       + I+Q+ AN+++G +             D  +++                    +N Y +I++        FNG F+KE+ P+  N++    + +GL    S   D+    L+  +G  +V ++   +      +L+     ++ DK  ++    + + +  L   +    G     PS  A+++    E F ++ D   T F  LL I T +I   V +II++    +S + ++ R+L+AI+K LG  D  N+ + + I+  V L+++++   +   +   +   IF A +I L  +I W  ++  YG + I  +++  ++ +    KK NL  +++
  S:  1654 KMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKTFGYEIINGKKINKLYDVPNFEDNGIIHQISLWTKNGLPPKSENDENAFFIKQNGQWKINEKPGVLTEQGAAEFLPEFLRLITQMYTFKTTRYLQYKAGLKFVNIED---EKVQQPYTYL---LGKMQTKTKRFANEIKILGINYEKNKFINGKPSPTTQLSLINDQGVNLIDLIKNDDPNNEIHNIIINKVVAQ----KYHLKINDVFEYQINNHIKRLSNKFNNTPENYKTKFKVVGINDSLMDEQLIINQKVANKLIGFD-------------DYRRRI------------------QIENGYPIIEER------EFNGFFTKEKEPIFFNNMASFYSPTGL----SPAIDSWPQNLLENIG-GNVQSINIYWIFYYSWDLANSILNASFDKNKITWEPFSEINLDKLLKKIGKIFGKEANLPSFKAVDANIENEIFASVVD--KTSFTLLLNIITAIIPSLVIIIILV----ASTLANESRRLIAIMKVLGMRDFRNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVISYGFVGI--VLLFAWLQMLYKTKKLNLPKALN 2259
>gi|148378006|ref|YP_001256882.1| ABC transporter permease protein [Mycoplasma agalactiae PG2] >gi|148292052|emb|CAL59444.1| ABC transporter permease protein [Mycoplasma agalactiae PG2] (2723 aa)
Score = 202, Expect = 3.6e-13, Identities = 87/388 (22%), Positives = 179/388 (46%)
  Q:   723 VNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLL--YTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNL---LTARISYPRVIAGYVNIF--AIILIVVLMVIGIYLSSL-LIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKL-LYLIKSRKIPLFALTKFRISLSLS---KLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQS---GLYKYQEYTDL 1110
           VN  +LS N K++     +N  L  N+ E E   + +   Y + +N + F+I+G  T+ +  +PV+       N + +  +Y+++ G++ ++  Y  + V +++      KN+ +V    + + ++  + +A     + +   L      R      I G +N+   +II ++ L +I + ++ + +I+ Y+        +  A G    +I++SL  F +  + I GILGY + +  Q +   + +N+W +P     F    L   +   +L   L  ++  + + R    +L++  ++    KL   + K          +F  +L+ S   KL  F   V+L S        G A  + F  + N T  N+ Y ++ +L++P+ +     LY   E  DL
  S:  1664 VNYAYLSKNNKAI-----YNGELPRNNVEMESLLNTIDDKYILDVNGIKFLIVGEDTTVDYIYPVIDENHLQVNTQNQALVYLNNYGFSRIMAAYQGNVVKKNLLVVNGSKNSNEVVKRNITNIVDSSISDANKLKRVFSYDELDPINPERALRITTIEGMINVILSSIIALMSLFIIMVSVAIIFIIRRYIANKAKVFGILLAQGYRPIEIAISLLPFAMVTSLIGGILGYSIGFRTQILLQNVFSNYWTLPKSAIPFDFFSLFFNVFIPFLGMSLLIIVVALISLRKSSIDLITGVDDAPRGKLFNKIKKKFINKKNVKKRFSFTLAYSGFWKLASFGGSVLLTSIA---TMFGLANYKTFNNTINDTYKNRDYRFKIDLESPTTEGKYYSLYNPSELKDL 2058
>gi|66880420|ref|ZP_00405401.1| COG0577: ABC-type antimicrobial peptide transport system, permease component [Mycoplasma genitalium G-37] (118 aa)
Score = 156, Expect = 7.1e-08, Identities = 26/101 (25%), Positives = 61/101 (60%)
  Q:  1659 IETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVI 1759
           ++  L+   +P I I  +++   M+ + +++   LK +GY D +NL+S+L  F+P  +++L++ I V+A +      ++FN A ++L+   +++ Y+ G++
  S:     4 VDAFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKAIGYRDVQNLISLLTFFIPAFVLALLISIGVLAGVLIGIQAVVFNVAQVFLTNVFEFLPYMVGIV 104
>gi|42561240|ref|NP_975691.1| permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492738|emb|CAE77333.1| Predicted permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1384 aa)
Score = 146, Expect = 1.0e-06, Identities = 65/255 (25%), Positives = 132/255 (51%)
  Q:   772 FIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGY---------------NSLLYTNSEVNQDIYFAIKFKNNGKVDLE-------YVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAF-LLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKS 1026
           + ++G   S +  FP ++  SPIPN   EG IYVD + +               +S L  +S    + ++++K   N K+  E       Y +  +NK   + ++   L++      +R S  +   G  NI++ I+++ ++ + +Y + L+ K  +  +R  +   +A G    Q++L+  +     + + GILGY+++     + +   +N++ +  G  +F  IGL+  +  ++L    +  +IG +   +  IN LL +    K++KL  LIKS
  S:   240 YQVVGFANSADFIFPTINAYSPIPNRLNEGIIYVDPLRFGLIKQTDGFYKYDSTSSKLVVSSNNEWESFYSLK--TNQKLSDETIDWMNQYFSQLINKKAQDKWIYK-LEDPNYRFNSRTSVIKKTIGAYNIYSFIVLLAVISVVLYTTFLITKKQILNSRGQIGTMRAIGYKKRQMALNYVMMPFFTSIVGGILGYILSCLVSIIIINRFSNYFSLDYGVFSFDWIGLLNNLIFMWLIISAISFLIGYLIMKKGAIN-LLENRNVKKISKLGSLIKS 513
Score = 99, Expect = 3.4e-01, Identities = 43/148 (29%), Positives = 77/148 (52%)
  Q:  1628 IGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVI-AIAGIVIINFI--FVSVY 1775
           IG   I  I   +  + + D  + +    LV+  + I +   +  +II++ +S+++SD  + +A LK LGYS++    +IL ++  V+   L++G I   S    F+  I +  SI + P I  +   + VI A+ GI +I  I  F S+Y
  S:  1227 IGQGVIQTITPIQITKQILDQISNLVMLALVLAIITILM---IAFVIILLTTSLIISDNTRFIATLKVLGYSNKYITENILGMYFIVIANMLVIGFI---SGWFIFDSTIKSLYSIIVLPIIFPIWLPFAVILAVGGIYLITLIVGFNSIY 1371
>gi|146319034|ref|YP_001198746.1| peptide ABC transporter permease [Streptococcus suis 05ZYH33] >gi|146321242|ref|YP_001200953.1| peptide ABC transporter permease [Streptococcus suis 98HAH33] >gi|145689840|gb|ABP90346.1| ABC-type antimicrobial peptide transport system, permease component [Streptococcus suis 05ZYH33] >gi|145692048|gb|ABP92553.1| ABC-type antimicrobial peptide transport system, permease component [Streptococcus suis 98HAH33] (1125 aa)
Score = 139, Expect = 7.0e-06, Identities = 52/194 (26%), Positives = 105/194 (54%)
  Q:  1588 KGVAELSAYYGLSTTDKYSLSVA---MSNNMTILSLQSWLQSNIGTPS-----IVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           + VA++ A + +  TD Y   V     + N  ++ L+     +I T +     + A+ S     +L D  TTI  +L  I T+L+ L + L ++I+  ++ + MS+  + ++ +K LG+ +RE  + I    + + LI ++VG++    L      MI  + SI  +P++    YL  ++AI+GI+ +   +V+ +L+K ++
  S:   917 EAVADMYAGHFIYMTDSYYEQVTGKQKTANAYLVQLKDSQLGHIQTLASQLLAMPAVRSLVQNTSLIDMLTTIAGSLQTIMTILVILSILLGLVILYNLTIINMSERIRELSTIKVLGFHNREVTMYIYRETIALSLIGMLVGLVGGIYLHKLLLAMI-GSDSIRFNPSVGLEVYLIPILAISGILSVLGWYVNHHLRKVDM 1117
>gi|81096560|ref|ZP_00874900.1| Protein of unknown function DUF214 [Streptococcus suis 89/1591] >gi|80977382|gb|EAP40925.1| Protein of unknown function DUF214 [Streptococcus suis 89/1591] (1121 aa)
Score = 135, Expect = 2.2e-05, Identities = 51/194 (26%), Positives = 105/194 (54%)
  Q:  1588 KGVAELSAYYGLSTTDKYSLSVA---MSNNMTILSLQSWLQSNIGTPS-----IVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           + VA++ A + +  TD Y   V     + N  ++ L+     +I T +     + A+ S     +L D  TTI  +L  I T+L+ L + L ++I+  ++ + MS+  + ++ +K LG+ ++E  + I    + + LI ++VG++    L      MI  + SI  +P++    YL  ++AI+GI+ +   +V+ +L+K ++
  S:   913 EAVADMYAGHFIYMTDSYYEQVTGKQKTANAYLVQLKDSQLGHIQTLASQLLAMPAVRSLVQNTSLIDMLTTIAGSLQTIMTILVILSILLGLVILYNLTIINMSERIRELSTIKVLGFHNKEVTMYIYRETIVLSLIGMLVGLVGGIYLHKLLLAMI-GSDSIRFNPSVGLEVYLIPILAISGILAVLGWYVNHHLRKVDM 1113
>gi|42560992|ref|NP_975443.1| hypothetical protein MSC_0457 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492489|emb|CAE77085.1| Hypothetical transmembrane protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1754 aa)
Score = 133, Expect = 3.5e-05, Identities = 76/345 (22%), Positives = 145/345 (42%)
  Q:   759 LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQD-------IYFAIKFKNNGKVDL--EYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGY--------VNIF---AIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFAL-TKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYK 1103
           L    ++ ++     I G  T   + FP    + PIP  +    +YV     N +L   S+ N +        +F  K +NN  +DL   Y  + ++K  D+       KN          +   I  +        +N +    +I  +V+ +I I    + I+  +  N   + + KA G S  QIS+S   + I     S  +G++     Q +F+ +  N++ IP+   T     L+ ++    L  ++  ++  +   +  + ++L+  +    +K +  +K          TKF ++L+ S      L V +       I+ G AIP    T +N+   + +Y+  YN       S L K
  S:   502 LKLGQQIIVDGALLTITGFATDAYSFFPTTDPDFPIPQSELGAILYVTRSTINDILGATSQSNTNRVLKGYLSFFLRKKQNNASIDLFNSYQMNDISKLYDSIKYQKDQKNKVTTWLNIKDFDHSIFRFNWTIAPLAINSYKGSTLIAALVVSLIAIIALVICIRKTIYFNAKQIGILKALGSSPIQISISYLAYVIVIILTSVPIGWITGLSTQSVFVKLFVNYFSIPLYSFTIEPFSLLISLLIFGLFGVIVSLLSAIIITKKQLADILAVKQNWSSSKFINRLKRTWFKKAKFTTKFSLTLASSGKKNIFLLVTVVGISTMFISAGLAIPSIAFTIKNTYYKSIKYANEYNYSKGVSNSPLTK 867
>gi|115252760|emb|CAK98196.1| hypothetical abc transporter permease component transmembrane protein [Spiroplasma citri] (1415 aa)
Score = 133, Expect = 3.5e-05, Identities = 83/318 (26%), Positives = 145/318 (45%)
  Q:   771 DFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNS---LLYTNSEVNQDIYFA-IKFKNNGKVDLEYVNSRM--------NKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFR---ISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLS-NKQYSY 1088
           +F +   G    N +P +      P+PKT+G IYV +  Y S      T+ E N  +Y   +    N   D E     +        N    NA L S  ++ T L+  R S       +     I+L ++ ++I I+   +LIK  + + +I   + KANG S   I+ S     I    I   LG+++  F Q   + + N+++ IP+   +FS I      G + L   L  ++  +R       +LL+  + +K +KL+Y I +        TKFR   +++S+ K+  F L   + S  +++ T+      KF     + L+ + +Y Y
  S:   423 NFFVGAIGGDPANIYPTIYDTDVFPDPKTDGIIYVSEKVYRSESIAANTDIEENSTLYINHVGLSENKGTDFENFKKYLAADFWSLNNPSYKNAPLQS--RDETKLVYLRYSLLGTTIIFYRTITIVLCIIFLIILIFTLIILIKKIINQQKIENGILKANGYSGLTIASSYLAHAIVVTGIGVPLGWIIGVFLQLPIMSVFNSYFVIPV-NFSFSLIPFAICFGIIGLVSSLSILVTAIRQLIISPLDLLNPNKNIKTSKLVYSISNVFRFKKFTTKFRFVMMAVSMKKIGWFFLTFFVASLSLTLATLIPTAINKFSKDYYANLNYDNEYEY 753
>gi|188159163|ref|ZP_02998575.1| Predicted permease [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1381 aa)
Score = 133, Expect = 3.8e-05, Identities = 62/255 (24%), Positives = 130/255 (50%)
  Q:   772 FIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGY---------------NSLLYTNSEVNQDIYFAIKFKNNGKVDL-----EYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAF-LLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKS 1026
           + ++G   S +  FP ++  SPIPN   EG IYVD + +               +S L  +S    + ++++K K     ++     +Y +  +NK   + ++   L++      +R S  +      NI++ I+++ ++ + +Y + L+ K  +  +R  +   +A G    Q+ L+  +     + + GILGY+++     + +   +N++ +  G  +F  IGL+  +  ++L    +  +IG +   +  IN LL +    K++KL  LIKS
  S:   237 YQVVGFANSADFIFPTINAYSPIPNRLNEGIIYVDPLRFGLIKQTDGFYKYDSTSSKLVVSSNNEWESFYSLKTKQKLSDEIVDWMNQYFSQLINKKAQDKWIYK-LEDPNYRFNSRTSVIKKTISAYNIYSFIVLLAVISVVLYTTFLITKKQILNSRGQIGTMRAIGYKKRQMVLNYVMMPFFTSIVGGILGYILSCLISIIIINRFSNYFSLDYGVFSFDWIGLLNNLIFMWLIISSISFLIGYLIMKKGAIN-LLENRNAKKISKLGSLIKS 510
Score = 98, Expect = 4.4e-01, Identities = 42/148 (28%), Positives = 78/148 (52%)
  Q:  1628 IGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVI-AIAGIVIINFI--FVSVY 1775
           IG   I  I   +  + + D  + +    LV+  + I +   +  +II++ +S+++SD  + +A LK LGYS++    +IL ++  V+   L++G +   S    F+  I +  SI + P I  +   + VI A++GI +I  I  F S+Y
  S:  1224 IGQGVIQTITPIQITKQILDQISNLVMLALVLAIITILM---IAFVIILLTTSLIISDNTRFIATLKVLGYSNKYITENILGMYFIVIANMLVIGFV---SGWFIFDSTIKSLYSIIVLPIIFPIWLPFAVILAVSGIYLITLIVGFNSIY 1368
>gi|50365077|ref|YP_053502.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] >gi|50363633|gb|AAT75618.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] (1693 aa)
Score = 132, Expect = 4.0e-05, Identities = 83/339 (24%), Positives = 156/339 (46%)
  Q:   765 VTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTA-RISY---PRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVV--RTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKF--RISLSLSKLTRFILFVILCSAGIS--IITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYK 1103
           + + + +F +IG  T   + +PVV+ + PIP PK  G IY       SL       N     A K          + N + +  L N   + + K  T   +  R S+   P+V+  Y ++F II+ +++ VI +    + +K  ++ N   + + KA G+    I+LS     +  A     L + +    Q  F+ +   ++ I + +   S + LI  IG ++  FL   V  +V  R    P+ E+L   E  K +   +++   K  +F+ +KF  + S++L+   R  ++++     I+  ++++G  IP    T++++   N +YS  YN       S L K
  S:   489 LKVGAQNFTVIGYATDTFSYYPVVNDDLPIPQPKNTGIIYASQETLKSLFEDTPSSN-----AEKIAKTYAKRFIWTNEKSDIDLFNYLFAPSQKAKTFAESVYRFSWDLQPQVVLAY-SLFTIIISLIIGVIALSGLLISLKKSIKANTKQIGILKALGVEPHNIALSYIAQSVIIAIFIIPLSWGIGLLVQSGFVHLFIPYFSIQLYQIQVSVLPLI--IGFIFFGFLSVMVSFLVAWRLTNKPVIEILRVEETKKSHS--WILNKMKNTIFSKSKFTLKFSITLASTNRRNIYLMTVVIFITSFLVSIGFTIPATVRTAESAYYKNVEYSNSYNYVENVSNSPLSK 827
>gi|50364971|ref|YP_053396.1| unknown substrate ABC transporter permease [Mesoplasma florum L1] >gi|50363527|gb|AAT75512.1| unknown substrate ABC transporter permease [Mesoplasma florum L1] (1429 aa)
Score = 132, Expect = 5.1e-05, Identities = 72/330 (21%), Positives = 147/330 (44%)
  Q:   772 FIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVD-----------------DIGYNSLLYTNSEVNQDIYFAIKFKNNGKVD---LEYVNSRMNKYL---DNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRF--ILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGL 1101
           F ++G G+S +   P+ +  + +P+   E  IYV+                 ++  N  L  +S V  + +++IKFK+  K     LE   S + + +    N  +    ++++   + RI   +      NI A ++ ++++ + +Y  SL+ K  +EK    L   KA G     +  +  +  + A+ I G+LGY+V+            +++ +   +  F  I L+  IG ++        +      R     L+++T   K +     ++S        +K R +L +    +   I FV+L S+   + TV  A P   + ++ +T +  +Y        PS  + L
  S:   239 FQVVGFGSSADFMSPIFNASTTLPSRNKEVMIYVNPTAFGLKYNQESNLYEYNLNQNGNLTVSSNVEIESFYSIKFKDAKKAKSTGLEQFESDLKELIRRNSNNKIVYGKEDSSYRFSKRILLIQKTIRTYNIAAFVIFILILFVCLYTISLVTKKQIEKASKQLGTLKALGYRKRILVYNFVMLPVIASTIGGLLGYIVSISVSNTLTNEFASYFSLNYSKFDFDWITLVLMIGVMWFILSAISFVIATMLMRKSSLSLITATFNQKASAFKAKLRSIHFRKSFGSKLRKALLVDAFGKMMAIGFVVLLSS--MLFTVSFAAPDILKRNEKATYTGVKYKQIVEYAQPSYNNPL 591
>gi|406356|gb|AAD12431.1| unknown [Mycoplasma genitalium] (116 aa)
Score = 130, Expect = 7.0e-05, Identities = 41/113 (36%), Positives = 59/113 (52%)
  Q:  1451 SSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVN-SLLLENTSGLWGNYSSFND 1563
           S+D+F   +YI+Q  AN +L L+ +QG  I+     DV +K               T   S  +    I    P  YVPFNGVFSKE  P L+N +L+L +  G+WGN++ F +
  S:     1 STDAFGQELYINQHIANNLLKLSGNQGRGII----RDVIKK---------------TNGQSQSSDEYEIDYVKPNGYVPFNGVFSKELKPSLLNKALVLNSIIGVWGNFTDFGN 95
>gi|66880287|ref|ZP_00405270.1| COG0577: ABC-type antimicrobial peptide transport system, permease component [Mycoplasma genitalium G-37] (103 aa)
Score = 130, Expect = 7.3e-05, Identities = 32/102 (31%), Positives = 59/102 (57%)
  Q:   863 NLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFW 964
           NLL AR  +   +   +N+ A+ L + ++ + I +S L++  Y++KN   + + KANG+S  +I+LSL +FG+  A +  I GY      Q + + + +N+W
  S:     2 NLLAARTVFIPNLINTINLVALFLTIAILTVAIIVSILILISYLKKNTEQIGILKANGLSGKKINLSLLIFGLIPAIVGAISGYSFGIGFQDVAIHLFSNYW 103
>gi|83319508|ref|YP_424628.1| hypothetical protein MCAP_0664 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283394|gb|ABC01326.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1381 aa)
Score = 128, Expect = 1.2e-04, Identities = 59/255 (23%), Positives = 123/255 (48%)
  Q:   772 FIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVD---------DIGY------NSLLYTNSEVNQDIYFAIKFK---NNGKVDL--EYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKS 1026
           + ++G   S +  FP ++  +PIPN   EG IYVD         D G+      +S L  +S    + ++++K K   N+  +D   +Y N  +NK   N ++     +N    +      + I+ Y NI+++ +++ ++ + +Y + L+ K  +  +R  +   +A G    Q+  +  +     + + GILGY+++     + +    N++ +  G  +F  IG +  +  ++L       +      +     LL +    K+ KL  L+KS
  S:   238 YQVVGFANSADFIFPTINAYTPIPNRLNEGIIYVDPSRFGLIKQDDGFYRYDSTSSKLVVSSNNEWESFYSLKTKDKLNDQIIDWMNQYFNQLINKRTQNKWIYKLDDSNYRFSSRTNVIKKTISAY-NIYSVAVLLAVISVVLYTTFLITKKQILNSRGQIGTMRAIGYKKRQMVFNYVMMPFFTSIVGGILGYILSCLISIIIINKFANYFSLDYGVFSFDWIGFLNNLIFMWLIISAISFLIAYLIMKKGAINLLENRNAKKITKLGNLVKS 511
Score = 99, Expect = 3.0e-01, Identities = 42/148 (28%), Positives = 79/148 (53%)
  Q:  1628 IGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVI-AIAGIVIINFI--FVSVY 1775
           IG   I  I   +  + + D  + +    LV+  + I +   ++ +II++ +S+++SD  + +A LK LGYS++    +IL ++  V+   L++G +   S    F+  I +  SI + P I  +   + VI A++GI +I  I  F S+Y
  S:  1224 IGQGVIKTITPIQITKQILDQISNLVMLALVLAIITILM---IVFVIILLTTSLIISDNIRFIATLKVLGYSNKYITENILGMYFIVIANMLVIGFV---SGWFIFDSTIKSLYSIIVLPIIFPIWLPFAVILAVSGIYLITLIVGFNSIY 1368
>gi|188159342|ref|ZP_02998718.1| hypothetical protein Mmycm_02535 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1753 aa)
Score = 126, Expect = 2.1e-04, Identities = 75/345 (21%), Positives = 145/345 (42%)
  Q:   759 LSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQD-------IYFAIKFKNNGKVDL--EYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGY--------VNIF---AIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFAL-TKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYK 1103
           L    ++ ++     I G  T   + FP    + PIP  +    +YV     N +L   S+ N +        +F  K ++N  ++L   Y  + ++K  D+       KN          +   I  +        +N +    +I  +V+ +I I    + I+  +  N   + + KA G S  QIS+S   + I     S  LG++     Q +F+ +  N++ IP+   T     L+ ++    L  ++  ++  +   +  + ++L+  +    +K +  +K          TKF ++L+ S      L V +       I+ G AIP    T +N+   + +Y+  YN       S L K
  S:   501 LKLGQQIIVDGALLTITGFATDTYSFFPTTDPDFPIPQSELGAILYVTRSTINDILGATSQSNTNRVSKGYLSFFLRKRQSNASINLFNSYQMNDISKLYDSIKYQKDQKNKVTTWLNIKDFDHSIFRFNWTIAPLAINSYKGATLIAALVVSLIAIIALVICIRKTIYFNAKQIGILKALGSSPIQISISYLAYVIVIILTSVPLGWITGLSTQSVFVKLFVNYFSIPLYSFTIEPFSLLISLLIFGLFGVIVSLLSAIIITKKQLADILAVKQNWSSSKFINRLKRTWFKKAKFTTKFSLTLASSGKKNIFLLVTVVGISTMFISAGLAIPSIAFTIKNTYYKSIKYANEYNYSKGVSNSPLTK 866
>gi|66880415|ref|ZP_00405396.1| hypothetical protein MgenG_01000021 [Mycoplasma genitalium G-37] (292 aa)
Score = 124, Expect = 3.4e-04, Identities = 67/238 (28%), Positives = 110/238 (46%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLE-DYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDI-NPLTGQTNINSSTNRV-----NTLGYFSNGHLNSTISFSSGNLKYP 238
           M    KQ+ KS K    LL G+ F+ F+I+F   S +  SNN+ S+Y+T+ S +  S  +       LK     Y       + S+++ +G YFS ++ D  +I   F Y   +    S    GS  N           N        +N  D ++  R RGIL +YG   I +E   ++   +   ++D  +   DI + +T +  I+   N +     N LGYF++G +  TIS  +G  ++P
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSIVQLSNNLVSTYTTLVSKTNSSDIVAPA---ILKEANPVY-------IASLTNDSG-YFSKIKIDDKKINYLFPYQENDFGSDSGQSNGSGDN----------QNKTIPRKGDVNEKDKLFLARKRGILKAYGEANI-AEKRIYKGLAVSFNNTD-SFNGSDISDSITNRHIISDPQNLIYDASGNLLGYFADGLIKETISLRAGIARFP 222
>gi|148988697|ref|ZP_01820130.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP6-BS73] >gi|147925898|gb|EDK76973.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP6-BS73] (812 aa)
Score = 123, Expect = 5.0e-04, Identities = 47/186 (25%), Positives = 95/186 (51%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G+I    L  F   MI + A+I   P + W  Y+  V+A++ I+ +   FV+ YL+K ++
  S:   626 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLIAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVVAVSIILTLLGFFVNYYLRKVDM 804
>gi|406330|gb|AAD12416.1| unknown [Mycoplasma genitalium] (103 aa)
Score = 121, Expect = 8.3e-04, Identities = 36/115 (31%), Positives = 56/115 (48%)
  Q:  1272 VLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLS 1386
           VL   +V N   ++FND FL F+  VYG+ +L+  D+K+ FGIVP        + ETYTY++         +            N    + GI  +S +V L+D    +L +L+S
  S:     1 VLTTIDVFNPGGVKFNDSFLSFMLKVYGDFELAKQDSKLNFGIVPV----DPAIEETYTYVEGPFGFQEDNLDE----------NSPYTLTGINPESSFVNLIDGSGNSLRNLIS 101
>gi|111657855|ref|ZP_01408569.1| hypothetical protein SpneT_02000952 [Streptococcus pneumoniae TIGR4] (902 aa)
Score = 119, Expect = 1.4e-03, Identities = 47/186 (25%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G+I    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLIAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|149006719|ref|ZP_01830405.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP18-BS74] >gi|147761634|gb|EDK68598.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP18-BS74] (902 aa)
Score = 119, Expect = 1.4e-03, Identities = 47/186 (25%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G+I    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLIAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSFILTLLGFFVNYYLRKVDM 894
>gi|148993778|ref|ZP_01823205.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|168488634|ref|ZP_02712833.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP195] >gi|147927734|gb|EDK78758.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|183572660|gb|EDT93188.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP195] (902 aa)
Score = 119, Expect = 1.5e-03, Identities = 47/186 (25%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G+I    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLIAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|148997702|ref|ZP_01825266.1| hypothetical protein CGSSp11BS70_02304 [Streptococcus pneumoniae SP11-BS70] >gi|168575160|ref|ZP_02721123.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae MLV-016] >gi|147756201|gb|EDK63243.1| hypothetical protein CGSSp11BS70_02304 [Streptococcus pneumoniae SP11-BS70] >gi|183578925|gb|EDT99453.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae MLV-016] (902 aa)
Score = 119, Expect = 1.5e-03, Identities = 47/186 (25%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G+I    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLIAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|149021256|ref|ZP_01835502.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|147930357|gb|EDK81341.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] (902 aa)
Score = 119, Expect = 1.7e-03, Identities = 47/186 (25%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G+I    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLIAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|15901487|ref|NP_346091.1| hypothetical protein SP_1652 [Streptococcus pneumoniae TIGR4] >gi|14973142|gb|AAK75731.1| putative membrane protein [Streptococcus pneumoniae TIGR4] (924 aa)
Score = 119, Expect = 1.7e-03, Identities = 47/186 (25%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G+I    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   738 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLIAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 916
>gi|168491466|ref|ZP_02715609.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC0288-04] >gi|183574226|gb|EDT94754.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC0288-04] (902 aa)
Score = 118, Expect = 1.8e-03, Identities = 47/186 (25%), Positives = 93/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L S     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++  K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|169834468|ref|YP_001695037.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae Hungary19A-6] >gi|168996970|gb|ACA37582.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae Hungary19A-6] (902 aa)
Score = 118, Expect = 1.8e-03, Identities = 45/186 (24%), Positives = 92/186 (49%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L S     S+V   S      LFD+  +     +   T+L+ + V L I+I+  ++++ +++  + ++  K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSVASSLNQTM---TILVIVSVLLAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|149001931|ref|ZP_01826885.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP14-BS69] >gi|147759740|gb|EDK66730.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP14-BS69] (902 aa)
Score = 118, Expect = 1.9e-03, Identities = 47/186 (25%), Positives = 93/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L S     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++  K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|194397244|ref|YP_002038267.1| ABC transporter, permease protein [Streptococcus pneumoniae G54] >gi|194356911|gb|ACF55359.1| ABC transporter, permease protein [Streptococcus pneumoniae G54] (902 aa)
Score = 118, Expect = 2.0e-03, Identities = 46/186 (24%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPXVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|116516046|ref|YP_816921.1| hypothetical protein SPD_1465 [Streptococcus pneumoniae D39] >gi|116076622|gb|ABJ54342.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae D39] (902 aa)
Score = 118, Expect = 2.0e-03, Identities = 45/186 (24%), Positives = 92/186 (49%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L S     S+V   S      LFD+  +     +   T+L+ + V L I+I+  ++++ +++  + ++  K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSVASSLNQTM---TILVIVSVLLAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|15903539|ref|NP_359089.1| hypothetical protein spr1496 [Streptococcus pneumoniae R6] >gi|15459156|gb|AAL00300.1| Hypothetical protein [Streptococcus pneumoniae R6] (924 aa)
Score = 118, Expect = 2.1e-03, Identities = 45/186 (24%), Positives = 92/186 (49%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L S     S+V   S      LFD+  +     +   T+L+ + V L I+I+  ++++ +++  + ++  K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   738 YGQLPQANTYLVSLRDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSVASSLNQTM---TILVIVSVLLAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 916
>gi|168493553|ref|ZP_02717696.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC3059-06] >gi|183576306|gb|EDT96834.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC3059-06] (902 aa)
Score = 117, Expect = 2.2e-03, Identities = 46/186 (24%), Positives = 94/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|188159619|ref|ZP_02998777.1| ABC transporter, permease protein, putative [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1773 aa)
Score = 115, Expect = 3.8e-03, Identities = 84/372 (22%), Positives = 160/372 (43%)
  Q:   769 SLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDD------IGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTN--------------------------LLTARISYPRVIAGYVNIFAIILIVVLMV-IGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFR----ISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTIST 1140
           ++  ++ G      + FP      P+P   + G IY  D      IG  +    N +     +F IK +++  ++        N YLD+   S+ ++ N N                           L  +I++   +A ++    I LI  L V +G+  S       ++ N   + + KANG+ +  I+ S   + +    IS  +G++     Q  F+GI  +++ + +    F  I ++ ++        LF  I  +     P+ ++++ T++    +L   +K     LF   KF     + L+ S    F L +IL       I++G AIP     ++N+   N  Y+  Y +           +   T+  +  +   ++N +EN       N YKTI T
  S:   517 AVGLVVSGYAVDTYSFFPTSDPNVPLPKSDSGGLIYASDKTIDQIIGDQTDPSNNDQTTIYNFFLIKKQSDANLN--------NLYLDHFSKSTKIRENINAYNSKDKANTFYKTYDFDKSWYSLNWTLYQKITFYYSLATFLTAGLIALIAALAVFVGVIKS-------IQANAKQIGILKANGVYSKTIASSYIWYALILVLISIPIGWMFGTILQVPFVGIFKDYFSLKVEVIEFDWISVLISVAIFGFLIGLFSFIVALFNIHKPVLQVINHTKKWSRPRLTDWLKKY---LFKKIKFNNLLMLKLTESGKKPFSLLLILTFVATLFISIGIAIPSIAIHTKNNYFKNINYNNEYQI-----------FNNITNTPLGKDTLNLWNGHEN-----LDNSYKTIKT 891
>gi|83319322|ref|YP_424484.1| hypothetical protein MCAP_0511 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283208|gb|ABC01140.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1753 aa)
Score = 115, Expect = 4.3e-03, Identities = 84/376 (22%), Positives = 159/376 (42%)
  Q:   728 LSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQD-------IYFAIKFKNNGKVDL--EYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIY-LSSLLIKIYVEK----------------NRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSR--KIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYK 1103
           L+ NQ + +P     K+  + S +F      L    ++ ++     I+G  T   + FP    + PIP  +    +YV       +L + S+ N +        +F  K  +   +D+   Y  + ++K  D+       KN  +       +        +IF    I+  + I  Y +S+L+  + V                  N   + + KA G S  QIS+S   + +     S  LG++V    Q +F+ +  +++ IP+   T     L+ ++    L  L+  ++      + P+ ++L+  +    +K +  +K    K   F  TKF ++L+ S      L V +       I+ G AIP    T +N+   + +Y+  YN       S L K
  S:   474 LNKNQGARLP----TKSEALISEQFAR-AHKLKLGQQIIVDGALLSIVGFATDAYSFFPTTDPDFPIPQSELGAILYVYKSTIKDILSSTSQSNTNRVSKGYLSFFLTKKHSTASIDMFNAYQMNDISKLYDSIKYQKEQKNKVSTWLNIKDFDH------SIFRFNWIIAPLAINTYKISTLIAALAVSLIAIIALIICIRKTIYFNAKQIGILKALGSSPLQISISYLAYILVIILTSVPLGWIVGLSTQSVFVKLFVHYFSIPLYSFTVEPFSLLISLLIFGLFGLIISLLTAFLITKKPLFDILAVKQNWSSSKFINRLKRTWFKKARFT-TKFSLTLASSGKKNIFLLVTVVGISTMFISAGLAIPSIAFTIKNTYYKSIKYANEYNYAKGVTNSPLTK 865
>gi|168483478|ref|ZP_02708430.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1873-00] >gi|172043087|gb|EDT51133.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1873-00] (902 aa)
Score = 115, Expect = 4.6e-03, Identities = 46/186 (24%), Positives = 93/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++  K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|168486980|ref|ZP_02711488.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1087-00] >gi|183570117|gb|EDT90645.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1087-00] (902 aa)
Score = 114, Expect = 5.6e-03, Identities = 44/186 (23%), Positives = 92/186 (49%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+  +     +   T+L+ + V L I+I+  ++++ +++  + ++  K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V A++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSVASSLNQTM---TILVIVSVLLAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDM 894
>gi|149011487|ref|ZP_01832734.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|147764477|gb|EDK71408.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] (902 aa)
Score = 113, Expect = 6.7e-03, Identities = 45/186 (24%), Positives = 93/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V  ++ I+ +   FV+ YL+K ++
  S:   716 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVATVSIILTLLGFFVNYYLRKVDM 894
>gi|182684595|ref|YP_001836342.1| hypothetical protein SPCG_1625 [Streptococcus pneumoniae CGSP14] >gi|182629929|gb|ACB90877.1| hypothetical protein SPCG_1625 [Streptococcus pneumoniae CGSP14] (924 aa)
Score = 113, Expect = 7.5e-03, Identities = 45/186 (24%), Positives = 93/186 (50%)
  Q:  1596 YYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           Y  L   + Y +S+  ++  +I S    L +     S+V   S      LFD+   I  +L    T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V  ++ I+ +   FV+ YL+K ++
  S:   738 YGQLPQANTYLVSLRDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDS---IASSLNQTMTILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVATVSIILTLLGFFVNYYLRKVDM 916
>gi|115252772|emb|CAK98208.1| hypothetical transmembrane protein [Spiroplasma citri] (280 aa)
Score = 110, Expect = 1.8e-02, Identities = 39/182 (21%), Positives = 91/182 (50%)
  Q:  1599 LSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIA-GIVIINFIFVSVYLKKQN 1780
            S TD Y  +  M +N   L L++ L        +  +N    F TL + Y+   RT+  +  +L  L + ++ +I+ ++ ++++ + R+ + ILK LGY   + +  +L  ++  +++  ++  ++   L      ++F +  + L   + + SY+  +  +A G ++I+ I V ++  K+N
  S:    94 FSLTDNYDFT--MFDNNKKLHLKNALDLRTNLKLLNGLNKIWPFDTLRENYSQGMRTVRDVLNVLEGLTIAIVALILSVLIAMVLDENRRTILILKVLGYPTWKIITIVLGFYLFAIILGYVLSYVIAQLLWNVIANIVFKSTGMLL--ILSFSSYVVSIATLAIGFILISVIGVGIWKIKKN 272
>gi|77360333|ref|YP_339908.1| lipoprotein releasing system transmembrane protein [Pseudoalteromonas haloplanktis TAC125] >gi|76875244|emb|CAI86465.1| putative lipoprotein releasing system transmembrane protein [Pseudoalteromonas haloplanktis TAC125] (414 aa)
Score = 108, Expect = 2.6e-02, Identities = 39/135 (28%), Positives = 72/135 (53%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLL-ICLFVPLIIIIIMIVSSVMMSDFRKL--VAILKTLGYSDRENLLSILM-----IFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFI 1770
           I+ + Y  + F T  ++++ + ++ T++ I +F+ + +    IVSS++M    K   +AILKT+G  D   L + +M      FV V+L SLI G+++  ++S  F                 W+S L+G   + G+  I F+
  S:   247 IDDYVYISSWFRTQGSLYQDIQMVRTIVYIVVFLIIAVASFNIVSSLVMEVREKQGNIAILKTMGAKDSTILATFVMQGLTQAFVGVVLGSLI-GVVLAINISELFT----------------WLSQLFGANPLQGVYFIEFL 372
>gi|149177070|ref|ZP_01855678.1| hypothetical protein PM8797T_12051 [Planctomyces maris DSM 8797] >gi|148844135|gb|EDL58490.1| hypothetical protein PM8797T_12051 [Planctomyces maris DSM 8797] (795 aa)
Score = 108, Expect = 2.9e-02, Identities = 58/267 (21%), Positives = 117/267 (43%)
  Q:   771 DFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDI-YFAIKFKNNGKVD--LEYVNSRMNKYLDNAYLSSTLKNNTN--LLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIP-IGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKF 1037
           + +I+G+  S E  + ++     +P P+T G  Y+       +       NQ + + A +F++  +V   L+ +   ++ Y    + ++ L   ++   L + I         + + A IL  + +++     +LL+    E+ R  +   KA G S  +I L    FG+      G+LG ++ Y   G       NF+  P +    +  + L+G + S++     F V+G  R  R+ +   LS  E ++    L   ++R+I L  +  F
  S:   165 ELLIVGTAISSEFVY-LIGPGGLVPEPETYGVFYLKHDYAEDVFGFEGAANQILGHLAPEFQSPDRVRQILDQLELNLDDY--GVFSTTPLAQQSSHWFLKSEIDG-------LKVSATILPTIFLIVAALALNLLMSRMAEQQRTIVGTLKALGYSNQEIFLHFIQFGLLIGIAGGLLGILIGYSLAGAMTAQYRNFFEFPSLINQMYPRVILLGMLISIF-----FAVLGTFRGVRSVVR--LSPAEAMRPKPPL---RARRILLEKIHAF 417
>gi|94994512|ref|YP_602610.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10750] >gi|94548020|gb|ABF38066.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10750] (878 aa)
Score = 108, Expect = 3.0e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNCHLKKVDM 870
>gi|15675215|ref|NP_269389.1| hypothetical protein SPy_1255 [Streptococcus pyogenes M1 GAS] >gi|13622383|gb|AAK34110.1| hypothetical protein SPy_1255 [Streptococcus pyogenes M1 GAS] (878 aa)
Score = 106, Expect = 4.4e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDM 870
>gi|71903603|ref|YP_280406.1| ABC transporter permease protein [Streptococcus pyogenes MGAS6180] >gi|71802698|gb|AAX72051.1| ABC transporter permease protein [Streptococcus pyogenes MGAS6180] (878 aa)
Score = 106, Expect = 4.5e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDM 870
>gi|56808389|ref|ZP_00366142.1| COG0577: ABC-type antimicrobial peptide transport system, permease component [Streptococcus pyogenes M49 591] (851 aa)
Score = 106, Expect = 4.5e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   715 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDM 843
>gi|50914301|ref|YP_060273.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10394] >gi|50903375|gb|AAT87090.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10394] (878 aa)
Score = 106, Expect = 4.6e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDM 870
>gi|94990589|ref|YP_598689.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10270] >gi|94544097|gb|ABF34145.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10270] (878 aa)
Score = 106, Expect = 4.7e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDM 870
>gi|94988699|ref|YP_596800.1| ABC transporter permease protein [Streptococcus pyogenes MGAS9429] >gi|94992522|ref|YP_600621.1| ABC transporter permease protein [Streptococcus pyogenes MGAS2096] >gi|94542207|gb|ABF32256.1| ABC transporter permease protein [Streptococcus pyogenes MGAS9429] >gi|94546030|gb|ABF36077.1| ABC transporter permease protein [Streptococcus pyogenes MGAS2096] (878 aa)
Score = 106, Expect = 4.7e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDM 870
>gi|71910778|ref|YP_282328.1| ABC transporter permease protein [Streptococcus pyogenes MGAS5005] >gi|71853560|gb|AAZ51583.1| ABC transporter permease protein [Streptococcus pyogenes MGAS5005] (391 aa)
Score = 105, Expect = 5.4e-02, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+V+ +LKK ++
  S:   255 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDM 383
>gi|50365078|ref|YP_053503.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] >gi|50363634|gb|AAT75619.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] (1724 aa)
Score = 105, Expect = 6.5e-02, Identities = 78/373 (20%), Positives = 166/373 (44%)
  Q:   758 NLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNT---NLLTARISY---PRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSL------SKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNL-----QTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEW 1130
           N+  N  + I      ++G  T   + +P+V    P P  +    IY    G    L+   E +Q          N    L   ++  +K  +     + L  NT   N  + R+++   P +++G + I  I + V++ VI +    + IK  V+ N   +A+ KA G++++ I+ S +  G+   F+   +G++V    Q +F+ +   ++ + I + + S + L+  + +   A ++  ++      R  +  +L+   ++K    +    +R   +FA +KF +  SL       + T    FVI  S+   +I  G +IP   ET++N   ++  Y+ ++         P  +S +   ++   +    +   +   Y NP + +
  S:   520 NIKNNSTIKIGPQVLTVVGIATDTFSYYPIVDENVPFPQYRNSAIIY----GTEQTLFPIVENSQSTSKEQISNTNINYFLWSKDNSASKNFETFASFTPLSKNTKTFNESSYRMNWVLQPSIVSGLLII-MISISVIVGVISLLGVVIYIKKMVKANIKQIAILKAMGVNSFSIAKSYAAVGLIITFLVIPIGWMVGTSVQLIFIKMFIPYFSVQISQISISMVALLIGVFAFGFAVIILSILFAYIETREDVTLMLNKVGKVKQQAAIMNWINR---VFANSKFTLRFSLIVSASAIRNTTTTAFVIFISS--FLIFFGLSIPALVETTKNGYYNHLNYNNQHRFVENVYNAPLSKSTISYTEDLKTIDANYKTTSLMEYYSNPTYSY 899
>gi|109646336|ref|ZP_01370240.1| protein of unknown function DUF214 [Desulfitobacterium hafniense DCB-2] >gi|109641582|gb|EAT51136.1| protein of unknown function DUF214 [Desulfitobacterium hafniense DCB-2] (794 aa)
Score = 105, Expect = 6.9e-02, Identities = 52/221 (23%), Positives = 90/221 (40%)
  Q:   774 IIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRV-IAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQG-MFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCV 994
           I+G+    E  + +       P+ +  G IYV      ++L     VN     ++    +G  D + V + + K L    L ST++    +  +        +     IF ++  +   VI IY++   +   +E  R  + V KA G S W I L    + +    +  ILG ++  F  G   LGI N+F+ +P    +     ++ A     L  L FCV
  S:   167 IVGTVKGPEYMYEIRDATEVFPDHEKFGVIYVQASYLQTILDYKGSVND---ISVLLTKDG--DSKKVKAELEKMLAPYGLVSTVEKKDQISYSMFHSDETGLQSMAAIFPMLFFIASAVI-IYIT---MTRMIENQRTLMGVFKALGYSDWDIMLHYQTYPLLVGILGSILGSLIGLFFIGEALLGIFNSFYNLPTENSSVQLAMVVPA----SLTALFFCV 376
>gi|89894072|ref|YP_517559.1| hypothetical protein DSY1326 [Desulfitobacterium hafniense Y51] >gi|89333520|dbj|BAE83115.1| hypothetical protein [Desulfitobacterium hafniense Y51] (791 aa)
Score = 104, Expect = 7.1e-02, Identities = 52/221 (23%), Positives = 90/221 (40%)
  Q:   774 IIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRV-IAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQG-MFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCV 994
           I+G+    E  + +       P+ +  G IYV      ++L     VN     ++    +G  D + V + + K L    L ST++    +  +        +     IF ++  +   VI IY++   +   +E  R  + V KA G S W I L    + +    +  ILG ++  F  G   LGI N+F+ +P    +     ++ A     L  L FCV
  S:   164 IVGTVKGPEYMYEIRDATEVFPDHEKFGVIYVQASYLQTILDYKGSVND---ISVLLTKDG--DSKKVKAELEKMLAPYGLVSTVEKKDQISYSMFHSDETGLQSMAAIFPMLFFIASAVI-IYIT---MTRMIENQRTLMGVFKALGYSDWDIMLHYQTYPLLVGILGSILGSLIGLFFIGEALLGIFNSFYNLPTENSSVQLAMVVPA----SLTALFFCV 373
>gi|83319828|ref|YP_424016.1| hypothetical protein MCAP_0018 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283714|gb|ABC01646.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1797 aa)
Score = 104, Expect = 7.4e-02, Identities = 81/359 (22%), Positives = 156/359 (43%)
  Q:   768 NSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYT-NSEVNQDIYFAIKF---KNNGKVDLEYV--------------------NSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMV-IGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSR--KIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYK-----YQEYTDLGITDEE----RGIFNIYENP 1126
           N+   I+ G      + FP      P+P   + G IY D    N +L   NS    D      F   KNN  ++++ V                     + +  +  N   S +  +    L  R+++   +A ++    I L+  L V +G+  S       ++ N   + + KANG S+  IS S   + +   FI+  LG++     Q  F+ I  +++       T+  +  + +I    +   +F  +  +   + P+ +++ S+++    K+   +  R  K P F  T   + L+ S    F L ++L   G   ++ G AIP   + ++++      Y+ +Y +      S L K     +  +  +  T +E     G  N YE+P
  S:   534 NAKGLIVTGYAVDTYSFFPTSDPNVPLPKSDSGGLIYADFTTINQILGDGNSATGNDQTSTFNFFLIKNNNSLNIKNVYFDHFSVADKIRDNIIAKQKGTEIQTFYKNQQFSDSSYSLNWTLYQRVAFWYSLATFLTASLIALVSALAVFVGVIKS-------IQANSKQIGILKANGASSSTISWSYVSYAVILVFIAIPLGWMAGTMLQVPFVAIFKDYFSFKTNVLTYDWLAPLISIIIFGVLIGVFSFLVALFHIKKPVLDIIKSSKKWSKPKITDWLHKRIFKKPRFT-TLLMLKLTESGKKPFSLLLVLVFVGTLFVSAGIAIPSVTKYAKDNYFKKVNYNNQYEIYNSLSNSPLGKDVFNFWNGHEQIDNTYKEIKDSSGTINYYEDP 920
>gi|45200983|ref|NP_986553.1| AGL114Cp [Ashbya gossypii ATCC 10895] >gi|44985753|gb|AAS54377.1| AGL114Cp [Ashbya gossypii ATCC 10895] (786 aa)
Score = 104, Expect = 7.5e-02, Identities = 45/150 (30%), Positives = 76/150 (50%)
  Q:     6 KQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQ-------AILETKDDSLKNGTLEYDYDSLNSLQSISSSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIY 155
           ++++KS+  S+ L IG+F I + I  +  ++L     IS  +S++    + +Q       A+L T   +L N  + Y Y+ L   Q + S       S E+ + + K+F Y   NL+   FT  G+ SNY +AY +DT +   Y   T +  F   Y
  S:   435 ERLIKSY--SVTLFIGIFSIFWIIPVSYLATLLNIKTISKFWSSLGKFLEDNQWAENIVTALLPTYIFTLFNFGIPYLYERLTEHQGLVSY------SEEELSLVSKNFFYIFVNLF-LVFTLAGTASNY-WAYLSDT-TKIAYQLATSVKEFSLFY 580
>gi|148984085|ref|ZP_01817380.1| hypothetical protein CGSSp3BS71_02652 [Streptococcus pneumoniae SP3-BS71] >gi|147923374|gb|EDK74487.1| hypothetical protein CGSSp3BS71_02652 [Streptococcus pneumoniae SP3-BS71] (129 aa)
Score = 104, Expect = 7.6e-02, Identities = 30/121 (24%), Positives = 68/121 (56%)
  Q:  1661 TLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           T+L+ + V L I+I+  ++++ +++  + ++ +K LG+ + E  L I    + + L+ +++G++    L  F   MI + A+I   P + W  Y+  V  ++ I+ +   FV+ YL+K ++
  S:     2 TILVIVSVLLAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLHQFLIQMI-SPATILFYPQVGWEVYVIPVATVSIILTLLGFFVNYYLRKVDM 121
>gi|50364974|ref|YP_053399.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] >gi|50363530|gb|AAT75515.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] (1814 aa)
Score = 102, Expect = 1.3e-01, Identities = 81/339 (23%), Positives = 161/339 (47%)
  Q:   755 WKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKF--KNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTAR---ISY------------------------PRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFS-----AIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKF------RISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQ 1093
           +K+  S   K+ I + +FII G G+     +P+V  E P+ +      +Y      N ++   +E  +D+ F   +  ++N K D E +  RM+ + D++ LS+  K + + + ++   +S+                        P+++   V I +I+  V+++++        IK  ++ N   +   KA G+ ++++SLS   + I   FI   L ++ A F Q +   +   ++   + E  F       + ++  IGSL L++ +  ++ V +     IN+    +++ KV   L     RK+ +  +  F      +ISL  SK    I F  L +    +IT     P              QY+ +Y +Q
  S:   559 FKNGYSVGDKIKIGNSNFIISGFGSDALTYYPLVDPEVPLSDVANSVIVYAPKYVINEIMKNGNE--KDVTFTTYYFIRDNLK-DKETIGKRMSNF-DSSLLSNKSKLSESFIDSKNENLSFGDKKSANEIKLFEKTYFNLNWTLQPKMLE-IVTIISIVTSVLVLIMSFVSIVFGIKKTIDHNSSQIGFLKAKGVDSYRLSLSYIGYSIILLFIIVPLAWLAAGFFQEIITKLFATYFSTTLYEFVFDYKILLILLVVFGIGSLILSYFIAFLL-VSKDVMQIINK---ESQQRKVRNWL----PRKLNVINIIDFKFRFPLKISLRGSKQIAMISFTALITT--FVITFSVLTPSMLNVYIRDAGKYYQYNNQYVMQ 922
>gi|116629719|ref|YP_814891.1| peptide ABC transporter permease [Lactobacillus gasseri ATCC 33323] >gi|116095301|gb|ABJ60453.1| ABC-type antimicrobial peptide transport system, permease component [Lactobacillus gasseri ATCC 33323] (859 aa)
Score = 102, Expect = 1.3e-01, Identities = 42/171 (24%), Positives = 87/171 (50%)
  Q:  1611 MSNNMTILSLQSWLQSNIGTPSIV---AINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFF--NFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           M+ N  ++ L+S +Q++    S++   A+N+     +      ++ +++  +  LLI L V L I++I  +++  + +  + ++ LK LG+ ++E  L I    + + ++ ++ G ++   L +F   N    NA      P I + +YL   I    I  I  IFVS  +K+ N+
  S:   679 MNTNAQLIELKSDVQTDDFANSLMKTGAVNAINLNTSNKQIIDSLIQSMDKVMFLLIGLAVLLAIVVIFTLTTTNLEERMREISTLKVLGFYNKEASLYIYRETIILSILGILFGFLIGNWLHSFIIDNLAPMNAM---FRPGILFSNYLLSAIIPLAITAIMAIFVSREIKEVNM 851
>gi|119472996|ref|ZP_01614831.1| putative lipoprotein releasing system transmembrane protein [Alteromonadales bacterium TW-7] >gi|119444616|gb|EAW25927.1| putative lipoprotein releasing system transmembrane protein [Alteromonadales bacterium TW-7] (414 aa)
Score = 100, Expect = 2.3e-01, Identities = 37/135 (27%), Positives = 70/135 (51%)
  Q:  1636 INSFEYFQTLFDTYTTIFRTLLVIETLL-ICLFVPLIIIIIMIVSSVMMSDFRKL--VAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFI 1770
           I+ + Y  + F T  ++++ + ++ T++ I +F+ + +    IVSS++M    K   +AILKT+G  D     +IL  FV   L    VG++    L +F   ++    ++ +S    W+S L G   + G+  I F+
  S:   247 ISDYVYISSWFRTQGSLYQDIQMVRTIVYIVVFLIIAVASFNIVSSLVMEVREKEGNIAILKTMGAKDS----TILATFVMQGLTQAFVGVL----LGSFIGVVL----ALNISELFAWLSQLMGANPLEGVYFIEFL 372
>gi|21910427|ref|NP_664695.1| hypothetical protein SpyM3_0891 [Streptococcus pyogenes MGAS315] >gi|28896003|ref|NP_802353.1| hypothetical protein SPs1091 [Streptococcus pyogenes SSI-1] >gi|21904625|gb|AAM79498.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811253|dbj|BAC64186.1| hypothetical protein [Streptococcus pyogenes SSI-1] (878 aa)
Score = 100, Expect = 2.5e-01, Identities = 31/130 (23%), Positives = 71/130 (54%)
  Q:  1652 IFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           +  +L  + TLL+ L + L I+I+  ++++ +++  + ++ +K LG+ D+E  L I    + + L+ +++GI +   L T+   MI +   I     +D   YL  ++ I  ++ +  I+ + +LKK ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWGNRHLKKVDM 870
>gi|42560593|ref|NP_975044.1| permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492089|emb|CAE76686.1| Predicted permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1795 aa)
Score = 98, Expect = 3.5e-01, Identities = 84/359 (23%), Positives = 156/359 (43%)
  Q:   768 NSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLL------YTNSEVNQDIYFAIKFKNNGKVDLEYVN--SRMNKYLDNAY----------------LSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMV-IGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSR--KIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYK-----YQEYTDLGITDEE----RGIFNIYENP 1126
           N+   I+ G      + FP      P+P   + G IY D    N +L        N + +   +F IK  N+  +   Y +  S  NK  DN                   S++  +    L  +IS+   +A ++    I L+  L V +G+  S       ++ N   + + KANG S+  IS S   + +   FI+  LG++     Q  F+ I  +++        +  +  + +I    +   +F  +  +   + P+ +++ S+++    K+   +     K P FA T   + L+ S    F L ++L   G   ++ G AIP   + ++++      Y  +Y +      S L K     +  +  +  T +E     G  N YENP
  S:   532 NAKGLIVTGYAVDTYSFFPTSDPNVPLPKSDSGGLIYADFATINQILGDGNSATANDQTSTFNFFLIKKNNSLNIKNVYFDHFSVANKIRDNILAKQKGTEIQTFYQEREFSNSWYSLNWTLYQKISFWYSLATFLMASLITLVSALAVFVGVIKS-------IQANSKQIGILKANGASSATISWSYVSYAVILVFIAIPLGWMAGTMLQVPFVAIFKDYFSFKTNVLIYDWLAPLISIIIFGVLIGVFSFLVALFHIKKPVLDIIKSSKKWSKPKITDWLHKHIFKKPRFA-TLLMLKLTESGKKPFSLLLVLVFIGTLFVSAGVAIPSVTKYAKDNYFKKVNYDNQYEIYNSLSNSPLGKDVFNFWNGHEQIDNTYKEIKDPSGTINYYENP 918
>gi|114567229|ref|YP_754383.1| hypothetical protein Swol_1714 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338164|gb|ABI69012.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (791 aa)
Score = 98, Expect = 4.1e-01, Identities = 46/232 (19%), Positives = 100/232 (43%)
  Q:   770 LDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYL-DNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIP--IGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTF 1001
           +   +IG+ TS E  +P+    S  P P+  G + +  +    +L    ++NQ     +       VD E +  ++ K L     +SS  + +    ++ +     + G + +FA+ L ++  ++   +  +++   +   R+P+ V KA G    +I    + +G+A   ++ ILG  +      +   +   F+ +P    E  F  +        LY +FL+  ++G+   F
  S:   164 VSLTVIGTATSPEFIYPMKDAGSLFPEPERFGILMLSQLQAQQILGLPGQINQ-----LLVDLAPGVDEEKIKEQVEKILAPYGNISSYPRKDQ---SSHLVLQAELDG-IKLFALTLPLIFFLVAAGIQFIILTRLIRSQRLPIGVMKALGYDNCRIMWHYTSYGLAVGLVAAILGTGLGIALTAVLNNLYAQFFNLPSMTNEINFRVV--------LY-SFLITSLVGIASGF 380
>gi|29375889|ref|NP_815043.1| permease domain protein [Enterococcus faecalis V583] >gi|29343351|gb|AAO81113.1| permease domain protein [Enterococcus faecalis V583] (878 aa)
Score = 98, Expect = 4.5e-01, Identities = 34/151 (22%), Positives = 68/151 (45%)
  Q:  1631 PSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNL 1781
           P ++ I      +  FD    + ++L ++  +LI +   L +I++  ++++ +S+  + ++ +K LG+ DRE    +    + +  I +IVG      L  +          I  SP I W SYLY  +      +   + +   LKK N+
  S:   724 PKVLNITFLTAMKGSFDD---MLKSLDIVIWVLIAVSGSLALIVLYNLTNINVSERIRELSTIKVLGFYDREVTTYVYRENIILTFIGIIVGCFFGKILHQYI-LATVEVDLIMFSPIIHWPSYLYSAVITMCFTLFVMVIMHRKLKKINM 870
>gi|90417519|ref|ZP_01225441.1| hypothetical protein GB2207_03202 [marine gamma proteobacterium HTCC2207] >gi|90330672|gb|EAS45956.1| hypothetical protein GB2207_03202 [marine gamma proteobacterium HTCC2207] (405 aa)
Score = 96, Expect = 7.5e-01, Identities = 31/117 (26%), Positives = 63/117 (53%)
  Q:  1642 FQTLFDTYTTIFRTLLVIETLL-ICLFVPLIIIIIMIVSSVMMS--DFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGV 1758
           F+  F T+  +++ + +   ++ + +F+ + I    ++S +MMS  D RK +AIL+TLG + RE L   L   V + L  +++G++ +  L  F           +++  + W+  L+GV
  S:   242 FRDWFQTHGNLYQAIQLSRNMVGLLIFMIIAIAAFNVISMLMMSVMDKRKDIAILQTLGLTRREILQLFLTQGVLIGLFGILIGVL-LGVLGCF-----------WVADLVLWLESLFGV 349
>gi|50364884|ref|YP_053309.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] >gi|50363440|gb|AAT75425.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] (1186 aa)
Score = 95, Expect = 8.4e-01, Identities = 26/119 (21%), Positives = 63/119 (52%)
  Q:  1667 FVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSI 1785
            V +++ I +++ S+++ + +  + + K+LGY  RE    ++  ++   + +LIV +++      + + +I+  A I L   + +   LYG+I  +  +++    + +Y K+QN K  I
  S:  1067 LVGMVLSISLVLISLILFENKNTIILFKSLGYKTREINKYLVTGYLIAAIGALIVALVINNFTIGYLSPIIYETAGISLIYVLSFSYVLYGIILSSTFILLILTSIKIYTKRQNPKEII 1185
>gi|150388436|ref|YP_001318485.1| hypothetical protein Amet_0599 [Alkaliphilus metalliredigens QYMF] >gi|149948298|gb|ABR46826.1| protein of unknown function DUF214 [Alkaliphilus metalliredigens QYMF] (785 aa)
Score = 95, Expect = 8.8e-01, Identities = 43/195 (22%), Positives = 88/195 (45%)
  Q:   774 IIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKN----NTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPI 968
           +IG   S E  + + + +S +P P+  G IYV +    S+L      N+     IK ++     ++ +   +   LD   +  T+K     + +++   +S    +A  V +  + L+V  ++I I LS +     V+ +R+ + V KA G   + I      + +A   +  ++G + + F    F  +   F+ IP+
  S:   165 MIGIVGSPEYIYLMENQQSLLPTPERFGVIYVTEEFAQSVLGFQGSYNE---VMIKIEDEHLDRIDSITDEIEDQLDRYGVRRTIKREDQLSNSMMMEEVSQLDQMATSVPL--LFLVVAAVIINIMLSRI-----VKNDRMAIGVMKALGYGNFNIMGHYVKYALAIGLVGAVIGIIFSVFLSQAFTNLYIQFFNIPL 353