>gi|26553542|ref|NP_757476.1| permease [Mycoplasma penetrans HF-2] >gi|26453548|dbj|BAC43880.1| predicted permeases [Mycoplasma penetrans HF-2] (1793 aa)
Score = 8145, Expect = 0.0e+00, Identities = 1793/1793 (100%), Positives = 1793/1793 (100%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLDEYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISGKTYRVKNNNTDTPFFVGETGYGKEWWTDQNYDLNGSNLNEIFSKFQTVEQTTDTPDIVNIMSSAYIQSSVALSLDKNIDWNIASLTPYYDYMRIMRDKRYLTQETTGKNQDLIVSVHLDMSKLSTLQRQTFDFVREKYGVQKYIDLTSFLYTVNGQSVKTALLASPNLSAELKKEIEGLSVDSLLPILKQTFGTTTGYEILITWLENYGNEKLITVKKELLKYEREFLSYKELSTFDNFTYKTQKSFTLSDFKTSQSFLVSHKGGVSNPNENNSINDLQILSGSKITNGYDFLSSKYDYLNKEVYSDDEQKTNSTKYEDISNTLLSTTRIGGGSQQEIETGGYSINPNGDYLINLVKFINDSYVTGETENTNANNSSESSKLLSDRIKELAKKIVDHYNGTTANVSGSINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSIS 1793
           MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLDEYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISGKTYRVKNNNTDTPFFVGETGYGKEWWTDQNYDLNGSNLNEIFSKFQTVEQTTDTPDIVNIMSSAYIQSSVALSLDKNIDWNIASLTPYYDYMRIMRDKRYLTQETTGKNQDLIVSVHLDMSKLSTLQRQTFDFVREKYGVQKYIDLTSFLYTVNGQSVKTALLASPNLSAELKKEIEGLSVDSLLPILKQTFGTTTGYEILITWLENYGNEKLITVKKELLKYEREFLSYKELSTFDNFTYKTQKSFTLSDFKTSQSFLVSHKGGVSNPNENNSINDLQILSGSKITNGYDFLSSKYDYLNKEVYSDDEQKTNSTKYEDISNTLLSTTRIGGGSQQEIETGGYSINPNGDYLINLVKFINDSYVTGETENTNANNSSESSKLLSDRIKELAKKIVDHYNGTTANVSGSINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSIS
  S:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLDEYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISGKTYRVKNNNTDTPFFVGETGYGKEWWTDQNYDLNGSNLNEIFSKFQTVEQTTDTPDIVNIMSSAYIQSSVALSLDKNIDWNIASLTPYYDYMRIMRDKRYLTQETTGKNQDLIVSVHLDMSKLSTLQRQTFDFVREKYGVQKYIDLTSFLYTVNGQSVKTALLASPNLSAELKKEIEGLSVDSLLPILKQTFGTTTGYEILITWLENYGNEKLITVKKELLKYEREFLSYKELSTFDNFTYKTQKSFTLSDFKTSQSFLVSHKGGVSNPNENNSINDLQILSGSKITNGYDFLSSKYDYLNKEVYSDDEQKTNSTKYEDISNTLLSTTRIGGGSQQEIETGGYSINPNGDYLINLVKFINDSYVTGETENTNANNSSESSKLLSDRIKELAKKIVDHYNGTTANVSGSINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSIS 1793
>gi|26553541|ref|NP_757475.1| permease [Mycoplasma penetrans HF-2] >gi|26453547|dbj|BAC43879.1| predicted permeases [Mycoplasma penetrans HF-2] (1786 aa)
Score = 5196, Expect = 0.0e+00, Identities = 1127/1793 (62%), Positives = 1436/1793 (80%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLDEYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDI--SGKTYRVKNNNTDTPFFVGETGYGKEWWTDQNYDLNGSNLNEIFSKFQTVEQTTDTPDIVNIMSSAYIQSSVALSLDKNIDWNIASLTPYYDYMRIMRDKRYLTQETTGKNQDLIVSVHLDMSKLSTLQRQTFDFVREKYGVQKYIDLTSFLYTVNGQSVKTALLASPNLSAELKKEIEGLSVDSLLPILKQTFGTTTGYEILITWLENYGNEKLITVKKELLKYEREFLSYKELSTFDNFTYKTQKSFTLSDFKTSQSFLVSHKGG-VSNPNENNSINDLQILSGSKITNGYDFLSSKYDYLNKEVYSDDEQKTNSTKYEDISNTLLSTTRIGGGSQQEIETGGYSINPNGDYLINLVKFINDSYVTGETENTNANNSSESSKLLSDRIKELAKKIVDHYNGTT-ANVSGSINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFD-NNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVE-TEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYG-NGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSIS 1793
           MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFS+NIS+SY+++ +SS G++A LETKD  LKN  L YD+DSLN+L  I  +S+G YF+SL++YA +  SFIYP TNLYHSSFTKQ +  NYIFAYYT ++  N YF G G+N  DS+YK RARGIL SYGNL IP  S +WRA+GLELG+ DL+ I+Y+I+PLTGQT I++++N VNTLGYFS+G+++STI+   GNLKYPTN+T  S ++     K Y++KN +T+TPFF+ ++    +WWTDQ+YDL GS+++ + S F+TV+ T D PDI NI+SS Y+ SSV+LSLDK IDWNIASLTP+YDYMRI+RDK YLT   T  ++D + S+HL+  KL+TLQ++T ++V+ KYG+QKYIDLTSF+YTVN   +K A L+  + ++    EI  LS +SL   L  T+G  +G  I+ TWL+NYG++KLIT+ KEL +YE+E+LSY+++S   N  Y  QKSFTLSDFK+ Q+FLVS KGG   + N+ + IN + +  GS I N YDFLS KY YL  E Y DD Q++NSTKYEDISN LLS   IGG SQ ++   GYSIN  G YLINL++ I D+Y++G     + ++S+++SK++      LA KI++ Y+G T  +VSG+INVNDYYHLFA+ATPQNY++Y N+D  D+NSSY+F+NN QNL Y+F    G+TP +Y S+A L APYGN+IVVN+ WL+SNQKSV+P ++W K LLMNS EF  WK NL   YKV INSL+FIIIGSG SFENSFP+VS+ESPIPNP+ EG  YVDD+GY SLLYTNS  NQDIYFAI+F    KVDL  +NS M+ Y   AYLSS + + TNLLTARISYP++IA Y+N+F  IL+ VL+VIGIYLSSLL+KIYVEKN++ LA+AKANGIS+ QI++SLSVFG  AA ISG++GY+ A+  QG+F+GIL+NFW+IPI    FS IGL   I  LY+AFLLF  +GV +TFR+PINELLSS+EE+KVNKLLYL+KS+K   F L KFRI+L+LSKLTRFILFV+LCSAG+SII VG+AIPRKFETSQ +TL N++Y Y YNLQTPSEQSGLYK QEY  LG  DE  GI++I+ N MF+   NPY+ + TS  Q+ +DL+ALRDL GNVI Y NG+ KYF+N LLPSYV +++F  D +LFRN +VSKWL+DF+IS+AGIY+NAW FVS AFP +LISRINAISNNFL++VLEVPELK IND+++YI +NSSGN+VL+   VLDL+NV++T+SIRFN+EFLK+IGM+YGN +LSS+DAKI+FGIVPFR + +N LTE+YTYLDA LND +VRIPS+RN+GK  L +I ++I+GIK+DS++VTL+ D+  +LNS L +P E + D +  YP V+N+GAAY+YDLE+G++FKID+ N+YTRYTD M   NP K++KLK+VGISSD+F T +YISQ+NAN ILGLNF+QGATI+G+S Y  N  + TTVLGDWSSGVL    + T+  Y + +  YP  YVPFNGVFSKEENPLLVNSL+LENTSGLWGNYSSF D+ FA LVS VG+ +++N+  PYS +G+++L+    +S+  +  +   +S++M+I SLQ+WLQ+N GTPSIVAINSFEYF T+FDTY TIF TL+ IETL+ICLF+PLIIII+MI+SSVMM+DFR+LVAILKTLGYSD+ENLLSIL+IFVPV+LISLIVGI ++A+LS  FNFM+FNAASIYL+P IDW++YL+G IAI GIV INFIFV++YLKKQNL+NSIS
  S:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSNNISSSYSTMESSSKGSQAILETKDDSLKNGTLEYDYDSLNSLQSIS-SSNGVYFSSLEDYAEIEKSFIYPVTNLYHSSFTKQGSVSNYIFAYYTDTSSNNPYFTGTGINSFDSIYKTRARGILTSYGNLVIPSESTKWRAYGLELGSSDLQYIVYDINPLTGQTNINSSTNRVNTLGYFSNGHLNSTISFSSGNLKYPTNLTANSPSETLDGSKNYQIKNGSTNTPFFISKS----DWWTDQSYDLQGSSIDSVLSGFKTVDGTDDQPDIANILSSFYVDSSVSLSLDKEIDWNIASLTPWYDYMRILRDKNYLTNTVTNNSKDFVFSIHLNNDKLTTLQKETLEYVKAKYGIQKYIDLTSFVYTVNSLWIKDAALSYFDSNSTEYNEINKLSFNSLNE-LALTYGDYSGLSIVKTWLKNYGDDKLITIDKELKQYEKEYLSYQQMSQLSNIEYNVQKSFTLSDFKSYQTFLVSLKGGSYGDNNQTDDINQIVLSDGSSIVNSYDFLSEKYSYLKPESYVDDLQESNSTKYEDISNALLSAEIIGGASQPKLADNGYSINEQGKYLINLIRLIKDTYLSGVQ---SGDSSTDASKIIP-----LATKIINQYDGNTEGSVSGTINVNDYYHLFALATPQNYFLYVNSDATDSNSSYLFNNNTQNLVYNFVTRGGLTPLSYLSKAILSAPYGNAIVVNDQWLSSNQKSVIPVSEWNKALLMNSREFEEWKSNLSANYKVTINSLDFIIIGSGTSFENSFPVVSLESPIPNPKTEGAIYVDDIGYNSLLYTNSEVNQDIYFAIKFKNNGKVDLEYVNSRMNKYLDNAYLSSTLKNNTNLLTARISYPRVIAGYVNIFAIILIVVLMVIGIYLSSLLIKIYVEKNRIPLAVAKANGISTWQISLSLSVFGIAAAFISGILGYVVAYFAQGMFLGILNNFWFIPIGEHTFSAIGLIGAIGSLYLAFLLFCVIGVVRTFRNPINELLSSTEELKVNKLLYLIKSRKIPLFALTKFRISLSLSKLTRFILFVILCSAGISIITVGSAIPRKFETSQNSTLSNKQYSYRYNLQTPSEQSGLYKYQEYTDLGITDEERGIFNIYENPMFEWQINPYKTISTSDSQETRDLMALRDLNGNVITYENGKKKYFTNFLLPSYVSINSFTNDIELFRNVIVSKWLIDFDISVAGIYINAWDFVSNAFPTDLISRINAISNNFLVNVLEVPELKAINDSKSYIIQNSSGNWVLDSNSVLDLSNVANTSSIRFNDEFLKFIGMVYGNKQLSSLDAKITFGIVPFRDLSSNDLTETYTYLDAILNDSSVRIPSLRNDGKRRLTNIEQQIYGIKEDSKYVTLVDDENRNLNSLLSQPSEISSDGFETYPVVINQGAAYKYDLEIGESFKIDINNTYTRYTDRMMNKNPVKTIKLKIVGISSDSFQTGMYISQENANQILGLNFSQGATIVGSSNYDVNQKLTTTVLGDWSSGVLATPTSSTDNKYVVIKKSYPTDYVPFNGVFSKEENPLLVNSLLLENTSGLWGNYSSFNDAAFATLVSFVGVKHVLNLVTPYSAKGVAELSAYYGLSTTDKYSLSVAMSNNMTILSLQSWLQSNIGTPSIVAINSFEYFQTLFDTYTTIFRTLLVIETLLICLFVPLIIIIIMIVSSVMMSDFRKLVAILKTLGYSDRENLLSILMIFVPVMLISLIVGIIVIASLSTFFNFMIFNAASIYLSPAIDWVSYLYGVIAIAGIVIINFIFVSVYLKKQNLKNSIS 1786
>gi|26554065|ref|NP_757999.1| permease [Mycoplasma penetrans HF-2] >gi|26454073|dbj|BAC44403.1| predicted permiase [Mycoplasma penetrans HF-2] (1818 aa)
Score = 3071, Expect = 0.0e+00, Identities = 769/1792 (42%), Positives = 1164/1792 (64%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGK-----YFNSLDEYA-NLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSA--DTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISG--KTYRVKNNNTDTPFFVGETGYGKEWW-TDQNYDLNGSNLNEIFSKFQTVEQTTDTPDIVNIMSSAYIQSSVALSLDKNIDWNIASLTPYYDYMRIMRDKRYLTQE---------TTGKN----QDLIVSVHLDMSKLSTLQRQTFDFVREKYGVQKYIDLTSFLYTVNGQSVKTALLASPNLSAELKKEIEGLSVDSLLPILKQTFGTTTGYE------ILITWLENYGNEKLITVKKELLKYEREFLSYKELSTFDNFTYKTQKSFTLSDFKTSQSFLVSHKG--GVSNPNENNSINDLQILSGSKITNGYDFLSSKYDYLNKEVYSDDEQKTNSTKYEDISNTLLSTTRIGGGSQQEIETGGYSINPNGDYLINLVKFINDSYVTGETENTNANNSSESSKLLSDRIKELAKKIVDHYN--GTTANVSGSINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDN-NNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQ----PKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELK--------------TINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSM--ETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGN-GTMETTVLGDWSSGVLKPSGTETNANYRIK--QVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFT---------DSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSIS------------SNSRNDIITRLSSSM-SISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           M QLIKQV KSFK S++LLIGL FI FAI+FA FSSLYF+SNI  S +SL+++SN   + + T  S+L +++LSYD D   N    KP SD       YF+S +E   N++ SF Y  T L+HSSF K +++RNYIFAYY  S   D+N +F   G+N A+ LY  RARG+L SYG   IP  S++WRA+GL L + DL+NI+Y +DPLTG+T ID+N     T+GYF+DGY++ST+T+  GN+ YP+NVT T A+DI+G  K YR KN +  TPFF  +     +WW  D ++DL     + I    Q         D+ N++ S        +SL  NI+W++A  +PYY+Y++I+RD RYLT+          T G +    +D + +VHL+M+ LS L+R+T ++V+  YG + Y DL SF+YTVNG  +K+ L    N+ +     ++  S ++L  +  Q    +   E      I+  W+ NY   KL  +   LL YE+E+++ K LST  N  +  Q+S+T+SD K+S ++LVS K     ++  ++N++N L + SG+++ N Y +L +     N                ED      +T+RI        E   Y++N NG+YL+NLVKF N+S V G T+    +  +   +     ++ LA  I++ Y    T +  + S+N NDYYHLF++ +P            D +   I + N+QN+  S     G  P  +    +   PYG+++V  + WL  N+KS++   +W K + M+S+++  W  NL    K+ INS  F IIG+GIS EN++P+ SI +P+PN   E + Y++D GY ++L T+S   +D YFA+  +     +L+S+ S + +     Y S++I +  NLLT RI  PK++  YI +F +IL+ V+ +IG+YL  LL+KIY+EKN++SLAIAKANG+SS++I  ++S+FG   A+ +G+VGYLSA  LQ +F+G++ N+W+IPIS   FS IG  SG A +Y+AFLLF  LGVWKTFR PIN+LLS + E+K+NK LYLLKS  T+  V+++FRI L+ +K++RF L V+LCS G+S I+ G +IP+KF  SQT+T  +  Y YS++LQTP++Q+GLYKVQ+YA LG  DE+ GIY +++N  +    +PY+ L        KDLLALRD  GNVI+Y+N       +YF+NLLLPSY+     +KDP  FRN+V +KWL+D+ I+IA + +N W FVS +F  +LISRI+A+SN+F+  ++   +                T+++ + +++ +++G + +N   V+   N ++ + IRFN+EFLK+IGM+YGN ELS+ D+K++FGIVPF ++  E+N+ TE+YTYL +T N P + IP+ +N+G + L  I+ EI GIK++S++V LI + +N+++S L     + D   VYP ++N G+AY+Y L+VG  F + V N+Y RYT  ++G +P+  VK KVVGIS+D+F    Y +Q+ AN ILGLNF+QGA I GTS       +E T+LGD S    +    E+N +++ K   V  P +YVPFNG+F+ EE PL  +SL LE  SG+WGNY+ F          ++ F    S++G  +I+N  +PY ++ LS L      +            +N R  +++ L ++  S+SSL   LQ  FG  ++VAI +  YF  +F TY TIFN+L+++E ++I L +P+II  +MIISS  +NDFR+++A+LKTLGY D+E L SI+V ++ ++L+S+ +GI ++A L  +F  ++FN +SI+L   I W+ ++FG   I+ I+  N +++ +  KKQNLRNSI
  S:     1 MTQLIKQVFKSFKRSVVLLIGLLFIGFAIIFAFFSSLYFTSNIDYSSSSLNSASNLGTSIVSTNSSDLNSSSLSYDIDGAFN-EYQKPTSDNNQTSSVYFSSYEEKVQNMDKSFAYTPTYLHHSSFVKDTSSRNYIFAYYNGSTNKDSNPFFTQAGINDANQLYTKRARGVLYSYGIASIPSESSKWRAWGLFLDDSDLQNIVYAVDPLTGETQIDSN-QMATTMGYFNDGYLNSTMTVREGNMIYPSNVTATKASDITGNNKAYRYKNGDYYTPFFSSK----DDWWVNDFSWDL-AQGWDWILQMLQ------QGADVFNLLPSMSKNIKNTISLSPNINWDLAVFSPYYEYLKILRDGRYLTKNGNSNTDNKPTNGNDIIQFKDYVFNVHLNMNNLSQLERETLNYVKSTYGAKTYNDLVSFVYTVNGSWIKSKL--KENVDSSQTTNVDNNSFETLSDLNTQYTLRSNDKEKISAKDIVKAWIRNYSESKLSELSSSLLTYEKEYIASK-LSTVSNIEFNNQRSYTISDSKSSITYLVSRKDYDPTNDKYQSNNVNKLVMTSGTRLENSYKYLDAANSLFNT--------------VED------TTSRIPAVEPDNKEINSYALNANGNYLMNLVKFTNESIVAGITDVPIIDGMASDYQ----TVRNLAANILNQYGIGDTPSTTAPSVNANDYYHLFSIVSP------------DFSKDNIVTTNDQNISLSIQVKWGGAPAHFPGSVTYVTPYGSAVVTTQKWLELNKKSIVDPQEWAKAVYMDSADYVEWLNNLSDDKKIVINSKSFAIIGTGISAENAYPVTSITNPLPNFSTESLIYLNDQGYRTILATSSLITEDSYFAVA-STNNSDNLASVQSAVRNLVSTPYSSNDIVNNNNLLTMRIGVPKMMTTYIQIFTSILIVVISIIGVYLCYLLIKIYIEKNQISLAIAKANGVSSLKIIFAVSMFGLVVAVFAGIVGYLSALFLQSIFLGVIGNYWFIPISQHLFSPIGFISGTAIIYLAFLLFVSLGVWKTFRKPINDLLSITTELKINKFLYLLKSSFTNASVISRFRIGLSFTKMSRFFLLVLLCSVGISFISTGVSIPQKFTKSQTDTQNSINYKYSFDLQTPTQQTGLYKVQDYADLGITDESLGIYSMYANKNYTGYTDPYQTLFEKEGSSGKDLLALRDSSGNVIEYTNSDGTKYKRYFTNLLLPSYIAQFGIQKDPHFFRNSVGTKWLLDYTINIASLSLNIWDFVSSSFSSDLISRIDALSNDFVNQIMAATDANGNTYLAEKNEIGNGTVDNPKPFLSLDTNGIWQINASNVMSSLNATNVDDIRFNDEFLKFIGMVYGNKELSAADSKMAFGIVPFNNLNDESNNQTETYTYLTSTFNSPNITIPASKNDGISKLSGIDVEILGIKENSKYVKLIDEDENNISSLLSTTSASADGNTVYPVIINVGSAYKYGLKVGQEFDVLVSNTYDRYTKKIAGEDPSVDVKFKVVGISADSFGAQFYTNQEYANKILGLNFDQGAIIYGTSKKTQWNQVEATILGDESLMAKEEVNIESNGDHKFKVNYVAPPSNYVPFNGIFTAEETPLQTSSLTLEMVSGIWGNYNYFKRGDAINASFNNYFVSGDSSIG--DILNAVIPYDQKTLSVLIEKFKTANPNYFASITVDDTNRRTTVLSYLRTTYNSVSSLAELLQTTFGNNNMVAIQNLTYFDILFGTYTTIFNSLLTVENMLIILIVPIIIFTIMIISSTTLNDFRKMLAVLKTLGYKDREILNSIIVSYLLILLVSIGIGIGLLAGLLTVFQLLIFNLSSIFLTSAISWIPFVFGASGILAILIFNILYITVLFKKQNLRNSI 1817
>gi|13508423|ref|NP_110373.1| suggestion: membrane transporter component [Mycoplasma pneumoniae M129] >gi|2496460|sp|P75109|Y684_MYCPN Uncharacterized ABC transporter permease MG468 homolog >gi|1673819|gb|AAB95806.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (1882 aa)
Score = 1257, Expect = 1.7e-135, Identities = 347/1103 (31%), Positives = 581/1103 (52%)
  Q:   664 NDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRAS---LYAPYGNSIVVNEAWLNSNQKSVLPTN---QWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFA-----IRFNYGEKVDLSSLNSLMDSY-----TKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQ-----GNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYV-LNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINP-TKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEY--PKSYVPFNGVFSKEENPLLVN-SLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLA-------TNLSISSNSRNDIITRLSSSM-SISSLQTWLQNNFG----TPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFI 1766
           N+Y  L +  TP+         +P+     +   N Q L+       G+ P T  +      +  P  +  VV++ WL  + K VLP      W++ L  N      W  +L  +YK +IN L F I+G G S E  +P++S  SP+PN + EG+ ++++ GY S+L+    ++++ Y+A     I+  +  +  +  + S +  Y     +  A+   +I+ F  L TAR  +P L+  Y+ +   ++ A L ++ +YL+ LL+K +++KN+   +I +A G S+ +    +SVF    A+ S   G L AFLL+    GI+S +W+I +    F++I  F  +  +++ F   S++   + F  P+N L+    E K +  L+LLK K  +   L KFR++L +S+L+R   +V L S  L +I +   IP+KF  +Q+NT+ NR + Y  NLQTP+EQSG Y +Q Y+  G  D++ GI  ++ +   D     ++       D++    L++L+     GN IK+ NG+     NLLLPS+        D   FR+A +SKWL+DF I + G  +N W+ V ++ P ++   ++A S+ FLI+VL   +     +   ++TRN   N++ L+  +VL   NV +   ++FN +FLK++  +YG+ ELS  D+K+++GIVP        + E+YTY+          +            D    + GI  DS+FV L     N L S +    E          +VN G  Y  + ++GD   I  KN+ TRY++      P T +VK +VVG+S+DAF   +YI+Q+ AN +L LN   G  +I      +G       G  S G     G+ ++      ++EY  P  YVPFNGVFSKE NP LV+ +LVL +  G+WGN++ F ++ F  LV     N II   +P   + L +LA        +     N R  +I + +S   S  SL +  +  FG     P++    +      + +    +FNT+  ++  ++   IP I I  +++   M+ + +R+   LK++GY D +NL+S+L  F+P  ++SL++ IAI+A L V    +VF  A ++L    ++L Y+ G +
  S:   755 NNYVALLSYFTPE-------FQDPNE----LVVTNRQKLDIPIIFKNGVNPLTLPTDQQSLVVQTPEAHGAVVSQQWLFKHDKEVLPLEGEYSWKEAL-ENPKNLPNWLNDLPDKYKFSINGLTFAILGVGESVETGYPVLSTNSPLPNSQDEGLIFLNEQGYRSVLFAVPAASEENYYAFKSDDIKAKFPGQDPIQVVASKLKGYLNVPDSDLAFNVKDISKFQYLTTARNYFPDLVQNYLAIASVVIAAFLSILALYLTILLIKSFIKKNQTEFSIIRAGGFSTAKFIAGMSVFAGIVALASSFFGVLFAFLLERQVKGIISRYWFIALPANSFNWISFFGSMLLIFVIFQFISWIAFKQLFSKPVNVLIDQGNETKFSVFLHLLKRKSYTMTPLGKFRVSLIISRLSRLFTYVGLSSIALLLIGIAGTIPQKFGAAQSNTVLNRNFNYRLNLQTPTEQSGWYAIQPYSRFGQTDDSLGIKALYKDKG-DQIQQQQQQQQQQGNDKEHPYNLKELKISDRGGNPIKH-NGKEIELGNLLLPSFGGAQQLNTDENFFRHASLSKWLIDFPIRVGGANINPWEIVEKSIPKQITQLLSASSDQFLIAVL-TDDYFNNLNNNGFLTRNPRTNFIQLDAARVLTQINVFNPGGVKFNEQFLKFLTKVYGDPELSYQDSKLTYGIVPVDP----QIEETYTYVQGPFGFKETELNP----------DSPYTLTGISPDSKFVNLTDSGGNSLRSLISSDSEMN-------VIVNAGFQYANNTKIGDFIFIQPKNTATRYSEKFLKSPPKTPTVKFRVVGVSTDAFGQELYINQNIANRLLKLNGFDGRGVI-KDVVKDGQSTDDSGGTSSGGGSCGGGSTSSTTKDKYKIEYVKPTGYVPFNGVFSKELNPSLVSKALVLNSNIGVWGNFTDFGNN-FTNLVKGKE-NKIITSILPSDPDILKQLAKEKGENGVDSMTYENLRKKVIEKYTSEWSSTQSLASGARGIFGDNIMVPALKLDAAGASAQIIRNNAEVLFNTVNQVDGFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKSIGYKDSQNLVSLLCFFIPAFVLSLLISIAILAGLLVGVQALVFGVAQVFLTNVFEFLPYMVGIV 1856
Score = 128, Expect = 1.4e-04, Identities = 69/264 (26%), Positives = 109/264 (41%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLD-EYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNE-DLKNIIYEIDPLTGQTAIDANS----NYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISGKTYRVKNNNTDT 264
           M    KQ+ KS K    LL G+ F+ F+I+F   S L  S+N+ N+Y +L   +N ++                  F   + +   +   + ++F+ +      +NF + Y E++    S  K S          T S+D N   KGD VN  D L+  R RGIL +YG   I +    ++   +   N         E + L   T  D  +       N LGYF DG I   I L  G  ++P +         + K   +K  ++ T
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSILQLSNNLVNTYTALVQKTNSSDIVAPAI------------FKESSPVYKTELKEEKRHFSKIKLTEKKINFIWPYQESDFGSDSEKKDST---------TKSSDNNPR-KGD-VNDKDKLFLARKRGILKAYGEANIAE-KRIYKGLAVSFQNTYSFTGTDQESNNLNQNTVSDPQNLIYDKEGNLLGYFVDGLILDGIPLRAGIARFPGDKGKGEDKKTTKKKSEIKQASSAT 246
>gi|1209522|gb|AAC43650.1| orf1882fr (1848 aa)
Score = 1240, Expect = 1.6e-133, Identities = 344/1089 (31%), Positives = 574/1089 (52%)
  Q:   664 NDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRAS---LYAPYGNSIVVNEAWLNSNQKSVLPTN---QWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFA-----IRFNYGEKVDLSSLNSLMDSY-----TKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQ-----GNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYV-LNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINP-TKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEY--PKSYVPFNGVFSKEENPLLVN-SLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLA-------TNLSISSNSRNDIITRLSSSM-SISSLQTWLQNNFG----TPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYL 1752
           N+Y  L +  TP+         +P+     +   N Q L+       G+ P T  +      +  P  +  VV++ WL  + K VLP      W++ L  N      W  +L  +YK +IN L F I+G G S E  +P++S  SP+PN + EG+ ++++ GY S+L+    ++++ Y+A     I+  +  +  +  + S +  Y     +  A+   +I+ F  L TAR  +P L+  Y+ +   ++ A L ++ +YL+ LL+K +++KN+   +I +A G S+ +    +SVF    A+ S   G L AFLL+    GI+S +W+I +    F++I  F  +  +++ F   S++   + F  P+N L+    E K +  L+LLK K  +   L KFR++L +S+L+R   +V L S  L +I +   IP+KF  +Q+NT+ NR + Y  NLQTP+EQSG Y +Q Y+  G  D++ GI  ++ +   D     ++       D++    L++L+     GN IK+ NG+     NLLLPS+        D   FR+A +SKWL+DF I + G  +N W+ V ++ P ++   ++A S+ FLI+VL   +     +   ++TRN   N++ L+  +VL   NV +   ++FN +FLK++  +YG+ ELS  D+K+++GIVP        + E+YTY+          +            D    + GI  DS+FV L     N L S +    E          +VN G  Y  + ++GD   I  KN+ TRY++      P T +VK +VVG+S+DAF   +YI+Q+ AN +L LN   G  +I      +G       G  S G     G+ ++      ++EY  P  YVPFNGVFSKE NP LV+ +LVL +  G+WGN++ F ++ F  LV     N II   +P   + L +LA        +     N R  +I + +S   S  SL +  +  FG     P++    +      + +    +FNT+  ++  ++   IP I I  +++   M+ + +R+   LK++GY D +NL+S+L  F+P  ++SL++ IAI+A L V    +VF  A ++L
  S:   755 NNYVALLSYFTPE-------FQDPNE----LVVTNRQKLDIPIIFKNGVNPLTLPTDQQSLVVQTPEAHGAVVSQQWLFKHDKEVLPLEGEYSWKEAL-ENPKNLPNWLNDLPDKYKFSINGLTFAILGVGESVETGYPVLSTNSPLPNSQDEGLIFLNEQGYRSVLFAVPAASEENYYAFKSDDIKAKFPGQDPIQVVASKLKGYLNVPDSDLAFNVKDISKFQYLTTARNYFPDLVQNYLAIASVVIAAFLSILALYLTILLIKSFIKKNQTEFSIIRAGGFSTAKFIAGMSVFAGIVALASSFFGVLFAFLLERQVKGIISRYWFIALPANSFNWISFFGSMLLIFVIFQFISWIAFKQLFSKPVNVLIDQGNETKFSVFLHLLKRKSYTMTPLGKFRVSLIISRLSRLFTYVGLSSIALLLIGIAGTIPQKFGAAQSNTVLNRNFNYRLNLQTPTEQSGWYAIQPYSRFGQTDDSLGIKALYKDKG-DQIQQQQQQQQQQGNDKEHPYNLKELKISDRGGNPIKH-NGKEIELGNLLLPSFGGAQQLNTDENFFRHASLSKWLIDFPIRVGGANINPWEIVEKSIPKQITQLLSASSDQFLIAVL-TDDYFNNLNNNGFLTRNPRTNFIQLDAARVLTQINVFNPGGVKFNEQFLKFLTKVYGDPELSYQDSKLTYGIVPVDP----QIEETYTYVQGPFGFKETELNP----------DSPYTLTGISPDSKFVNLTDSGGNSLRSLISSDSEMN-------VIVNAGFQYANNTKIGDFIFIQPKNTATRYSEKFLKSPPKTPTVKFRVVGVSTDAFGQELYINQNIANRLLKLNGFDGRGVI-KDVVKDGQSTDDSGGTSSGGGSCGGGSTSSTTKDKYKIEYVKPTGYVPFNGVFSKELNPSLVSKALVLNSNIGVWGNFTDFGNN-FTNLVKGKE-NKIITSILPSDPDILKQLAKEKGENGVDSMTYENLRKKVIEKYTSEWSSTQSLASGARGIFGDNIMVPALKLDAAGASAQIIRNNAEVLFNTVNQVDGFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKSIGYKDSQNLVSLLCFFIPAFVLSLLISIAILAGLLVGVQALVFGVAQVFL 1842
Score = 127, Expect = 1.6e-04, Identities = 69/264 (26%), Positives = 109/264 (41%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLD-EYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYFKGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNE-DLKNIIYEIDPLTGQTAIDANS----NYVNTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISGKTYRVKNNNTDT 264
           M    KQ+ KS K    LL G+ F+ F+I+F   S L  S+N+ N+Y +L   +N ++                  F   + +   +   + ++F+ +      +NF + Y E++    S  K S          T S+D N   KGD VN  D L+  R RGIL +YG   I +    ++   +   N         E + L   T  D  +       N LGYF DG I   I L  G  ++P +         + K   +K  ++ T
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSILQLSNNLVNTYTALVQKTNSSDIVAPAI------------FKESSPVYKTELKEEKRHFSKIKLTEKKINFIWPYQESDFGSDSEKKDST---------TKSSDNNPR-KGD-VNDKDKLFLARKRGILKAYGEANIAE-KRIYKGLAVSFQNTYSFTGTDQESNNLNQNTVSDPQNLIYDKEGNLLGYFVDGLILDGIPLRAGIARFPGDKGKGEDKKTTKKKSEIKQASSAT 246
>gi|12045327|ref|NP_073138.1| ABC transporter, permease protein [Mycoplasma genitalium G37] >gi|6136529|sp|Q49460|Y468_MYCGE Uncharacterized ABC transporter permease MG468 >gi|3845063|gb|AAC72488.1| ABC transporter, permease protein [Mycoplasma genitalium G37] >gi|166078936|gb|ABY79554.1| ABC transporter, permease protein [synthetic Mycoplasma genitalium JCVI-1.0] (1783 aa)
Score = 1180, Expect = 1.3e-126, Identities = 331/1073 (30%), Positives = 568/1073 (52%)
  Q:   694 IFSNNNQNLEYSFSANAGMTP---TTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTN---QWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRF----NYGEKVDLSSLNSLMDSY-----TKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTM---FDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYV-LNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDS-MSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNAN--YRIKQVEYPKSYVPFNGVFSKEENPLLVN-SLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNS-------RNDIITRLSSSM-SISSLQTWLQNNFGTPSIVAINSFEYFTT----VFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFI 1766
           +   N Q LE   +   G+ P    T      +  P  +  VV++ WL  + K +LP      W K  L   + F  W  +L  RYK +IN L F I+G G S E  +P++S++SP+PN + E + +V+D  Y S+L+    +NQ+ Y+A +      + ++  +  + + ++ Y     +  A+   +I+ F  L TAR  +P L+  Y+ +  T++   L+++ +YL  LL+K +++KN+   +I +A G S+ +  + +SVF    AI+S  +G L AFLL+G   GI++ +W+I +    F+++  F      +  F   S++   + F  P+N L+    E K + LL+LLK K  +   L KFR++L +S+ +R   +V L S  L +I +   IP+KF  +QT+T  NR + Y  NLQTP+EQSG Y +Q Y++ G  D   GI  +++ ++     N +PY+             L L++ Q   IK ++G      NLLLPSY        D   FR+A +SKW++DF I + G  +N W+ V ++ P ++   ++A S+ FLISVL       +N    ++ RN   N + L+  +VL   +V +   ++FN+ FL ++  +YG+ EL+  D+K++FGIVP       ++ E+YTY++                  NL  +    + GI  +S FV LI    N L + +    E          +VN G  Y  ++ +GD   I  KN+ TRY++  +       +V  KVVG+S+DAF   +YI+Q  AN +L L+ NQG  II                     V+K +  ++ ++  Y I  V+ P  YVPFNGVFSKE  P L+N +LVL +  G+WGN++ F ++ F  LV    ++ +I   +P   E ++KLA    I + +       R +++ +  +   S++ L     + FG   I  + + +   T    + +    +FNT+  ++  ++   IP I I  +++   M+ + +R+   LK +GY D +NL+S+L  F+P  +++L++ I ++A + +    +VFN A ++L    ++L Y+ G +
  S:   705 LIETNRQMLEIPITVKNGVNPLILPTDQQNLVVQTPEAHGAVVSQQWLFRHNKEILPQEGEYAW-KTALQTPNNFPNWLNDLPDRYKFSINGLTFAILGIGESVETGYPVLSLQSPLPNTQDEALIFVNDQAYRSILFAVPAANQENYYAFKSTDLKQHTDQDPVQFIANRLEGYLDVPRSDLAFNVKDISKFNYLTTARNYFPDLVQSYLAIVSTVIAIFLIILALYLIILLIKSFIKKNQTEFSIIRAGGFSTTKFIVGMSVFAGIVAIVSSFLGVLFAFLLEGQVKGIINRYWFIALPENSFNWLSFFGSFFITFFVFEFISWIAFKQLFSKPVNVLIDQGNETKFSVLLHLLKHKSHTMSPLTKFRVSLIVSRFSRLFTYVGLSSVALLLIGIAGTIPQKFSAAQTSTSLNRNFNYKLNLQTPTEQSGWYAIQPYSHFGVTDNNNGIKTLYNESVQANSQNEHPYK----------PSNLKLKNRQDQPIKAADGTELELGNLLLPSYGGAQQLNTDENFFRHASLSKWIIDFPIRVGGSNINPWEIVEKSIPKQITQLLSASSDQFLISVLTDDFFNNLN-ANGFLIRNPRTNQIQLDASRVLTTIDVFNPGGVKFNDSFLSFMLKVYGDFELAKQDSKLNFGIVPVDP----AIEETYTYVEGPFG----------FQEDNLDENSPYTLTGINPESSFVNLIDGSGNSLRNLISSDQEMN-------VIVNAGFQYANNINIGDYVYIKPKNTATRYSEKFLKAPLNNSTVAFKVVGVSTDAFGQELYINQHIANNLLKLSGNQGRGII-------------------RDVIKKTNGQSQSSDEYEIDYVK-PNGYVPFNGVFSKELKPSLLNKALVLNSIIGVWGNFTDFGNN-FQNLVRN-KLDKVITSILPTDPEIINKLAQEKQIINTTSMNYESLRKELVNKYKTEWNSVNLLSQNASSIFGNNIIAPVLNIDAAGTSAQIIRNNAEVLFNTVNQVDAFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKAIGYRDVQNLISLLTFFIPAFVLALLISIGVLAGVLIGIQAVVFNVAQVFLTNVFEFLPYMVGIV 1757
Score = 174, Expect = 6.9e-10, Identities = 102/386 (26%), Positives = 174/386 (45%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLD-EYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYF--KGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYV-----NTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISGKTYRVKNNNTDTPFFVGETGYGKEWWTDQNYDLNGSNLNEIFSKFQTVEQTTDTPDI------------VNIMSSAYIQSSVALSLDKNIDWNIASLTPYYDYMRIMRDKRYLTQETTGKNQDLIVSVHLDMSKLSTLQRQTFDFV 386
           M    KQ+ KS K    LL G+ F+ F+I+F   S +  S+N+ ++Y +L + +N ++       + LK  N  Y   SL N        D  YF+ +  +   +N+ F Y E +    S + QSN          S  + NK    KGD VN+ D L+  R RGIL +YG   I +    ++   +   N D  N     D +T +  I    N +     N LGYF+DG I  TI+L  G  ++P +   ++ T +     +  NN+             K+   +  Y  N  N ++++  F++ E   D  DI             N   + Y    + L +D    +    + P+ + +     + + TQ+ +  NQ   ++ +LD+SKL+ L  +   ++
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSIVQLSNNLVSTYTTLVSKTNSSDI---VAPAILKEANPVY-IASLTN--------DSGYFSKIKIDDKKINYLFPYQENDF--GSDSGQSNG---------SGDNQNKTIPRKGD-VNEKDKLFLARKRGILKAYGEANIAE-KRIYKGLAVSFNNTDSFNGSDISDSITNRHIISDPQNLIYDASGNLLGYFADGLIKETISLRAGIARFPGDKGKSTGTQVKITQKQQTNNDPQ-----------KDSTVNSLYKTN--NKDKVW--FKSDETKADNTDISANYLFTGGNEAANWFPNLYANIPIDLEIDPGSQF-WKDVNPFKEIV-----EEFQTQKESKDNQSFTLTFNLDISKLNKLDNEQLKWL 360
>gi|66880419|ref|ZP_00405400.1| hypothetical protein MgenG_01000026 [Mycoplasma genitalium G-37] (574 aa)
Score = 710, Expect = 3.9e-72, Identities = 206/627 (32%), Positives = 323/627 (51%)
  Q:  1011 FRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTM---FDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYITRNSSGNYV-LNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDS-MSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNAN--YRIKQVEYPKSYVPFNGVFSKEENPLLVN-SLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT 1637
           F  P+N L+    E K + LL+LLK K  +   L KFR++L +S+ +R   +V L S  L +I +   IP+KF  +QT+T  NR + Y  NLQTP+EQSG Y +Q Y++ G  D   GI  +++ ++     N +PY+             L L++ Q   IK ++G      NLLLPSY        D   FR+A +SKW++DF I + G  +N W+ V ++ P ++   ++A S+ FLISVL       +N    ++ RN   N + L+  +VL   +V +   ++FN+ FL ++  +YG+ EL+  D+K++FGIVP       ++ E+YTY++                  NL  +    + GI  +S FV LI    N L + +    E          +VN G  Y  ++ +GD   I  KN+ TRY++  +       +V  KVVG+S+DAF   +YI+Q  AN +L L+ NQG  II                     V+K +  ++ ++  Y I  V+ P  YVPFNGVFSKE  P L+N +LVL +  G+WGN++ F ++ F  LV    ++ +I   +P   E ++KLA    I +          ++SM+  SL+  L N + T
  S:     2 FSKPVNVLIDQGNETKFSVLLHLLKHKSHTMSPLTKFRVSLIVSRFSRLFTYVGLSSVALLLIGIAGTIPQKFSAAQTSTSLNRNFNYKLNLQTPTEQSGWYAIQPYSHFGVTDNNNGIKTLYNESVQANSQNEHPYKP----------SNLKLKNRQDQPIKAADGTELELGNLLLPSYGGAQQLNTDENFFRHASLSKWIIDFPIRVGGSNINPWEIVEKSIPKQITQLLSASSDQFLISVLTDDFFNNLN-ANGFLIRNPRTNQIQLDASRVLTTIDVFNPGGVKFNDSFLSFMLKVYGDFELAKQDSKLNFGIVPVDP----AIEETYTYVEGPFG----------FQEDNLDENSPYTLTGINPESSFVNLIDGSGNSLRNLISSDQEMN-------VIVNAGFQYANNINIGDYVYIKPKNTATRYSEKFLKAPLNNSTVAFKVVGVSTDAFGQELYINQHIANNLLKLSGNQGRGII-------------------RDVIKKTNGQSQSSDEYEIDYVK-PNGYVPFNGVFSKELKPSLLNKALVLNSIIGVWGNFTDFGNN-FQNLVRN-KLDKVITSILPTDPEIINKLAQEKQIIN----------TTSMNYESLRKELVNKYKT 572
>gi|31544225|ref|NP_852803.1| hypothetical protein MGA_0654 [Mycoplasma gallisepticum R] >gi|31541069|gb|AAP56371.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (1361 aa)
Score = 612, Expect = 9.9e-61, Identities = 257/1040 (24%), Positives = 491/1040 (47%)
  Q:   753 KVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--------LYTN---SFSNQDIYFAIRFNYGEKVD-LSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISR--------INAISNNFLISVLEVPELKTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIR---FNNEFLKYIGMIYGNTELSS---IDAKISFGIVPFRSMETNSLTE------SYTYLDA-TLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGIN-----PTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFT--DSGFAGLV--STVGINNIINMAMPYSEEG-------------LSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT-PSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +++ +N   F      +  RYK+ I+   ++I+G+G+S E  +PI S  + IPNP  + + YV+D GY  L        + TN    F ++++  A R    +K++  +S+N       K AY +++I++  NL  AR ++   +   I     +L+A+++++ + +  L+VK Y++KN+ +L I  ANG +  +I +S+++F    ++I G+ GY+  ++LQ + +   S+FW+IP+ +R FS   L +      I F + SFL      R  + + L +  E KV+K+   +K       V+ +FRI++  + + +  L  +L +A + ++    +    ++ ++ +T     Y Y  +L TP++QSGL   QE+  LG  D A   ++   N    N        + TD ++     L  +  N I   + +  Y                      +N V SK  +D+ I +  +  N W   S   P    +         + AI+NN +   L+ P     ND   YI        V NP+   ++  ++   ++       EF+ ++   + N   ++   +D KI++ ++   +     + +      +YT +D  T ND   +I  ++N  K   +D        +KD     LI +    +N KLF   +T+DN    P ++N+  A     +VGDT    + N   R +D ++ IN       + VK KV+GISS A    +Y S D AN +LG                                         +++ I+        +PFNG +S + +     S  L + SGL  + S+F+  +     ++  S +   + ++ + PY++               L  L    ++  N+ +      + + S+S     L + +G+ P    IN     ++    +  I  T ++I+ +II + +P++ +IV++IS++++++ +++   +K LG+SD+  + S L I++PV +  L+VG  +   L  ++N ++  +ASI L   I     L     ++GI +I+F      L+K  +   I
  S:   360 QLMSLNGDAFLERFNTISDRYKIQIDQTSYLILGTGVSPEFIYPIYSFTNFIPNPVNQRIYYVNDYGYSRLREAFSTNPIETNIVGRFKDRNLSQAQRQLALDKINQWASINMAWPPNLKSAYFANDISNILNLRAARTTFIPSLLNTIKNTSLMLMAIIILLALMVGILIVKSYIDKNRQTLGILLANGFNKTKINLSMAIFSFIPSLIGGMAGYILGYILQEVAINAFSSFWFIPVELRRFSATALVTSFFLPVIIFGVTSFLVSVYLMRKNVVDSLKNDSEYKVSKISVYIKKPIAILSVMNRFRISIAFNSMWKLFLLCILSAATMVVLIFSLSTLNVYDKAKNDTFGANNYKYYVDLATPTQQSGLIMYQEFKDLGKTDAALAGWEDHKNYFLAN--------SRTDPNQSGWSNLHIVGLNDIIDQSSKVTY---------------------LKNYVQSKIGLDYLIGLGVLSANPWSLSSSLMPSNQAAASEKSYEIFLQAIANN-VYRNLKTP---ADNDPSYYI------RIVFNPQLNRNVYEINQDQALSGGILKPEFIHFLIQQFENISNNTYGLVDYKITYNVIGLGAKTIGDIKDKESPKFAYTRIDTVTDNDQKFQIKGIKNWIKTTNLDDVD-----RKDYLGPILIDNNNKVINQKLFN--QTDDN----PIIINEFVAKNNHWKVGDTIDFTITNRVDRISDKLNIINHDEYLKNQKVKFKVIGISSSARDNDLYTSYDLANKLLGF----------------------------------------SDFEIEH------KLPFNGYYSDDLDA-FERSTPLFSESGLLPSTSNFSVDNKQLQKIIRNSILNYQSTLSTSTPYNQLSSTRQAYVDDYKALLVALGEVKNLDGNNFHQWTELKADNQSVSDYIKKLVSVYGSLPYNTMINFLYNSSSNRAIFENISKTSLTIQNVIIAMIVPIVTLIVILISNMLIDELKKIAIRMKALGFSDRAIIFSFLSIYIPVFIFGLLVGGPLSLILVNIYNLIILKSASIALFTTISITHILGALTGVMGIFSISFFTNWYTLRKMKIAQEI 1358
>gi|13507819|ref|NP_109768.1| ABC transporter membrane protein [Mycoplasma pneumoniae M129] >gi|2496282|sp|P75613|Y080_MYCPN Uncharacterized ABC transporter permease MG064 homolog >gi|1673728|gb|AAB95723.1| Probably ABC transporter membrane protein subunit [Mycoplasma pneumoniae M129] (1386 aa)
Score = 523, Expect = 2.4e-50, Identities = 260/1044 (24%), Positives = 457/1044 (43%)
  Q:   749 NQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYE---SLLYTNSFSNQDIYFAIRFNYGEKV--DLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISY-PKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQT-NTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPEL---KTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIR-----------------FNNEFLKYIGMIYGNTELSSIDAKIS-FGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQ---FVTLIGDKKNDL------------NSKLFEPVETEDNYLVYP--------AVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSIS---SNSRNDIIT--RLSSSMSISS-LQTWLQNNFGTPSIVAINSFEYFTTVF---------DTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           N W ++  +  +EF    Q +D RYK+ ++ +E++I+G GI+ +  +P+ S    IPN   E + YV+  GYE   S   TN      +      N+   V    +  N       K AY +++ T+  NLL AR  + P LI   I+L  + L   +L++ I+++ L++  Y++KN   + I KANG+S  +I +SL +F     I+   +GY     +Q + + + SN+W+IP     FS +GL      + +     S    W   R  + ++L    E KV+ L    K     F ++ +FR+AL  +   + +   ++ +  + I+ +  A    F+ +QT  TL    + Y + L +P+EQSGL K Q +A LG  D+        +N         R  + S D+ +              K+ N Q   F             F  D     N V SK  +D+ +    +  N W+      P    S  N    NFL +++ +      K I  T++ +T      Y ++  K L   N    N I+                  +N+F K+   +Y    L     K     +  F     N +   Y+  +A        +P V       +I + KE    +KD+    F+TL     ND             N+ L   + T ++ ++           ++N  AA +Y L+ G    + + N Y R    +   +PT +    +VGI++       Y S   A T+L               Y N                                E+ +  +PFN  ++    P    S  L + SGL+   SSF  +     V T  I   I      S+  + K A   + +   ++S+N+ +   RL  ++ I+S L +     + T      +   Y +T+            +  I NT   I+T  I + IP+I++IV+++S+ ++ + +++   LK LGYS+ + LLS L I++P+ +  L++ I I   L  L N ++F++A+I L   +++   +   + + G+++I F+   L L K  +   I
  S:   367 NHWNRIKRLPFNEFEREFQKIDKRYKMLVDKIEYLILGVGITPDFVYPVFSESLLIPNTANEQLYYVNQTGYERTASSFLTNPTETGIVARLPNLNHDLDVINQWAVKNMSWPPNLKAAYSNTDTTNILNLLAARTVFIPNLINT-ISLVSSFLTIAILLVAIFVTILILVSYLKKNTEQIGILKANGVSGRKINLSLLIFSLIPGIVGSFIGYTLGISMQNVAINLFSNYWFIPTQTSSFSVLGLLFFALLVVLMMSGISLFVGWLILRQDVVKILKHDSEFKVSHLGLWAKWLFAKFGIMTRFRVALAFNAPWKLVFLTLMSALTMMILNLSFATKDAFQVAQTKTTLTQSNHQYEFELASPTEQSGLLKWQLFAELGATDDRTTDAVKLANR--------RMEIQSVDESK--------------KWKNQQVINF-------VTDATGFSNDINYLENIVQSKIGLDYSLGFGNVSSNPWKLSETLMPANQASASNTAFQNFLKAIIVIDPNEGGKYIKQTKDEVTVRFL--YEIDSSKALKNGNTKSVNKIQKSTAAPQAQQGQSNQLMLDNDFAKF---LYKQFNLIKEGGKADPVDLNNFDFANQNQIKRFYSKYNA--------LPPVDYKLAFNVIGLPKETIANQKDAPLFGFLTLQAQLGNDAIKIKGIKDWKLDNTNLGPVLRTNEDEIINQRLFSKPNGIIINSSAAKKYRLKEGSQLHVKIHNGYKRVNAKLVNQDPTLTATFNIVGINNSVHEPEFYTSYKTAATLL--------------QYPN--------------------------------EWIEKQLPFNSFYANSILP-FTQSTSLFSESGLFPGTSSFAAN---NTVLTEVIKKTIEGGKTNSKTDVQKRAAQATANGKYNSSQNNKMNYERLQKALGITSDLDSSKAGEYATILERVYDGLPYNSTISFISNVQANDALFANIANTTQQIQTAAIGIIIPIIMLIVLLVSTTLIQELKKIAIRLKALGYSNPKILLSFLSIYLPLFIFGLLISIPISIYLIALHNQVIFSSAAILLEATLNFPTVILSMLVLSGVLSITFVLNWLELNKIKIAKEI 1383
>gi|12044916|ref|NP_072726.1| ABC transporter, permease protein, putative [Mycoplasma genitalium G37] >gi|6226729|sp|P47310|Y064_MYCGE Uncharacterized ABC transporter permease MG064 >gi|3844662|gb|AAC71282.1| ABC transporter, permease protein, putative [Mycoplasma genitalium G37] >gi|166079075|gb|ABY79693.1| ABC transporter, permease protein, putative [synthetic Mycoplasma genitalium JCVI-1.0] (1331 aa)
Score = 507, Expect = 1.6e-48, Identities = 262/1063 (24%), Positives = 475/1063 (44%)
  Q:   730 SIVVNEAWLNSNQ--KSVLP-TNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNY-GEKVDLSSLNSLM------DSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNT-LENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKT---INDTQNYITRNSSGNYVLNPEKVLDLTNVSD--TNSIRFNNEFLKYIGMIY---------GNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKE-------IFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSY----VPFNGVFSKEENPLL--VNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISS-LQTWLQNNFGTPSIVAINSFEYFTTVF---------DTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +IV    W    Q  K V P  N W+ +  +   +F +    +D +YK++I+++++++IG GIS +  +P+ S    +PN   E + YV+  GYE     +SF    +  AI       + DL+++N          +  K AY SS+ T+  NLL AR  +   +   INL    L   +L + I +S L++  Y++KN   + I KANG+S  +I +SL +FG   AI+  + GY      Q + + + SN+W+IP +   FS +GL      + +     S L      +  + ++L    E KV++L    K     F ++ +FR+AL  +   + +   ++ S  + I+ +  A    FE +Q+ T L N+ + Y + L + + QSGL K Q +A LGT D+        +N   D +N    +  S D   + ++       N +  ++G                  F  D     N V SK  +D+ +    I  N W+      P    S  N    NFL +++ +   +    I  TQ+ +T+     Y ++ +K L   N  +   N +  N++F K++   +          N +L++ID +    I  F +         Y      +  P   I    +  K   + ++ E       I GIK     V  +G   +D N+ +    E   NY   P +VN  AA +Y L +G    I V NS+ R  + +   +P  +   +VVGI++ A     + S   A                                                   K +EYP  +    +PFN  ++   N LL  V S  L + SG++   SSF+        +   +  +I   + Y    +++ ++N     +S+ +   +L  ++ IS+ L+    N +        N   Y +T+            +  I NT   I+ ++I + IP+I++I++++S+ ++ + +++   LK LGYS+ + L S L I++P+    L++ I     L  L N ++F ++SI+L   + + + +   + ++ +++I F+   L L K  +   I
  S:   316 TIVAPGNWTYQQQLGKEVYPDINNWESIKKLPLEQFESEFLKIDQKYKISIDNIDYLVIGVGISPDFVYPVFSASLIVPNIENEQLYYVNQTGYERTF--SSFLTNPVETAIVARLINLESDLNTINQWAVENMSWPTNIKAAYSSSDTTNILNLLAARTVFIPNLINTINLVALFLTIAILTVAIIVSILILISYLKKNTEQIGILKANGLSGKKINLSLLIFGLIPAIVGAISGYSFGIGFQDVAIHLFSNYWFIPTATSSFSVVGLLFFSLFVILIMSSISLLVGSIILKKDVVKILKHDSEFKVSRLGLSSKKLFARFGIMTRFRVALAFNAPWKLVFLTLMSSFTMMILNLSFATKDSFENAQSKTNLTNQNHQYEFELASATTQSGLLKWQLFAELGTTDKRSESSVKLANKRMDISN----VDASKDWKNQQVI-------NFLSDASG------------------FSNDLNYLENIVQSKIGLDYSLGFNNIVSNPWRLSETLMPTNQASASNTAFQNFLKAIITINPSQGSQFIKQTQDPLTKRFI--YAIDSDKALKNNNEQNGSQNHLTLNDDFAKFLYSQFELIKKSGNASNEDLNAIDFENPQTIRDFYNKYNALPPLDYKLSFNVIGLPKETIAGQIDTPKYGFLTLHGEYQNTPIKIKGIKDWKDKVDNLGPVLSDQNNHIINQ-ELFKNYSFDPLIVNNSAAKKYQLAIGSEINIAVNNSFKRIDNKIINQDPLVNATFRVVGINNSAHDPEFFTSYSTA--------------------------------------------------FKVLEYPNEWFVKKLPFNSFYA---NSLLSFVQSTSLFSESGIFPATSSFS-------TNNTVLVELIKKTINYKNGQMNQTSSN----DSSKKENYQKLQKALGISTDLEISKVNEYVAILARVYNGLPYNSTISFISNVAANNALFGNIANTTKQIQAVVIAVIIPIIMLIILLVSTTLIQELKKIAIRLKALGYSNLKILASFLSIYIPLFAFGLLISIPFSIYLIALHNEVIFASSSIFLDAFLSFESAIGSMLVLLAVLSITFVLNWLELNKIKIDKEI 1328
>gi|26554476|ref|NP_758410.1| ABC transporter membrane protein [Mycoplasma penetrans HF-2] >gi|26454486|dbj|BAC44814.1| probably ABC transporter membrane protein [Mycoplasma penetrans HF-2] (1485 aa)
Score = 420, Expect = 1.7e-38, Identities = 280/1133 (24%), Positives = 513/1133 (45%)
  Q:   660 SINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASL----YAPYGNSI--------VVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIY----FAIRFNYGEKVDLSSLNSLMDSYT------KKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAY----------------LGTND-----------EAGGIY--DIFSNTMFDNNNPY---RKLVTSTD-----------QDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIY-VNAWQFV---SEAFPL---ELISRINAISNNFLISVLEVPELKTINDTQ----NYITRNSSGNYVLNPEKVLDLTNVSDTNSI-RFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKD--SQFVTLIGDKKNDLNSKLFEPVETEDNY--LVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGI-NPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTS--TYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVE-YPKSYVPFNGVFSKEENPL--LVNSLVLENTSGLW--GNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           S+  +D Y+ +++A  +NY  YTN +N    S    ++ + NL+     + G+    +  R S      AP    I        +V+  +L +  K  +    W   L    + F  W  +L       I++  F+I+G+GI+ +  +PIVS  + +P+   E V Y +  GY  ++ +   ++Q+ +    F+ R +      L+ +NS+  +Y         AY+  + ++  +    R+ +   I   I      L   +L++ I ++ +++K  +E N+ SL I +ANG    +I + + +      + + V+GY+    LQ + + +L +FW +P  +   S+  +F  +  + + FL    +          +E +    + K+ K+   LK     F ++ + R A+  S L R IL  ++ +  +S +     I   F+ S   T   R Y Y+ NL TP+ QSG Y    Y                   GT D           E G  Y  D  SNT+F +N       +L++  D           +++    A  D+       S+  P   ++ L+P+     A K    +F +AV         ISI GI   N +Q +   ++A+ +   E  +    I+N F      V  +  IN+      +YI   S  NY    E    L + S+   + + +  FL  +  IY  T LS     I++       +        +TY++  + +   R     NN  +L       I GI  D  +  +++  +K   LN  L+      DN   +VYP V+N+ A  +YDL VG+   +D+ NS  RY+ +  G  NP      K++ I++       YI+Q +AN ILGL  N     + TS     N      +  D+ +     S T       +   + +  S   FNG+FS  E  L  +   + L + SG++   +  S  D+    L +        NM    ++ G   L  +    + +  D+I R++     SS                ++S    ++  +   T  +TL  ++   + + + + ++I++I+SS+++ND  +L AILK LG  DK+N  S L +++PV    L++ + I   ++ ++   +FN A I +     +  +L   + I+ I  +++      ++K +L  SI
  S:   303 SVTFDDIYN-YSLAN-ENYNPYTNQNNGTTVSDSKITSQSTNLKTIIDTSNGIINDNHQVRFSYSIAGVAPVSGYIEDFTSYGAIVSTNYLETLGKRPVNYQDWVSHLSDKQASFNAWLNSLS-ENTFEIDNQTFVILGTGITPDFMYPIVSFSNLVPDSNTEQVVYTNSSGYSKMINSFRGNDQETFLVGKFSTRNSNLNNQTLAQINSITTNYMAWPSNINAAYMYDDTSNTMSPTALRVIFIPQIVTTITSVSGFLTTFILILSIIIAVVIIKRCIETNRNSLGIMQANGYKKREIILGMCLLILIPVLAASVLGYILGISLQTVAINLLGSFWTLPTEISGISFASMFLTLFIVALLFLAIVIVFSSICLLGETSEFMKDDAKYKMTKVASALKKPFVKFSIIDRLRAAIAFSSLWRLILLSLMSALLVSSLTFSINILDSFKDSAEKTYGIRNYNYALNLLTPTLQSGQYYTVPYQQQGKTLNKTTYFDTSLATGTYDQSDNYISQRYWETGSAYNTDASSNTLFSDNLKKFGNYQLISQDDLNAQTSELYYLKNKTTTKAFADITLGAGSVSS-NPWTLASQLMPTNNTSYANKAFNGMFGSAVADS---TTPISIEGITETNLYQAIKKFTKAYAVLKDEADANATPIANGFGGGNPTVVLIDEINNNDSAFYDYIDSQSDPNYSYYLEFTTALMSGSNNGIVTKVSPGFLNLLYYIYSKTNLSEYTYSINY-----HKLVVEQQDSPFTYINFNIKNINSR---EVNNPDSL------NITGISNDFTNPNLSITNEKNRVLNQTLWNESSYVDNQGNIVYPIVINEYAKRKYDLNVGNVITVDILNSADRYSRTYFGASNPV--AYFKIIDIATTYQGAEFYINQYDANKILGLTINNVKPKVPTSLEEISNTVNWANLEYDYGNNTSNSSSTTITTPTSVANKDAFIGSESGFNGIFSTSETDLKEVTGGVSLYSLSGIYPGTDLISPDDTTLNKLFADSN-----NMKKAINQLGFLDLLDSSGNPTVNAKDLIQRIADIFGSSSSFF------------IVSSASSISSTLNVLNTSSSTLTKLQVSFLSILLIITVLIIVIVSSLIINDSFKLAAILKCLGLDDKKNAASFLSVYLPVFFFGLLISVPITFAMTSVYITFIFNFAGILIVSNNSFWHFLAASLGIIVIFFLSYWTTWQKIRKMDLAQSI 1484
>gi|195869135|ref|ZP_03004494.2| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659701|gb|EDX53081.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (1575 aa)
Score = 417, Expect = 4.0e-38, Identities = 107/383 (27%), Positives = 206/383 (53%)
  Q:   730 SIVVNEAWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           ++V  +A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L V I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   316 TLVGLDAFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 717
Score = 153, Expect = 1.6e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1064 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMH 1278
>gi|195867653|ref|ZP_03079655.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660710|gb|EDX53965.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (1575 aa)
Score = 416, Expect = 5.3e-38, Identities = 106/377 (28%), Positives = 202/377 (53%)
  Q:   736 AWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L V I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   322 AFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 717
Score = 154, Expect = 1.4e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1064 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMH 1278
>gi|185179146|ref|ZP_02964863.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|189009911|ref|ZP_03004070.2| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|184208925|gb|EDU05968.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188997855|gb|EDU66952.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (1540 aa)
Score = 416, Expect = 5.5e-38, Identities = 106/377 (28%), Positives = 202/377 (53%)
  Q:   736 AWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L V I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   287 AFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKRESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 682
Score = 154, Expect = 1.3e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1029 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMH 1243
>gi|188592408|ref|ZP_03005776.1| hypothetical protein Uureaserovar_00370 [Ureaplasma urealyticum serovar 10] (1547 aa)
Score = 416, Expect = 6.1e-38, Identities = 106/377 (28%), Positives = 202/377 (53%)
  Q:   736 AWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L V I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   294 AFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 689
Score = 153, Expect = 1.6e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1036 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMH 1250
>gi|188530882|ref|ZP_03005165.1| hypothetical protein Uurese_01000004_0200001960 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] (1547 aa)
Score = 416, Expect = 6.1e-38, Identities = 106/377 (28%), Positives = 202/377 (53%)
  Q:   736 AWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L V I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   294 AFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVVVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 689
Score = 153, Expect = 1.6e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1036 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMH 1250
>gi|171920966|ref|ZP_02932100.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188024199|ref|ZP_02996912.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|171902990|gb|EDT49279.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188018850|gb|EDU56890.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] (1575 aa)
Score = 415, Expect = 6.4e-38, Identities = 106/377 (28%), Positives = 202/377 (53%)
  Q:   736 AWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L V I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   322 AFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKRESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 717
Score = 154, Expect = 1.4e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1064 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMH 1278
>gi|188039436|ref|ZP_02998199.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 8] (1547 aa)
Score = 415, Expect = 7.0e-38, Identities = 106/377 (28%), Positives = 202/377 (53%)
  Q:   736 AWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L V I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   294 AFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKRESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAVSIFSEYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 689
Score = 153, Expect = 1.6e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1036 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQEIEIYTGIKNAAQILGMH 1250
>gi|188568597|ref|ZP_03005390.1| hypothetical protein Uurealyserovar_00335 [Ureaplasma urealyticum serovar 2] (1547 aa)
Score = 414, Expect = 1.0e-37, Identities = 105/377 (27%), Positives = 202/377 (53%)
  Q:   736 AWLNSNQKSVLPTNQWQKVLL--MNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL--LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFL-LFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLY 1112
           A+L+S+ K   P + WQK L+   +   F  W  +LD +Y V+I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ Y +  GY  +   + ++ + +++   I     E VD+++L  +      +               AYL  +  +       R+ +   I   I  F  ++   +LV+ +++  +++  ++ +NK+++ I+ ANG++  +I +S    G    ++ G+ GYL A+  Q L + I S +W IP ++  F +  L + I   ++ F  L + LG W   + PIN L+  +E  K++K+++++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G Y
  S:   294 AFLSSHNKQKYPMDLWQKALVEHQDQKSFEKWFNSLDEKYIVHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYANLNGYARIHDAFRSNPAEKNLQIRITNQKHEAVDINTLKKITKDLNDRIKKESIMNWPTSLDAAYLKDDTNNHITPSPLRLVFIDKITSTIQTFSILITLFILVLAVFVIVIIINRFLAQNKINIGISIANGVARWKIILSFGFIGLIPCVVGGLCGYLVAYFTQNLAISIFSGYWLIPTALEGFDFGALITVIVFPFLLFFALIAILGYWSVRKPPIN-LMRGTETFKISKIVHVIKLPFKYMSGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTTDATLQTKKYRYGIDLITPTDQGGQY 689
Score = 154, Expect = 1.2e-07, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:  1255 ELKTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           E+K + + Q YI   R    +Y ++P K    TN   T  S++ +N+F+  + + + +   S  D  + I+F ++ F  +  N+ T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N  LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++
  S:  1036 EIKNVVNNQIYIYYPRQIKRSYKIDPAKA---TNAIKTGLSVKLDNDFINLVLLTHPSINPSYTDVWSGITFNMIGFDYLTKNNKTQLNEFDEPYIWIDAQIN---------KINKQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INHLLFNENDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYV----KKQITLKVVGIIDTYQGIEIYTGIKNAAQILGMH 1250
>gi|13357877|ref|NP_078151.1| hypothetical protein UU317 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|11356796|pir||G82905 conserved hypothetical UU317 [imported] - Ureaplasma urealyticum >gi|6899294|gb|AAF30726.1|AE002129_2 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (1575 aa)
Score = 396, Expect = 1.0e-35, Identities = 123/441 (27%), Positives = 226/441 (51%)
  Q:   702 LEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSE--FRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL---LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIA-FLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNN 1142
           + +SF   AG+    Y    S YA  G       A+L+++ K   P   WQK L+ +  +  F  W  +LD +Y ++I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ YV+  GY  +     +N   N ++   I     + VD+S L  ++ +   +               AYL  +  +       R+ +   I   I  F  ++   +L++ I++  +++  ++ +NK+++ I+ ANG+   +I +S +  G    +I G+ GYL+A+  Q L + I S +W IP  +  F++  L + I   ++  F+L   LG W   + PI +L+  +E  K++K++Y++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G     +Y  L TN           +T+ DN+N
  S:   294 ITFSFEP-AGIPIPVYFDVKSAYALVGLG-----AFLSNHNKQKYPMYLWQKALVDHEEQQSFEKWFNSLDEKYIIHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYVNLNGYARIYDAFRSNPIEN-NLQIRITNQKHQSVDISILKKIVKNLNDQIKKDAIMNWPTSLDAAYLKDDTNNHITPSPLRLVFINKITNTIQTFSVLITLFILILTIFVIVIIINRFLAQNKINIGISIANGVPRWKIILSFAFIGLIPCVIGGLCGYLTAYFTQNLAINIFSGYWLIPTVLENFNFGALITVIIFPFLLFFILIVGLGYWSIRKPPI-DLMRGTETFKISKIVYVIKFPFKYISGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTIDATLQTKKYRYGIDLITPTDQGG-----QYISLSTNQ--------IGSTLNDNDN 734
Score = 149, Expect = 5.0e-07, Identities = 128/525 (24%), Positives = 248/525 (47%)
  Q:  1234 ELISRINAISNNFLISVLEVPEL----KTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNAN-----YRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNL-SISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDW 1758
           ++I +IN  S+N ++ V ++ +L    K I + Q Y+   +    +Y ++P K    TN   T  SI+ +N+F+  + + + +   S  D  + I+F +V F  +  N  T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N+ LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++         +S Y + ++     G +       +G  TN N      RI  +  P    P +  + K+   + +   +L +       Y+++  +      S V +N+ +++      +   +L  +  +I  ++ N +  R   + +   +   +           +N+ E    +F    T   T+ ++E ++I L + +II+++++IS   ++D  ++  +LK +GYSD +N    L+ F+P ++I  I+ I +V  +  +F+ ++FN+ ++ L     W
  S:  1040 KIIKKINFKSDNDIV-VTKINDLTYQVKNIINQQIYLYSPKPIKRSYRIDPAKA---TNAIKTGLSIKLDNDFINLVLLTHPSINPSYADVWSGITFNMVGFDYLTKNDKTQLNEFDEPYIWIDAQIN---------KINNQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INNLLFNKNDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYI----KKQITLKVVGIIDTYQGIEIYTGIKNAAEILGMH---------SSPYADKSLYDEYDGAF-------NGIFTNKNNPAMLTRIISIYSPSGLYPISETWKKDAPTINLIKNILSD------KYTTYELNNKWDPKSLV-LNSRLSLTKALGYKNFDELKLDARNIYDDNHNYLGLRDEQAQAEWVIDKLISIYGRDTYSSTLNNVEVVDVLFAVLETASKTIQTVEIVVIFLILFIIILVLVLISINSLSDTLKVAKLLKNIGYSDLKNAKLFLMAFLPSLIIGSIISIPLVIVVMQVFSEIIFNSLNVLLTTSFIW 1538
>gi|186701641|ref|ZP_02971343.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700881|gb|EDU19163.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (1540 aa)
Score = 396, Expect = 1.1e-35, Identities = 123/441 (27%), Positives = 226/441 (51%)
  Q:   702 LEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSE--FRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL---LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIA-FLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNN 1142
           + +SF   AG+    Y    S YA  G       A+L+++ K   P   WQK L+ +  +  F  W  +LD +Y ++I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ YV+  GY  +     +N   N ++   I     + VD+S L  ++ +   +               AYL  +  +       R+ +   I   I  F  ++   +L++ I++  +++  ++ +NK+++ I+ ANG+   +I +S +  G    +I G+ GYL+A+  Q L + I S +W IP  +  F++  L + I   ++  F+L   LG W   + PI +L+  +E  K++K++Y++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G     +Y  L TN           +T+ DN+N
  S:   259 ITFSFEP-AGIPIPVYFDVKSAYALVGLG-----AFLSNHNKQKYPMYLWQKALVDHEEQQSFEKWFNSLDEKYIIHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYVNLNGYARIYDAFRSNPIEN-NLQIRITNQKHQSVDISILKKIVKNLNDQIKKDAIMNWPTSLDAAYLKDDTNNHITPSPLRLVFINKITNTIQTFSVLITLFILILTIFVIVIIINRFLAQNKINIGISIANGVPRWKIILSFAFIGLIPCVIGGLCGYLTAYFTQNLAINIFSGYWLIPTVLENFNFGALITVIIFPFLLFFILIVGLGYWSIRKPPI-DLMRGTETFKISKIVYVIKFPFKYISGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTIDATLQTKKYRYGIDLITPTDQGG-----QYISLSTNQ--------IGSTLNDNDN 699
Score = 148, Expect = 5.7e-07, Identities = 128/525 (24%), Positives = 248/525 (47%)
  Q:  1234 ELISRINAISNNFLISVLEVPEL----KTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNAN-----YRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNL-SISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDW 1758
           ++I +IN  S+N ++ V ++ +L    K I + Q Y+   +    +Y ++P K    TN   T  SI+ +N+F+  + + + +   S  D  + I+F +V F  +  N  T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N+ LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++         +S Y + ++     G +       +G  TN N      RI  +  P    P +  + K+   + +   +L +       Y+++  +      S V +N+ +++      +   +L  +  +I  ++ N +  R   + +   +   +           +N+ E    +F    T   T+ ++E ++I L + +II+++++IS   ++D  ++  +LK +GYSD +N    L+ F+P ++I  I+ I +V  +  +F+ ++FN+ ++ L     W
  S:  1005 KIIKKINFKSDNDIV-VTKINDLTYQVKNIINQQIYLYSPKPIKRSYRIDPAKA---TNAIKTGLSIKLDNDFINLVLLTHPSINPSYADVWSGITFNMVGFDYLTKNDKTQLNEFDEPYIWIDAQIN---------KINNQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INNLLFNKNDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYI----KKQITLKVVGIIDTYQGIEIYTGIKNAAEILGMH---------SSPYADKSLYDEYDGAF-------NGIFTNKNNPAMLTRIISIYSPSGLYPISETWKKDAPTINLIKNILSD------KYTTYELNNKWDPKSLV-LNSRLSLTKALGYKNFDELKLDARNIYDDNHNYLGLRDEQAQAEWVIDKLISIYGRDTYSSTLNNVEVVDVLFAVLETASKTIQTVEIVVIFLILFIIILVLVLISINSLSDTLKVAKLLKNIGYSDLKNAKLFLMAFLPSLIIGSIISIPLVIVVMQVFSEIIFNSLNVLLTTSFIW 1503
>gi|170761957|ref|YP_001752399.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920330|ref|ZP_02691358.2| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508697|ref|ZP_02958185.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168827534|gb|ACA32796.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902751|gb|EDT49040.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675619|gb|EDT87524.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (1549 aa)
Score = 396, Expect = 1.1e-35, Identities = 123/441 (27%), Positives = 226/441 (51%)
  Q:   702 LEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSE--FRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESL---LYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKK---------------AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIA-FLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNN 1142
           + +SF   AG+    Y    S YA  G       A+L+++ K   P   WQK L+ +  +  F  W  +LD +Y ++I++  ++I+ SGI+ +  +PI+S  S IPNP+ EG+ YV+  GY  +     +N   N ++   I     + VD+S L  ++ +   +               AYL  +  +       R+ +   I   I  F  ++   +L++ I++  +++  ++ +NK+++ I+ ANG+   +I +S +  G    +I G+ GYL+A+  Q L + I S +W IP  +  F++  L + I   ++  F+L   LG W   + PI +L+  +E  K++K++Y++K          K+ I L+ S +TR I+F ++ +     I   T    K + +   TL+ ++Y Y  +L TP++Q G     +Y  L TN           +T+ DN+N
  S:   268 ITFSFEP-AGIPIPVYFDVKSAYALVGLG-----AFLSNHNKQKYPMYLWQKALVDHEEQQSFEKWFNSLDEKYIIHIDNTPYLILDSGITPDFMYPIISFTSVIPNPKKEGLVYVNLNGYARIYDAFRSNPIEN-NLQIRITNQKHQSVDISILKKIVKNLNDQIKKDAIMNWPTSLDAAYLKDDTNNHITPSPLRLVFINKITNTIQTFSVLITLFILILTIFVIVIIINRFLAQNKINIGISIANGVPRWKIILSFAFIGLIPCVIGGLCGYLTAYFTQNLAINIFSGYWLIPTVLENFNFGALITVIIFPFLLFFILIVGLGYWSIRKPPI-DLMRGTETFKISKIVYVIKFPFKYISGFNKYLITLSFSSITRIIIFSIMIALSFGSIMFLTGTRGKIKQTIDATLQTKKYRYGIDLITPTDQGG-----QYISLSTNQ--------IGSTLNDNDN 708
Score = 148, Expect = 5.6e-07, Identities = 128/525 (24%), Positives = 248/525 (47%)
  Q:  1234 ELISRINAISNNFLISVLEVPEL----KTINDTQNYI--TRNSSGNYVLNPEKVLDLTNVSDTN-SIRFNNEFLKYIGMIYGNTELSSID--AKISFGIVPFRSMETNSLT------ESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNAN-----YRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNL-SISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDW 1758
           ++I +IN  S+N ++ V ++ +L    K I + Q Y+   +    +Y ++P K    TN   T  SI+ +N+F+  + + + +   S  D  + I+F +V F  +  N  T      E Y ++DA +N         + N +      N +I GI K+S+ V L+ +KK  +N+ LF   + +       A++N+ AA  Y+L++GD F     N   RYT         K + LKVVGI        IY    NA  ILG++         +S Y + ++     G +       +G  TN N      RI  +  P    P +  + K+   + +   +L +       Y+++  +      S V +N+ +++      +   +L  +  +I  ++ N +  R   + +   +   +           +N+ E    +F    T   T+ ++E ++I L + +II+++++IS   ++D  ++  +LK +GYSD +N    L+ F+P ++I  I+ I +V  +  +F+ ++FN+ ++ L     W
  S:  1014 KIIKKINFKSDNDIV-VTKINDLTYQVKNIINQQIYLYSPKPIKRSYRIDPAKA---TNAIKTGLSIKLDNDFINLVLLTHPSINPSYADVWSGITFNMVGFDYLTKNDKTQLNEFDEPYIWIDAQIN---------KINNQKYEEAKNPKIIGIIKNSKLVHLLSNKKQ-INNLLFNKNDEQ------VAIINRVAAKYYNLKIGDHFSFVANNQTNRYTKDYI----KKQITLKVVGIIDTYQGIEIYTGIKNAAEILGMH---------SSPYADKSLYDEYDGAF-------NGIFTNKNNPAMLTRIISIYSPSGLYPISETWKKDAPTINLIKNILSD------KYTTYELNNKWDPKSLV-LNSRLSLTKALGYKNFDELKLDARNIYDDNHNYLGLRDEQAQAEWVIDKLISIYGRDTYSSTLNNVEVVDVLFAVLETASKTIQTVEIVVIFLILFIIILVLVLISINSLSDTLKVAKLLKNIGYSDLKNAKLFLMAFLPSLIIGSIISIPLVIVVMQVFSEIIFNSLNVLLTTSFIW 1512
>gi|71894623|ref|YP_278731.1| putative ABC transporter permease protein [Mycoplasma synoviae 53] (2638 aa)
Score = 344, Expect = 1.0e-29, Identities = 232/1052 (22%), Positives = 456/1052 (43%)
  Q:   734 NEAWLNSNQKSV----LPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIY-FAIRFNYGEKVD--LSSLNSLMDSYTK----------KAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYV-EKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILF--VVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIK--YSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYI------TRNSSGNYVLNPEKVL------------DLTNVSDTNSIR---FNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSME-TNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSG-INPTKSV-----KLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENP-LLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMP--------------YSEEGLSKLATNLSISSNSRNDIITRLSSSMS--ISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKK 1785
           N AWL  N K +    +P N  + + L+NS         L     +N+N ++FIIIG  I+ +  +P++  E+   + + +G+ YV+  G++ +   NS+ N  +  + +    GE  D   S + + +++Y +          + YL++E+       + R+     I   IN  +  L  +L+         ++K Y+  KNKV + I  + G S  +I  S++ F  F     G++GY+  F  Q   + ++ N+W +PI    FS++ L   +   ++A  +  +     + R    +L+S   E+K+ ++  +  S   S  +  KF  +L  +   +   F   +  ++ ++I A        F+ +   T +NR Y Y Y+L+TP+ +S  YK                   F+ +  DN   Y  L  S++ +       R    N I   ++NG P+Y                 DP      V++++ ++  I+  G+ V+ +  +  + P    ++I  I  N +   LE  +   + ++ N I        N  G +   P+ ++            D  N  +   I    + NE+ ++  +I G  +L     K    ++ F  +   N   E+YTY  A  ND ++ +   R + K + +  N      K + +F         D N  L EP+         P ++N+ A Y+Y L+      + ++N+  R+ +     INP + +     K K+V IS     T   I    AN I  L+                                             ++ + +   PFNG+ SK E P LL++S  L + S  WG  ++   +  + +      N++    +               YS+  ++K   N + + N RN I      +++    ++  +L      P ++  ++ +             NT+  I T +  +F    I+I++I S++++N+  + +AI   LGYS+KE +     IF+P +L++ ++ I +   +  +F+  +   ASI +   I+ +        ++G+ +I  + + + + K
  S:  1632 NYAWLQQNNKKIYSGEIPDNPIKMLALLNS---------LPEDNILNVNGVKFIIIGQEITADYLYPVIDEENLQVDTKSQGIIYVNQNGFDRI--RNSYRNNVVKEYVVSKIPGETTDEQKSEIRNNIENYVQETIDDSAKIQRTYLTNELDGINPERSLRVRIIDSIISSINKSLIALTGILIFFVTVSVIFIIKRYIFNKNKV-IGILISQGYSPWEIVFSMTTFSIFIIFFGGILGYVVGFTSQAAVIHVIKNYWTLPIVTLNFSWVSLLVTLMIPFLAITVLIYSITISSLRFKSIDLMSGVYEVKLGRVQRIFSSLFKSKKITTKFSASLIFNSFWKLFSFGTSIFLTSIVTIFAFTATT--VFDKAINETYKNRLYNYKYDLKTPTVESNAYKT------------------FNGSTLDNQ-LYVPLGHSSEINSYAGDYFRPGFSNSINTNFANGNPEY----------------NDPH-----VLTQFSLNIRIN-GGVSVDPFNLIFNSLPDSQKNKIIVI-RNIIGKELEKTQDNLVYNSNNEIDISKTSKINKVGFFGYIPDNLVIQNGKFWYFQYNDAKNEYERVQITTGAYRNEYRQF--LINGYKKLYEDPKKTQDFLISFGGIYLDNRFDETYTYAQAIFNDNSINLYGYRPDSKQIQVYDNNVNILKKINDEF---------DANPDLNEPI---------PLIINEVARYKYLLQRNQIITLKIENTTDRFKEKFDKEINPNRELSDNTYKFKIVDISKTYINTEFIIPHQAANLITKLD---------------------------------------------KLNFGEDTGPFNGILSKNEIPSLLLSSASLYSYSNFWGVVAAIDTNSMSRIDKVALFNSLFGSKLTNPNDFTEGVLKTNGYSDFEIAKF-INPNFNQNDRNAIYDNYHQTINNPDGAINKFLAAYNDMPYVIVASNLDAKNIELSFTTITANTVKVIITFVSIIFFITSIVILIIFSTILINENTKNIAIWSILGYSNKEKVKMFFGIFIPFILVAFLLAIPLAIAIMQIFSITLTYVASIAIPSMINAVNIFATLGVVLGVFSITSVILWINMNK 2628
>gi|144575197|gb|AAZ44020.2| putative ABC transporter permease protein [Mycoplasma synoviae 53] (2636 aa)
Score = 344, Expect = 1.1e-29, Identities = 232/1052 (22%), Positives = 456/1052 (43%)
  Q:   734 NEAWLNSNQKSV----LPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIY-FAIRFNYGEKVD--LSSLNSLMDSYTK----------KAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYV-EKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILF--VVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIK--YSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKTINDTQNYI------TRNSSGNYVLNPEKVL------------DLTNVSDTNSIR---FNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSME-TNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSG-INPTKSV-----KLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENP-LLVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMP--------------YSEEGLSKLATNLSISSNSRNDIITRLSSSMS--ISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKK 1785
           N AWL  N K +    +P N  + + L+NS         L     +N+N ++FIIIG  I+ +  +P++  E+   + + +G+ YV+  G++ +   NS+ N  +  + +    GE  D   S + + +++Y +          + YL++E+       + R+     I   IN  +  L  +L+         ++K Y+  KNKV + I  + G S  +I  S++ F  F     G++GY+  F  Q   + ++ N+W +PI    FS++ L   +   ++A  +  +     + R    +L+S   E+K+ ++  +  S   S  +  KF  +L  +   +   F   +  ++ ++I A        F+ +   T +NR Y Y Y+L+TP+ +S  YK                   F+ +  DN   Y  L  S++ +       R    N I   ++NG P+Y                 DP      V++++ ++  I+  G+ V+ +  +  + P    ++I  I  N +   LE  +   + ++ N I        N  G +   P+ ++            D  N  +   I    + NE+ ++  +I G  +L     K    ++ F  +   N   E+YTY  A  ND ++ +   R + K + +  N      K + +F         D N  L EP+         P ++N+ A Y+Y L+      + ++N+  R+ +     INP + +     K K+V IS     T   I    AN I  L+                                             ++ + +   PFNG+ SK E P LL++S  L + S  WG  ++   +  + +      N++    +               YS+  ++K   N + + N RN I      +++    ++  +L      P ++  ++ +             NT+  I T +  +F    I+I++I S++++N+  + +AI   LGYS+KE +     IF+P +L++ ++ I +   +  +F+  +   ASI +   I+ +        ++G+ +I  + + + + K
  S:  1630 NYAWLQQNNKKIYSGEIPDNPIKMLALLNS---------LPEDNILNVNGVKFIIIGQEITADYLYPVIDEENLQVDTKSQGIIYVNQNGFDRI--RNSYRNNVVKEYVVSKIPGETTDEQKSEIRNNIENYVQETIDDSAKIQRTYLTNELDGINPERSLRVRIIDSIISSINKSLIALTGILIFFVTVSVIFIIKRYIFNKNKV-IGILISQGYSPWEIVFSMTTFSIFIIFFGGILGYVVGFTSQAAVIHVIKNYWTLPIVTLNFSWVSLLVTLMIPFLAITVLIYSITISSLRFKSIDLMSGVYEVKLGRVQRIFSSLFKSKKITTKFSASLIFNSFWKLFSFGTSIFLTSIVTIFAFTATT--VFDKAINETYKNRLYNYKYDLKTPTVESNAYKT------------------FNGSTLDNQ-LYVPLGHSSEINSYAGDYFRPGFSNSINTNFANGNPEY----------------NDPH-----VLTQFSLNIRIN-GGVSVDPFNLIFNSLPDSQKNKIIVI-RNIIGKELEKTQDNLVYNSNNEIDISKTSKINKVGFFGYIPDNLVIQNGKFWYFQYNDAKNEYERVQITTGAYRNEYRQF--LINGYKKLYEDPKKTQDFLISFGGIYLDNRFDETYTYAQAIFNDNSINLYGYRPDSKQIQVYDNNVNILKKINDEF---------DANPDLNEPI---------PLIINEVARYKYLLQRNQIITLKIENTTDRFKEKFDKEINPNRELSDNTYKFKIVDISKTYINTEFIIPHQAANLITKLD---------------------------------------------KLNFGEDTGPFNGILSKNEIPSLLLSSASLYSYSNFWGVVAAIDTNSMSRIDKVALFNSLFGSKLTNPNDFTEGVLKTNGYSDFEIAKF-INPNFNQNDRNAIYDNYHQTINNPDGAINKFLAAYNDMPYVIVASNLDAKNIELSFTTITANTVKVIITFVSIIFFITSIVILIIFSTILINENTKNIAIWSILGYSNKEKVKMFFGIFIPFILVAFLLAIPLAIAIMQIFSITLTYVASIAIPSMINAVNIFATLGVVLGVFSITSVILWINMNK 2626
>gi|72080785|ref|YP_287843.1| hypothetical protein MHP7448_0453 [Mycoplasma hyopneumoniae 7448] (2666 aa)
Score = 334, Expect = 1.9e-28, Identities = 250/1056 (23%), Positives = 467/1056 (44%)
  Q:   728 GNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLS--SEITDFTNLL--------------TARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIG-LFSGIACLYIAFLLFSFLGVWKTFRSP------INELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTN--DEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPEL-KTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRF--------NNEFLKYIGMIYGNT----------------ELSSIDAKISFGIVPFRSMETNSLTES--YTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDS---GFAGLVSTVG-----INNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQN-------NFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYL 1783
           G  + VN+++L  N+K V     +Q  +  ++S+     + LD +Y +N   L++II+G+  S +  +P++  ++   + + + + YV+  G++   ++   +    YF IR   G   +     + +DS+  K + S  S+ T FTN +              T  I       IY++LF++ILV       ++  + ++K Y+  N   L I +A G S  +IA S    G   A + G +G+L+ F  +     ++S FW   I++  F  I  +FS I   ++  +L   +  W   + P      INE+ +S    KV KL +  KSK     ++ KF I+L ++ + + I  ++       ++    +    F+ S   T +NR Y Y  NL +P+++ G   V     LG N    AG       NT  + N+P                           +  G P  F   +      VD+  ++P      V+S+  ++ +++ A    + +  V    P  L + I AISN  +  + +V  + + I   Q Y                  L + SD N  RF         NE+  Y   I+G +                   S D  ISF  + F      +L ++  YTY+D+          S++  G N            K +   +  I DK N+      E    +D   +YP ++N   A +++L +G   ++ + N   RY + +  + P K  K  ++GIS     + +  SQ  AN +LGL+  +                  +L +++   L P      +N  I+Q+    S    +G ++     + V+ L  ++T G + N  +F+++      G +   G     I ++IN      E+     A+ L  +S +    + +     +I  ++  L+N             +  + +    T     +  +F   I+I   ++ +F+ + +II++II+S ++N+ ++ +AIL  LGY++K  +     I++P++LIS ++ I  V     +FN  +    SI+L+  +    +   F    GI+ + FIFV  +L
  S:  1649 GYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPG--TNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILV-------LFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLAGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFW--KSK-----IVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIRKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLGKNLYVPAG------ENTEVNYNSPNY-------------------------FRPGNPSVFG--INSKNGLVDSKSRNP-----VVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKY---------------LVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNNRDAYRKFLVDSYLNNQVSKDFTISFAGIEFSENANENLPKNQVYTYIDSFYGAKNNTESSIKIYGYN-----------PKTEKNSIIEIKDKYNNNLLAEIEKYPIKDE--IYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNKIKKL-PQKKAKFVIIGISDTYINSELITSQAIANKLLGLDQFE-----------------NILKNYN---LSPFNGIILSNPEIEQISKSFSLYSPSGYWAGSSK-ISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLINFDKKNQEKPWLNSASALDFASLTNPSFVNQ-----NIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINI---VVIIFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2649
>gi|144575465|gb|AAZ53820.2| ABC transporter permease protein [Mycoplasma hyopneumoniae 7448] (2651 aa)
Score = 332, Expect = 2.8e-28, Identities = 250/1056 (23%), Positives = 467/1056 (44%)
  Q:   728 GNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLS--SEITDFTNLL--------------TARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIG-LFSGIACLYIAFLLFSFLGVWKTFRSP------INELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTN--DEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPEL-KTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRF--------NNEFLKYIGMIYGNT----------------ELSSIDAKISFGIVPFRSMETNSLTES--YTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDS---GFAGLVSTVG-----INNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQN-------NFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYL 1783
           G  + VN+++L  N+K V     +Q  +  ++S+     + LD +Y +N   L++II+G+  S +  +P++  ++   + + + + YV+  G++   ++   +    YF IR   G   +     + +DS+  K + S  S+ T FTN +              T  I       IY++LF++ILV       ++  + ++K Y+  N   L I +A G S  +IA S    G   A + G +G+L+ F  +     ++S FW   I++  F  I  +FS I   ++  +L   +  W   + P      INE+ +S    KV KL +  KSK     ++ KF I+L ++ + + I  ++       ++    +    F+ S   T +NR Y Y  NL +P+++ G   V     LG N    AG       NT  + N+P                           +  G P  F   +      VD+  ++P      V+S+  ++ +++ A    + +  V    P  L + I AISN  +  + +V  + + I   Q Y                  L + SD N  RF         NE+  Y   I+G +                   S D  ISF  + F      +L ++  YTY+D+          S++  G N            K +   +  I DK N+      E    +D   +YP ++N   A +++L +G   ++ + N   RY + +  + P K  K  ++GIS     + +  SQ  AN +LGL+  +                  +L +++   L P      +N  I+Q+    S    +G ++     + V+ L  ++T G + N  +F+++      G +   G     I ++IN      E+     A+ L  +S +    + +     +I  ++  L+N             +  + +    T     +  +F   I+I   ++ +F+ + +II++II+S ++N+ ++ +AIL  LGY++K  +     I++P++LIS ++ I  V     +FN  +    SI+L+  +    +   F    GI+ + FIFV  +L
  S:  1634 GYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPG--TNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILV-------LFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLAGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFW--KSK-----IVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIRKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLGKNLYVPAG------ENTEVNYNSPNY-------------------------FRPGNPSVFG--INSKNGLVDSKSRNP-----VVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKY---------------LVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNNRDAYRKFLVDSYLNNQVSKDFTISFAGIEFSENANENLPKNQVYTYIDSFYGAKNNTESSIKIYGYN-----------PKTEKNSIIEIKDKYNNNLLAEIEKYPIKDE--IYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNKIKKL-PQKKAKFVIIGISDTYINSELITSQAIANKLLGLDQFE-----------------NILKNYN---LSPFNGIILSNPEIEQISKSFSLYSPSGYWAGSSK-ISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLINFDKKNQEKPWLNSASALDFASLTNPSFVNQ-----NIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINI---VVIIFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2634
>gi|71893801|ref|YP_279247.1| hypothetical protein MHJ_0450 [Mycoplasma hyopneumoniae J] (2660 aa)
Score = 332, Expect = 3.2e-28, Identities = 250/1056 (23%), Positives = 469/1056 (44%)
  Q:   728 GNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLS--SEITDFTNLL--------------TARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIG-LFSGIACLYIAFLLFSFLGVWKTFRSP------INELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTN--DEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPEL-KTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRF--------NNEFLKYIGMIYG-----------------NTELSSIDAKISFGIVPFRSMETNSLTES--YTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDS---GFAGLVSTVG-----INNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQN-------NFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYL 1783
           G  + VN+++L  N+K V     +Q  +  ++S+     + LD +Y +N   L++II+G+  S +  +P++  ++   + + + + YV+  G++   ++   +    YF IR   G   +     + +DS+  K + S  S+ T FTN +              T  I       IY++LF++ILV       ++  + ++K Y+  N   L I +A G S  +IA S    G   A + G +G+LS F  +     ++S FW   I++  F  I  +FS I   ++  +L   +  W   + P      INE+ +S    KV KL +  KSK     ++ KF I+L ++ + + I  ++       ++    +    F+ S   T +NR Y Y  NL +P+++ G   V     LG N    AG       NT  + N+P                           +  G P  F   +      VD+  ++P      V+S+  ++ +++ A    + +  V    P  L + I AISN  +  + +V  + + I   Q Y                  L + SD N  RF         NE+  Y   I+G                 N +++  D  ISF  + F      +L ++  YTY+D+          S++  G N            K +   +  I DK N+      E    +D   +YP ++N   A +++L +G   ++ + N   RY + +  + P K  K  ++GIS     + +  SQ  AN +LGL+  +                  +L +++   L P      +N  I+Q+    S    +G ++     + V+ L  ++T G + N  +F+++      G +   G     I ++IN      E+     ++ L  +S +    + +     +I  ++  L+N             +  + +    T     +  +F   I+I   ++ +F+ + +II++II+S ++N+ ++ +AIL  LGY++K  +     I++P++LIS ++ I  V     +FN  +    SI+L+  +    +   F    GI+ + FIFV  +L
  S:  1643 GYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPG--TNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILV-------LFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLSGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFW--KSK-----IVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIKKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLGKNLYVPAG------ENTEVNYNSPNY-------------------------FRPGNPSVFG--INSKNGLVDSESRNP-----VVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKY---------------LVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNNRDAYRKFLVDSYLNNQVAK-DFTISFAGIEFSENANENLPKNQVYTYIDSFYGAKNNTESSIKIYGYN-----------PKTEKNSIIEIKDKYNNNLLAEIEKYPIKDE--IYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNKIKKL-PQKKAKFVIIGISDTYINSELITSQAIANKLLGLDQFE-----------------NILKNYN---LSPFNGIILSNPEIEQISKSFSLYSPSGYWAGSSK-ISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLINFDKKNQEKPWLNSSSALDFASLTNPSFVNQ-----NIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINI---VVIIFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2643
>gi|144227641|gb|AAZ44536.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (2651 aa)
Score = 331, Expect = 3.8e-28, Identities = 249/1056 (23%), Positives = 467/1056 (44%)
  Q:   728 GNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLS--SEITDFTNLL--------------TARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIG-LFSGIACLYIAFLLFSFLGVWKTFRSP------INELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTN--DEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPEL-KTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRF--------NNEFLKYIGMIYGNT----------------ELSSIDAKISFGIVPFRSMETNSLTES--YTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDS---GFAGLVSTVG-----INNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQN-------NFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYL 1783
           G  + VN+++L  N+K V     +Q  +  ++S+     + LD +Y +N   L++II+G+  S +  +P++  ++   + + + + YV+  G++   ++   +    YF IR   G   +     + +DS+  K + S  S+ T FTN +              T  I       IY++LF++ILV       ++  + ++K Y+  N   L I +A G S  +IA S    G   A + G +G+LS F  +     ++S FW   I++  F  I  +FS I   ++  +L   +  W   + P      INE+ +S    KV KL +  KSK     ++ KF I+L ++ + + I  ++       ++    +    F+ S   T +NR Y Y  NL +P+++ G   V     LG N    AG       NT  + N+P                           +  G P  F   +      VD+  ++P      V+S+  ++ +++ A    + +  V    P  L + I AISN  +  + +V  + + I   Q Y                  L + SD N  RF         NE+  Y   I+G +                   + D  ISF  + F      +L ++  YTY+D+          S++  G N            K +   +  I DK N+      E    +D   +YP ++N   A +++L +G   ++ + N   RY + +  + P K  K  ++GIS     + +  SQ  AN +LGL+  +                  +L +++   L P      +N  I+Q+    S    +G ++     + V+ L  ++T G + N  +F+++      G +   G     I ++IN      E+     ++ L  +S +    + +     +I  ++  L+N             +  + +    T     +  +F   I+I   ++ +F+ + +II++II+S ++N+ ++ +AIL  LGY++K  +     I++P++LIS ++ I  V     +FN  +    SI+L+  +    +   F    GI+ + FIFV  +L
  S:  1634 GYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPG--TNREKFRADIDSFIAKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILV-------LFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLSGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFW--KSK-----IVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIKKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLGKNLYVPAG------ENTEVNYNSPNY-------------------------FRPGNPSVFG--INSKNGLVDSESRNP-----VVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFAISNKVVHQIEKVQNIPEKIKQKQPYFKY---------------LVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNNRDAYRKFLVDSYLNNQVAKDFTISFAGIEFSENANENLPKNQVYTYIDSFYGAKNNTESSIKIYGYN-----------PKTEKNSIIEIKDKYNNNLLAEIEKYPIKDE--IYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNKIKKL-PQKKAKFVIIGISDTYINSELITSQAIANKLLGLDQFE-----------------NILKNYN---LSPFNGIILSNPEIEQISKSFSLYSPSGYWAGSSK-ISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLINFDKKNQEKPWLNSSSALDFASLTNPSFVNQ-----NIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINI---VVIIFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2634
>gi|54020519|ref|YP_115962.1| hypothetical protein mhp452 [Mycoplasma hyopneumoniae 232] >gi|53987692|gb|AAV27893.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (2651 aa)
Score = 328, Expect = 8.3e-28, Identities = 249/1056 (23%), Positives = 466/1056 (44%)
  Q:   728 GNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLS--SEITDFTNLL--------------TARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIG-LFSGIACLYIAFLLFSFLGVWKTFRSP------INELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTN--DEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPEL-KTINDTQNYITRNSSGNYVLNPEKVLDLTNVSDTNSIRF--------NNEFLKYIGMIYGNT----------------ELSSIDAKISFGIVPFRSMETNSLTES--YTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLVLENTSGLWGNYSSFTDS---GFAGLVSTVG-----INNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQN-------NFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYL 1783
           G  + VN+++L  N+K V     +Q  +  ++S+     + LD +Y +N   L++II+G+  S +  +P++  ++   + + + + YV+  G++   ++   +    YF IR   G   +     + +DS+  K + S  S+ T FTN +              T  I       IY++LF++ILV       ++  + ++K Y+  N   L I +A G S  +IA S    G   A + G +G+L+ F  +     ++S FW   I++  F  I  +FS I   ++  +L   +  W   + P      INE+ +S    KV KL +  KSK     ++ KF I+L ++ + + I  ++       ++    +    F+ S   T +NR Y Y  NL +P+++ G   V     LG N    AG       NT  + N+P                           +  G P  F   +      VD+  ++P      V+S+  ++ +++ A    + +  V    P  L + I A SN  +  + +V  + + I   Q Y                  L + SD N  RF         NE+  Y   I+G +                   S D  ISF  + F      +L ++  YTY+D+          S++  G N            K +   +  I DK N+      E    +D   +YP ++N   A +++L +G   ++ + N   RY + +  + P K  K  ++GIS     + +  SQ  AN +LGL+  +                  +L +++   L P      +N  I+Q+    S    +G ++     + V+ L  ++T G + N  +F+++      G +   G     I ++IN      E+     A+ L  +S +    + +     +I  ++  L+N             +  + +    T     +  +F   I+I   ++ +F+ + +II++II+S ++N+ ++ +AIL  LGY++K  +     I++P++LIS ++ I  V     +FN  +    SI+L+  +    +   F    GI+ + FIFV  +L
  S:  1634 GYVVKVNKSYLEKNKKEV-----YQGKIPDSASDIEKLIELLDPKYILNAGGLKYIIVGTDFSIDYLYPVIDEKNVKLDGQNQVLAYVNKFGFDKARFSYQSNPIKNYFLIRLKPG--TNREKFRADIDSFIGKNFASNSSQHTFFTNEIDHLNPERALRIQVGTNIIETFSKTNIYLSLFLSILV-------LFAIAFIIKRYISTNNKVLGILRAQGYSLFEIASSFLSIGFIIAFLGGSLGFLAGFFGKIPLYNLISQFWEFDINIYNFEPISFVFSLIIPFFVISVLIYLVIFWNLRQKPYHLLSGINEINTSKFAQKVAKLFW--KSK-----IVNKFSISLVINSIWKIISLIIAIVIVQFVLIFSLSSYNIFQNSIKKTYQNRHYAYKINLFSPTKEGGPLVVYNAKDLGKNLYVPAG------ENTEVNYNSPNY-------------------------FRPGNPSVFG--INSKNGLVDSKTRNP-----VVISRSSLNIKVNQAN-KASIFDIVLANLPESLRNNIFATSNKVVHQIEKVQNIPEKIKQKQPYFKY---------------LVDSSDPNQGRFWYYQFDQDKNEYRAYEVSIFGQSNNRDAYRKFLVDSYLNNQVSKDFTISFAGIEFSENANENLPKNQVYTYIDSFYGAKNNTESSIKIYGYN-----------PKTEKNSIIEIKDKYNNNLLAEIEKYPIKDE--IYPLIINYVFAKKHNLGIGSRIEVPILNHVDRYYNKIKKL-PQKKAKFVIIGISDTYINSELITSQAIANKLLGLDQFE-----------------NILKNYN---LSPFNGIILSNPEIEQISKSFSLYSPSGYWAGSSK-ISVDQLNKDDTIGFFANIFAFSENETDKTKGALQIAGYTKQEILDLINFDKKNQEKPWLNSASALDFASLTNPSFVNQ-----NIPEIKKALKNFNEIYGETIYQIGLTGLEAKNIETNFISNFANLFGAGINI---VVIIFLVVSLIILVIIASSIINENQQNIAILDVLGYANKTKVRLFYSIYLPILLISSLISIPFVIIAMEIFNSYILLTNSIFLSLGLSISTFFLAF----GIILVVFIFVLSFL 2634
>gi|66880418|ref|ZP_00405399.1| hypothetical protein MgenG_01000025 [Mycoplasma genitalium G-37] (258 aa)
Score = 308, Expect = 2.0e-25, Identities = 73/231 (31%), Positives = 138/231 (59%)
  Q:   756 LMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRF----NYGEKVDLSSLNSLMDSY-----TKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYI 986
           +   + F  W  +L  RYK +IN L F I+G G S E  +P++S++SP+PN + E + +V+D  Y S+L+    +NQ+ Y+A +      + ++  +  + + ++ Y     +  A+   +I+ F  L TAR  +P L+  Y+ +  T++   L+++ +YL  LL+K +++KN+   +I +A G S+ +  + +SVF    AI+S  +G L AFLL+G   GI++ +W+I +    F+++
  S:     1 MQTPNNFPNWLNDLPDRYKFSINGLTFAILGIGESVETGYPVLSLQSPLPNTQDEALIFVNDQAYRSILFAVPAANQENYYAFKSTDLKQHTDQDPVQFIANRLEGYLDVPRSDLAFNVKDISKFNYLTTARNYFPDLVQSYLAIVSTVIAIFLIILALYLIILLIKSFIKKNQTEFSIIRAGGFSTTKFIVGMSVFAGIVAIVSSFLGVLFAFLLEGQVKGIINRYWFIALPENSFNWL 240
>gi|193216518|ref|YP_001999760.1| ABC transporter permease protein [Mycoplasma arthritidis 158L3-1] >gi|193001841|gb|ACF07056.1| ABC transporter permease protein [Mycoplasma arthritidis 158L3-1] (2777 aa)
Score = 306, Expect = 3.3e-25, Identities = 239/1053 (22%), Positives = 456/1053 (43%)
  Q:   733 VNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSL--------NSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSG--IACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTR-FILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNNNPYRKLVTSTDQDEKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKD--PQLFRNAVVSKWLVDFEISIAGIYVNAWQFVSEAFPLELISRINAISNNFLISVLEVPELKT------------INDTQNYITRNSSGNYVLNPEKVLDLTN-----VSDTNSIRFNNEFL-KYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVR-NNGKN---------LLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFE---PVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSM-SGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPL-LVNSLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRND----------------IITRLSSSMSISSLQTWLQ---NNFGTPSIVAINSFEYFTTVFDT---------YVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSV--LFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKK 1785
           VN+A+L+ N K +  T    K  L N    + +  +L  +YK+ +N++E++IIG   + +  +P+V+ E+   + + + + YV+  G++ +           Y  I+       +++ +        +++  S  KK Y ++E        + RI+    +   I     I + +L+VI I++   ++K Y+E     + I  A G  + +IA+S + FG   A I G+ GY++   LQ   + I S++W +  +   F+ + L     +  L I+ L+F+ +  +   R P+ E+++   E+ +N +   +      + +  KF I++ L+   + F LF+   S  L I+    +    F+ S + T +NR Y Y  +L++P+ +                  GG Y       +++N+  R L   +D     L       G+ + Y N       N L P       F  D  P+ F   V++K  +D ++ ++ + ++ W       P    +R+  I     + +     L T            + D + Y    ++G     PE   DL+N     +   N +  +++   K    +  N + SS ++ +       R      L ++Y  +D  + D  V    V  N   N         L       I+G ++DS+++ ++    NDL+ KL +   P E        P VVN  +A +  L VGD  + D+ N   R+   +     P    + +VVGIS          S+   + ILG++         T T        + L   ++  L P   E N        ++ K Y  FNG+ S ++ P+  +++L   + SG WG  ++F   G +         N+           L + A N    ++  N                 +   +  +  IS  Q       N F  P          +   FD            +I  T+  I T++I +   + I+I++II+++M+   R  +A    LGY++ E +      F+P +L++   G+ I ATL +  +FN  V + + I L   ++    +   +  + + T+  +   L L +
  S:  1717 VNQAYLDKNNKEIY-TGDISK-YLNNPLAMKEFIASLPSKYKIKVNTIEYLIIGKETTADYLYPVVNEENIQVDTKTQALVYVNQRGFDRIRSAYPTFAIKEYVLIKMPKASDKEINKMRDELNGVISNITSSANKKVYKTTESDYLNPERSIRITAVMSVVNIIQKAQVISIIMLIVIVIFIVYFVIKRYIENRHKVIGILCAQGYKTSEIALSFAAFGWLPAAIGGIAGYITGLSLQLGAMRIFSSYWTLENNTIPFNVLSLLIAMILPVLGISALIFA-ITYYAVRRKPV-EMMNGLVELSINNVSQKIYMIFRRWNIKMKFVISMILNNFWKLFSLFLGFSSTSL-IMMFFLSSGNVFDRSISQTYKNRNYRYKLDLESPTTE------------------GGPY-----VTYNHNDLSRLLYVPSD-----LAGKASSNGSQLDYEN------PNFLRPG----GGFNSDVIPRKFDPVVLTKSSLDLKLDLS-VELSPWDITYANMPETQRARVLQIFERVSMKMQATQNLITGEVNSGEGGYIAVKDLEKYKRDKAAGR----PE---DLSNRKGYFLFSNNRLSGDDDVASKSFRYVAWNPQSSSYESSVKVTTSAHREKYREFLVDAYKKID--VPDFYVAFGGVYWNEATNERYTYAKLGLTNGQETRIYGYQEDSKYIKVLDKNGNDLSKKLDQWSGPSEP------IPLVVNNVSAKRLGLSVGDIIEGDLLNHVDRFVHKLVQTAAPQTRYRFRVVGISDTYINDEFVASKKILDRILGMD---------TLTKRLRDARRSELDQLNA--LYPEKKEENIR------KFNKKYEAFNGILSVDKTPVQTIDTLTTYSASGYWGATATFDTEGASAEAKWAFFKNVFISNPKLKFTSLFEHAINAYNEAHGTNKKYEEEMRKFLGIDDPAVFEEIKETTDISKFQKIASDAINKFYAPQESIYGKNIMYGASFDVNSKDIEAGFISSISKTINVILTVVIIVSFIISIVILVIITNIMIASNRISIATFSVLGYNNFEKIFLFFFSFIPSILLA--CGLMIPATLGLITIFNNFVLSTSQIVLPLTLNISTVIISVVTCLVVFTLTSVITWLSLNR 2767
>gi|15829245|ref|NP_326605.1| ABC transporter permease [Mycoplasma pulmonis UAB CTIP] >gi|14090189|emb|CAC13947.1| ABC TRANSPORTER PERMEASE PROTEIN [Mycoplasma pulmonis] (2599 aa)
Score = 300, Expect = 1.5e-24, Identities = 123/514 (23%), Positives = 235/514 (45%)
  Q:   597 INPNGDYLINLVKFINDSYVTGETENTNANNSSESSKLLSDRIKELAKKIVDHYNGTTANVSGSINVNDYYHLFAMATPQNYYV----------YTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSV----LPTNQ--WQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFN-YGEKVDLSSLNSLMDSYT------KKAYLSSEITDFTNLLTARISYPKLIAIYI---NLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAF-LLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSG 1110
           ++P  + L+  V     S +     + N +N S  + L+++++  L K   +      +   G+ N    ++ F      N +V            N+   ++    +F  N +   Y F  +A   P T  +           + VN+A+L  N K++    +PTN   + + LL N  E           + +N+N  +FII+G+  + +  +P+V   +   N   + + YV+  G+E +   +   N   Y  ++     E++    + S +   T      KK YL++EI       + R++ P+LI   +   N ++ I++  L+ I I     +V  Y++   + + I  + G S +QI++S++VF  F A+  GV GY+    LQGL + + SNFW +     +FS + L   +   ++   +L     +W   + PI +L+S    +KV      +    +   V  KF  +L ++   + +      +   +II  G +I + F  S  +T +NR Y +  NL TP+ + G
  S:  1432 VDPMLNILLPQVALWFTSSLNTPENSQNKDNKSNLAYLITNKVVNLGKMNFEQIQNFVSVFLGNSN-EGVFNNFENDAKSNLFVDLDYLELIGINENSRKKNDEQELVFGINFKKTIYEF-IDAVTYPHTLDNVVVFNDVASYLVKVNQAYLVKNNKTIYTGEIPTNNKLFNEFLLKNKDE----------SWMLNVNGSQFIIVGTDTTSDYLYPVVDENNLQVNTSQQAIVYVNQKGFERVKTFSESPNIKEYILVKAEPKKERLLADQIESYISQQTDQSVGIKKTYLNNEIDPINPERSIRVATPRLIISSVSNFNFYIIIILITLVAISIIF---IVHRYIKNKSLVIGILISQGYSPLQISLSMTVFAMFTAVFGGVFGYVVGNNLQGLLMNVFSNFWTLERHTEKFSIVSLMVAVFLPFLGMSILIILTSLWILRKKPI-DLMSGITAIKVGSFSRRINRLFSKRNVKTKFSASLLVNSFFKLLSLAFAITITSTIIMFGISINKVFSKSIDSTYKNRHYSFKLNLATPTLEGG 1956
Score = 138, Expect = 1.0e-05, Identities = 40/112 (35%), Positives = 60/112 (53%)
  Q:  1370 IFGIKKDSQFVTLIGDKKNDLNSKL--FEPVETEDNYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLN 1481
           I+G K DS+F+ +I +   DL  ++  FE  +T D   VYP VVN  ++ +Y L +G TF + + N  TRY+  +   N   +V  +VVGI+          SQ+  N I  LN
  S:  2219 IYGYKSDSKFIKIIDENDVDLMQEIAKFE-TKTIDGKKVYPVVVNTVSSKKYKLGIGSTFGVSILNKATRYSHQIKQENFDNNVIFEVVGINPTFINEEFITSQEIVNEITDLN 2331
Score = 129, Expect = 1.1e-04, Identities = 29/89 (32%), Positives = 50/89 (56%)
  Q:  1697 VAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKK 1785
           +AI   LGY++KE L+    IFVP ++ ++++    V  +   FNF + NAASI L   + +   L  F+A+  I+++  IF  + + K
  S:  2501 IAIFAILGYNNKERLILFFSIFVPFIIFAILLSSVFVLAIIFTFNFFLINAASIALPLSLKFWHMLVTFLAVAAIISVTSIFSWIGINK 2589
>gi|188568885|ref|ZP_03005600.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 2] (2263 aa)
Score = 212, Expect = 2.5e-14, Identities = 87/362 (24%), Positives = 163/362 (45%)
  Q:   774 KVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGI-----------YLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSN 1135
           KV IN   F IIG+  S E  FP ++    + N +   V YV+D G+  L    +      Y+ ++ N     +L   N++ +   K   LS++  +           P  I +   LF+T L  +++ I +           Y  +  +K  + KNKV L   +A G++  Q  +S + F    ++I  ++GY  A+ +Q L + + S++W IPI  +  S   +F+    L +      +  ++   + P  E +      K+NK +   K+    F  +   +    ++ L R ++ +V+ S+   I ++       F  S + T   R Y Y+ +L +P+EQ G Y + ++  +G  +E   +  I  N
  S:   886 KVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVN-TNNFNLLQKNNVYNQ-IKSELLSAKKGNIYK--KTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMLGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQFVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQN 1254
Score = 201, Expect = 4.2e-13, Identities = 162/645 (25%), Positives = 289/645 (44%)
  Q:  1125 EAGGIYDIFSNTM-FDNNNPYRKLVTSTDQDEKDLLALRDLQGN-----VIKYSNGQPKY---FSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAG----IYVNAWQFVSEAFPLELISR--------INAISNNFLISVLEVPELKTINDTQNY----ITRNSS-----------------------GNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETED-NYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIK-QVEYPKSYVP---FNGVFSKEENPLLVNSLV-LENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT----PSIVAINSF---EYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYL--FGFIAIV 1769
           E G IY I S T+   + N Y   V + D+ +   L    L+ N     +       P Y    SN+  PS        ++ + F + V+SK  +D  IS+      I  N W F     P+  I+R        ++    NF   +++  ++  + D  N+    I R  S                       G + +N +  +    +++  +  F  EFL+ I  +Y       +  K     + F ++E     + YTYL   +   T +     N  K L I+  K  F   K S    L     ND    L + ++ ++ N  V+  ++NK  A +Y L + D F+ ++ N   R ++  +        K KVVGI+       + I+Q  AN ++G +                                        +YR + QVE     +    FNG F+KE++P+  N++    + SGL    S   DS    L+  +G  N+ N+ + +       LA ++  +S  +N I     S +++  L   +   FG     PS  A+++    E F +V D       T  ++   II   IP ++II+++++S + N+ RRL+AI+K LG  D +N+ + + I+  V L+++++   +   +  ++   +F A +I L   I W  ++  FGF+ +V
  S:  1593 EKGYIYQISSATLEGSDTNLYLDNVNAIDKTKDSGLPYSSLKYNNAMREIKDLGTDHPVYGKMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVKINGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAG---LKFVNIEDEKTQQPYTYLLGQMQTKTKKFG---NEIKILGINYEKNKFIDDKPSPTTQL--SLINDQGVNLIDLIKDDNVNNEVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD----------------------------------------DYRERMQVENGHPIIEAREFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMSKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLV 2237
>gi|13358107|ref|NP_078381.1| hypothetical protein UU543 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|11356824|pir||B82877 conserved hypothetical UU543 [imported] - Ureaplasma urealyticum >gi|6899548|gb|AAF30956.1|AE002153_4 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (1413 aa)
Score = 211, Expect = 3.5e-14, Identities = 84/362 (23%), Positives = 164/362 (45%)
  Q:   774 KVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLN-------SLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSN 1135
           K+ IN   F IIG+  S E  FP ++    + N +   V YV+D G+  L   ++      Y+ ++ N  +   L   N        L+DS     Y  ++  +   +   R  +   +   I      L+ ++L++GIY  +  +K  + KNKV     +A G+S  Q+  S + F    ++I  ++GY  ++ +Q L + + S++W IPI  +  S   +F+    L +      ++ ++   +    E +      K+NK +   K+    F  +   +    ++ L R ++ +V+ S+   I ++       F  S + T   R Y Y+ +L +P+EQ G Y + ++  +G ++E   +  I  N
  S:    36 KIEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTISASVPILEYYTLKVNTNDLNLLQKNNVYNEIKSELLDSKKGNIYKRTDKDNPYPIYVKRTFFLTQLRNLIIAIALSLIVLILLLGIYFVTSSIKNMINKNKVMFGAMQAQGVSRWQVWFSFAPFYTIPSLIVLIIGYSISYEIQPLIMRLFSSYWLIPIPDQFVSVGWIFAIPIALTLILGFICWVLIYYILKHSTAETMKGDAGFKINKFIIKTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYQYAVDLYSPTEQGGFYYISKFDEMGVSNEYAPLKQIVKN 404
Score = 193, Expect = 4.2e-12, Identities = 160/645 (24%), Positives = 291/645 (45%)
  Q:  1125 EAGGIYDIFSNTM-FDNNNPYRKLVTSTDQDEKDLLALRDLQGN-----VIKYSNGQPKY---FSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAG----IYVNAWQFVSEAFPLELISR--------INAISNNFLISVLEVPELKTINDTQNY-----------ITRNSSGNYVLNPEKVLDLTN------------VSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDI--NKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETED-NYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLV-LENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT----PSIVAINSF---EYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYL--FGFIAIV 1769
           E G +Y I + T+   + N Y   V S D+ + + L    L+ N     +       P Y    SN+  PS        ++ + F + V+SK  +D  IS+      I  N W F     P+  I+R        ++     F   ++   ++  + D  N+            T+N       N E    +              +++  +  F  EFL+ I  +Y       +  K     + F ++E   + + YTYL   +   T R     N  K L I+   NK I G    +  ++LI    ND    L + ++ +D N  ++  ++NK  A +Y L++ D F+  + N   R ++  +        K KVVGI+       + I+Q  AN ++G +                        D+   +   +G        I++ E       FNG F+KE+ P+  N++    + +GL    S   DS    L+  +G  N+ ++ + +       LA ++  +S  +N I     S +++  L   +   FG     PS  A+++    E F +V D   T F  L++I    I   IP ++II+++++S + N+ RRL+AI+K LG  D  N+ + + I+  V L+++++   +   +  ++   +F A +I L   I W  ++  +GF+ IV
  S:   743 EKGYVYQISTATLEGSDTNLYLDNVNSIDKTKDNGLPYSSLKYNNAMREIKNLGTDHPVYGKMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKTFGYEIINGKKINKLYDVPNFEDNGIIHQISLWTKNGLPPKSENDENAFFIKQNGQWKINEKPGVLTEQGAAEFLPEFLRLITQMYTFKTTRYLQYKAG---LKFVNIEDEKVQQPYTYLLGKMQTKTKRFA---NEIKILGINYEKNKFINGKPSPTTQLSLI----NDQGVNLIDLIKNDDPNNEIHNIIINKVVAQKYHLKINDVFEYQINNHIKRLSNKFNNTPENYKTKFKVVGINDSLMDEQLIINQKVANKLIGFD------------------------DYRRRIQIENGYPI-----IEERE-------FNGFFTKEKEPIFFNNMASFYSPTGL----SPAIDSWPQNLLENIG-GNVQSINIYWIFYYSWDLANSILNASFDKNKITWEPFSEINLDKLLKKIGKIFGKEANLPSFKAVDANIENEIFASVVDK--TSFTLLLNI----ITAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFRNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVISYGFVGIV 1387
>gi|188518370|ref|ZP_03003877.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188530636|ref|ZP_03004983.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188998162|gb|EDU67259.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (2263 aa)
Score = 209, Expect = 6.0e-14, Identities = 86/362 (23%), Positives = 162/362 (44%)
  Q:   774 KVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGI-----------YLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSN 1135
           KV IN   F IIG+  S E  FP ++    + N +   V YV+D G+  L    +      Y+ ++ N     +L   N++ +   K   LS++  +           P  I +   LF+T L  +++ I +           Y  +  +K  + KNKV     +A G++  Q  +S + F    ++I  ++GY  A+ +Q L + + S++W IPI  +  S   +F+    L +      +  ++   + P  E +      K+NK +   K+    F  +   +    ++ L R ++ +V+ S+   I ++       F  S + T   R Y Y+ +L +P+EQ G Y + ++  +G  +E   +  I  N
  S:   886 KVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVN-TNNFNLLQKNNVYNQ-IKSELLSAKKGNIYK--KTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMFGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQFVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQN 1254
Score = 201, Expect = 4.0e-13, Identities = 162/645 (25%), Positives = 289/645 (44%)
  Q:  1125 EAGGIYDIFSNTM-FDNNNPYRKLVTSTDQDEKDLLALRDLQGN-----VIKYSNGQPKY---FSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAG----IYVNAWQFVSEAFPLELISR--------INAISNNFLISVLEVPELKTINDTQNY----ITRNSS-----------------------GNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETED-NYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIK-QVEYPKSYVP---FNGVFSKEENPLLVNSLV-LENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT----PSIVAINSF---EYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYL--FGFIAIV 1769
           E G IY I S T+   + N Y   V + D+ +   L    L+ N     +       P Y    SN+  PS        ++ + F + V+SK  +D  IS+      I  N W F     P+  I+R        ++    NF   +++  ++  + D  N+    I R  S                       G + +N +  +    +++  +  F  EFL+ I  +Y       +  K     + F ++E     + YTYL   +   T +     N  K L I+  K  F   K S    L     ND    L + ++ ++ N  V+  ++NK  A +Y L + D F+ ++ N   R ++  +        K KVVGI+       + I+Q  AN ++G +                                        +YR + QVE     +    FNG F+KE++P+  N++    + SGL    S   DS    L+  +G  N+ N+ + +       LA ++  +S  +N I     S +++  L   +   FG     PS  A+++    E F +V D       T  ++   II   IP ++II+++++S + N+ RRL+AI+K LG  D +N+ + + I+  V L+++++   +   +  ++   +F A +I L   I W  ++  FGF+ +V
  S:  1593 EKGYIYQISSATLEGSDTNLYLDNVNAIDKTKDSGLPYSSLKYNNAMREIKDLGTDHPVYGKMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVKINGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAG---LKFVNIEDEKTQQPYTYLLGQMQTKTKKFG---NEIKILGINYEKNKFIDDKPSPTTQL--SLINDQGVNLIDLIKDDNVNNEVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD----------------------------------------DYRERMQVENGHPIIEAREFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMSKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLV 2237
>gi|188039204|ref|ZP_02998014.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 8] (2263 aa)
Score = 209, Expect = 6.1e-14, Identities = 86/362 (23%), Positives = 162/362 (44%)
  Q:   774 KVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGI-----------YLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSN 1135
           KV IN   F IIG+  S E  FP ++    + N +   V YV+D G+  L    +      Y+ ++ N     +L   N++ +   K   LS++  +           P  I +   LF+T L  +++ I +           Y  +  +K  + KNKV     +A G++  Q  +S + F    ++I  ++GY  A+ +Q L + + S++W IPI  +  S   +F+    L +      +  ++   + P  E +      K+NK +   K+    F  +   +    ++ L R ++ +V+ S+   I ++       F  S + T   R Y Y+ +L +P+EQ G Y + ++  +G  +E   +  I  N
  S:   886 KVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVN-TNNFNLLQKNNVYNQ-IKSELLSAKKGNIYK--KTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMFGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQFVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQN 1254
Score = 201, Expect = 4.2e-13, Identities = 162/645 (25%), Positives = 289/645 (44%)
  Q:  1125 EAGGIYDIFSNTM-FDNNNPYRKLVTSTDQDEKDLLALRDLQGN-----VIKYSNGQPKY---FSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAG----IYVNAWQFVSEAFPLELISR--------INAISNNFLISVLEVPELKTINDTQNY----ITRNSS-----------------------GNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETED-NYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIK-QVEYPKSYVP---FNGVFSKEENPLLVNSLV-LENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT----PSIVAINSF---EYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYL--FGFIAIV 1769
           E G IY I S T+   + N Y   V + D+ +   L    L+ N     +       P Y    SN+  PS        ++ + F + V+SK  +D  IS+      I  N W F     P+  I+R        ++    NF   +++  ++  + D  N+    I R  S                       G + +N +  +    +++  +  F  EFL+ I  +Y       +  K     + F ++E     + YTYL   +   T +     N  K L I+  K  F   K S    L     ND    L + ++ ++ N  V+  ++NK  A +Y L + D F+ ++ N   R ++  +        K KVVGI+       + I+Q  AN ++G +                                        +YR + QVE     +    FNG F+KE++P+  N++    + SGL    S   DS    L+  +G  N+ N+ + +       LA ++  +S  +N I     S +++  L   +   FG     PS  A+++    E F +V D       T  ++   II   IP ++II+++++S + N+ RRL+AI+K LG  D +N+ + + I+  V L+++++   +   +  ++   +F A +I L   I W  ++  FGF+ +V
  S:  1593 EKGYIYQISSATLEGSDTNLYLDNVNAIDKTKDSGLPYSSLKYNNAMREIKDLGTDHPVYGKMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVKINGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAG---LKFVNIEDEKTQQPYTYLLGQMQTKTKKFG---NEIKILGINYEKNKFIDDKPSPTTQL--SLINDQGVNLIDLIKDDNVNNEVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD----------------------------------------DYRERMQVENGHPIIEAREFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMNKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLV 2237
>gi|188592701|ref|ZP_03005990.1| efflux ABC transporter, permease protein [Ureaplasma urealyticum serovar 10] (2263 aa)
Score = 208, Expect = 6.3e-14, Identities = 86/362 (23%), Positives = 162/362 (44%)
  Q:   774 KVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGI-----------YLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSN 1135
           KV IN   F IIG+  S E  FP ++    + N +   V YV+D G+  L    +      Y+ ++ N     +L   N++ +   K   LS++  +           P  I +   LF+T L  +++ I +           Y  +  +K  + KNKV     +A G++  Q  +S + F    ++I  ++GY  A+ +Q L + + S++W IPI  +  S   +F+    L +      +  ++   + P  E +      K+NK +   K+    F  +   +    ++ L R ++ +V+ S+   I ++       F  S + T   R Y Y+ +L +P+EQ G Y + ++  +G  +E   +  I  N
  S:   886 KVEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTIAASVPILEYYTLKVN-TNNFNLLQKNNVYNQ-IKSELLSAKKGNIYK--KTDKDNPYRIYVKRTLFLTQLRNLVIAIAVGLIVLILLLGIYFVASSIKNMINKNKVMFGAMQAQGVTRWQAWLSFAPFYTIPSLIVLIIGYSVAYAIQPLIMRLFSSYWLIPIPEQFVSVGWIFAIPITLALILGFICWTLIFYILKQPTAETMKGDAGFKINKFIIGTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYEYAVDLYSPTEQGGFYYISKFEEMGVPNEYSPLKQIVQN 1254
Score = 201, Expect = 4.4e-13, Identities = 162/645 (25%), Positives = 289/645 (44%)
  Q:  1125 EAGGIYDIFSNTM-FDNNNPYRKLVTSTDQDEKDLLALRDLQGN-----VIKYSNGQPKY---FSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAG----IYVNAWQFVSEAFPLELISR--------INAISNNFLISVLEVPELKTINDTQNY----ITRNSS-----------------------GNYVLNPEKVLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETED-NYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIK-QVEYPKSYVP---FNGVFSKEENPLLVNSLV-LENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT----PSIVAINSF---EYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYL--FGFIAIV 1769
           E G IY I S T+   + N Y   V + D+ +   L    L+ N     +       P Y    SN+  PS        ++ + F + V+SK  +D  IS+      I  N W F     P+  I+R        ++    NF   +++  ++  + D  N+    I R  S                       G + +N +  +    +++  +  F  EFL+ I  +Y       +  K     + F ++E     + YTYL   +   T +     N  K L I+  K  F   K S    L     ND    L + ++ ++ N  V+  ++NK  A +Y L + D F+ ++ N   R ++  +        K KVVGI+       + I+Q  AN ++G +                                        +YR + QVE     +    FNG F+KE++P+  N++    + SGL    S   DS    L+  +G  N+ N+ + +       LA ++  +S  +N I     S +++  L   +   FG     PS  A+++    E F +V D       T  ++   II   IP ++II+++++S + N+ RRL+AI+K LG  D +N+ + + I+  V L+++++   +   +  ++   +F A +I L   I W  ++  FGF+ +V
  S:  1593 EKGYIYQISSATLEGSDTNLYLDNVNAIDKTKDSGLPYSSLKYNNAMREIKDLGTDHPVYGKMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKNFGYEIIDGKKVNKLYDVPNFEDDGIVRQVSLWTKTGLPPKSENDEDAFFVKINGQWKINEKPGV----LTEQGAAEFLPEFLRLITQMYTFKSTRYLQYKAG---LKFVNIEDEKTQQPYTYLLGQMQTKTKKFG---NEIKILGINYEKNKFIDDKPSPTTQL--SLINDQGVNLIDLIKDDNVNNEVHNIIINKVVAQKYHLNINDVFEYEINNHIKRLSNKFNNTPQVYKTKFKVVGINDSLMDEQLIINQKIANKLIGFD----------------------------------------DYRERMQVENGHPIIEAREFNGFFTKEKSPIFFNNMASFYSPSGL----SPAIDSWPQNLLENIG-GNVQNINIYWIFYYSWDLANSILNASFDKNKISWDSFSEVNLDKLLKKMSKIFGKEANLPSFKAVDANIENEIFASVID------KTSFTLLLNIIIAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFKNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVVSFGFVGLV 2237
>gi|170761857|ref|YP_001752627.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|168827434|gb|ACA32696.1| efflux ABC transporter, permease protein [Ureaplasma parvum serovar 3 str. ATCC 27815] (2263 aa)
Score = 206, Expect = 1.2e-13, Identities = 84/362 (23%), Positives = 164/362 (45%)
  Q:   774 KVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLN-------SLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSN 1135
           K+ IN   F IIG+  S E  FP ++    + N +   V YV+D G+  L   ++      Y+ ++ N  +   L   N        L+DS     Y  ++  +   +   R  +   +   I      L+ ++L++GIY  +  +K  + KNKV     +A G+S  Q+  S + F    ++I  ++GY  ++ +Q L + + S++W IPI  +  S   +F+    L +      ++ ++   +    E +      K+NK +   K+    F  +   +    ++ L R ++ +V+ S+   I ++       F  S + T   R Y Y+ +L +P+EQ G Y + ++  +G ++E   +  I  N
  S:   886 KIEINGQFFFIIGAVDSPEFLFPAINDSDILINKQKSTVLYVNDSGFAKLKTISASVPILEYYTLKVNTNDLNLLQKNNVYNEIKSELLDSKKGNIYKRTDKDNPYPIYVKRTFFLTQLRNLIIAIALSLIVLILLLGIYFVTSSIKNMINKNKVMFGAMQAQGVSRWQVWFSFAPFYTIPSLIVLIIGYSISYEIQPLIMRLFSSYWLIPIPDQFVSVGWIFAIPIALTLILGFICWVLIYYILKHSTAETMKGDAGFKINKFIIKTKAIFLKFGAIRVLKATYVVANLARMLILLVIASSFSIIASIIATTKNNFSQSASITNAKREYQYAVDLYSPTEQGGFYYISKFDEMGVSNEYAPLKQIVKN 1254
Score = 185, Expect = 2.9e-11, Identities = 160/645 (24%), Positives = 291/645 (45%)
  Q:  1125 EAGGIYDIFSNTM-FDNNNPYRKLVTSTDQDEKDLLALRDLQGN-----VIKYSNGQPKY---FSNLLLPSYVHVDAFKKDPQLFRNAVVSKWLVDFEISIAG----IYVNAWQFVSEAFPLELISR--------INAISNNFLISVLEVPELKTINDTQNY-----------ITRNSSGNYVLNPEKVLDLTN------------VSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDI--NKEIFGIKKDSQFVTLIGDKKNDLNSKLFEPVETED-NYLVYPAVVNKGAAYQYDLEVGDTFKIDVKNSYTRYTDSMSGINPTKSVKLKVVGISSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNANYRIKQVEYPKSYVPFNGVFSKEENPLLVNSLV-LENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMPYSEEGLSKLATNLSISSNSRNDIITRLSSSMSISSLQTWLQNNFGT----PSIVAINSF---EYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYL--FGFIAIV 1769
           E G +Y I + T+   + N Y   V S D+ + + L    L+ N     +       P Y    SN+  PS        ++ + F + V+SK  +D  IS+      I  N W F     P+  I+R        ++     F   ++   ++  + D  N+            T+N       N E    +              +++  +  F  EFL+ I  +Y       +  K     + F ++E   + + YTYL   +   T R     N  K L I+   NK I G    +  ++LI    ND    L + ++ +D N  ++  ++NK  A +Y L++ D F+  + N   R ++  +        K KVVGI+       + I+Q  AN ++G +                        D+   +   +G        I++ E       FNG F+KE+ P+  N++    + +GL    S   DS    L+  +G  N+ ++ + +       LA ++  +S  +N I     S +++  L   +   FG     PS  A+++    E F +V D   T F  L++I    I   IP ++II+++++S + N+ RRL+AI+K LG  D  N+ + + I+  V L+++++   +   +  ++   +F A +I L   I W  ++  +GF+ IV
  S:  1593 EKGYVYQISTATLEGSDTNLYLDNVNSIDKTKDNGLPYSSLKYNNAMREIKNLGTDHPVYGKMLSNVYYPSISTQPEILQNIRFFDSKVISKSSLDGNISVKATDVNIEFNPWVFAKTFLPITAIARSELNEKHLLDEAFKTFGYEIINGKKINKLYDVPNFEDNGIIHQISLWTKNGLPPKSENDENAFFIKQNGQWKINEKPGVLTEQGAAEFLPEFLRLITQMYTFKTTRYLQYKAG---LKFVNIEDEKVQQPYTYLLGKMQTKTKRFA---NEIKILGINYEKNKFINGKPSPTTQLSLI----NDQGVNLIDLIKNDDPNNEIHNIIINKVVAQKYHLKINDVFEYQINNHIKRLSNKFNNTPENYKTKFKVVGINDSLMDEQLIINQKVANKLIGFD------------------------DYRRRIQIENGYPI-----IEERE-------FNGFFTKEKEPIFFNNMASFYSPTGL----SPAIDSWPQNLLENIG-GNVQSINIYWIFYYSWDLANSILNASFDKNKITWEPFSEINLDKLLKKIGKIFGKEANLPSFKAVDANIENEIFASVVDK--TSFTLLLNI----ITAIIPSLVIIIILVASTLANESRRLIAIMKVLGMRDFRNVNNFMFIYPIVWLLNILIATPLSFGIIHIYKLAIFAAFNIVLVASIPWWIFVISYGFVGIV 2237
>gi|148378006|ref|YP_001256882.1| ABC transporter permease protein [Mycoplasma agalactiae PG2] >gi|148292052|emb|CAL59444.1| ABC transporter permease protein [Mycoplasma agalactiae PG2] (2723 aa)
Score = 204, Expect = 2.1e-13, Identities = 85/382 (22%), Positives = 175/382 (45%)
  Q:   733 VNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLL--YTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYT------KKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSS---LLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKL-LYLLKSKKTSFFVLAKFRIALTLS---KLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKV 1114
           VN A+L+ N K++     +   L  N+ E  +    +D +Y +++N ++F+I+G   + +  +P++       N + + + Y+++ G+  ++  Y  +   +++          +V   ++ +++DS        K+ +   E+         RI+    I   IN+ ++ ++A++ +  I +S     +++ Y+        I  A G   I+IAISL  F    ++I G++GY   F  Q L   + SN+W +P S   F +  LF  +   ++   L   +    + R    +L++  ++    KL   + K       V  +F   L  S   KL  F   V+L S        G A  + F  +  +T +NR Y +  +L++P+ +   Y +
  S:  1664 VNYAYLSKNNKAI-----YNGELPRNNVEMESLLNTIDDKYILDVNGIKFLIVGEDTTVDYIYPVIDENHLQVNTQNQALVYLNNYGFSRIMAAYQGNVVKKNLLVVNGSKNSNEVVKRNITNIVDSSISDANKLKRVFSYDELDPINPERALRIT---TIEGMINVILSSIIALMSLFIIMVSVAIIFIIRRYIANKAKVFGILLAQGYRPIEIAISLLPFAMVTSLIGGILGYSIGFRTQILLQNVFSNYWTLPKSAIPFDFFSLFFNVFIPFLGMSLLIIVVALISLRKSSIDLITGVDDAPRGKLFNKIKKKFINKKNVKKRFSFTLAYSGFWKLASFGGSVLLTSIA---TMFGLANYKTFNNTINDTYKNRDYRFKIDLESPTTEGKYYSL 2049
>gi|50365077|ref|YP_053502.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] >gi|50363633|gb|AAT75618.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] (1693 aa)
Score = 163, Expect = 1.1e-08, Identities = 83/339 (24%), Positives = 149/339 (43%)
  Q:   775 VNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIY---FAIRFNY-GEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKF--RIALTLSKLTR--FILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYK 1113
           + + +  F +IG      + +P+V+ + PIP P+  G+ Y      +SL      SN +     +A RF +  EK D+   N L     K    +  +  F+  L      P+++  Y +LF  I+  ++ VI +    + +K  ++ N   + I KA G+    IA+S        AI    + +    L+Q  FV +   ++ I +   + S + L  G        ++ SFL  W+    P+ E+L   E  K +   ++L   K + F  +KF  + ++TL+   R    L  V+      ++++G  IP    T+++   +N  Y  SYN       S L K
  S:   489 LKVGAQNFTVIGYATDTFSYYPVVNDDLPIPQPKNTGIIYASQETLKSLFEDTPSSNAEKIAKTYAKRFIWTNEKSDIDLFNYLFAPSQKAKTFAESVYRFSWDLQ-----PQVVLAY-SLFTIIISLIIGVIALSGLLISLKKSIKANTKQIGILKALGVEPHNIALSYIAQSVIIAIFIIPLSWGIGLLVQSGFVHLFIPYFSIQLYQIQVSVLPLIIGFIFFGFLSVMVSFLVAWRLTNKPVIEILRVEETKKSHS--WILNKMKNTIFSKSKFTLKFSITLASTNRRNIYLMTVVIFITSFLVSIGFTIPATVRTAESAYYKNVEYSNSYNYVENVSNSPLSK 827
>gi|66880420|ref|ZP_00405401.1| COG0577: ABC-type antimicrobial peptide transport system, permease component [Mycoplasma genitalium G-37] (118 aa)
Score = 163, Expect = 1.2e-08, Identities = 28/101 (27%), Positives = 60/101 (59%)
  Q:  1666 IETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFI 1766
           ++  ++   IP I I  +++   M+ + +R+   LK +GY D +NL+S+L  F+P  +++L++ I ++A + +    +VFN A ++L    ++L Y+ G +
  S:     4 VDAFLLGTIIPFIFITCVVLGISMLEEMKRIFISLKAIGYRDVQNLISLLTFFIPAFVLALLISIGVLAGVLIGIQAVVFNVAQVFLTNVFEFLPYMVGIV 104
>gi|188159619|ref|ZP_02998777.1| ABC transporter, permease protein, putative [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1773 aa)
Score = 158, Expect = 3.9e-08, Identities = 77/321 (23%), Positives = 141/321 (43%)
  Q:   782 FIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSF-SNQDIYFAIRFNYGEKVDLSSLNSL-MDSYTKKAYLSSEITDFTNLLTARISYP----------------KLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKS---KKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNL 1102
            ++ G  +   + FP      P+P     G+ Y  D   + ++   +  SN D      F   +K   ++LN+L +D ++K   +   I  + +   A   Y                 + I  Y +L   +   ++ +I      + V   ++ N   + I KANG+ S  IA S   +     +IS  +G++   +LQ  FVGI  +++ + + V EF +I +   +A       LFSF+        P+ ++++ +++    +L   LK    KK  F  L    + LT S    F L ++L       I++G AIP     ++ N  +N  Y   Y +
  S:   520 LVVSGYAVDTYSFFPTSDPNVPLPKSDSGGLIYASDKTIDQIIGDQTDPSNNDQTTIYNFFLIKKQSDANLNNLYLDHFSKSTKIRENINAYNSKDKANTFYKTYDFDKSWYSLNWTLYQKITFYYSLATFLTAGLIALIAALAVFVGVIKSIQANAKQIGILKANGVYSKTIASSYIWYALILVLISIPIGWMFGTILQVPFVGIFKDYFSLKVEVIEFDWISVLISVAIFGFLIGLFSFIVALFNIHKPVLQVINHTKKWSRPRLTDWLKKYLFKKIKFNNL--LMLKLTESGKKPFSLLLILTFVATLFISIGIAIPSIAIHTKNNYFKNINYNNEYQI 859
>gi|42561240|ref|NP_975691.1| permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492738|emb|CAE77333.1| Predicted permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1384 aa)
Score = 158, Expect = 4.9e-08, Identities = 77/293 (26%), Positives = 142/293 (48%)
  Q:   782 FIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKA--YLSSEITDFTNL------------------------LTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTL---SKLTRFILFVVLCSAGLSIIA 1074
           + ++G   S +  FP ++  SPIPN   EG+ YVD + +  +  T+ F   D       +   K+ +SS N     Y+ K    LS E  D+ N                           +R S  K      N++  I++  ++ + +Y + L+ K  +  ++  +   +A G    Q+A++  +   F +I+ G++GY+ + L+  + +   SN++ +   V  F +IGL + +  +++     SFL  +   +     LL +    K++KL  L+KS         + R AL +   SKLT  + FVVL +  L  I+
  S:   240 YQVVGFANSADFIFPTINAYSPIPNRLNEGIIYVDPLRFGLIKQTDGFYKYD-------STSSKLVVSSNNEWESFYSLKTNQKLSDETIDWMNQYFSQLINKKAQDKWIYKLEDPNYRFNSRTSVIKKTIGAYNIYSFIVLLAVISVVLYTTFLITKKQILNSRGQIGTMRAIGYKKRQMALNYVMMPFFTSIVGGILGYILSCLVSIIIINRFSNYFSLDYGVFSFDWIGLLNNLIFMWLIISAISFLIGYLIMKKGAINLLENRNVKKISKLGSLIKSLSNKRKFNHRLRAALLVNSGSKLTG-VGFVVLIATILFTIS 553
>gi|66880415|ref|ZP_00405396.1| hypothetical protein MgenG_01000021 [Mycoplasma genitalium G-37] (292 aa)
Score = 157, Expect = 5.7e-08, Identities = 78/261 (29%), Positives = 122/261 (46%)
  Q:     1 MLQLIKQVLKSFKSSILLLIGLFFISFAIVFATFSSLYFSSNISNSYNSLSASSNGNEAFLETKDSELKNNNLSYDFDSLNNLNPIKPNSDGKYFNSLD-EYANLNFSFIYPETNLYHSSFTKQSNARNYIFAYYTSSADTNKYF--KGDGVNKADSLYKDRARGILASYGNLKIPDSSNQWRAFGLELGNEDLKNIIYEIDPLTGQTAIDANSNYV-----NTLGYFSDGYISSTITLWGGNLKYPTNVTGTSATDISGKTYRVKNNN 261
           M    KQ+ KS K    LL G+ F+ F+I+F   S +  S+N+ ++Y +L + +N ++       + LK  N  Y   SL N        D  YF+ +  +   +N+ F Y E +    S + QSN          S  + NK    KGD VN+ D L+  R RGIL +YG   I +    ++   +   N D  N     D +T +  I    N +     N LGYF+DG I  TI+L  G  ++P +   ++ T +     +  NN+
  S:     1 MFSFFKQIFKSLKKFFFLLFGIIFVLFSIIFLETSIVQLSNNLVSTYTTLVSKTNSSDI---VAPAILKEANPVY-IASLTN--------DSGYFSKIKIDDKKINYLFPYQENDF--GSDSGQSNG---------SGDNQNKTIPRKGD-VNEKDKLFLARKRGILKAYGEANIAE-KRIYKGLAVSFNNTDSFNGSDISDSITNRHIISDPQNLIYDASGNLLGYFADGLIKETISLRAGIARFPGDKGKSTGTQVKITQKQQTNND 244
>gi|406356|gb|AAD12431.1| unknown [Mycoplasma genitalium] (116 aa)
Score = 149, Expect = 4.8e-07, Identities = 49/133 (36%), Positives = 73/133 (54%)
  Q:  1459 SSDAFATSIYISQDNANTILGLNFNQGATIIGTSTYGNGTMETTVLGDWSSGVLKPSGTETNAN--YRIKQVEYPKSYVPFNGVFSKEENPLLVN-SLVLENTSGLWGNYSSFTDSGFAGLVSTVGINNIINMAMP 1591
           S+DAF   +YI+Q  AN +L L+ NQG  II                     V+K +  ++ ++  Y I  V+ P  YVPFNGVFSKE  P L+N +LVL +  G+WGN++ F ++ F  LV    ++ +I   +P
  S:     1 STDAFGQELYINQHIANNLLKLSGNQGRGII-------------------RDVIKKTNGQSQSSDEYEIDYVK-PNGYVPFNGVFSKELKPSLLNKALVLNSIIGVWGNFTDFGNN-FQNLVRN-KLDKVITSILP 114
>gi|188159163|ref|ZP_02998575.1| Predicted permease [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1381 aa)
Score = 149, Expect = 5.4e-07, Identities = 77/293 (26%), Positives = 142/293 (48%)
  Q:   782 FIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYT--KKAYLSSEITDFTNL------------------------LTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTL---SKLTRFILFVVLCSAGLSIIA 1074
           + ++G   S +  FP ++  SPIPN   EG+ YVD + +  +  T+ F   D       +   K+ +SS N     Y+   K  LS EI D+ N                           +R S  K      N++  I++  ++ + +Y + L+ K  +  ++  +   +A G    Q+ ++  +   F +I+ G++GY+ + L+  + +   SN++ +   V  F +IGL + +  +++     SFL  +   +     LL +    K++KL  L+KS         + R AL +   SKLT  + FVVL +  L  I+
  S:   237 YQVVGFANSADFIFPTINAYSPIPNRLNEGIIYVDPLRFGLIKQTDGFYKYD-------STSSKLVVSSNNEWESFYSLKTKQKLSDEIVDWMNQYFSQLINKKAQDKWIYKLEDPNYRFNSRTSVIKKTISAYNIYSFIVLLAVISVVLYTTFLITKKQILNSRGQIGTMRAIGYKKRQMVLNYVMMPFFTSIVGGILGYILSCLISIIIINRFSNYFSLDYGVFSFDWIGLLNNLIFMWLIISSISFLIGYLIMKKGAINLLENRNAKKISKLGSLIKSLSNKRKFNHRLRAALLVNSGSKLTG-VGFVVLIATILFTIS 550
>gi|42560863|ref|NP_975314.1| permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492360|emb|CAE76956.1| Predicted permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] (704 aa)
Score = 133, Expect = 3.3e-05, Identities = 77/312 (24%), Positives = 144/312 (46%)
  Q:   782 FIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSF-SNQDIYFAIRFNYGEKVDLSSLNSL-MDSYTKKAYLSSEIT---------------DFTN-------LLTARISYPKLIAIYINLFVTILVAVLLV-IGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLL-----YLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLEN 1093
            ++ G  +   + FP      P+P     G+ Y  D   + ++   +  SN D      F   +K   ++LN+L +D ++K   +   I                DF          L  +I++   +A ++   +  L+A L V +G+  S       ++ N   + I KANG+ S  IA S   +     +IS  +G++   +LQ  FVGI  +++ + + V EF +I +   +A       LFSF+        P+ ++++ +++    +L      YL K  K +  ++ K    LT S    F L ++L       I++G A+P     ++ N  +N
  S:   352 LVVSGYAVDTYSFFPTSDPNVPLPKSDSGGLIYASDKTIDQIIGDQTDPSNNDQTTIYNFFLIKKQSDANLNNLYLDHFSKSTKIRENINAYNNKNKANTFYKTYDFDKSWYSLNWTLYQKITFYYSLATFLTAGLIALIAALAVFVGVIKS-------IQANAKQIGILKANGVYSKTIASSYIWYALILILISIPIGWMFGTVLQVPFVGIFKDYFSLKVEVIEFDWISVLISVAIFGFLIGLFSFIVALFNIHKPVLQVINHTKKWSKPRLTDWFKKYLFKKIKFNNLLMLK----LTESGKKPFSLLLILTFIATLFISIGIAVPSIAIHTKNNYFKN 682
>gi|66880287|ref|ZP_00405270.1| COG0577: ABC-type antimicrobial peptide transport system, permease component [Mycoplasma genitalium G-37] (103 aa)
Score = 133, Expect = 3.6e-05, Identities = 38/102 (37%), Positives = 57/102 (55%)
  Q:   873 NLLTARISY-PKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFW 974
           NLL AR  + P LI   INL    L   +L + I +S L++  Y++KN   + I KANG+S  +I +SL +FG   AI+  + GY      Q + + + SN+W
  S:     2 NLLAARTVFIPNLINT-INLVALFLTIAILTVAIIVSILILISYLKKNTEQIGILKANGLSGKKINLSLLIFGLIPAIVGAISGYSFGIGFQDVAIHLFSNYW 103
>gi|83319508|ref|YP_424628.1| hypothetical protein MCAP_0664 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283394|gb|ABC01326.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1381 aa)
Score = 125, Expect = 3.1e-04, Identities = 76/293 (25%), Positives = 139/293 (47%)
  Q:   782 FIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYT--KKAYLSSEITD-----FTNLLTARIS--------------------YPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTL---SKLTRFILFVVLCSAGLSIIA 1074
           + ++G   S +  FP ++  +PIPN   EG+ YVD   +  +   + F   D       +   K+ +SS N     Y+   K  L+ +I D     F  L+  R                        K I+ Y    V +L+AV+ V+ +Y + L+ K  +  ++  +   +A G    Q+  +  +   F +I+ G++GY+ + L+  + +   +N++ +   V  F +IG  + +  +++     SFL  +   +     LL +    K+ KL  L+KS         + R AL +   SKLT  + FVVL +  L  I+
  S:   238 YQVVGFANSADFIFPTINAYTPIPNRLNEGIIYVDPSRFGLIKQDDGFYRYD-------STSSKLVVSSNNEWESFYSLKTKDKLNDQIIDWMNQYFNQLINKRTQNKWIYKLDDSNYRFSSRTNVIKKTISAYNIYSVAVLLAVISVV-LYTTFLITKKQILNSRGQIGTMRAIGYKKRQMVFNYVMMPFFTSIVGGILGYILSCLISIIIINKFANYFSLDYGVFSFDWIGFLNNLIFMWLIISAISFLIAYLIMKKGAINLLENRNAKKITKLGNLVKSLSNKRKFNHRLRAALLVDSGSKLTG-VGFVVLIATILFTIS 551
>gi|146319034|ref|YP_001198746.1| peptide ABC transporter permease [Streptococcus suis 05ZYH33] >gi|146321242|ref|YP_001200953.1| peptide ABC transporter permease [Streptococcus suis 98HAH33] >gi|145689840|gb|ABP90346.1| ABC-type antimicrobial peptide transport system, permease component [Streptococcus suis 05ZYH33] >gi|145692048|gb|ABP92553.1| ABC-type antimicrobial peptide transport system, permease component [Streptococcus suis 98HAH33] (1125 aa)
Score = 124, Expect = 3.5e-04, Identities = 39/147 (26%), Positives = 79/147 (53%)
  Q:  1642 AINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNL 1788
           A+ S    T++ D   TI  +L +I T+++ L I L ++I+  ++ + M++  R ++ +K LG+ ++E  + I    + + LI ++VG+     L  L   M+  + SI   P +    YL   +AI GI+++   +V  +L+K ++
  S:   972 AVRSLVQNTSLIDMLTTIAGSLQTIMTILVILSILLGLVILYNLTIINMSERIRELSTIKVLGFHNREVTMYIYRETIALSLIGMLVGLVGGIYLHKLLLAMI-GSDSIRFNPSVGLEVYLIPILAISGILSVLGWYVNHHLRKVDM 1117
>gi|149177070|ref|ZP_01855678.1| hypothetical protein PM8797T_12051 [Planctomyces maris DSM 8797] >gi|148844135|gb|EDL58490.1| hypothetical protein PM8797T_12051 [Planctomyces maris DSM 8797] (795 aa)
Score = 124, Expect = 3.7e-04, Identities = 77/311 (24%), Positives = 135/311 (43%)
  Q:   748 TNQWQKVLLMNSSEFRTWKQNLDGRYKVNINS--LEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDI-YFAIRFNYGEKVD--LSSLNSLMDSY-----TKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLL---YLLKSKKTSFFVLAKFRIALTLSKLTR 1058
           T+Q Q+ +++N +  R          ++ +N+   E +I+G+ IS E  + ++     +P P   GV Y+     E +      +NQ + + A  F   ++V   L  L   +D Y     T  A  SS        L + I   K+ A       TIL  + L++     +LL+    E+ +  +   KA G S+ +I +    FG    I  G++G L  + L G       NF+  P  + +     +  G+    +  + F+ LG ++  RS +   LS +E M+    L    +L  K  +F+    FR  L L  + R
  S:   130 TDQRQEEVIINDAFARAHNLRPGDHIQLILNNRLQELLIVGTAISSEFVY-LIGPGGLVPEPETYGVFYLKHDYAEDVFGFEGAANQILGHLAPEFQSPDRVRQILDQLELNLDDYGVFSTTPLAQQSSHW-----FLKSEIDGLKVSA-------TILPTIFLIVAALALNLLMSRMAEQQRTIVGTLKALGYSNQEIFLHFIQFGLLIGIAGGLLGILIGYSLAGAMTAQYRNFFEFPSLINQMYPRVILLGM----LISIFFAVLGTFRGVRSVVR--LSPAEAMRPKPPLRARRILLEKIHAFWNALDFRWQLVLRDIFR 434
>gi|188159342|ref|ZP_02998718.1| hypothetical protein Mmycm_02535 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1753 aa)
Score = 124, Expect = 3.8e-04, Identities = 86/319 (26%), Positives = 153/319 (47%)
  Q:   795 FPIVSIESPIPNPRIEGVTYV------DDMGYESLLYTNSFSNQDIYFAIR-------FNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPK----LIAIYINLFV-TILVAVLLVIGIYLSSLLVKI--YVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPI---SVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPI-------NELLSSSEEMKVNKLLYLLKSKKTSFFVLAKF--RIALTLSKLTRFILFVVLCSAGLS--IIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYK 1113
           FP    + PIP   +  + YV      D +G  S   TN  S   + F +R        N      ++ ++ L DS   +    +++T + N+     S  +    +  + IN +    L+A L+V  I + +L++ I   +  N   + I KA G S IQI+IS   +     + S  +G+++    Q +FV +  N++ IP+   ++  FS          L I+ L+F   GV  +  S I        ++L+  +    +K +  LK    ++F  AKF  + +LTL+   +  +F+++   G+S   I+ G AIP    T +    ++ +Y   YN       S L K
  S:   527 FPTTDPDFPIPQSELGAILYVTRSTINDILGATSQSNTNRVSKGYLSFFLRKRQSNASINLFNSYQMNDISKLYDSIKYQKDQKNKVTTWLNIKDFDHSIFRFNWTIAPLAINSYKGATLIAALVVSLIAIIALVICIRKTIYFNAKQIGILKALGSSPIQISISYLAYVIVIILTSVPLGWITGLSTQSVFVKLFVNYFSIPLYSFTIEPFS----------LLISLLIFGLFGVIVSLLSAIIITKKQLADILAVKQNWSSSKFINRLKR---TWFKKAKFTTKFSLTLASSGKKNIFLLVTVVGISTMFISAGLAIPSIAFTIKNTYYKSIKYANEYNYSKGVSNSPLTK 866
>gi|81096560|ref|ZP_00874900.1| Protein of unknown function DUF214 [Streptococcus suis 89/1591] >gi|80977382|gb|EAP40925.1| Protein of unknown function DUF214 [Streptococcus suis 89/1591] (1121 aa)
Score = 124, Expect = 3.9e-04, Identities = 40/151 (26%), Positives = 80/151 (52%)
  Q:  1642 AINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           A+ S    T++ D   TI  +L +I T+++ L I L ++I+  ++ + M++  R ++ +K LG+ +KE  + I    + + LI ++VG+     L  L   M+  + SI   P +    YL   +AI GI+ +   +V  +L+K ++  ++
  S:   968 AVRSLVQNTSLIDMLTTIAGSLQTIMTILVILSILLGLVILYNLTIINMSERIRELSTIKVLGFHNKEVTMYIYRETIVLSLIGMLVGLVGGIYLHKLLLAMI-GSDSIRFNPSVGLEVYLIPILAISGILAVLGWYVNHHLRKVDMLEAL 1117
>gi|83319322|ref|YP_424484.1| hypothetical protein MCAP_0511 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283208|gb|ABC01140.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1753 aa)
Score = 124, Expect = 4.0e-04, Identities = 107/466 (22%), Positives = 207/466 (44%)
  Q:   734 NEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQD-------IYFAIRFNYGEKVDL------SSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPK----LIAIYINLF-VTILVAVLLV--IGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKF--RIALTLSKLTRFILFVVLCSAGLS--IIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNT--MFDNNNPYRKLVTSTDQD--EKDLLALRDLQGNVIKYSNGQPKYFSNLLLPSYVHVDAFKKDPQL 1199
           N   LN NQ + LPT   +   L++    R  K  L    ++ ++     I+G      + FP    + PIP   +  + YV     + +L + S SN +        +F  + +    +D+      + ++ L DS   +    ++++ + N+     S  +    +  + IN + ++ L+A L V  I I    + ++  +  N   + I KA G S +QI+IS   +     + S  +G++     Q +FV +  +++ IP+         L   +    +  L+ S L  +   + P+ ++L+  +    +K +  LK    ++F  A+F  + +LTL+   +  +F+++   G+S   I+ G AIP    T +    ++ +Y   YN       S L K     + G  +    I     N   +F  N+P   + +S D +   K L  L +L  N IK +  +  +    L+ +  HV+   K   L
  S:   470 NLTILNKNQGARLPT---KSEALISEQFARAHKLKLG--QQIIVDGALLSIVGFATDAYSFFPTTDPDFPIPQSELGAILYVYKSTIKDILSSTSQSNTNRVSKGYLSFFLTKKHSTASIDMFNAYQMNDISKLYDSIKYQKEQKNKVSTWLNIKDFDHSIFRFNWIIAPLAINTYKISTLIAALAVSLIAIIALIICIRKTIYFNAKQIGILKALGSSPLQISISYLAYILVIILTSVPLGWIVGLSTQSVFVKLFVHYFSIPLYSFTVEPFSLLISLLIFGLFGLIISLLTAFLITKKPLFDILAVKQNWSSSKFINRLKR---TWFKKARFTTKFSLTLASSGKKNIFLLVTVVGISTMFISAGLAIPSIAFTIKNTYYKSIKYANEYNYAKGVTNSPLTKPTINYWNGQEELDKNISSTILNNQELFYYNDPTDYVSSSYDVNPFPKYLYKLEELNKNNIKETKSKLAWTLLELIQNKDHVNELNKTNSL 955
>gi|407656|gb|AAD12339.1| unknown [Mycoplasma genitalium] (107 aa)
Score = 124, Expect = 4.2e-04, Identities = 33/99 (33%), Positives = 59/99 (59%)
  Q:   862 AYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAF 960
           A+   +I+ F  L TAR  +P L+  Y+ +  T++   L+++ +YL  LL+K +++KN+   +I +A G S+ +  + +SVF    AI+S  +G L AF
  S:     9 AFNVKDISKFNYLTTARNYFPDLVQSYLAIVSTVIAIFLIILALYLIILLIKSFIKKNQTEFSIIRAGGFSTTKFIVGMSVFAGIVAIVSSFLGVLFAF 107
>gi|50365078|ref|YP_053503.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] >gi|50363634|gb|AAT75619.1| unknown substrate ABC transporter permease component [Mesoplasma florum L1] (1724 aa)
Score = 120, Expect = 1.3e-03, Identities = 128/632 (20%), Positives = 251/632 (39%)
  Q:   522 NENNSINDLQILSGSKITNGYDFLSSKYDYLNKEVYSDDEQKTNSTKYEDISNTLLSTTRIGGGSQQEIETGGYSINPNGDYLINLVKFINDSYVTGETENTNANNSSES--SKLLSDRIKELAKKIVDHYNGTTANVSGSINVNDYYHLFAMATPQNYYVYTNTDNPDNNSSYIFSNNNQNLEYSFSANAGMTPTTYSSRASLYAPYGNSIVVNEAWLNSNQKSVLPTNQWQKVLLMNSSEFRTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLL--VIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLY------LLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNL-----QTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDNN-----NPYRKLVTSTDQ 1153
           NE N + D  +++G      Y ++S   D  N +VY+  +      K   I        +I   S + I     S+N N          +ND + +G+    N +N S+     L S+R  E       +Y+   AN   + N+++ Y +F          Y+N +        +F N NQ ++Y               +A +   Y ++   N   LN N+   LP N  + ++    SE      N+     + I      ++G      + +PIV    P P  R   + Y  +     ++  +  ++++       NY      +S +   +++     LS     F N  + R+++    +I   L + ++   ++  VI +    + +K  V+ N   +AI KA G++S  IA S +  G     +   +G++    +Q +F+ +   ++ + IS    S + L  G+     A ++ S L  +   R  +  +L+   ++K    +          SK T  F L     A+  +  T F++F+        +I  G +IP   ET++     +  Y   +         P  +S +   ++   +  N +   + + +SN  +  +     +P  K V S +Q
  S:   312 NEQNKLYD-SVVTGDTKEKNYIYVSK--DTNNSDVYAKIKSNGLKGKATPIVAFYDDEDKITKASTEYINLNPLSLNSNS---------LNDDW-SGKFSAINNSNMSDQFFGNLFSERNIEWLTWSQSNYSLFEANSPWTNNISNNYRMFLKIAAS----YSNFNIEFRKEFNVFDNLNQ-IQY---------------KAVILDEYNHT---NLKILNDNEGGRLPLNHGEILV----SEQYAKAHNIKNNSTIKIGPQVLTVVGIATDTFSYYPIVDENVPFPQYRNSAIIYGTEQTLFPIVENSQSTSKEQISNTNINYFLWSKDNSASKNFETFASFTPLSKNTKTF-NESSYRMNWVLQPSIVSGLLIIMISISVIVGVISLLGVVIYIKKMVKANIKQIAILKAMGVNSFSIAKSYAAVGLIITFLVIPIGWMVGTSVQLIFIKMFIPYFSVQISQISISMVALLIGVFAFGFAVIILSILFAYIETREDVTLMLNKVGKVKQQAAIMNWINRVFANSKFTLRFSLIVSASAIRNTTTTAFVIFI-----SSFLIFFGLSIPALVETTKNGYYNHLNYNNQHRFVENVYNAPLSKSTISYTEDLKTIDANYKTTSLMEYYSNPTYSYDSSFDVSPLSKYVYSKNQ 917
>gi|42560992|ref|NP_975443.1| hypothetical protein MSC_0457 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492489|emb|CAE77085.1| Hypothetical transmembrane protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1754 aa)
Score = 119, Expect = 1.4e-03, Identities = 84/319 (26%), Positives = 153/319 (47%)
  Q:   795 FPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQD-------IYFAIRFNYGEKVDL------SSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPK----LIAIYINLFV-TILVAVLLVIGIYLSSLLVKI--YVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPI---SVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPI-------NELLSSSEEMKVNKLLYLLKSKKTSFFVLAKF--RIALTLSKLTRFILFVVLCSAGLS--IIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYK 1113
           FP    + PIP   +  + YV       +L   S SN +        +F  +      +DL      + ++ L DS   +    +++T + N+     S  +    +  + IN +  + L+A L+V  I + +L++ I   +  N   + I KA G S IQI+IS   +     + S  +G+++    Q +FV +  N++ IP+   ++  FS          L I+ L+F   GV  +  S I        ++L+  +    +K +  LK    ++F  AKF  + +LTL+   +  +F+++   G+S   I+ G AIP    T +    ++ +Y   YN       S L K
  S:   528 FPTTDPDFPIPQSELGAILYVTRSTINDILGATSQSNTNRVLKGYLSFFLRKKQNNASIDLFNSYQMNDISKLYDSIKYQKDQKNKVTTWLNIKDFDHSIFRFNWTIAPLAINSYKGSTLIAALVVSLIAIIALVICIRKTIYFNAKQIGILKALGSSPIQISISYLAYVIVIILTSVPIGWITGLSTQSVFVKLFVNYFSIPLYSFTIEPFS----------LLISLLIFGLFGVIVSLLSAIIITKKQLADILAVKQNWSSSKFINRLKR---TWFKKAKFTTKFSLTLASSGKKNIFLLVTVVGISTMFISAGLAIPSIAFTIKNTYYKSIKYANEYNYSKGVSNSPLTK 867
>gi|148988697|ref|ZP_01820130.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP6-BS73] >gi|147925898|gb|EDK76973.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP6-BS73] (812 aa)
Score = 119, Expect = 1.4e-03, Identities = 42/176 (23%), Positives = 87/176 (49%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+ I       F   + + A+I   P++ W  Y+   +A+  I+T+   FV  YL+K ++  ++
  S:   640 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGL-IAGFYLHQFLIQMISPATILFYPQVGWEVYVIPVVAVSIILTLLGFFVNYYLRKVDMLEAL 808
>gi|83319828|ref|YP_424016.1| hypothetical protein MCAP_0018 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283714|gb|ABC01646.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1797 aa)
Score = 119, Expect = 1.4e-03, Identities = 78/336 (23%), Positives = 147/336 (43%)
  Q:   778 NSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLL---------------------YTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLT----ARISYPKLIAIYINLFVTILVAVLLV-IGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKS---KKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYK 1113
           N+   I+ G  +   + FP      P+P     G+ Y D      +L                       NS + +++YF   F+  +K+  + +     +  +  Y + + +D +  L      R+++   +A ++   +  LV+ L V +G+  S       ++ N   + I KANG SS  I+ S   +      I+  +G+++  +LQ  FV I  +++    +V  + ++     I    +   +FSFL      + P+ +++ SS++    K+   L     KK  F  L    + LT S    F L +VL   G   ++ G AIP   + ++ N  +   Y   Y +      S L K
  S:   534 NAKGLIVTGYAVDTYSFFPTSDPNVPLPKSDSGGLIYADFTTINQILGDGNSATGNDQTSTFNFFLIKNNNSLNIKNVYFD-HFSVADKIRDNIIAKQKGTEIQTFYKNQQFSDSSYSLNWTLYQRVAFWYSLATFLTASLIALVSALAVFVGVIKS-------IQANSKQIGILKANGASSSTISWSYVSYAVILVFIAIPLGWMAGTMLQVPFVAIFKDYFSFKTNVLTYDWLAPLISIIIFGVLIGVFSFLVALFHIKKPVLDIIKSSKKWSKPKITDWLHKRIFKKPRFTTL--LMLKLTESGKKPFSLLLVLVFVGTLFVSAGIAIPSVTKYAKDNYFKKVNYNNQYEIYNSLSNSPLGK 888
>gi|149006719|ref|ZP_01830405.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP18-BS74] >gi|147761634|gb|EDK68598.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP18-BS74] (902 aa)
Score = 115, Expect = 3.8e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+ I       F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGL-IAGFYLHQFLIQMISPATILFYPQVGWEVYVIPVAAVSFILTLLGFFVNYYLRKVDMLEAL 898
>gi|148993778|ref|ZP_01823205.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|168488634|ref|ZP_02712833.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP195] >gi|147927734|gb|EDK78758.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|183572660|gb|EDT93188.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP195] (902 aa)
Score = 115, Expect = 4.3e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+ I       F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGL-IAGFYLHQFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|149021256|ref|ZP_01835502.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|147930357|gb|EDK81341.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] (902 aa)
Score = 115, Expect = 4.5e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+ I       F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGL-IAGFYLHQFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|148997702|ref|ZP_01825266.1| hypothetical protein CGSSp11BS70_02304 [Streptococcus pneumoniae SP11-BS70] >gi|168575160|ref|ZP_02721123.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae MLV-016] >gi|147756201|gb|EDK63243.1| hypothetical protein CGSSp11BS70_02304 [Streptococcus pneumoniae SP11-BS70] >gi|183578925|gb|EDT99453.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae MLV-016] (902 aa)
Score = 115, Expect = 4.5e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+ I       F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGL-IAGFYLHQFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|15901487|ref|NP_346091.1| hypothetical protein SP_1652 [Streptococcus pneumoniae TIGR4] >gi|14973142|gb|AAK75731.1| putative membrane protein [Streptococcus pneumoniae TIGR4] (924 aa)
Score = 115, Expect = 4.5e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+ I       F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   752 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGL-IAGFYLHQFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 920
>gi|111657855|ref|ZP_01408569.1| hypothetical protein SpneT_02000952 [Streptococcus pneumoniae TIGR4] (902 aa)
Score = 115, Expect = 4.5e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+ I       F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGL-IAGFYLHQFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|168493553|ref|ZP_02717696.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC3059-06] >gi|183576306|gb|EDT96834.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC3059-06] (902 aa)
Score = 114, Expect = 5.4e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|42560593|ref|NP_975044.1| permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492089|emb|CAE76686.1| Predicted permease [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1795 aa)
Score = 113, Expect = 6.8e-03, Identities = 80/336 (23%), Positives = 144/336 (42%)
  Q:   778 NSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLL---------------------YTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITD----FTNLLTARISYPKLIAIYINLFVTILVAVLLV-IGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKS---KKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYK 1113
           N+   I+ G  +   + FP      P+P     G+ Y D      +L                       NS + +++YF   F+   K+  + L     +  +  Y   E ++        L  +IS+   +A ++   +  LV+ L V +G+  S       ++ N   + I KANG SS  I+ S   +      I+  +G+++  +LQ  FV I  +++    +V  + ++     I    +   +FSFL      + P+ +++ SS++    K+   L     KK  F  L    + LT S    F L +VL   G   ++ G AIP   + ++ N  +   Y   Y +      S L K
  S:   532 NAKGLIVTGYAVDTYSFFPTSDPNVPLPKSDSGGLIYADFATINQILGDGNSATANDQTSTFNFFLIKKNNSLNIKNVYFD-HFSVANKIRDNILAKQKGTEIQTFYQEREFSNSWYSLNWTLYQKISFWYSLATFLMASLITLVSALAVFVGVIKS-------IQANSKQIGILKANGASSATISWSYVSYAVILVFIAIPLGWMAGTMLQVPFVAIFKDYFSFKTNVLIYDWLAPLISIIIFGVLIGVFSFLVALFHIKKPVLDIIKSSKKWSKPKITDWLHKHIFKKPRFATL--LMLKLTESGKKPFSLLLVLVFIGTLFVSAGVAIPSVTKYAKDNYFKKVNYDNQYEIYNSLSNSPLGK 886
>gi|188586693|ref|YP_001918238.1| protein of unknown function DUF214 [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351380|gb|ACB85650.1| protein of unknown function DUF214 [Natranaerobius thermophilus JW/NM-WN-LF] (797 aa)
Score = 113, Expect = 7.8e-03, Identities = 48/226 (21%), Positives = 94/226 (41%)
  Q:   781 EFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAI--RFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLG 1006
           E  I G G+S E ++P+ +     PNP   G+ ++      +L         ++ F I  +F + E  +L  L   +D Y  +   S E      +L+  ++  + ++  + L    +  ++L I       ++K  +E+ +  + I KA G +  +I I    +      + G+ G +    L      +L  F+ +P     FS   L  G+A     F++  +LG
  S:   161 ELTIQGKGMSPEFTYPLRTETELFPNPEQFGIAFLPYEDMSTLFPDQENRVNNLVFTINPKFKFSEVENL--LEPELDQYGLQTIYSRENQTSHLILSEEVAMLERVSRALPLTFLSIAGIILFI-------MLKRLIEQQRGQIGILKAFGYTDREIVIHYLSYSILIGAVGGLAGSIIGMFLATPLTELLLEFFNVPRFYEGFSMYYLILGLALSLSVFVVAGYLG 379
>gi|158321638|ref|YP_001514145.1| hypothetical protein Clos_2618 [Alkaliphilus oremlandii OhILAs] >gi|158141837|gb|ABW20149.1| protein of unknown function DUF214 [Alkaliphilus oremlandii OhILAs] (785 aa)
Score = 112, Expect = 8.4e-03, Identities = 77/333 (23%), Positives = 150/333 (45%)
  Q:   784 IIGSGISFENSFPIVSIESPIPNPRIEGVTYV-DDMGYESLLYTNSFSNQDIYFAIRFNYGEKVD--LSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLG---VWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAK--FRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYG------YSYNLQTPSEQSGLYKVQE 1116
           +IG   S E  + + + ++ +P P   GV YV D+    SL +  S++  ++   I  NY  K+   + ++   +D Y  K  +  E     +++   +   + +A  I          L+V G+ ++ +L +I V+ +++ + I KA G S+  I    + +     +   V+G + +  L  LF  +   +  IP+   +  YI    GI    I  +L   +G   V K F  P + +    E  KV K  +L K K    F+ +K  F   + +  + R     V    G+++    T +P  F +S  ++L   +YG      Y+ +   P +++ L ++ +
  S:   165 VIGVVGSPEYIYLMENEQALLPAPEKFGVIYVTDEFAQSSLGFQGSYN--EVVIKIDENYRNKIHSIVDAIEDELDRYGVKRIVKREDQLSHSMMMQEVESLETMASSITFLF------LMVAGVIINIMLSRI-VKNDRIYIGIMKALGYSNSDILSHYTKYSILIGLAGSVIGMILSIPLSVLFTNLYMVYMNIPMFKTKIYYIYFVYGIGLTSIFCILSGLIGARSVLKIF--PADAM--KPEAPKVGKRFWLEKVK----FIWSKISFSWKMVIRNIARNKRRAVFLVLGIALTYSITMVP-VFMSSVFDSLFTMQYGELQTMDYNIDFAVPMDRNALLELSK 493
>gi|194397244|ref|YP_002038267.1| ABC transporter, permease protein [Streptococcus pneumoniae G54] >gi|194356911|gb|ACF55359.1| ABC transporter, permease protein [Streptococcus pneumoniae G54] (902 aa)
Score = 111, Expect = 1.1e-02, Identities = 42/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P + W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPXVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|168483478|ref|ZP_02708430.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1873-00] >gi|172043087|gb|EDT51133.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1873-00] (902 aa)
Score = 111, Expect = 1.2e-02, Identities = 42/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++  K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|168486980|ref|ZP_02711488.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1087-00] >gi|183570117|gb|EDT90645.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC1087-00] (902 aa)
Score = 111, Expect = 1.2e-02, Identities = 42/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++  K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSVASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|115252760|emb|CAK98196.1| hypothetical abc transporter permease component transmembrane protein [Spiroplasma citri] (1415 aa)
Score = 111, Expect = 1.3e-02, Identities = 95/394 (24%), Positives = 175/394 (44%)
  Q:   747 PTNQWQKVLLMNSSEF-RTWKQNLDGRYKVNINSLEFIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYES---LLYTNSFSNQDIYF---------AIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGV---VGYLSAFLLQGLFVGILSNFWYIPISVRE--------FSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFR---IALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDEAGGIYDIFSNTMFDN 1140
           PTN    V ++ + +F R+ K  +  +  +  NS  F +   G    N +P +      P+P+ +G+ YV +  Y S      T+   N  +Y             F   +K   +   SL +   K A L S   D T L+  R S      I+      +L  + L+I I+   +L+K  + + K+   I KANG S + IA   S + A A +++G+   +G++    LQ   + + ++++ IP++           F  IGL S ++ L  A        + +   SP+ +LL+ ++ +K +KL+Y + +         KFR   +A+++ K+  F L   + S  L++    T IP        +   N  Y   Y            + + Y + G +      Y +  N++  +
  S:   389 PTNPINDVYVVITPQFARSQKLKVGDQLTIGENS-NFFVGAIGGDPANIYPTIYDTDVFPDPKTDGIIYVSEKVYRSESIAANTDIEENSTLYINHVGLSENKGTDFENFKKYLAADFWSLNNPSYKNAPLQSR--DETKLVYLRYSLLGTTIIFYRTITIVLCIIFLIILIFTLIILIKKIINQQKIENGILKANGYSGLTIA---SSYLAHAIVVTGIGVPLGWIIGVFLQLPIMSVFNSYFVIPVNFSFSLIPFAICFGIIGLVSSLSILVTA--------IRQLIISPL-DLLNPNKNIKTSKLVYSISNVFRFKKFTTKFRFVMMAVSMKKIGWFFLTFFVASLSLTL---ATLIPTAINKFSKDYYANLNYDNEYEYTNVIGNIPFSRYEMYDWNGPSFSTEAAYPLTKNSLVSD 791
>gi|50364971|ref|YP_053396.1| unknown substrate ABC transporter permease [Mesoplasma florum L1] >gi|50363527|gb|AAT75512.1| unknown substrate ABC transporter permease [Mesoplasma florum L1] (1429 aa)
Score = 110, Expect = 1.5e-02, Identities = 78/357 (21%), Positives = 152/357 (42%)
  Q:   769 LDGRYKVNINSLE-FIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGY------ESLLYTNSF---------SNQDI--YFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSE------ITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRF--ILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTNDE 1125
           +DG+Y +  ++ + F ++G G S +   PI +  + +P+   E + YV+   +      ES LY  +          SN +I  +++I+F   +K   + L        +    +S         D +   + RI   +      N+   ++  ++L + +Y  SL+ K  +EK    L   KA G     +  +  +    A+ I G++GY+ +  +        ++++ +  S  +F +I L   I  ++      SF+      R     L++++   K +     L+S        +K R AL +    +   I FVVL S+ L    V  A P   + ++  T    +Y        PS  + L   + +      DE
  S:   225 IDGKYNIYYSNYQWFQVVGFGSSADFMSPIFNASTTLPSRNKEVMIYVNPTAFGLKYNQESNLYEYNLNQNGNLTVSSNVEIESFYSIKFKDAKKAKSTGLEQFESDLKELIRRNSNNKIVYGKEDSSYRFSKRILLIQKTIRTYNIAAFVIFILILFVCLYTISLVTKKQIEKASKQLGTLKALGYRKRILVYNFVMLPVIASTIGGLLGYIVSISVSNTLTNEFASYFSLNYSKFDFDWITLVLMIGVMWFILSAISFVIATMLMRKSSLSLITATFNQKASAFKAKLRSIHFRKSFGSKLRKALLVDAFGKMMAIGFVVLLSSML--FTVSFAAPDILKRNEKATYTGVKYKQIVEYAQPSYNNPLTFAKTFNPSTKQDE 605
>gi|182684595|ref|YP_001836342.1| hypothetical protein SPCG_1625 [Streptococcus pneumoniae CGSP14] >gi|182629929|gb|ACB90877.1| hypothetical protein SPCG_1625 [Streptococcus pneumoniae CGSP14] (924 aa)
Score = 110, Expect = 1.6e-02, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+     +  I+T+   FV  YL+K ++  ++
  S:   752 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVATVSIILTLLGFFVNYYLRKVDMLEAL 920
>gi|149011487|ref|ZP_01832734.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|147764477|gb|EDK71408.1| isoleucyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] (902 aa)
Score = 110, Expect = 1.6e-02, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L N     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++ +K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+     +  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMNQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTIKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVATVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|188159694|ref|ZP_02998818.1| Predicted permease [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1795 aa)
Score = 108, Expect = 2.6e-02, Identities = 59/239 (24%), Positives = 106/239 (44%)
  Q:   875 LTARISYPKLIAIYINLFVTILVAVLLV-IGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLLYLLKS---KKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYK 1113
           L  +I++   +A ++   +  LV+ L V +G+  S       ++ N   + I KANG SS  I+ S   +      I+  +G+++  +LQ  FV I  +++    +V  + ++     I    +   +FSFL      + P+ +++ SS++    K+   L     KK  F  L    + LT S    F L +VL   G   ++ G AIP   + ++ N  +   Y   Y +      S L K
  S:   653 LYQKIAFWYSLATFLTASLIALVSALAVFVGVIKS-------IQANSKQIGILKANGASSATISWSYVSYAVILVFIAIPLGWMAGTMLQVPFVAIFKDYFSFKTNVLIYDWLAPLISIIIFGVLIGVFSFLVALFHIKKPVLDIIKSSKKWSKPKITDWLHKRIFKKPRFATL--LMLKLTESGKKPFSLLLVLVFVGTLFVSAGVAIPSVTKYAKDNYFKKVNYDNQYEIYNSLSNSPLGK 886
>gi|89896414|ref|YP_519901.1| hypothetical protein DSY3668 [Desulfitobacterium hafniense Y51] >gi|89335862|dbj|BAE85457.1| hypothetical protein [Desulfitobacterium hafniense Y51] (749 aa)
Score = 107, Expect = 3.6e-02, Identities = 67/309 (21%), Positives = 129/309 (41%)
  Q:   795 FPIVSIESPIPNPRIEGVTYVD-----DMGYESLLY-------TNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGV-WKTFRSPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENR-RYGYSYNLQ 1103
           +P+ ++   + +P   GV  +D     D+G  SL Y       T S + Q + F  R  + E V  S    +M++   +   +S     T L T  I  P            + +   L+IGI +  +     + +  V +    A G    ++           A+  G  G L A L     +  + +++ +P++  E S+  +  GI    +   L S+L +  +  RSP   +    ++ KVN L   LK ++ +F    KF++   L  ++R +   +   +  +++ +G  I    +    N+ E   R+ Y Y  +
  S:   160 YPLKNVYDIMVSPSNFGVGVIDPAEFADIGNGSLFYSVRFQDRTQSLNQQAVQFRERL-HAEGVTESEWVDIMNNKRARMAWAS----ITGLKTMSIPVP----------AAMFLLCCLIIGIMIWRM-----IRREGVIIGTLYAQGYRRRELMGHYMTIPLLLAVAGGAAGSLLALLSVAPAITGMVSYYNVPVTAIELSFWHVLIGILTPVLFLGLSSYLVIRLELQRSPAELMKGREQKTKVNALERALKLERFAFG--TKFKLREQLRSISRLLFLFLGVVSASALMLLGFTIMNSMDYMFKNSTEGAFRFEYEYAFK 460
>gi|169834468|ref|YP_001695037.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae Hungary19A-6] >gi|168996970|gb|ACA37582.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae Hungary19A-6] (902 aa)
Score = 107, Expect = 3.8e-02, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L +     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++  K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSVASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|149001931|ref|ZP_01826885.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP14-BS69] >gi|147759740|gb|EDK66730.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae SP14-BS69] (902 aa)
Score = 106, Expect = 4.4e-02, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L +     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++  K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|15903539|ref|NP_359089.1| hypothetical protein spr1496 [Streptococcus pneumoniae R6] >gi|15459156|gb|AAL00300.1| Hypothetical protein [Streptococcus pneumoniae R6] (924 aa)
Score = 106, Expect = 4.5e-02, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L +     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++  K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   752 RDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSVASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 920
>gi|116516046|ref|YP_816921.1| hypothetical protein SPD_1465 [Streptococcus pneumoniae D39] >gi|116076622|gb|ABJ54342.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae D39] (902 aa)
Score = 106, Expect = 4.6e-02, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L +     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++  K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSVASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|168491466|ref|ZP_02715609.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC0288-04] >gi|183574226|gb|EDT94754.1| efflux ABC transporter, permease protein [Streptococcus pneumoniae CDC0288-04] (902 aa)
Score = 106, Expect = 4.7e-02, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:  1617 RLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           R +S+ SI S    L +     S+V   S      +FD+  +  N  ++I  ++  L   L I+I+  ++++ + +  R ++  K LG+ + E  L I    + + L+ +++G+     L   F   + + A+I   P++ W  Y+    A+  I+T+   FV  YL+K ++  ++
  S:   730 RDTSATSIESQAGLLMSQSAVSSVVQNASA---IRLFDSIASSLNQTMTILVIVSVL---LAIVILYNLTNINVAERIRELSTTKVLGFHNNEVTLYIYRETIVLSLVGIVLGLVAGFYLH-QFLIQMISPATILFYPQVGWEVYVIPVAAVSIILTLLGFFVNYYLRKVDMLEAL 898
>gi|83319606|ref|YP_424256.1| ABC transporter, permease protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283492|gb|ABC01424.1| ABC transporter, permease protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1768 aa)
Score = 105, Expect = 5.9e-02, Identities = 78/321 (24%), Positives = 138/321 (42%)
  Q:   782 FIIIGSGISFENSFPIVSIESPIPNPRIEGVTYVDDMGYESLL--YTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTK--------KAYLSSEITD-FTNLLTARISYPKL-------IAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFRSPINELLSSSEEMKVNKLL-----YLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNL 1102
            I+ G  +   + FP      P+P     G+ Y  D     ++   T+  +N        F   +  D +  N  +D ++K        KAY S    D F   L+   S+  L       I  + +L   +  +++ +I      + V   ++ N   + I KANG+ S  IA S   +      I   +G++   +LQ  FVGI  +++ + + V EF +I +   +    I   LFSF+        P+ E+++ +++    K+      YL K  K +  ++ K    LT S    F L ++L        +VG AIP     ++    +N  Y   Y +
  S:   514 LIVSGYAVDTYSFFPTSDPNVPLPKSDSGGLVYASDKTINQIIGDQTDPSNNDQTTIYNFFLIKKNNDANLKNVYLDHFSKANKIRENIKAYNSQNKADTFYKTLSFDKSWYSLNWTLYQKITFWYSLATFLTSSLIALISALAVFVGVIKSIQANAKQIGILKANGVYSKTIASSYIWYALILVFIPIPIGWMLGTILQVPFVGIFKDYFSLKVEVIEFDWISIIISVIIFGILIGLFSFIVAVININKPVLEVINHTKKWSKPKITDWLSKYLFKRLKFNTLLMLK----LTESGKKPFSLLLILLFIATLFTSVGIAIPSIAIHTKDTYFKNINYNNEYQI 853
>gi|406330|gb|AAD12416.1| unknown [Mycoplasma genitalium] (103 aa)
Score = 105, Expect = 6.0e-02, Identities = 33/112 (29%), Positives = 55/112 (49%)
  Q:  1281 VLDLTNVSDTNSIRFNNEFLKYIGMIYGNTELSSIDAKISFGIVPFRSMETNSLTESYTYLDATLNDPTVRIPSVRNNGKNLLIDINKEIFGIKKDSQFVTLIGDKKNDLNS 1392
           VL   +V +   ++FN+ FL ++  +YG+ EL+  D+K++FGIVP       ++ E+YTY++                  NL  +    + GI  +S FV LI    N L +
  S:     1 VLTTIDVFNPGGVKFNDSFLSFMLKVYGDFELAKQDSKLNFGIVPVDP----AIEETYTYVEGPFG----------FQEDNLDENSPYTLTGINPESSFVNLIDGSGNSLRN 98
>gi|15894812|ref|NP_348161.1| permease [Clostridium acetobutylicum ATCC 824] >gi|15024483|gb|AAK79501.1|AE007663_6 Predicted permease [Clostridium acetobutylicum ATCC 824] (746 aa)
Score = 103, Expect = 9.8e-02, Identities = 79/340 (23%), Positives = 144/340 (42%)
  Q:   771 GRYKVNINSLEFIIIGSGISFENSFPIVSIESPI-PNPRIEGVTYVDDMGYESLLYTNSFSNQDIYFAIRFNYGEKVDLSSLNSLMDSYTKKAYLSSEITDFTNL-LTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTFR-SPINELLSSSEEMKVNKLLYLLKSKKTSFFVLAKFRIALTLSKLTR--FILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSY---NLQTPSEQSG 1110
           G  K+N++ L        +S  N    +  ES I  NP+  G+  +    ++SL   +SF N      I+FN  E +D  S  S + SY K   ++  +  +TN+    R++Y            + +   +L++   ++ +++   ++K  V +    A G    +I      +    A+I G+VG +   L     V  + +++ +P +   F    +   I    I   + S+  + K  + SP++ +    E  KVN     LK     F   +KF+I   L  + R   +LF ++ S  L ++   T     F   ++ T    +Y Y Y   +LQT S   G
  S:   142 GNKKLNVSGL--------MSLPNYIYAIKSESDIMNNPKSFGIAVITKNNFDSLNLGSSFYN------IKFNNSENID--SKISKLKSYLKSQNIN--VLSWTNIDENPRVTYVTAKIKSTKSISSSMPIAILLLTCSMTGIIMLRMLQKEAVIIGTLYALGYRKREIRKHYLTYSLSIAVIGGIVGTILGGLALKPMVTFMVSYFNVPTNYLSFDIKYVVISILLPIIFLFISSYFIINKQLKHSPVDLMHGGIENSKVNFFERHLKLDNFKFN--SKFKIRQQLRSIPRSLLLLFGIIASTMLLLLGFATKNSMDFLMQESIT-STYKYKYQYIFNSLQTTSPSRG 468
>gi|94994512|ref|YP_602610.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10750] >gi|94548020|gb|ABF38066.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10750] (878 aa)
Score = 102, Expect = 1.3e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNCHLKKVDMLEAL 874
>gi|94990589|ref|YP_598689.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10270] >gi|94544097|gb|ABF34145.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10270] (878 aa)
Score = 102, Expect = 1.5e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDMLEAL 874
>gi|71903603|ref|YP_280406.1| ABC transporter permease protein [Streptococcus pyogenes MGAS6180] >gi|71802698|gb|AAX72051.1| ABC transporter permease protein [Streptococcus pyogenes MGAS6180] (878 aa)
Score = 102, Expect = 1.5e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDMLEAL 874
>gi|56808389|ref|ZP_00366142.1| COG0577: ABC-type antimicrobial peptide transport system, permease component [Streptococcus pyogenes M49 591] (851 aa)
Score = 102, Expect = 1.5e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   715 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDMLEAL 847
>gi|94988699|ref|YP_596800.1| ABC transporter permease protein [Streptococcus pyogenes MGAS9429] >gi|94992522|ref|YP_600621.1| ABC transporter permease protein [Streptococcus pyogenes MGAS2096] >gi|94542207|gb|ABF32256.1| ABC transporter permease protein [Streptococcus pyogenes MGAS9429] >gi|94546030|gb|ABF36077.1| ABC transporter permease protein [Streptococcus pyogenes MGAS2096] (878 aa)
Score = 102, Expect = 1.6e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDMLEAL 874
>gi|50914301|ref|YP_060273.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10394] >gi|50903375|gb|AAT87090.1| ABC transporter permease protein [Streptococcus pyogenes MGAS10394] (878 aa)
Score = 102, Expect = 1.6e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDMLEAL 874
>gi|15675215|ref|NP_269389.1| hypothetical protein SPy_1255 [Streptococcus pyogenes M1 GAS] >gi|13622383|gb|AAK34110.1| hypothetical protein SPy_1255 [Streptococcus pyogenes M1 GAS] (878 aa)
Score = 102, Expect = 1.6e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDMLEAL 874
>gi|71910778|ref|YP_282328.1| ABC transporter permease protein [Streptococcus pyogenes MGAS5005] >gi|71853560|gb|AAZ51583.1| ABC transporter permease protein [Streptococcus pyogenes MGAS5005] (391 aa)
Score = 101, Expect = 1.6e-01, Identities = 31/134 (23%), Positives = 71/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+V  +LKK ++  ++
  S:   255 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWVNRHLKKVDMLEAL 387
>gi|110004894|emb|CAK99226.1| hypothetical abc transporter permease component transmembrane protein [Spiroplasma citri] (1454 aa)
Score = 101, Expect = 2.0e-01, Identities = 57/252 (22%), Positives = 115/252 (45%)
  Q:   873 NLLTARISYPKLIAIYINLFVTILVAVLLVIGIYLSSLLVKIYVEKNKVSLAIAKANGISSIQIAISLSVFGAFAAIISGVVGYLSAFLLQGLFVGILSNFWYIPISVREFSYIGLFSGIACLYIAFLLFSFLGVWKTF-RSPINELLSSSEEMKV-NKLLYLLKSKKTSFFVLAKFRIALTLSKLTRFILFVVLCSAGLSIIAVGTAIPRKFETSQTNTLENRRYGYSYNLQTPSEQSGLYKVQEYAYLGTND 1124
           NLL   I+    + IYI LF  I+ A+ L     +S +++K  +++    + + KA G    +IA+S       + +I+   G+L+   +Q LFV  L N ++I      ++++ LFS I    I     +F+  + +  ++ +  L+    ++KV N L + ++S     FV  +FR+ +  + L +   ++ + +     + V    P   +   TN  +N +YG           +     + YA+ G ++
  S:   559 NLLAKTIN----VYIYIGLFFIIIFAITL---FAVSYIIIKEMIKRESPQIGMLKAAGYYLREIALSYWSILMVSILIAVPTGWLAGITVQ-LFVVKLFNMFFIINWSFTWNWMILFSLIGFFVIFLSFITFITCYFSINKTEVLSLIHPMRKLKVDNSLAHTVRSFHFKTFV-GRFRMVVLSTSLKQAFTYLGIFALVTFTLTVSLLAPVYAKNFNTNYYKNIKYGSEVKYSNVISNNPFSYYKTYAWNGIDN 803
>gi|77360333|ref|YP_339908.1| lipoprotein releasing system transmembrane protein [Pseudoalteromonas haloplanktis TAC125] >gi|76875244|emb|CAI86465.1| putative lipoprotein releasing system transmembrane protein [Pseudoalteromonas haloplanktis TAC125] (414 aa)
Score = 100, Expect = 2.2e-01, Identities = 35/135 (25%), Positives = 69/135 (51%)
  Q:  1643 INSFEYFTTVFDTYVTIFNTLISIETLI-ICLFIPLIIIIVMIISSVMMNDFRRL--VAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFI 1777
           I+ + Y ++ F T  +++  +  + T++ I +F+ + +    I+SS++M    +   +AILKT+G  D     +IL  FV   L    VG+ + + + V+         +I ++    WL+ LFG   + G+  I F+
  S:   247 IDDYVYISSWFRTQGSLYQDIQMVRTIVYIVVFLIIAVASFNIVSSLVMEVREKQGNIAILKTMGAKDS----TILATFVMQGLTQAFVGVVLGSLIGVVL--------AINISELFTWLSQLFGANPLQGVYFIEFL 372
>gi|119471727|ref|ZP_01614087.1| hypothetical protein ATW7_08751 [Alteromonadales bacterium TW-7] >gi|119445350|gb|EAW26638.1| hypothetical protein ATW7_08751 [Alteromonadales bacterium TW-7] (275 aa)
Score = 100, Expect = 2.2e-01, Identities = 53/163 (32%), Positives = 78/163 (47%)
  Q:  1606 ISSNSRNDIITRLSSSMSISSLQTWLQNNFGTPSIVAINSFEYFT-------TVFDTYVTIFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKE----------NLLSILVI-FVP-VVLISLIVGIAIVATLSVLFNFMVFNAASIYLA------PEIDWLAYLFGFIAI 1768
           ISS +   I   +S S+ +S L  W +  F    ++A+ SF  F+       TV D        L    T    LF   I  + ++   V +     LVA L  LGY D            ++ SIL++ F P V LI+LI   A  + LS++   + F A  I +       P +  L YLF  + I
  S:    55 ISSPNFEQIARDISGSIGLSKLLDWPEAEFAMYWLIALYSFPVFSLFICSDQTVGDRERGTLRFLSLRSTRFEILFGRFIGQLAVLTCLVAIT----LVATLAVLGYRDPSLLVGGVGRALSIFSILIVTFAPFVALITLINTFARSSRLSIVLAILYFTAGGIVVGLLQWQIPALSVLDYLFPGVQI 238
>gi|163789419|ref|ZP_02183858.1| ABC transporter, permease protein [Carnobacterium sp. AT7] >gi|159875273|gb|EDP69338.1| ABC transporter, permease protein [Carnobacterium sp. AT7] (1103 aa)
Score = 98, Expect = 4.0e-01, Identities = 38/151 (25%), Positives = 82/151 (54%)
  Q:  1638 PSIVAINSFEYFTTVFDTYVTIFNTLISIETLIICLFIPLIIIIVMI-ISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYL---APEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNL 1788
           PS++ +N     +  F+  +      + I TL++ +   L+  +V+  ++++ +++  R ++ +K LG+ DKE  + I    + + L+ ++VG    + L VL +  V + A I L   +P I  L+YL+   AI+ +V    + +A++ K +N+
  S:   949 PSVLLVNFSSDVSKAFEETMGS----LGIVTLVLIVSAGLLAFVVLYNLTNINVSERERELSTIKVLGFFDKEVTMYIYRENIILTLMGIVVG----SLLGVLLHSFVLDTAEIDLLMFSPTIQPLSYLYS--AIITLVFSGIVMIAMHFKLKNV 1093
>gi|89209995|ref|ZP_01188388.1| Binding-protein-dependent transport systems inner membrane component [Halothermothrix orenii H 168] >gi|89160335|gb|EAR79990.1| Binding-protein-dependent transport systems inner membrane component [Halothermothrix orenii H 168] (278 aa)
Score = 98, Expect = 4.2e-01, Identities = 35/118 (29%), Positives = 65/118 (55%)
  Q:  1635 FGTPSIVAINSFEYFTTVFDTYVTIFNTL--ISIETLII--------CLFIPLIIIIVMIISSVMMNDFRR----LVAILKTLGYSDKENLLS-ILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYL 1752
            GT   + +  FEY   + + Y+ I N++  +++  +II         + +  ++I V++   +M+N FR     LV +L TLG S K+ L   IL   +P +  +L V + +    +++  F+V  A   YL
  S:   104 LGTLIAIILWWFEYLYDLLEPYIVILNSIPKVALGPVIIVWMGNGPQAIIVMALLISVIVTIMMMINGFREVEGNLVKLLSTLGASKKQVLFKVILPASIPTIFSALKVSVGLSMVGTIVGEFLVSKAGLGYL 236
>gi|21910427|ref|NP_664695.1| hypothetical protein SpyM3_0891 [Streptococcus pyogenes MGAS315] >gi|28896003|ref|NP_802353.1| hypothetical protein SPs1091 [Streptococcus pyogenes SSI-1] >gi|21904625|gb|AAM79498.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811253|dbj|BAC64186.1| hypothetical protein [Streptococcus pyogenes SSI-1] (878 aa)
Score = 95, Expect = 9.5e-01, Identities = 30/134 (22%), Positives = 70/134 (52%)
  Q:  1659 IFNTLISIETLIICLFIPLIIIIVMIISSVMMNDFRRLVAILKTLGYSDKENLLSILVIFVPVVLISLIVGIAIVATLSVLFNFMVFNAASIYLAPEIDWLAYLFGFIAIVGIVTINFIFVALYLKKQNLRNSI 1792
           +  +L  + TL++ L I L I+I+  ++++ + +  R ++ +K LG+ D+E  L I    + + L+ +++GI +   L      M+ +   I    ++D   YL   + I+ ++ +  I+   +LKK ++  ++
  S:   742 VVTSLNQVMTLLVFLSILLAIVILYNLTTINIAERIRELSTIKVLGFYDQEVTLYIYRETISLSLVGILLGIYLGKGLHTYIMTMI-STGDIQFGVKVDAYVYLVPILVILSLLAVLGIWGNRHLKKVDMLEAL 874