>gi|26553461|ref|NP_757395.1| hypothetical protein MYPE90 [Mycoplasma penetrans HF-2] >gi|26453467|dbj|BAC43799.1| hypothetical protein [Mycoplasma penetrans HF-2] (275 aa)
Score = 767, Expect = 1.0e-79, Identities = 275/275 (100%), Positives = 275/275 (100%)
  Q:     1 MASKKRKFTFTDLADDDFVDQQENQNTTKPSENINFTLNDLKNDQKPEPIVQQNNHSVEKKETNQEPTIVNTAIANNEPTKSESLSEEIIYEKYNLENDNQQPSSVENNNKIEVQNTETDNKNNQVTEKKVYEVNYDDILNDSVPQKNKEVIDSLIEKKDPIKELFNTKEEKENPQNSEDSEQETKVYKNLKPRSTVKTYNEALKKQEQRQVDVHFEENKIKQFLNVREKLEVKTNIYLKNSIVIKLSELEARTNESRSSIINKLIEIALKTIEE 275
           MASKKRKFTFTDLADDDFVDQQENQNTTKPSENINFTLNDLKNDQKPEPIVQQNNHSVEKKETNQEPTIVNTAIANNEPTKSESLSEEIIYEKYNLENDNQQPSSVENNNKIEVQNTETDNKNNQVTEKKVYEVNYDDILNDSVPQKNKEVIDSLIEKKDPIKELFNTKEEKENPQNSEDSEQETKVYKNLKPRSTVKTYNEALKKQEQRQVDVHFEENKIKQFLNVREKLEVKTNIYLKNSIVIKLSELEARTNESRSSIINKLIEIALKTIEE
  S:     1 MASKKRKFTFTDLADDDFVDQQENQNTTKPSENINFTLNDLKNDQKPEPIVQQNNHSVEKKETNQEPTIVNTAIANNEPTKSESLSEEIIYEKYNLENDNQQPSSVENNNKIEVQNTETDNKNNQVTEKKVYEVNYDDILNDSVPQKNKEVIDSLIEKKDPIKELFNTKEEKENPQNSEDSEQETKVYKNLKPRSTVKTYNEALKKQEQRQVDVHFEENKIKQFLNVREKLEVKTNIYLKNSIVIKLSELEARTNESRSSIINKLIEIALKTIEE 275
>gi|194770241|ref|XP_001967204.1| GF19006 [Drosophila ananassae] >gi|190618542|gb|EDV34066.1| GF19006 [Drosophila ananassae] (8905 aa)
Score = 87, Expect = 7.2e-01, Identities = 39/163 (23%), Positives = 77/163 (47%)
  Q:   102 QPSSVENNNKIEVQNTETD--NKNNQVTEKKVYEVNYDDILNDSVPQKNKEVIDSLIEKKDPIKELFNTKEEKENPQNSEDSEQETKVYKNLKPRSTVKTYNEALKKQEQRQVDVHFEENKIKQFLNVREKLEVKTNIYLKNSIVIKLSELEARTNESRSSIINK 264
           QP  +  N + EV N +TD   ++N+V+  K+   +    +   +P+ N +  D    KK  +    +T+ E   PQ +E+     K+ K  + ++++ +  E    + +RQ  ++ +E    +   + E          K+S+V++    E++T   RSSII K
  S:   902 QPKIITKNTEKEVTNVKTDEGKESNEVSSAKIIPQSISKKVKSEIPEVNNQQSDLNKNKKTELSSSTDTENEWNEPQAAEE-----KILKKAERKASIISVKEDDSLEVRRQSIINCKEETSIEDSKIEE--------VRKSSLVVQ----ESKTGSRRSSIIEK 1049
>gi|154422909|ref|XP_001584466.1| Beige/BEACH domain containing protein [Trichomonas vaginalis G3] >gi|121918713|gb|EAY23480.1| Beige/BEACH domain containing protein [Trichomonas vaginalis G3] (2862 aa)
Score = 87, Expect = 8.0e-01, Identities = 43/196 (21%), Positives = 82/196 (41%)
  Q:    19 VDQQENQNTTKPSENINFTLNDLKNDQKPEPIVQQNNHSVEKKETNQEPTIVNTAIANNEPTKSESLSEEIIYEKYNLENDNQQPSSVENNNKIEVQNTETDNKNNQVTEKKVYEVNYDDILNDSVPQKNKEVIDSLIEKKDPIKELFNTKEEKENPQNSEDSEQETKVYKNLKPRSTVKTYNEALKKQEQRQVDV 214
           + + ++    K SEN +     L  +Q  + +    N S++  + ++  ++ N  ++ N+  ++  LSE +      + ND  Q SS E +   E +N    N  N    K + E     + N+     N+++ ++L E         N K  +   +N E+S  E K+  N+K    +    E +K  E    DV
  S:   840 LSENQSLQNVKLSENQSLQNVKLSENQSLQNVKLSENQSLQNVKLSENQSLQNVKLSENQSLQNVKLSENL----QKIPNDGNQKSSNEKDLTTE-ENLTNLNLQNSDVNKNLSENQNSSLSNEEKEHPNEKMNEALDETSSDKILSENVKNNENLTENKENSNSEEKLSNNVKNHGNL---TENVKNDENLSNDV 1027