>gi|26553543|ref|NP_757477.1| hypothetical protein MYPE900 [Mycoplasma penetrans HF-2] >gi|26453549|dbj|BAC43881.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (574 aa)
Score = 2315, Expect = 0.0e+00, Identities = 574/574 (100%), Positives = 574/574 (100%)
  Q:     1 MKVFKNKKRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLDVIIQKLEKFFTKNK 574
           MKVFKNKKRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLDVIIQKLEKFFTKNK
  S:     1 MKVFKNKKRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLDVIIQKLEKFFTKNK 574
>gi|12045306|ref|NP_073117.1| hypothetical protein MG_447 [Mycoplasma genitalium G37] >gi|1723165|sp|P47685|Y447_MYCGE Uncharacterized protein MG447 >gi|3845040|gb|AAC72467.1| membrane protein, putative [Mycoplasma genitalium G37] >gi|166078660|gb|ABY79278.1| membrane protein, putative [synthetic Mycoplasma genitalium JCVI-1.0] (547 aa)
Score = 350, Expect = 7.0e-31, Identities = 122/541 (22%), Positives = 255/541 (47%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGK 548
           +++ L ++++E++ +    L+  VP+ F +L    Y+F+DQI++   +P + +N  ++      L  +   S    +DS  +    I Q  + ++     +I  +N    +I +FI  G  V+FS+A+ + D+ K +  W +   S     ++   L++S     +   + +S+   +   NS+ Q  ++  ++ A++Y+Y + G   I M+  L  +  ++EGR  FI     IANL NI+   +      + +IG  ++ ++GY +N L   ++I++  ++NK +  +   FK +K  KI++N+     ++ + +F R+ S+++    Y   F   L   +T   D        F          I NL   AI+G++ G+R + +Y + ++ Y  +K +  Y +I  + F  LI         FG   ++SFF+  +   + +       +  Q   ++   +    FQ+T ++  + + SL  GL  F P+L+    I +  ++ +V ++    N A++ +       I+ +L+M K
  S:     9 EKQLLIKNVFESKQLFLTILRFTVPTFFFALFSAAYVFIDQIMVIKFVPRSELN-PDSIFTDQSLIDEFKNSAFYKSDSFLSSGLNIKQFIKTVLNISQPLIVLLN----AINIFIPLGTGVIFSKAIGRNDQNKIQEAWNTGLISTTVFGLITQFLVLSFAKEWLHYNLDQSSFEQNFQANSFQQFFNKKAIDVASEYVYILIGLNIIPMLSRLFFYLAQSEGRQLFIAIVPPIANLINILIVFLLVRYSSLGVIGSAVAGILGYLINFL---AYIIYLIYLNKRNLTY-LTFKTIKLNKIDFNLLVVVSLIGMASFFRNGSLSIVTTFYE-SFLVNLTKATTDKND-------VFYLTLLTGPIAISNLASAAIFGLLQGVRTVSSYKFGQKKYDEIKKINIYTVIICISFGSLI--YLLTAVAFGKQILSSFFDV-SDQNLDLANYFSLIVQAQVFFVATGANSQQYFQNTNRVLYSWIVSLTHGLFVFIPLLFIFQAITLQTNNIEVFIWLLTANAALAGLINIAFGQIHTNLFMDK 529
>gi|31544433|ref|NP_853011.1| hypothetical protein MGA_1037 [Mycoplasma gallisepticum R] >gi|33860229|sp|P53660|Y229_MYCGA Uncharacterized protein MG447 homolog MYCGA2290 >gi|31541278|gb|AAP56579.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (596 aa)
Score = 338, Expect = 1.5e-29, Identities = 132/548 (24%), Positives = 262/548 (47%)
  Q:    27 LKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANR---------NMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSI-QTYIVEACIAKSTVSTSE---------VVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFF--------LVFKMDIIGGGISILIGYFVNILLV---ASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSG--TPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLDVIIQKLEKFFTKNK 574
           L+ ++PS+ VS    +YIFVDQI++   +  + +N          +  +   + +  N     Y + +  +N          ++I    S+   + +I  ++ L I  G +  FS+AL + D++K K +W + F + + +SI  +++I+ + +T++  +       S            +V+ +     +L +  A+ Y+Y + G   I     +     ++EGR  FI+    +ANL NI+F+ +                +IG  +S L     NI+L+   A+ + + E   KG +              NWN     +++ L +F R+A+++V+N ++        N ++       +   L  N  Q++ G  TPI NL+  +++G++ G R +  + + ++N+K +  +Y+Y  +    +S ++  +F   F      + + FN      + V  L+    L Q   ++LS++   LFQST ++ +  +ASL QGL  F P+ ++M+N+AI  ++  + ++    N  ++ I   I S  + H Y     K  D    LD  + K +    K K
  S:    48 LRFIIPSILVSFFAALYIFVDQIMIVKFVTRSDLN-------PDSIFDNDYFNFVDSNGQSWIYQDYLTASNNLKIPPFNINDLIRAAISISAPITVIINALTLLITMGLANQFSKALGRGDEEKIKEVWATGFITNVIVSIATSMIIVGVAKTWLTSSANGTMNRSLESLDTNSRYGYIVSIFFSRFRELQVQNASSYVYILAGLFTIQTFNQMYFLLNQSEGRQLFISIIPPLANLINILFDYLLIRYTSAGIAAAAYATVIGWSLSCLAYVIYNIVLIKKKATHLEYREIFRKGHF--------------NWNYLYLIILIGLASFFRNAALSVSNGIF------QTNLVTIT---EKIQPNLPPNYYQSIFGSVTPISNLMLQSVWGLIHGSRSLCGFKFGQRNFKDITKIYWYVPLIAFSYSSIVYLLFG--FGLNNIFLINLFNIQGADNLVVSNLVLRITLVQSIFIALSMNAQLLFQSTQRIGMAWIASLMQGLFTFAPVFFTMYNLAIDTNNIYLYIWIQPINAILTCIGNWIISIPFAHKYREFVSKRFDIGTMLDKYLNKTKNPKVKAK 595
>gi|26554353|ref|NP_758287.1| hypothetical protein MYPE9000 [Mycoplasma penetrans HF-2] >gi|26454363|dbj|BAC44691.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (558 aa)
Score = 314, Expect = 1.0e-26, Identities = 122/496 (24%), Positives = 243/496 (48%)
  Q:    16 MYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNL----LIFF---LRAEGRSYFITFAALIANLFNIIFELIFFLVFK-----MDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFS-----LLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTL-LFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAI 511
           ++E  +I K  L+++  ++ VSL  G+Y+F DQ+LMQ I+P N  +Y++    + G +    +   +    +   D +    N             + ++  +I L    G+++L+S+AL  +      SIW +SFY+CL  SI+ ++++ +    I+   I           ++Y++ +  +I+    + +   T    I+ I N+    LI++   L +EG++   T   LI+N  NI+ + +           + + G  I+ ++ Y ++  +  +++L+     + D    F    LK +K+NW +    L +   +F R+AS AV +IV + ++   +  +S             F  I     TPIYNL F A+ GI+ G R +++YN+ +   + ++  ++  I TG+ F       +++   +  F FG   + + FN +  S  +  T+    +   Q  + +  +SG+  FQS  K    +++S+  GLI   P+L+ +W+I+I
  S:    25 LFENTTIFKSLLRIVFLAVTVSLASGLYVFADQVLMQQILPQNQ-SYIDYIQETIGWSSTMFVGDPTYGTMKGVVDEITRLVNAGN--------SPITVLCTAISLASGLGSAILYSKALGTKKIYDINSIWKNSFYNCLSFSIITSIVLSACVFIIIPQEIHLGA------ADNYSEQQKAIIIALQQESIKLCTNYCLILTIFNIFNNFLIYYVSLLNSEGKNAIPTIVVLISNAINILTDWVLLKFSPSSSAYVSVYGSAIATVVSYILSNFMFTTYLLYKN--KRNDTFMIFKNLSLKNYKVNWKIVLDILRIGTASFFRNASTAVFSIVQLSLYGLAIKGVSIY--SIANQNATYFTSIMGAV-TPIYNLFFSAMIGILRGARTVISYNHGRGLTENIRKAFW--ISTGMAFGYGAIFFIVSGPLFTSFGFGNGGLLNLFNVSIDSPKYWDTVKLLNINTAQLVIYAFLLSGMLYFQSVAKPVHALISSIMYGLILGLPMLFILWSISI 516
>gi|188159196|ref|ZP_02998603.1| hypothetical protein Mmycm_01555 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (441 aa)
Score = 294, Expect = 2.3e-24, Identities = 105/420 (25%), Positives = 207/420 (49%)
  Q:     5 KNKKRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLI---------YQANRNMIVYQTSVIGTVNLIFISIGLFINS-------GASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACI----------AKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           + + RK   E+      I K    V +PSL  SL+ G+Y F+DQI +   +P    N   N         D  L  L+ ND   +Y+ ++           A++  ++   +++      F  + +F N+       G+S+ +++ + ++ ++  K++W + F+ C+ LSI  + L  ++I + +++             +++ +    + + YN   H+L +  A +Y+Y    +  +  +   L +F+R+EG + ++ F A++ANL NI  + +F +VFKM ++GG ++ +IG+  N      +I+  +   K       + K L  FK N  +     +L LG FLR   I  + +V  ++   +  A+              +       G PI  L    I+GI DG R + +YNY  + + R K VY + +I  +++S+++
  S:     9 QQRARKLFGET-----PISKAIWIVAIPSLLASLMVGLYSFIDQIFILQFVPKYS-NVFGNMNSEIMKYLDLSLHNLTTNDLFKSYNEMLDAYNQQAGMLNASKLTVINSNTIVSISTASFAPLTIFSNAIVYLVPVGSSIYYTKCIGKRLEKTGKNLWATMFWVCIMLSIFSSFLSFIAIWSGLIDKIAGVTQIDPNIASRANIDVLRLQDFYNAA-HKLSVQWAKQYVYIYASATILNSLTLYLSYFIRSEGYNTYVMFCAIVANLINIGLDALFIIVFKMGVLGGVVATVIGWVFNTFAYIIYIVIKDHKQKT----WLSIKSLFMFKFNKKLLGPIFLLGLGGFLRTFGIGFSFLVMNLLIANSQFAMP------------EYFQFYWAKGQPIVTLFLITIFGISDGARSLFSYNYTLRKFDRCKEVYLWTMIIALLYSIIV 432
>gi|31544356|ref|NP_852934.1| hypothetical protein MGA_0879 [Mycoplasma gallisepticum R] >gi|31541200|gb|AAP56502.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (712 aa)
Score = 287, Expect = 1.2e-23, Identities = 132/516 (25%), Positives = 260/516 (50%)
  Q:    42 IYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQ--ANYDNLIYQANRNMIVYQT-SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTS---------------------------------------EVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK--------VVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFF----NANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIA-ILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTV 557
           I IF +Q+  Q II ++  N L  ++ +  +  + +L   +  +SQ  A  DN    +N ++I  Q  +    + LI  +    +  GA V ++++++ + ++  + IWV SF++ L L ++ +++       IV A + +S + T+                                       +V+ +Y+     +    A++Y +        I + +LL F +R+EGR+ F+T A++IAN+ N++ + IF   F + +IGG  + +I + VN++L   F++++   NK    +  +F  L + K N  +    +IL L +F+R   + V  +VY ++                  +G  F +    S TP+  L F A++GI DG RP++ YNY  ++YKRV         V + Y II+ +V   +   V   +F F  PS T       NA+  +    +T+L      +  + S++I G+ LFQ T  +  + ++S  +G    + +  +++ ++ +L     + ++   +  AIS     +   I   L++ +    K+ T+
  S:   124 IKIFGEQVRSQPIITLDK-NVLAQSINNYQILDNIVLLFKNVYNSQIGAVGDNTSQLSNVSIIARQAVNSFQNILLIGNAAIYLVPIGAGVYYTKSISYKYEKTGRDIWVMSFWTTLILCLIASLICF----IIVGAGVQRSLIGTANLSPRVISLLDHNNANEIVSRINNVDLDSLNGVNFVNYPKVILTYDDAMADISALWADQYSWIYASGFFFIGLFSLLSFMIRSEGRNIFVTVASIIANVTNVLLDFIFIKYFSLGLIGGATASVISWVVNLILYVGFVMYF---NKKQATW-LSFHDLFKVKFNIKIIIPIMILGLSSFIRIVGLTVMFLVYNLLLIRV--------------SGQDFQNYHAGS-TPLLILFFVALFGISDGGRPLIGYNYTNRHYKRVHSAFWWSLFVTFTYAIISYIVVFFVAKTVLVNLFNFKDPSTTPMVQPIDNADMATSYIRITML------RIVMFSITICGMMLFQGTNDVIRSYISSAIEGSFISYLVFGTVYGLSTVLPKTDNLNIWVYVSGYAISPFITSVVVLILSILFLRRNLNVKNETI 664
>gi|13508400|ref|NP_110350.1| hypothetical protein MPN661 [Mycoplasma pneumoniae M129] >gi|6920082|sp|P75130|Y661_MYCPN Uncharacterized protein MG447 homolog >gi|11379488|gb|AAG34741.1|AE000019_8 conserved hypothetical protein [Mycoplasma pneumoniae M129] (549 aa)
Score = 263, Expect = 7.6e-21, Identities = 106/561 (18%), Positives = 256/561 (45%)
  Q:     9 RKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAK-STVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFG-GPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLDVIIQKLEKF 569
           ++ L +  +E++ +    L+  +P+ F +L    Y+FVDQI++   +P   +N  ++      L ++   S         N+  L       ++    ++   + +I  +I +F+  G  V+FS+ + + D++K K  W +   S    ++V  +++++I    ++  + K       +V + +    ++  +   ++Y+Y + G   I M+  L  +  ++EGR  FI     ++NL N++F  +      + ++G  ++ ++ YF+  +   +++++   +NK    +  + +     ++++N+F    ++ L +F R+ S+++ N  Y   F   L    T   D        F  +       I NL   AI+G++ G+R +++Y + +     +K +  Y ++  +VF+    A+ + I   G G  +       + + + +       +  Q   +++  +    FQ+  ++  + + SL QG+I F P+L+    I +   + ++ ++    N A++ +   +   +++H +M K    K    H   I+Q +E++
  S:    10 KQVLIQKSFESKRLFLTILRFAIPTFFFALFSAAYVFVDQIMVIKFVPHGPLN-PDSIFTDQALIEEFKASAFYKGGDIPNHTEL---TASQLVKTVLNISQPIVVILNAITIFVPLGTGVIFSKTIGKGDEKKIKDAWNTGLVSTTLFALVTQIIVLAIAKEWLQFNLDKVDEQHHVQVADQFQHFFNEKAVAIGSEYVYILIGFNIIPMLSRLFFYLGQSEGRQLFIAIVPPLSNLLNVLFVFLLVRFSTLGVVGSAVAAILVYFITFM---AYVVYLISLNKRGLTY-LSLRDFSFKRVSFNLFLVISMVGLASFFRNGSLSILNTFYE-SFLVNLTKTLTDQSD-------TFYLVLLTGPIAIANLTSAAIFGVLQGVRTVVSYKFGQGQLADIKRINVYTLLVCLVFA----ALLYLILAVGLGKEILVHLFDTSAATLMLANQFSLIVQAQVFFVAIGATSQQYFQNNNRVLYSWIVSLMQGVIVFVPLLFIFQAITLQTKNIEIFIWLLTANAALAGLINVLIGQVHIHFFMDKYFAQK----HKSRIVQFIERY 548
>gi|31544359|ref|NP_852937.1| hypothetical protein MGA_0889 [Mycoplasma gallisepticum R] >gi|31541203|gb|AAP56505.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (539 aa)
Score = 262, Expect = 1.0e-20, Identities = 114/399 (28%), Positives = 208/399 (52%)
  Q:    42 IYIFVDQILMQHII---------PVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSI-----QTYIVEACIAKSTV-------STSEVVNSYNQVRHQ-----------------------LILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK--------VVYYYGIITGVVFSLLINAVFWPIFLFGGPSVT 440
           I IF +QI  + II          +N    L+N +L      +  +S LS N SQ +  ++I +   N +     +IG   +  + IG      A V +++A++ + ++  + IWV SF+S L L ++ +++   I     Q +++        +       +T ++V++ N V +Q                       +  + A+++ +       II + +LL F +R+E R+ F+T A+++ANL N++ + IF   F + +IGG  + +I + VN+LL   F++++   NK    +  +F  L + K N  +    +IL L +F+R  S+ V  +VY ++                  +G  F +    S  P+  L F A++GI DG RP++ YNY  ++YKRV         V + Y II+ ++   +   V   +F F  PS T
  S:    95 IKIFGEQIWSETIITLDRNFLSNSINNYQILDNIVLLFKNVYNAQMSGLSDNTSQLSNVSIIARQAVNSL-QNVLLIGNAAIYLVPIG------AGVYYTKAISYKYEKTGRDIWVMSFWSTLILCLIASLVCFIIVGAEFQRHLIGTTNLSPNIISLLRTNNTQQIVSNINNVDNQSLNGINFTIYPKVILAYDNAMADISAHWADQHSWIYASGFFIIGLFSLLSFMIRSETRNIFVTVASIVANLTNVLLDFIFIKYFSLRLIGGAAASVISWVVNLLLYVGFLMYF---NKKQSTW-LSFADLFKVKFNIKIIIQIMILGLSSFIRIVSLTVMFLVYNLLLIKV--------------SGQDFQNYHAGS-VPLIILFFVALFGISDGGRPLIGYNYTNRHYKRVHSAFWWSLFVTFSYAIISYIIVFFVAKTVLVNLFNFKDPSTT 519
>gi|150385488|ref|ZP_01924106.1| MATE efflux family protein [Victivallis vadensis ATCC BAA-548] >gi|150258135|gb|EDM95427.1| MATE efflux family protein [Victivallis vadensis ATCC BAA-548] (468 aa)
Score = 237, Expect = 8.1e-18, Identities = 98/398 (24%), Positives = 162/398 (40%)
  Q:   106 TSVIGTVNLIFI------SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV-FWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           TS  G V ++F       ++G  I  G     SRAL +QD++       S+F   L   + LTV+ +   + ++    A  T                 IL  A  Y  +I     ++    +L   LRAEG++        +  L NI  + +F   F + I G  ++ LI   V+       IL Y F+ K     S            W+ +   L +   +F R     ++ +         LN  +   GDA V+A        ++ G  +++ +  A+ G   G +P+  YNY  + + RV+  + + + TG VF   + A+ FW       P V S F ++ P+ I +    F       PL S  +    LFQS GK F  +  S  +  I+F P++
  S:    55 TSAAGAVGIVFAMMALIQAVGFMIGVGCGSSVSRALGRQDREAADRFGSSAFLMSLVFGLTLTVIGLVFNSGLMRLLGATPT-----------------ILPYARDYAKYIFAGTVLMCSSFVLNNILRAEGKAVLSMVGLGVGGLLNIGLDPLFIFTFGLGIAGAALATLISQAVSF-----GILLYFFIAKK----SITRLSFGSISRRWSDYLEILKIGSSSFCRQGLAGISTV--------ALNVTAGGYGDAAVAA-------MSIVGR-VFHFLLSALIGFGQGFQPVAGYNYGAKRFDRVREAFRFTVKTGTVFLTCLGALGFW-----FAPEVISLFQSDDPAVIEIGATAFRAQCLALPLQSTIVLSNMLFQSVGKAFQALFISATRQGIYFLPLI 412
>gi|169334258|ref|ZP_02861451.1| hypothetical protein ANASTE_00656 [Anaerofustis stercorihominis DSM 17244] >gi|169258975|gb|EDS72941.1| hypothetical protein ANASTE_00656 [Anaerofustis stercorihominis DSM 17244] (465 aa)
Score = 208, Expect = 1.7e-14, Identities = 107/404 (26%), Positives = 177/404 (43%)
  Q:   106 TSVIGTVNLIFI------SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFL-NIVASLAQGLIFFFPILYSMWNI 509
           TS  G V ++F       +IG  +  G+  L SR L  +  +K   +  + F+  +   I+L V  +     +++   +  T                 IL  A  Y  +I    PI+M   ++   LRAEG++           + NII + IF   F + I G  I+ ++       L++ FIL   F++K            +EF+      T S+I+  G  +  R    ++A ++        LN  +   GDA V+A        ++ G  I+  IF  + G   G +P+L +NY  + Y RVK  + + + TG++  + + AVF  IF    P +   F A+    I + T  F       P++ L +     FQS GK F   I++SL QG IFF P++  + NI
  S:    63 TSASGAVGIVFSLMAIIQAIGFTLGMGSGSLISRLLGAKRDEKANEVGSTGFFLAVLAGILLAVFGLIFIDPLMKVLGSTDT-----------------ILPYAKGYAGYILFGAPIMMASFVMNNILRAEGKADLAMIGIGTGGILNIILDPIFIFTFDLGISGAAIATILSQ-----LISFFILLSHFLSKRSEVKLHIRNFTREFE------TCSMIIKTGLPSLARQGLASIATVM--------LNVAAAGYGDAAVAA-------MSIVGK-IFMFIFSIMIGFGQGYQPVLGFNYGAKRYDRVKQAFTFTLKTGMIV-MTVFAVFAFIF---APQLIKAFIADDMKVIKIGTEAFRFQCAIIPIVPLGVIANMTFQSIGKSFTATILSSLRQG-IFFIPLILILPNI 426
>gi|168179251|ref|ZP_02613915.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] >gi|168184486|ref|ZP_02619150.1| MATE efflux family protein [Clostridium botulinum Bf] >gi|182669703|gb|EDT81679.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] >gi|182672405|gb|EDT84366.1| MATE efflux family protein [Clostridium botulinum Bf] (464 aa)
Score = 199, Expect = 1.9e-13, Identities = 110/497 (22%), Positives = 199/497 (40%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFY-SCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           K K     M E ESI K+ LK+ VP++   L+  IY  VD + +  +                                           N    +   S++  + +   +IG+   +G +   SR L ++ K++      S+    C+F  I   + I+ ++ +++     ++T+                    A +Y Y I       +   ++   +RAEG S +   A  I  + NII + IF   F M I G  ++ +I   V+ +    F+L Y +  K     S+    +K FK N+N+F   L + +  F+     + A         G +N  +   GDA V+A G+ F          + ++ F+ ++GI  G +P+  YNY  +N+ R+K      I   VV  ++I+ +F    +F    +  F        I +      +LL  FPL     +   L+Q+ GK     + S+++  IF+ P++Y
  S:     2 KNKISTTEMMEKESISKVLLKLSVPAIIAMLINAIYNIVDTMFVGML-------------------------------------------NNTSAIAAVSIVYPLFMFIGAIGVMFGAGGASYLSRLLGEKKKEEADRTLTSTIVIGCIFSLIFTVICIIFLEQFLLMYGATETTMPY------------------AKEYGYTIVAGSIFTIGTAIMSNTIRAEGNSKYSMIATCIGGVINIILDPIFMFKFGMGIKGAAVATVISQLVSFI----FLLRYYYSKK-----SYIKLGIKFFKPNFNMFFEILKIGIPIFVTQVLASFA--------LGFMNLGAKPYGDAAVAAMGIVFR---------VMSIGFYIVFGIGQGFQPVAGYNYGAKNFTRLKEAVKLSIKWSVVSGIVISILF---IVFAEGCMLIFTRDREVINIGIKAFRAASLL--FPLFGYVNTYAVLYQALGKALGAFILSISRQGIFYIPLMY 408
>gi|148380799|ref|YP_001255340.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 3502] >gi|153932118|ref|YP_001385084.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|153936520|ref|YP_001388553.1| MATE efflux family protein [Clostridium botulinum A str. Hall] >gi|148290283|emb|CAL84404.1| putative drug/sodium antiporter [Clostridium botulinum A str. ATCC 3502] >gi|152928162|gb|ABS33662.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|152932434|gb|ABS37933.1| MATE efflux family protein [Clostridium botulinum A str. Hall] (464 aa)
Score = 193, Expect = 1.1e-12, Identities = 109/497 (21%), Positives = 198/497 (39%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFY-SCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           K K     M E ESI K+ LK+ VP++   L+  IY  VD + +  +                                           N    +   S++  + +   +IG+   +G +   SR L ++ K++      S+    C+F  I   + I+ ++ +++     ++T+                    A +Y Y I       +   ++   +RAEG S +   A  I  + NII + IF   F M I G  ++ +I   V+ +    F+L Y +  K     S+    +K FK  +N+F   L + +  F+     + A         G +N  +   GDA V+A G+ F          + ++ F+ ++GI  G +P+  YNY  +N+ R+K      I   VV  ++I+ +F    +F    +  F        I +      +LL  FPL     +   L+Q+ GK     + S+++  IF+ P++Y
  S:     2 KNKISTAEMMEKESISKVLLKLSVPAIIAMLINAIYNIVDTMFVGML-------------------------------------------NNTSAIAAVSIVYPLFMFIGAIGVMFGAGGASYLSRLLGEKKKEEADRTLTSTIVIGCIFSLIFTVICIIFLEQFLLMYGATETTMPY------------------AKEYGYTIVAGSIFTIGTAIMSNTIRAEGNSKYSMIATCIGGVINIILDPIFMFKFGMGIKGAAVATVISQLVSFI----FLLRYYYSKK-----SYIKLGIKFFKPTFNMFFEILKIGIPIFVTQVLASFA--------LGFMNLGAKPYGDAAVAAMGIVFR---------VMSIGFYIVFGIGQGFQPVAGYNYGAKNFTRLKEAVKLSIKWSVVSGIVISILF---IVFAEGCMLIFTRDREVINIGIKAFRAASLL--FPLFGYVNTYAVLYQALGKALGAFILSISRQGIFYIPLMY 408
>gi|167730096|emb|CAO81008.1| putative Na+ driven multidrug efflux pump [Candidatus Cloacamonas acidaminovorans] (447 aa)
Score = 192, Expect = 1.3e-12, Identities = 97/392 (24%), Positives = 170/392 (43%)
  Q:   113 NLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIF-LFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           N++    G+F N GAS L SR L ++D +  +    ++ ++   +SI    L ++ I TY+  +  +  T  +                  A +Y+  I    PIIMI   LI  LRAEG +        I    NII + +F   FKMD+ G  I+ +IG  + +L   S+ L  +         S A    K     W+ +     + + + L    +++ N +           +++A  D  ++A      +  VS   ++++  FA  G+  G++P++ +NY  QNY R+K +    I    +  L ++AVF   F LF G  +  F       +I   T +    +F  P   L +  ++  Q+ GK     + SL++  I + P+LY
  S:    63 NMLMAIAGIFANGGASYL-SRLLGKKDLKTARETTTTAIFTVAIVSIFAAALGVLFIPTYLKLSGASALTALS------------------ARQYLTAIFIGSPIIMIKFTLIQLLRAEGAAKEAMLGLFIGTGANIILDPLFIFTFKMDVTGAAIATVIGQGLAMLYYISYYLKKK---------SLASPGRKYLHPRWSCYKEIFAIGIPSSLSQVMMSIGNAISF--------KLASAYTDHTIAA------LGVVS--RVFSIAIFAFIGLSIGIQPLIGFNYGAQNYTRMKKI----IKMSNIICLGMSAVFTLFFALFPGELIAVFIKDKAIMKIG--TQILNAYVFAIPFAGLGMILMAALQAMGKAIPAFIVSLSRQGIVYIPMLY 406
>gi|153941515|ref|YP_001392120.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] >gi|152937411|gb|ABS42909.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] (464 aa)
Score = 191, Expect = 1.7e-12, Identities = 108/497 (21%), Positives = 198/497 (39%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFY-SCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           K K     M E ESI K+ LK+ VP++   L+  IY  VD + +  +                                           N    +   S++  + +   +IG+   +G +   SR L ++ K++      S+    C+F  I   + I+ ++ +++     ++T+                    A +Y Y I       +   ++   +RAEG S +   A  I  + NII + IF   F M I G  ++ +I   V+ +    F+L Y +  K     S+    +K FK  +N+F   L + +  F+     + A         G +N  +   GDA V+A G+ F          + ++ F+ ++GI  G +P+  YNY  +N+ R+K      I   VV  ++I+ +F    +F    +  F        + +      +LL  FPL     +   L+Q+ GK     + S+++  IF+ P++Y
  S:     2 KNKISTAEMMEKESISKVLLKLSVPAIIAMLINAIYNIVDTMFVGML-------------------------------------------NNTSAIAAVSIVYPLFMFIGAIGVMFGAGGASYLSRLLGEKKKEEADRTLTSTIVIGCIFSLIFTVICIIFLEQFLLMYGATETTMPY------------------AKEYGYTIVAGSIFTIGTAIMSNTIRAEGNSKYSMIATCIGGVINIILDPIFMFKFGMGIKGAAVATVISQLVSFI----FLLRYYYSKK-----SYIKLGIKFFKPTFNMFFEILKIGIPIFVTQVLASFA--------LGFMNLGAKPYGDAAVAAMGIVFR---------VMSIGFYIVFGIGQGFQPVAGYNYGAKNFTRLKEAVKLSIKWSVVSGIVISILF---IVFAEGCMLIFTRDREVINMGIKAFRAASLL--FPLFGYVNTYAVLYQALGKALGAFILSISRQGIFYIPLMY 408
>gi|166981169|ref|ZP_02252636.1| MATE efflux family protein, putative [Bacillus cereus AH187] >gi|168159933|ref|ZP_02595166.1| MATE efflux family protein, putative [Bacillus cereus H3081.97] (451 aa)
Score = 191, Expect = 1.8e-12, Identities = 86/392 (21%), Positives = 182/392 (46%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A +Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +FK  + G   + ++   +  L     +L   F+ K       +  +  +F   W+     +I+   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P E+  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGVLAAICLWRIEDL-------------AYLFGANEVILPYALEYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFKWGVTGAASATILSAAIGFL-----VLLTHFLRKS------SILKWTKFHFEWDTVKQIMIIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLAERLR----EGLQFAVKIAVVLGGVAIIVGLFFGKYIIGLFDVQSP-ELLELTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTTKSVLIIMSRGLLFIIPLLWIM 406
>gi|20090897|ref|NP_616972.1| DNA damage-inducible protein [Methanosarcina acetivorans C2A] >gi|19915974|gb|AAM05452.1| DNA damage-inducible protein [Methanosarcina acetivorans C2A] (468 aa)
Score = 190, Expect = 2.1e-12, Identities = 97/402 (24%), Positives = 183/402 (45%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWN 508
           S+   + +I ++ G+ + +G S + SRAL  ++ +K +    + F   LFLSI++ V  +     I+E   A                    IL  A++Y+ Y I G I  +  + +    +RAEG +     A LI    NI+ + +F   F+M + G  I+ +I   V+    + ++L Y    KG   F          K +  +      + LG+F+  AS   ++++ + V+    NA++   GD  ++    F  +  V+     + IF  + G+  GL+PI+ +NY  + ++R+       +I    F LL       I+LF    +   F+A+ P  + V       +L   PL+ L++  ++LFQ+ G+   + + SL++ L+F  P++  + N
  S:    58 SIAFPIQMIIMAFGIVLGTGGSSIISRALGAKENEKAERTLGNVFSLSLFLSILIAVPFLLYLGPILEIFGATPG-----------------ILPYASEYLEYIIEGGIFFVFGVAVQ-HIVRAEGNARLAMNAMLIGAGINILLDPLFIFGFEMGVKGAAIATVISQAVS----SGWLLHYCLKGKGAVNFKSG-----NLKPDLKIIKEIGAIGLGSFVMQAS---SSLMMIFVY----NALANHGGDVAIA---VFGIVIKVN-----SFIFLPLLGMSFGLQPIIGFNYGAKKFERIVEAVKLALIATTSFGLL---GLLTIYLF-TEQLLVLFSAD-PEYLAVGKHAVMIMLMGMPLIGLNVVTVTLFQALGQAKPSFLLSLSRQLLFLIPLVLILPN 413
>gi|148377443|ref|YP_001256319.1| hypothetical protein MAG1770 [Mycoplasma agalactiae PG2] >gi|148291489|emb|CAL58875.1| Pseudogene of Conserved hypothetical protein(C-terminal part) [Mycoplasma agalactiae PG2] (344 aa)
Score = 190, Expect = 2.5e-12, Identities = 55/200 (27%), Positives = 99/200 (49%)
  Q:   225 FFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           +F+R+EG + ++    + ANL NI  + +F +VFKM ++GG ++ +IG+F N      +I+  +   K       + K L +FK N  +      L LG FLR   I  + IV  ++   +  A+              +       G PI +L   +I+GI DG R + +YNY  + + R K VY + ++  +++S+++
  S:     3 YFIRSEGYNTYVMACGIAANLINIALDALFIIVFKMGVLGGVVATVIGWFFNTFAYIIYIVVKDRKQKT----WLSIKSLFKFKFNKKLLGPIFSLGLGGFLRTFGIGFSFIVMNLLIANSHFAMP------------EYFQFFWAKGQPIVSLFLISIFGINDGARSLFSYNYTLRKFDRCKKVYLWTMLIALLYSIIV 186
>gi|47566092|ref|ZP_00237130.1| conserved hypothetical protein integral membrane protein, putative [Bacillus cereus G9241] >gi|47557009|gb|EAL15339.1| conserved hypothetical protein integral membrane protein, putative [Bacillus cereus G9241] (451 aa)
Score = 190, Expect = 2.6e-12, Identities = 86/392 (21%), Positives = 181/392 (46%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +FK  + G   + ++   +  L     +L   F+ K       +  +  +F   W+     +I+   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P E+  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGVLAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFKWGVTGAASATILSAAIGFL-----VLLTHFLRKS------SILKWTKFHFEWDTVKQIMIIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLAERLR----EGLQFAVKIAVVLGGVAIIVGLFFGKYIIGLFDVQSP-ELLELTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTTKSVLIIMSRGLLFIIPLLWIM 406
>gi|167934819|ref|ZP_02521894.1| Na+ driven multidrug efflux pump [Bacillus cereus AH1134] (451 aa)
Score = 189, Expect = 3.2e-12, Identities = 85/392 (21%), Positives = 180/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +  +++ +SI+  S    + +++V+  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +++   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P E+  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKRERARSIFTQS----MTVAVVIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTVKQIMVIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLKFAVKIAVVLGGVAIIVGLFFGKYIIGLFDVQSP-ELLELTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFIIPLLWIM 406
>gi|168142055|ref|ZP_02585284.1| Na+ driven multidrug efflux pump [Bacillus cereus G9842] (451 aa)
Score = 189, Expect = 3.3e-12, Identities = 85/392 (21%), Positives = 180/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +  +++ +SI+  S    + +++V+  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +++   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P E+  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKRERARSIFTQS----MTVAVVIVGVLAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTVKQIMVIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLKFAVKIAVVLGGVAIIVGLFFGKYIIGLFDVQSP-ELLELTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFILPLLWIM 406
>gi|42780806|ref|NP_978053.1| MATE efflux family protein, putative [Bacillus cereus ATCC 10987] >gi|42736726|gb|AAS40661.1| MATE efflux family protein, putative [Bacillus cereus ATCC 10987] (451 aa)
Score = 188, Expect = 3.6e-12, Identities = 86/392 (21%), Positives = 180/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +FK  + G   + ++   +  L     +L   F  K       +  +  +F   W+     +I+   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P E+  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGVLAAICLWRIEDL-------------AYVFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFKWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTVKQIMIIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLAERLR----EGLQFAVKIAVVLGGVAIIVGLFFGKYIIGLFDVQSP-ELLELTLTGMSLFFIQYVFLGYNIVYGEYFQSVRQTTKSVLIIMSRGLLFIIPLLWIM 406
>gi|30019762|ref|NP_831393.1| Na+ driven multidrug efflux pump [Bacillus cereus ATCC 14579] >gi|168134762|ref|ZP_02577991.1| Na+ driven multidrug efflux pump [Bacillus cereus B4264] >gi|29895307|gb|AAP08594.1| Na+ driven multidrug efflux pump [Bacillus cereus ATCC 14579] (451 aa)
Score = 188, Expect = 4.4e-12, Identities = 84/392 (21%), Positives = 180/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +  +++ +SI+  S    + +++V+  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +++   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  +   + LF G  +   F+  +P E+  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKRERARSIFTQS----MTVAVVIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTVKQIMVIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLKFAVKIAVVLGGIAIIVGLFFGKYIIGLFDVQSP-ELLELTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFIIPLLWIM 406
>gi|160901503|ref|YP_001567084.1| MATE efflux family protein [Petrotoga mobilis SJ95] >gi|160359147|gb|ABX30761.1| MATE efflux family protein [Petrotoga mobilis SJ95] (477 aa)
Score = 187, Expect = 5.9e-12, Identities = 90/400 (22%), Positives = 169/400 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL--INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           SV   + +I ++ G  I  G   L SR+L  +D ++ ++   + F +   LSI LT+L                T+    ++N +       IL+ +  YM  I        I       +RAEG + +   A ++  + NII + IF  V  M++ G  ++ ++  FV ++ +  + L       G     F     K F ++W++ + +L +    F+R  + ++  IV           ++   G  G S  +A   +       +    F  ++GI  G  PI AYNY  + Y RVK V     I  + +S++  +    +P FL    S      +     + + T+    + FQ       + G SLFQ+ G+    ++ S+++ ++ F P+++ M
  S:    55 SVAFPIQMIIMAFGGMIGIGGGTLISRSLGAKDVERAENALGNIFSAIFVLSIALTIL---------------GTIFLDPILNLFGATPD--ILSYSEDYMSVILYGAIFFSIAMASHNVMRAEGNAKYAMIAMIVPGVLNIILDPIFIFVLNMEVKGAAVATVLSQFVGVVYIGYYFL------SGKSALKF---HRKNFILDWHIMSETLAVGSSAFVRQVAGSLLAIV-----------LNNLLGTYGSSLHIAIFGVI----NRLLMFFFMPMFGIAQGFLPIAAYNYGAKRYDRVKEVLKKATIAALTWSIVSFLLVQLFPGFLLSIFSTDPSLISEGIPALRIDTMFIWVVGFQ-------VVGASLFQAIGRAGPALLLSMSRQILIFIPMVFVM 408
>gi|166992284|ref|ZP_02258744.1| MATE efflux family protein, putative [Bacillus cereus AH820] (451 aa)
Score = 185, Expect = 9.3e-12, Identities = 85/392 (21%), Positives = 179/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +I+   +F+ ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P  +  LTL   +L F Q+  L  +I     FQS  +   +I+  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAILNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTIKQIMIIGFPSFITESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLQFAVKIAVILGGVVIIVGLFFGKYIIGLFDVQSPQLLE-LTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSILIIMSRGLLFIIPLLWIM 406
>gi|30261712|ref|NP_844089.1| MATE efflux family protein, putative [Bacillus anthracis str. Ames] >gi|47526928|ref|YP_018277.1| MATE efflux family protein, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184539|ref|YP_027791.1| MATE efflux family protein, putative [Bacillus anthracis str. Sterne] >gi|65318979|ref|ZP_00391938.1| COG0534: Na+-driven multidrug efflux pump [Bacillus anthracis str. A2012] >gi|165869395|ref|ZP_02214054.1| putative MATE efflux family protein [Bacillus anthracis str. A0488] >gi|167633371|ref|ZP_02391696.1| putative MATE efflux family protein [Bacillus anthracis str. A0442] >gi|167639193|ref|ZP_02397466.1| putative MATE efflux family protein [Bacillus anthracis str. A0193] >gi|170686047|ref|ZP_02877269.1| putative MATE efflux family protein [Bacillus anthracis str. A0465] >gi|170706460|ref|ZP_02896920.1| putative MATE efflux family protein [Bacillus anthracis str. A0389] >gi|177650328|ref|ZP_02933295.1| putative MATE efflux family protein [Bacillus anthracis str. A0174] >gi|190566517|ref|ZP_03019435.1| putative MATE efflux family protein [Bacillus anthracis Tsiankovskii-I] >gi|196033376|ref|ZP_03100788.1| putative MATE efflux family protein [Bacillus cereus W] >gi|30255940|gb|AAP25575.1| MATE efflux family protein, putative [Bacillus anthracis str. Ames] >gi|47502076|gb|AAT30752.1| MATE efflux family protein, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178466|gb|AAT53842.1| MATE efflux family protein, putative [Bacillus anthracis str. Sterne] >gi|164714835|gb|EDR20353.1| putative MATE efflux family protein [Bacillus anthracis str. A0488] >gi|167512983|gb|EDR88356.1| putative MATE efflux family protein [Bacillus anthracis str. A0193] >gi|167531409|gb|EDR94087.1| putative MATE efflux family protein [Bacillus anthracis str. A0442] >gi|170128558|gb|EDS97425.1| putative MATE efflux family protein [Bacillus anthracis str. A0389] >gi|170669744|gb|EDT20485.1| putative MATE efflux family protein [Bacillus anthracis str. A0465] >gi|172083472|gb|EDT68532.1| putative MATE efflux family protein [Bacillus anthracis str. A0174] >gi|190562652|gb|EDV16619.1| putative MATE efflux family protein [Bacillus anthracis Tsiankovskii-I] >gi|195993810|gb|EDX57766.1| putative MATE efflux family protein [Bacillus cereus W] (451 aa)
Score = 184, Expect = 1.2e-11, Identities = 85/392 (21%), Positives = 179/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +I+   +F+ ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P  +  LTL   +L F Q+  L  +I     FQS  +   +I+  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAILNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTIKQIMIIGFPSFITESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLQFAVKIAVILGGVAIIVGLFFGKYIIGLFDVQSPQLLE-LTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSILIIMSRGLLFIIPLLWIM 406
>gi|49480965|ref|YP_035828.1| Na+ driven multidrug efflux pump [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49332521|gb|AAT63167.1| Na+ driven multidrug efflux pump [Bacillus thuringiensis serovar konkukian str. 97-27] (451 aa)
Score = 182, Expect = 1.8e-11, Identities = 84/392 (21%), Positives = 179/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +I+   +F+ ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P  +  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAILNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTIKQIMIIGFPSFITESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLQFAVKIAVILGGVAIIVGLFFGKYIIGLFDVQSPQLLE-LTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFIIPLLWIM 406
>gi|163939517|ref|YP_001644401.1| MATE efflux family protein [Bacillus weihenstephanensis KBAB4] >gi|163861714|gb|ABY42773.1| MATE efflux family protein [Bacillus weihenstephanensis KBAB4] (452 aa)
Score = 182, Expect = 1.8e-11, Identities = 86/392 (21%), Positives = 178/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++V+  ++ +I  + +E               +Y    +++IL  A  Y+  +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +++   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  +L++  +   + LF G  +   FN  +P E+  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    63 IFFSISLWIGMGGATLYSIALGENKLERARSIFTQS----MTVAVVIVGVLAAICLWRIEDL-------------AYLFGANEVILPYALDYLQVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTVKQIMVIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEIGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLQFAVKIALVLGGIAIVVGLFFGKYIIGLFNVQSP-ELLELTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFVIPLLWIM 407
>gi|118477150|ref|YP_894300.1| Na+ driven multidrug efflux pump [Bacillus thuringiensis str. Al Hakam] >gi|196045091|ref|ZP_03112324.1| putative MATE efflux family protein [Bacillus cereus 03BB108] >gi|118416375|gb|ABK84794.1| Na+ driven multidrug efflux pump [Bacillus thuringiensis str. Al Hakam] >gi|196024093|gb|EDX62767.1| putative MATE efflux family protein [Bacillus cereus 03BB108] (451 aa)
Score = 182, Expect = 2.0e-11, Identities = 84/392 (21%), Positives = 179/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +I+   +F+ ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P  +  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKN------SILKWTKFHFEWDTIKQIMIIGFPSFITESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLQFAVKIAVVLGGVAIIVGLFFGKYIIGLFDVQSPQLLE-LTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFIIPLLWIM 406
>gi|196038988|ref|ZP_03106295.1| putative MATE efflux family protein [Bacillus cereus NVH0597-99] >gi|196030133|gb|EDX68733.1| putative MATE efflux family protein [Bacillus cereus NVH0597-99] (451 aa)
Score = 182, Expect = 2.1e-11, Identities = 84/392 (21%), Positives = 179/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +I+   +F+ ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P  +  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAILNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTIKQIMIIGFPSFITESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLQFAVKIAVVLGGVAIIVGLFFGKYIIGLFDVQSPQLLE-LTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFIIPLLWIM 406
>gi|52143747|ref|YP_083081.1| Na+ driven multidrug efflux pump [Bacillus cereus E33L] >gi|51977216|gb|AAU18766.1| Na+ driven multidrug efflux pump [Bacillus cereus E33L] (451 aa)
Score = 182, Expect = 2.1e-11, Identities = 84/392 (21%), Positives = 179/392 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IF SI L+I  G + L+S AL +   ++ +SI+  S    + +++++  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F   W+     +I+   +F+ ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++     G+   V  ++++  V   + LF G  +   F+  +P  +  LTL   +L F Q+  L  +I     FQS  +   +++  +++GL+F  P+L+ M
  S:    62 IFFSISLWIGMGGATLYSIALGENKIERARSIFTQS----MTVAVIIVGILAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFEWDTIKQIMIIGFPSFITESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLR----EGLQFAVKIAVILGGVAIIVGLFFGKYIIGLFDVQSPQLLE-LTLTGISLFFIQYVFLGYNIVYGEYFQSVRQTKKSVLIIMSRGLLFIIPLLWIM 406
>gi|58337834|ref|YP_194419.1| membrane protein [Lactobacillus acidophilus NCFM] >gi|58255151|gb|AAV43388.1| membrane protein [Lactobacillus acidophilus NCFM] (444 aa)
Score = 182, Expect = 2.2e-11, Identities = 101/417 (24%), Positives = 182/417 (43%)
  Q:    93 LIYQANRNMIVYQTSVIGTVNLIFISIGLF---------INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGT----PIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           +IY     M V +TS    V  I I   LF            G S L SR   +++ Q  K +            ++LT +++  +  I+    AK+                    +AA+ Y     G+ PI+  + +    +R EG +     A +   +  II + IF  VFKM  IG GI+ + GY     LV   IL Y  + K +Y       +LK  KI+            G  ++D        +  I   G++   + + G A +++ LA      V+       IY+++   I G   G +P++ YNY  +N+KR+K +  + I+  VV++++   +   + LF  P VT+ F  N P  ++  + +    +   P++ + +   ++FQS G  +   + ++A+  + +F  L ++ NI
  S:    29 MIYNLADTMFVAKTSDTNLVAGITIGAPLFTFLIAVSDIFGLGGSSLISRLFGERNYQLSKRVSSFCMIGGFVTGLILTAILLIFENPILHLLGAKAATYQ----------------DAADFYRIISIGAAPIVFSI-IPQNLIRTEGLATQAMIATMTGTILAIILDPIFLFVFKMGAIGVGIANITGY-----LVTDIILIYYVLCKTEY----IKLKLKYTKIS------------GKTIKD--------IVAIGIPGSITNFAQSFGMALLNSSLALYGANKVAAMGITQKIYSIVILVIVGFAFGSQPLIGYNYGAKNWKRLKKILNFDILVQVVYAVVSGGL---LILFARP-VTALF-MNQPDIVNAGSYMLIATIITTPIVGIILVYTTVFQSVGNAWAAFIMAIARQGVVYFIALETLKNI 407
>gi|170761361|ref|YP_001788161.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169408350|gb|ACA56761.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] (464 aa)
Score = 181, Expect = 2.4e-11, Identities = 107/497 (21%), Positives = 199/497 (40%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFY-SCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           K K     M E ESI K+ LK+ VP++   L+  IY  VD + +  +                                           N    +   S++  + +   +IG+   +G +   SR L ++ K++      S+    C+F  I   + I+ ++ +++     ++T+                    A +Y Y I       +   ++   +RAEG S +   A  I  + NII + IF   F M I G  ++ +I   V+ +    F+L Y +  K     S+    +K FK  +N+F   L + +  F+     + A         G +N  +   GDA V+A G+ F          + ++ F+ ++GI  G +P+  YNY  +N+ R+K      I   ++  ++I+ +F    +F    +  F        I +      +LL  FPL     +   L+Q+ GK   + + S+++  IF+ P++Y
  S:     2 KNKISTAEMMEKESISKVLLKLSVPAIIAMLINAIYNIVDTMFVGML-------------------------------------------NNTSAIAAVSIVYPLFMFIGAIGVMFGAGGASYLSRLLGEKKKEEADRTLTSTIVIGCIFSLIFTVICIIFLEQFLLMYGATETTMPY------------------AKEYGYTIVAGSIFTIGTAIMSNTIRAEGNSKYSMIATCIGGVINIILDPIFMFKFGMGIKGAAVATVISQLVSFI----FLLRYYYSKK-----SYIKLGIKFFKPTFNMFFEILKIGIPIFVTQVLASFA--------LGFMNLGAKPYGDAAVAAMGIVFR---------VMSIGFYIVFGIGQGFQPVAGYNYGAKNFTRLKEAVKLSIKWSIISGIVISILF---IVFAEGCMLIFTRDREVINIGIKAFRAASLL--FPLFGYVNTYAVLYQALGKALGSFILSISRQGIFYIPLMY 408
>gi|28210172|ref|NP_781116.1| Na+ driven multidrug efflux pump [Clostridium tetani E88] >gi|28202608|gb|AAO35053.1| Na+ driven multidrug efflux pump [Clostridium tetani E88] (462 aa)
Score = 181, Expect = 2.9e-11, Identities = 109/491 (22%), Positives = 196/491 (39%)
  Q:    16 MYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKR----VKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           M E ESI K+ LK+ VP++   L+  IY  VD +          +  L+N    A +                                  S++  + +   +IG+   +G +   SR L ++ K++      S+       S++ TV+               +TV   E +  Y     + I+  A +Y Y I       +   ++   +RAEG S +   A  +  + NII + I    F M I G  I+ +I    + +    F+L Y + N+    F     ++  FK  +N+F   L + +  F+     + A         G +N  +   GDA V+A G+ F          + ++ F+ ++GI  G +P+  YNY  +N+ R    +K+   +  I  ++ SLL         +F    +  F       +I +      +LL  FPL     +   LFQ+ GK     + S+++  IF+ P++Y +
  S:    10 MMEKESISKVLLKLSVPAIIAMLINAIYNIVDTMF---------VGMLDNTSAIAAV----------------------------------SIVYPLFMFIGAIGVMFGAGGASYLSRLLGEKKKEEADKTLTSTIIMGCIFSLIFTVI---------------ATVFLDEFLLMYGAT--ETIMPYAKEYGYVIVLGSIFTIGTAIMSNTIRAEGNSRYSMIATCVGAVVNIILDPILMFNFNMGIKGAAIATVIAQLTSFI----FLLRYYYSNRNYINF-----KINLFKPTFNMFFEILKIGIPIFVTQVLASFA--------LGFMNLGAKPYGDAAVAAMGIVFR---------VMSIGFYIVFGIGQGFQPVAGYNYGAKNFTRLEESIKISIRWSTIAAIITSLL-------FIIFAKECMLIFTRDREVIDIGIKAFRAASLL--FPLFGYVNTYAVLFQALGKAVGAFILSISRQGIFYIPLMYVL 410
>gi|182417625|ref|ZP_02948944.1| cation efflux protein [Clostridium butyricum 5521] >gi|182378349|gb|EDT75880.1| cation efflux protein [Clostridium butyricum 5521] (454 aa)
Score = 178, Expect = 5.2e-11, Identities = 113/457 (24%), Positives = 208/457 (45%)
  Q:   105 QTSVIGTVNLIFISIGLFINS---GASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLDV 561
           Q + +G  + IF+ +    N    G S L SR L  +D +K K I  SSF  C + SI+L ++ + +    +E  +    + TS +  S+               +Y+I G+ P ++    L   +R EG S       +I  L NII + I  LV +M I G  I+ +IG       V+S I F   +NK     S +   +K+F IN  + +  +++ +   + +  ++++   YV V     N      GD+ ++A G+A           + +L+   + G   G +PI+AY+Y  +N KR+  +  +     ++   +  AV   IF+F    V  F   N    ++   L+   L+   PL+ +     +LFQ  GK   +++ ++ +  + F P++  M  IA +     +++  A T++  + +A+    S+++HL  GK+       + LDV
  S:    49 QVAAVGLTSPIFMLLLALSNVFAIGGSALISRTLGAKDTEKVKHI--SSF--CFYSSIILGIICIIVLNLAMEPIL--KLLGTSSLTKSF----------CKEFLLYYIVGA-PFVVCTFTLGNLIRTEGLSKEAMIGNMIGTLLNIILDPIMILVLEMGIRGAAIATVIGN------VSSVIYFIIIINKKCKGLSLS---IKDFSINKEIISGVMVVGIPASINNMLMSIS---YVFV-----NNYLKLYGDSAIAAMGIA---------NKVVSLVTLLLIGFAAGAQPIMAYSYGAENNKRLSELLRFLFKAAIIGGFIGGAV---IFVFANNIVKVFI--NDAEIVNYGILMLRALIVSAPLVGVIYVLSNLFQGMGKGTQSLILAVGRQGLIFIPVISIMNKIAGMNG---IIISQALTDVLTAILAV----SMFVHL-KGKENISIKKQIELDV 453
>gi|118443463|ref|YP_877297.1| MATE efflux family protein [Clostridium novyi NT] >gi|118133919|gb|ABK60963.1| MATE efflux family protein [Clostridium novyi NT] (455 aa)
Score = 178, Expect = 5.8e-11, Identities = 108/490 (22%), Positives = 196/490 (40%)
  Q:    14 ESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +SM   E I KL LK  +P++   L+  +Y  VD+I + HI  V  +     A+   G+T                                      +  I ++ G+ +  G +   S  + Q  ++  + +      +C  LSI+++ ++  I    V   +                     +  A+   +Y+    I II+   I N+L F L    RA+G      F  ++  L NI+ + +F  VF + I G  ++ +I   V+ +    +I++Y    KG         + K FK++  +   +  + +  F    + +V  ++       T N +    GD  + A    + I  V   P        I+GI  G +PI+ YNY  + Y R+K      II   +  L+I ++   I  F   ++  F   +   EI V  +     L   P++ +SI G + +QS GK  + +  SL + +I F P++
  S:     4 QSMLGEEPIGKLLLKYSIPAIIGMLVNALYNIVDRIFIGHIPNVGAL-----AITGVGITM------------------------------------PIMYILLAFGMLVGIGTTANISIKMGQGKREDAEKL----LGNCFTLSIIISAVLTVIGILFVNKILG--------------------VFGASENTLYYAKEYINIILFGAIFNILNFALNSTIRADGSPKIAAFTMILGCLVNIVLDAVFIFVFNLGIKGAALATVIAQIVSTI----WIIYY--YTKGSSNLKL---KTKNFKLDKKLVKITFAIGVAPFSMQIASSVVQVI-------TNNTLKLYGGDLAIGAMAVISSIAMVFLMP--------IFGINQGAQPIIGYNYGAKKYHRMKDAVKISIIAATII-LVIGSIL--IQSFPAAAIKVFNKDDKLLEIGVKGIRI--FLIMMPVIGISIIGSNYYQSVGKAKVAMFLSLLRQVILFIPLM 406
>gi|170755169|ref|YP_001782452.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] >gi|169120381|gb|ACA44217.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] (464 aa)
Score = 172, Expect = 2.8e-10, Identities = 106/497 (21%), Positives = 198/497 (39%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFY-SCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           K K     M E ESI K+ LK+ VP++   L+  IY  VD + +  +                                           N    +   S++  + +   +IG+   +G +   SR L ++ K++      S+    C+F  I   + I+ ++ +++     ++T+                    A +Y Y I       +   ++   +RAEG S +   A  I  + NII + IF   F M I G  ++ +I   V+ +    F+L Y +  K     S+    +K FK  +N+F   L + +  F+     + A         G +N  +   GDA V+A G+ F          + ++ F+ ++GI  G +P+  YNY  +N+ R+K      I   ++  ++I+ +F    +F    +  F        I +      +LL  FPL     +   L+Q+ GK     + S+++  IF+ P+++
  S:     2 KNKISTAEMMEKESISKVLLKLSVPAIIAMLINAIYNIVDTMFVGML-------------------------------------------NNTSAIAAVSIVYPLFMFIGAIGVMFGAGGASYLSRLLGEKKKEEADRTLTSTIVIGCIFSLIFTVICIIFLEQFLLMYGATETTMPY------------------AKEYGYTIVAGSIFTIGTAIMSNTIRAEGNSKYSMIATCIGGVINIILDPIFMFKFGMGIKGAAVATVISQLVSFI----FLLRYYYSKK-----SYIKLGIKFFKPTFNMFFEILKIGIPIFVTQVLASFA--------LGFMNLGAKPYGDAAVAAMGIVFR---------VMSIGFYIVFGIGQGFQPVAGYNYGAKNFTRLKEAVKLSIKWSIISGIVISILF---IVFAEGCMLIFTRDREVINIGIKAFRAASLL--FPLFGYINTYAVLYQALGKALGAFILSISRQGIFYIPLIF 408
>gi|19705047|ref|NP_602542.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19712963|gb|AAL93841.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (457 aa)
Score = 171, Expect = 4.0e-10, Identities = 87/396 (21%), Positives = 163/396 (41%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           V+  V ++  +  L I  G++   S  L  +D+++ +          +FLS +++V++M I  + ++  I     S    +              A  Y+++I   +P  ++  +L   +R++G         L+  + NI+ + IF   F M + G  I+ +I  +V++L    + ++Y   NK          +L +  I +N +    I  LG+      +  + + Y++        +    GD  + A        T    PI+        GI  G++PIL YNY  + YKRVK   Y GI    +  ++    +  + LF    +  F       EI    L   T++  FP++   I     FQ+ GK  ++   SL++ +I   P L
  S:    58 VVFPVVILIFAFSLLIGIGSAAAVSLKLGMKDREEAERF----LGVAVFLSFIVSVVLMIIIYFNMDKIIYFIGGSNETFI-------------YAKDYLFYINLGVPAAILGLVLNSVIRSDGSPKIAMGTLLVGAITNIVLDPIFIFGFGMGVKGAAIATIISQYVSML----WTIYYFTSNKSKI-------KLVKKDIKFNFYKAKEICLLGSSAFAIQLGFSLVTYILN-----TVLKKYGGDTSIGAMAIVQSFMTFMAMPIF--------GINQGIQPILGYNYGAEKYKRVKEALYKGIFAATIICII---GYTSVRLFSDTLIKIFTTKPELQEITKYGLKAYTMV--FPIVGFQIVSSIYFQAVGKPRMSFFISLSRQIIVMIPCL 407
>gi|187778571|ref|ZP_02995044.1| hypothetical protein CLOSPO_02166 [Clostridium sporogenes ATCC 15579] >gi|187772196|gb|EDU35998.1| hypothetical protein CLOSPO_02166 [Clostridium sporogenes ATCC 15579] (464 aa)
Score = 169, Expect = 5.8e-10, Identities = 107/497 (21%), Positives = 196/497 (39%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           K K     M E ESI K+ LK+ VP++   L+  IY  VD + +  +                                           N    +   S++  + +   +IG+   +G +   SR L ++ K++      S+       S++ TV+               S +   + +  Y     + I+  A +Y Y I       +   ++   +RAEG S +   A  I  + NII + IF   F M I G  ++ +I   V+ +    F+L Y +  K     S+    +K FK  +N+F   L + +  F+     + A         G +N  +   GDA V+A G+ F          + ++ F+ ++GI  G +P+  YNY  +N+ R+K      I   ++  ++I+ +F    +F    +  F        I +      +LL  FPL     +   L+Q+ GK     + S+++  IF+ P+++
  S:     2 KNKISTAEMMEKESISKVLLKLSVPAIIAMLINAIYNIVDTMFVGML-------------------------------------------NNTSAIAAVSIVYPLFMFIGAIGVMFGAGGASYLSRLLGEKKKEEADKTLTSTIIIGCIFSLIFTVI---------------SIIFLDKFLLMYGAT--ETIMPYAREYGYTIVLGAVFTIGTGIMSNTIRAEGNSKYSMIATCIGGVINIILDPIFMFKFGMGIKGAAVATVISQIVSFV----FLLRYYYSKK-----SYIKLGIKFFKPTFNMFFEILKIGIPIFVTQVLASFA--------LGFMNLGAKPYGDAAVAAMGIVFR---------VMSIGFYIVFGIGQGFQPVAGYNYGAKNFARLKEAVKLSIKWSIISGIVISILF---IVFAEGCMLIFTRDREVINIGIKAFRAASLL--FPLFGYINTYAVLYQALGKALGAFILSISRQGIFYIPLIF 408
>gi|34763613|ref|ZP_00144544.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886711|gb|EAA23853.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (346 aa)
Score = 166, Expect = 1.4e-09, Identities = 72/301 (23%), Positives = 126/301 (41%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           A  Y+++I   +P  ++  +L   +R++G         L+  + NI+ + IF   F M + G  I+ +I  +V++L    + ++Y   NK          +L +  I +N +    I  LG+      +  + + Y++        +    GD  + A        T    PI+        GI  G++PIL YNY  + YKRVK   Y GI    +  ++    +  + LF    +  F       EI    L   TL+  FP++   I     FQ+ GK  ++   SL++ +I   P L
  S:    25 AKDYLFYINLGVPAAILGLVLNSVIRSDGSPKIAMGTLLLGAITNIVLDPIFIFAFGMGVKGAAIATIISQYVSML----WTIYYFTSNKSKI-------KLIKKNIEFNFYKAKEICLLGSSAFAIQLGFSLVTYILN-----TVLKKYGGDTSIGAMAIVQSFMTFMAMPIF--------GINQGIQPILGYNYGAEKYKRVKEALYKGIFAATIICII---GYTSVRLFSNSLIKIFTTNPELEEITRYGLKAYTLV--FPIVGFQIVSSIYFQAVGKPKMSFFISLSRQIIVMIPCL 296
>gi|150399914|ref|YP_001323681.1| MATE efflux family protein [Methanococcus vannielii SB] >gi|150012617|gb|ABR55069.1| MATE efflux family protein [Methanococcus vannielii SB] (457 aa)
Score = 166, Expect = 1.6e-09, Identities = 73/302 (24%), Positives = 139/302 (46%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQF-PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           A +Y   + G   +++  N++   LR EG +    +A ++ ++ NI+ + IF  V  M I+G  I+ LI      +LV SF+  Y    K D   S +   LK+FK +  +     I S+G     + + +A  ++++ +      +S A G+ G++           +G  I ++    + G+  G+  +    Y  +N +++++ Y Y I  G++  L+I  +   I +F  P    F  + T + I    L+F   +F F P L L +   ++FQ   K   ++  SL + +I   P+ Y
  S:   133 AVQYSSILFGGGVLLLFTNIVNAILRGEGDAKRSMYAIILGSVLNILLDPIFIYVLDMGIVGAAIATLIS-----MLVTSFLFIYWVFIKKDTYVSIS---LKDFKFDLKIVKE--IFSIGIPASVSQLTMAFSMFLLTYI-----VSKAGGNDGIAV--------FSTGWRIVSMGTIPLVGLATGVTAVTGAAYGSKNPEKLEISYIYAIKIGILIELIIATL---ILIFANPITYLFTYSETSAHILDDLLVFLKYMFLFYPTLPLGMLTAAMFQGVSKGKNSLFISLLRTIILQIPMAY 409
>gi|88711471|ref|ZP_01105559.1| C-5 cytosine-specific DNA methylase:Multi antimicrobial extrusion (MatE) protein [Flavobacteriales bacterium HTCC2170] >gi|88710412|gb|EAR02644.1| C-5 cytosine-specific DNA methylase:Multi antimicrobial extrusion (MatE) protein [Flavobacteriales bacterium HTCC2170] (459 aa)
Score = 165, Expect = 2.1e-09, Identities = 98/402 (24%), Positives = 180/402 (44%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTP--SEIHVLTLLFCT---------LLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWN 508
           +V+  V+    ++G+ I  G S + SRAL  ++K K    + +     L L+I LT++I+ + TY+ E   A                    I + A  Y   +   +P + +  +    +RAEG+  F   A +I ++ N+  + +F  VF   + G   +  I YF    L  S++L++      +        +L +F +  N+     I SLG F+  A  AV +I+Y+++     N +    G+A V+       +  + G  +     F ++G+  G  PI  YNY    YKRVK   Y    T + +S L+  + +   +     + S F +N P  S++ + T  F           +    P+++L + G + FQ+ GK    ++ +L +   FF P++  + N
  S:    56 NVVLPVSFFIGALGMAIGIGGSSIISRALGAENKAKALKTFGNQIM--LTLTITLTMVILGL-TYVDELIPAFGGKGA--------------IFDPAKIYYVIVVCGVPFLALCMMGNTVIRAEGKPKFAMIAMIIPSIGNLFLDYLFIYVFDWGMAGAAWASTISYF----LCFSYVLYFFLSKNSELKL-----RLPDFAL--NILILKEIGSLG-FVTMARQAVVSIIYLLMN----NILFDLGGEAMVA-------VYAIIGRMLM-FALFPVFGVTQGFLPIAGYNYGAHKYKRVKESIY----TAIKYSALMATLVFIGLMVFPAEIASLFLSNKPDLSDLELATNAFVLEHTPAAMRWVFAATPIIALQLIGAAYFQAVGKAVPALLLTLTRQGFFFIPLILILPN 423
>gi|110802626|ref|YP_698596.1| Na+ driven multidrug efflux protein [Clostridium perfringens SM101] >gi|110683127|gb|ABG86497.1| Na+ driven multidrug efflux pump (mviN domain) [Clostridium perfringens SM101] (456 aa)
Score = 161, Expect = 5.4e-09, Identities = 95/398 (23%), Positives = 171/398 (42%)
  Q:   107 SVIGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           S +G    +F  +G F   I+ G S   S  L ++ K++ + I  ++F     LSIV+ ++IM      +E  +     S   ++ + + +R  LI    N   + +  +I             RAEG         +I+ + NII + IF  +F M I G  +  +I  FV  L    + ++Y  + K +        ++K   +N N+    ++++L  F  + +    +++       T   +    GD  + A          S T IY L    ++G+  G++ I+AYNY  + YKR K      ++T ++ +L++      I ++    +  F        I +  L   T  F  P L +SI G   FQS G +  +I  SL + +I F PI++
  S:    53 SGLGVTMPLFTILGAFCVAISVGGSTNISIKLGEEKKEEAERILGNTF----ILSIVVALIIMIFGLSFLEKILYFFGASKETIIYAKDYMRVILIGAWFNFPGFALNNAI-------------RAEGNPKLAGKIMIISCILNIILDPIFIFLFNMGIKGAALGTIICQFVVFL----WTMYYFTLGKSNLKL-----RIKGRILNKNILRAIILIALTPFFMELAAGFIHLI-------TNRVLKDYGGDLAIGA--------MTSITSIYLLFLMPVFGLSQGMQTIVAYNYGAKEYKRAKKTL---LMTIIIATLILTLGLVLIRIYPREFINIFTKDKELISIALNGLKIYT--FALPTLGVSILGAVYFQSIGNVKKSIFLSLLRQVILFIPIVF 407
>gi|153955313|ref|YP_001396078.1| efflux pump [Clostridium kluyveri DSM 555] >gi|146348171|gb|EDK34707.1| Predicted efflux pump [Clostridium kluyveri DSM 555] (461 aa)
Score = 160, Expect = 6.9e-09, Identities = 89/409 (21%), Positives = 168/409 (41%)
  Q:   101 MIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSL--LINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           M +   S+   + +I ++ G+ +  GA+   S  L Q +KQ  + I  ++    + +SI++TVL ++ +   ++    + +T+S                   A +++  I       +I   L   +R+EG         LI  + NII + IF  +F   I G   + +I   +N++ V  + L      KG+         L    + W    +   + +  F    + +V NIV          ++    GD  + A    N I TV+  P        I+GI  G +P++ +NY  + Y RVK      II   V S    + A  +P  L G      FFN +  +   +        +  FP++   +   + FQ+  K  +++  +L++ +I   P+L+ + +I
  S:    48 MAISGVSLTFPIAIIVMAFGMLVGIGAAARISIKLGQNNKQGAEHILGNALVLLIIVSIIVTVLGLILVDPMLIAFGASNNTISY------------------AREFITIILCGSIFQIIGFGLNNVIRSEGNPKKAMTTMLIGGITNIILDFIFIYIFHFGIKGAAFATVIAQCINMIWVLYYFL------KGNSMLKIKKGNL---ILKWETVISIFSIGMSPFAMQLAASVVNIVLN-------RSLGIYGGDLAIGAMGIINGIVTVTLMP--------IFGINQGSQPVIGFNYGAELYPRVKKALKLAIIAATVISTAGALCAHIFPNILVG------FFNKSDANLTAITVNGIKIYMLLFPVVGFQVVSANFFQAIAKAKVSMFLALSRQVIVLIPMLFLLPHI 411
>gi|154249430|ref|YP_001410255.1| MATE efflux family protein [Fervidobacterium nodosum Rt17-B1] >gi|154153366|gb|ABS60598.1| MATE efflux family protein [Fervidobacterium nodosum Rt17-B1] (454 aa)
Score = 159, Expect = 8.7e-09, Identities = 106/385 (27%), Positives = 161/385 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGG----GISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGT-PIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSE-IHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           +I +SI   I  G S   SR + ++D +   S+   S    L +S+  TVLI  I T I    + K   ++ E             L  A  Y + I    P +M  N  +  LR EG S    +A   +++ NI  + IF   FK+ I G     GISI+    +       FI +  F +K     +F    LK+F+ N        I+   T L  A IA++  +YV+  F        A GD GV+         T +G   I NL    I GI   + P+    Y  +N KR++    Y I    +FSL I      IF+F       F  +   SE +  ++     L    P   L +    +FQ  G+ F ++VA++ + +IF
  S:    61 MIVVSIATGITVGTSSAISRKIGEKDYEGANSVAEHSILLSLIVSL-FTVLI-GITTLIP---VLKGIGASGEA------------LQKAYDYGFIIFLFTPFLMFNNTAVGILRGEGDSKRPMYAVTFSSILNIFLDPIFIYTFKLGIKGAAWATGISIISATVI-------FIYYLFFSDK-----TFLKVSLKKFRYNGKYLRDISIVGFPTAL--AQIAMSIAIYVLNRFAV-----KAGGDVGVA---------TFTGAWRIINLGTLTIIGISSAVTPVTGAAYGARNVKRIEDALNYAIKFAEIFSLTI---MLGIFIFSKQLAFLFAYSKASSELLENISQALKILCLFLPGTPLGMLTSGMFQGIGQGFKSLVATILRTIIF 403
>gi|21229296|ref|NP_635218.1| DinF protein [Methanosarcina mazei Go1] >gi|20907876|gb|AAM32890.1| DinF protein [Methanosarcina mazei Go1] (473 aa)
Score = 159, Expect = 9.5e-09, Identities = 95/410 (23%), Positives = 186/410 (45%)
  Q:    94 IYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +Y A+    +   S+   + +I ++ G+ + +G S + SRAL  ++ +K +    + F   L LSI++ +  +     I+E   A     T  ++    +    +IL A    ++F+ G    + + N+    +RAEG +       LI    NII + +F     M + G  I+ ++        V S I   ++  KG     F  + LK + KI  ++ +    + +G+F+   S   ++I+ + V+    NA++T  GD  V+    F  I  V+     + IF  + G+  GL+PI+ YNY  + + R+       ++    F      V +    F    +   F+A+ P  + V T     +L   PL+ L++  +++FQ+ GK   + + SL++ ++F  P++
  S:    45 VYGADSVQAIGGLSIAFPIQMIIMAFGVVLGTGGSSIISRALGAKELEKAEKTLGNVFSLSLILSIIIAIPYLLFLDTILEIFGA-----TPGIMPYAREYLEYIILGA----VFFVFG----VAVQNI----VRAEGNARLAMNVMLIGAGLNIILDPVFMFGLDMGVKGAAIATVLSQ------VVSSIWLLQYCLKGKGAVHFKSRYLKPDIKIIKDIGS----IGVGSFVMQIS---SSIMMIFVY----NALATYGGDVAVA---VFGVIIKVN-----SFIFLPLLGMSFGLQPIVGYNYGAKQFGRIARAIKLTLMATTAFGTFGLLVIY----FFTEQILGLFSAD-PQYLDVGTHAVKIMLLGMPLVGLNVVSMTVFQALGKARPSFLLSLSRQILFLIPLV 408
>gi|148323699|gb|EDK88949.1| MOP/MATE family multidrug-resistance efflux pump [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (457 aa)
Score = 159, Expect = 9.6e-09, Identities = 90/396 (22%), Positives = 160/396 (40%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNIL-LVASFILFYEFVNKGDYPFSFAFKQLKEF-KINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           V+  V ++  +  L I  G++   S  L  +D+++ +          +FLS +++ ++M I  + ++  I     S    +              A  Y+++I   +P  ++  +L   +R++G         LI  + NI+ + IF  VF M + G  I+ +I  +V++   +  F      +        F F + KE   +  + F   L  SL T++ +          V+  +G         GD  + A        T    PI+        GI  G++PIL YNY  + YKRVK   Y GI    +  ++    +  + LF    +  F       EI    L   TL+  FP++   I     FQ+ GK  ++   SL++ +I   P L
  S:    58 VVFPVVILIFAFSLLIGIGSAAAVSLKLGMKDREEAERF----LGVAVFLSFIISAVLMVIIYFNMDKIIYLIGGSKDTFI-------------YAKDYLFYINLGVPAAILGLVLNSVIRSDGSPKIAMGTLLIGAITNIVLDPIFIFVFGMGVKGAAIATIISQYVSMFWTIHYFNSKRSKIKLIKKDIKFNFHKAKEICLLGSSAFAIQLGFSLVTYILNT---------VLKKYG---------GDTSIGAMAIVQSFMTFMAMPIF--------GINQGIQPILGYNYGAEKYKRVKEALYKGIFAATIICII---GYTSVRLFSNTLIQIFTTKPELEEIAKYGLKAYTLV--FPIVGFQIVSSIYFQAVGKPKMSFFISLSRQIIVMIPCL 407
>gi|160942180|ref|ZP_02089495.1| hypothetical protein CLOBOL_07070 [Clostridium bolteae ATCC BAA-613] >gi|158435071|gb|EDP12838.1| hypothetical protein CLOBOL_07070 [Clostridium bolteae ATCC BAA-613] (475 aa)
Score = 158, Expect = 1.2e-08, Identities = 112/490 (22%), Positives = 192/490 (39%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDI-QTVSG--TPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSL-LINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           N+ M E ESI KL L+  +P +   L+  +Y  VDQI +       GI +L N                                        T+V+  V +I +S+ L +  G +   S    ++D +       ++        IVLT+L    +  I+    A           + N + +      A +Y  ++   IP  M  N +   +RA+G   F  F+ LI    N++ + +   V    + G  ++ + G  V+ LL   ++           P SF  K++  FK +  +    L L + +FL   SI V   V   V+V +G           AG   G    DI  TV G    ++ ++   + GI  G +PI+ YNY    ++RVK+++    +    FS+ L++ + + +F      + S F +          L F   L    L  +  S     QS GK  L+++ SL +  +   P+
  S:     6 NQYMAE-ESIGKLMLRFSIPCIMSLLVSALYNIVDQIFIGR-----GIGFLGNG--------------------------------------ATNVVFPVTVIALSLSLLVGDGCAAYLSICQGRRDGEHAHRSVGNAVVFITASGIVLTLLYAFFRDSILWGFGA-----------TENNIGY------AREYFLYLIPGIPFFMFANAMNSVIRADGSPQFAMFSTLIGCALNVVLDPVAIFVLGWGMKGAALATITGQIVSALLAVYYLF---------RPKSFRLKRV-SFKPDAEILKHVLPLGISSFLTQVSIVVIMAVMNNVLVIYG-----------AGSKYGA---DIPMTVVGIVMKVFQIVISVVVGIAAGAQPIVGYNYGAGLWRRVKLIFR--TMMAAEFSVGLVSLICFEVFPV---QIISVFGSEDGLYNEFAVLAFRVFLGGIVLCCIQKSCSIFLQSMGKPALSMLLSLLRDFVLSVPL 411
>gi|88797471|ref|ZP_01113060.1| hypothetical protein MED297_09976 [Reinekea sp. MED297] >gi|88779643|gb|EAR10829.1| hypothetical protein MED297_09976 [Reinekea sp. MED297] (454 aa)
Score = 158, Expect = 1.2e-08, Identities = 82/400 (20%), Positives = 161/400 (40%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY---GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           S++  V +I  +    + SGA+ + SR L  +D +  +    ++    +  S V+  L++     I+      S +  +E +  Y+             Y+  I    PI ++  +    LRAEG+  ++    L  ++ N+I + IF  V  M + G  I+ +I     + L  SF L      +G           +E++I+W      + L L  F+  A  +        +   T NA+S   G+A         DI   +   +  ++ F I    G++   + I  YNY      RV+ +   G+ + ++    ++A+   +     P V      + P  +     +  T+   F L+  +      FQ+TG   + ++AS A+  +F  P + ++
  S:    55 SIVFPVQMIVFAFAAVLGSGAASIVSRRLGAKDHEAARHAAQTTLTFSILFSFVICALVLLAMKPIL------SLLGVTEALMPYSV-----------DYLLPILLGSPIAIMGAVFGDLLRAEGKMQYMMMLMLTGSVLNMILDPIFIFVLDMGVQGAAIATVIAQTAGLCLAVSFYL------RGKTAIHLT---AREWRIDWRALWPVVALGLPFFISHAGAS-------FMIATTNNALSQVGGNAA--------DIYISAYGLVGRVLMFVILPLIGMMIAFQTITGYNYGAGELSRVRTMVRLGLTSSLILCGSVSAIMLTV-----PQVFLGIFTSDPELLQRAMQISRTVFLCFTLVGSTFIITGYFQATGHARMALIASSARVYLFLIPAMLTL 411
>gi|182624195|ref|ZP_02951981.1| MATE efflux family protein [Clostridium perfringens D str. JGS1721] >gi|177910609|gb|EDT72977.1| MATE efflux family protein [Clostridium perfringens D str. JGS1721] (456 aa)
Score = 158, Expect = 1.3e-08, Identities = 95/398 (23%), Positives = 170/398 (42%)
  Q:   107 SVIGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           S +G    +F  +G F   I+ G S   S  L ++ K++ + I  ++F     LSIV++++IM      +E  +     S   ++ + + +R  LI    N   + +  +I             RAEG         +I+ + NII + IF  +F M I G  +  +I  F+  L    + ++Y  + K +       K L     N N+    ++++L  F  + +    +++       T   +    GD  + A          S T IY L    ++G+  G++ I+AYNY  + YKR K      ++T ++ +L++      I ++    +  F        I +  L   TL    P L +SI G   FQS G +  +I  SL + +I F PI++
  S:    53 SGLGVTMPLFTILGAFCVAISVGGSTNISIKLGEEKKEEAERILGNTF----ILSIVVSLIIMVFGFSFLEKILYFFGASKETIIYAKDYMRVILIGAWFNFPGFALNNAI-------------RAEGNPKLAGKIMIISCVLNIILDPIFIFLFHMGIKGAALGTIICQFIVFL----WTMYYFTLGKSNLKLRIKGKIL-----NKNILRAIILIALTPFFMELAAGFIHLI-------TNRVLKDYGGDLAIGA--------MTSITSIYLLFLMPVFGLSQGMQTIVAYNYGAKEYKRAKKAL---LMTIIIATLILTLGLVLIRIYPREFINIFTKDKELINIALNGLKIYTL--ALPTLGVSILGAVYFQSIGNVKKSIFLSLLRQVILFIPIVF 407
>gi|20089987|ref|NP_616062.1| integral membrane protein [Methanosarcina acetivorans C2A] >gi|19914951|gb|AAM04542.1| integral membrane protein [Methanosarcina acetivorans C2A] (475 aa)
Score = 156, Expect = 2.0e-08, Identities = 95/426 (22%), Positives = 189/426 (44%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP---------ILYSMWNIAILVSDYKVMLFTAFTNIAISSI 532
           S+   V +I ++ G+ + +G S + SRAL  ++ +K +    + F     LS++L++LI     + +E  I +   +T  V+       + +IL      ++F+ G    + + N++    R+EG +     A LI    NI+ + +F   F M + G  I+ ++   V     + F+L Y     G   F     + +  K +  +      +  G+F+ +++   ++++ + V+    NA++   GD  ++  G+            I + IF  + G+  GL+PI+ +NY  + Y R+       ++    F LL   +   ++LF    +  F  +  P  + +  +    +    PL+ L++    LFQ+ GK     + S+++ L+F  P          L  +W  A  VSD    + + F  I I  I
  S:    65 SIAFPVQMIIMAFGIVLGTGGSSIISRALGARENKKAERTLGNVFS----LSLILSMLIAVPCLFYLEP-ILRVFGATPGVLPYARDYLNIIILGG----IFFVFG----VAVQNIV----RSEGNARLAMNAMLIGGGLNILLDPVFMFGFGMGVKGAAIATVLAQAV----ASVFLLLYYLKGMGSVHF-----RSETLKPDLKIIKEIGAIGTGSFVMESA---SSLMMIFVY----NALADYGGDVAIAVFGITMK---------INSFIFLPLLGMAFGLQPIVGFNYGAKKYGRIVEAVKLALVAATTFGLLGLLI---VYLFAEKLLIIF--SADPEYLELGKIAARIMFLGTPLIGLNVVTTILFQALGKARPAFILSVSRQLLFLIPAVVLLPRFYALNGVW-AAFPVSDLLAFMLSGFMLIRIYRI 452
>gi|163787012|ref|ZP_02181459.1| MATE efflux family protein [Flavobacteriales bacterium ALC-1] >gi|159876900|gb|EDP70957.1| MATE efflux family protein [Flavobacteriales bacterium ALC-1] (451 aa)
Score = 156, Expect = 2.2e-08, Identities = 74/306 (24%), Positives = 136/306 (44%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSL-----ILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQF---PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           I   A  Y   +   +PI+ +  +    +RAEG+  F  +A L  ++ N+I +++F  VF   + G   +    Y +  L +  F L                 +  E KIN   F   L     I SLG F+  A  A+ ++ Y+++     N +    G+  V+A      +   +         F +YGI  G  PI  +NY  +NYKRV+      I+T + + +L+ A+ +   +    S+T  F      ++ VL      + + F   P++ + + G + FQ+ GK    ++ +L +  +FF P+++
  S:   131 IFEPAKTYYRIVLYGVPILALSMMGNTVIRAEGKPKFAMYAMLFPSVGNLILDVLFIKVFDFGMAGAAWATTGSYVLCFLFIVWFFL----------------SKNSELKINIKHFWLDLPIVKEIGSLG-FVTLARQAIVSVTYLLMN----NILFDLGGETSVTAYAIVGRMLMFA--------LFPVYGITQGFLPIAGFNYGAENYKRVRET----IMTAIKYGILLAAIIFVFLMIFPDSITRLFT----QDLDVLEETPPAMRWVFAATPIIGIQLIGAAYFQAVGKAIPALLLTLLRQGLFFIPLIF 407
>gi|182420039|ref|ZP_02951273.1| mate efflux family protein [Clostridium butyricum 5521] >gi|182376076|gb|EDT73663.1| mate efflux family protein [Clostridium butyricum 5521] (459 aa)
Score = 155, Expect = 2.5e-08, Identities = 98/407 (24%), Positives = 168/407 (41%)
  Q:   100 NMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITG---VVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           N+ +    +   +  I ++ G+ I  G +   S +L Q  K+K +    ++F   + +SI+LTV+ +     ++ A  A                    I+  A +Y+  I       ++   L   +R++G       + LI  + NII + IF     + + GG I+ +I  FV+ + V  +        KG        K LK      N      I S+G  +   S+ +AN    +V     N++ T  GD  V+A    N +  +   PI+        GI  G++PI+ YNY  + + RVK    Y +I+    VV   LI  +F    +         FN++ P  I++        L   PL+   I   + FQS GK+ +++  SL + +I   P L  M
  S:    49 NLAIAGVGITMPLMTIIMAFGMLIGIGTATRISISLGQHHKEKAEKFLGNAFSLIIIISILLTVVGLVFMDPLLRAFGASDN-----------------IIVYAEQYIEIIFAGCIFNIVGFGLNHSIRSDGSPKVAMLSMLIGAITNIILDPIFIFGLNLGVRGGAIATVISQFVSAIWVVYYF------TKGKSVLKIRRKYLK-----LNKEAVMGIFSIG--VSPFSMQIANCAVQVV---ANNSLQTYGGDLAVAAMTIINSLSMIFLMPIF--------GINQGMQPIVGYNYGAKKHDRVKETIKYCVISATIIVVIGFLIVELFPEKLIL-------IFNSD-PELINIGVNGMRIFLCMLPLIGGQIIVTNYFQSIGKVKISMFLSLLRQVILLIPCLIVM 409
>gi|168217654|ref|ZP_02643279.1| MATE efflux family protein [Clostridium perfringens NCTC 8239] >gi|182380341|gb|EDT77820.1| MATE efflux family protein [Clostridium perfringens NCTC 8239] (455 aa)
Score = 155, Expect = 2.6e-08, Identities = 97/440 (22%), Positives = 180/440 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPS-VTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKD 554
           I +  G+ I  GA+   S    Q  ++  + I  +S      +S+VLT++ +     I+                         +  A+   +++    I +I+   I NL+ F L    RA+G         ++  + N+I + +F  VF + I G  ++ +I   V  L+    +L+Y  +   +    F     +  K++W +    L + +  F    + +V  ++         NA+    GD  + A  A + I  +   PI+        GI  G +PI+ YNY  + Y+R +      +I      L++  +    F    P+ V S FN++ P  + +        LF  P++ +SI G + FQS GK  L    SL + +I   P+   +  IA L            T + ++    +  S+I   L++ K+ K +D
  S:    64 ILLGFGMLIGIGATANISIKFGQNKRKDAEKILGNSVVLITIISLVLTIIGIVFANSILH------------------------LFGASEATIFYAKEYINVILLGTIFNLMSFSLYSTIRADGNPKMSAAVMVLGCIINVILDAVFIFVFNLGIKGAALATVISQIVTTLI----MLYYYTLGGSNLKLKF-----ETLKLDWRLVKIVLAIGVAPFSMQMAASVVQVI-------ANNALRMYGGDLAIGAMAAISSIAMIFLMPIF--------GINQGSQPIIGYNYGAKKYERAQKTVKLAMIAATTI-LVLGGILIQAF----PALVISMFNSD-PKLLEIGVPGLRIYLFMMPIIGISIIGSNYFQSIGKAKLATFLSLLRQVILLIPLTLVLPKIAGL----------GLTGVWLAGTVSDFLSTIITGLFIIKEFKKED 447
>gi|168209607|ref|ZP_02635232.1| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] >gi|170712173|gb|EDT24355.1| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] (456 aa)
Score = 155, Expect = 2.7e-08, Identities = 94/406 (23%), Positives = 173/406 (42%)
  Q:    99 RNMIVYQTSVIGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           +++  +  S +G    +F  +G F   I+ G S   S  L ++ +++ + I  ++F     LSIV+ ++IM      +E  +     S   ++ + + +R  LI    N   + +  +I             RAEG         +I+ + NII + IF  +F M I G  +  +I  F+  L    + ++Y  + K +       K L     N N+    ++++L  F  + +    +++       T   +    GD  + A          S T IY L    ++G+  G++ I+AYNY  + YKR K      ++T ++ +L++      I ++    +  F        I +  L   TL    P L +SI G   FQS G +  +I  SL + +I F PI++
  S:    45 KDIGAFAISGLGVTMPLFTILGAFCVAISVGGSTNISIKLGEEKREEAERILGNTF----ILSIVVALIIMIFGFSFLEKILYFFGASKETIIYAKDYMRVILIGAWFNFPGFALNNAI-------------RAEGNPKLAGKIMIISCVLNIILDPIFIFLFHMGIKGAALGTIICQFIVFL----WTMYYFTLGKSNLKLRIKGKIL-----NKNILRAIILIALTPFFMELAAGFIHLI-------TNRVLKDYGGDLAIGA--------MTSITSIYLLFLMPVFGLSQGMQTIVAYNYGAKEYKRAKKAL---LMTIIIATLILTLGLVLIRIYPREFINIFTKDKELINIALNGLKIYTL--ALPTLGVSILGAVYFQSIGNVKKSIFLSLLRQVILFIPIVF 407
>gi|18311517|ref|NP_563451.1| MATE efflux family protein [Clostridium perfringens str. 13] >gi|110799155|ref|YP_697223.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|168205797|ref|ZP_02631802.1| MATE efflux family protein [Clostridium perfringens E str. JGS1987] >gi|168209775|ref|ZP_02635400.1| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] >gi|168213461|ref|ZP_02639086.1| MATE efflux family protein [Clostridium perfringens CPE str. F4969] >gi|169343279|ref|ZP_02864289.1| MATE efflux family protein [Clostridium perfringens C str. JGS1495] >gi|182624262|ref|ZP_02952047.1| MATE efflux family protein [Clostridium perfringens D str. JGS1721] >gi|18146201|dbj|BAB82241.1| conserved hypothetical protein [Clostridium perfringens str. 13] >gi|110673802|gb|ABG82789.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|169298577|gb|EDS80658.1| MATE efflux family protein [Clostridium perfringens C str. JGS1495] >gi|170662653|gb|EDT15336.1| MATE efflux family protein [Clostridium perfringens E str. JGS1987] >gi|170712064|gb|EDT24246.1| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] >gi|170715026|gb|EDT27208.1| MATE efflux family protein [Clostridium perfringens CPE str. F4969] >gi|177910480|gb|EDT72853.1| MATE efflux family protein [Clostridium perfringens D str. JGS1721] (455 aa)
Score = 155, Expect = 3.0e-08, Identities = 97/440 (22%), Positives = 180/440 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPS-VTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKD 554
           I +  G+ I  GA+   S    Q  ++  + I  +S      +S+VLT++ +     I+                         +  A+   +++    I +I+   I NL+ F L    RA+G         ++  + N+I + +F  VF + I G  ++ +I   V  L+    +L+Y  +   +    F     +  K++W +    L + +  F    + +V  ++         NA+    GD  + A  A + I  +   PI+        GI  G +PI+ YNY  + Y+R +      +I      L++  +    F    P+ V S FN++ P  + +        LF  P++ +SI G + FQS GK  L    SL + +I   P+   +  IA L            T + ++    +  S+I   L++ K+ K +D
  S:    64 ILLGFGMLIGIGATANISIKFGQNKRKDAEKILGNSVVLITIISLVLTIVGIVFANSILH------------------------LFGASEATIFYAKEYINVILLGTIFNLMSFSLYSTIRADGNPKMSAAVMVLGCIINVILDAVFIFVFNLGIKGAALATVISQIVTTLI----MLYYYTLGGSNLKLKF-----ETLKLDWRLVKIVLAIGVAPFSMQMAASVVQVI-------ANNALRMYGGDLAIGAMAAISSIAMIFLMPIF--------GINQGSQPIIGYNYGAKKYERAQKTVKLAMIAATTI-LVLGGILIQAF----PALVISMFNSD-PKLLEIGVPGLRIYLFMMPIIGISIIGSNYFQSIGKAKLATFLSLLRQVILLIPLTLVLPKIAGL----------GLTGVWLAGTVSDFLSTIITGLFIIKEFKKED 447
>gi|154503816|ref|ZP_02040876.1| hypothetical protein RUMGNA_01642 [Ruminococcus gnavus ATCC 29149] >gi|153795916|gb|EDN78336.1| hypothetical protein RUMGNA_01642 [Ruminococcus gnavus ATCC 29149] (458 aa)
Score = 154, Expect = 3.3e-08, Identities = 86/404 (21%), Positives = 149/404 (36%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL 423
           E +P+L     VPS+   L+  +Y  VDQ+ +       G+ YL NA                                       T+V   +  I ++I L I  G++ LFS  L    K+    +  ++F   L   ++  VLI   + ++V    A    +               I+  A +Y       +P +++ N +    RA+G   F     LI  + N I + +F  +FK+ + G   + +IG  V+ L+  S++  +  V               E K ++      L L + +     S+    + +V +          A    G    LA   I   +      ++   I GI  G +PI+ +NY  + Y RV+ VY   I   +V SL+
  S:    13 EKLPRLLKSFAVPSIIAMLVSSLYNIVDQVFIGQ-----GVGYLGNA--------------------------------------ATNVAFPLTTISLAIALLIGIGSASLFSLNLGAGKKEDAAQVVGTAFTMMLVFGVIYAVLI---EIFLVPLLTAFGATAE--------------IMPYAKEYTRITAIGMPFLIVNNGMSNLARADGSPKFSMTCMLIGAIINTILDPVFIFIFKLGVAGAAWATIIGQIVSCLVAVSYLKRFRNV---------------ELKAHYFRLHRKLCLKIASLGMSNSLNQVALTFVQIVLNNSLTYYGALSPYGKEIPLAACGIVMKTNA----ILLAVIIGISQGSQPIIGFNYGAKQYDRVRGVYKLAIQCNLVISLI 337
>gi|110803757|ref|YP_699791.1| MATE efflux family protein [Clostridium perfringens SM101] >gi|110684258|gb|ABG87628.1| MATE efflux family protein [Clostridium perfringens SM101] (455 aa)
Score = 154, Expect = 3.4e-08, Identities = 98/440 (22%), Positives = 179/440 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKD 554
           I +  G+ I  GA+   S    Q  ++  + I  +S      +S+VLT++ +     I+                         +  A+   +++    I +I+   I NL+ F L    RA+G         ++  + N+I + +F  VF + I G  ++ +I   V  L++   + +Y F   G       F+ LK   ++W +    L + +  F    + +V  ++         NA+    GD  + A  A + I  +   PI+        GI  G +PI+ YNY  + Y+R +      +I      L++  +    F      V S FN++ P  + +        LF  P++ +SI G + FQS GK  L    SL + +I   P+   +  IA L            T + ++    +  S+I   L++ K+ K +D
  S:    64 ILLGFGMLIGIGATANISIKFGQNKRKDAEKILGNSVVLITIISLVLTIVGIVFANSILH------------------------LFGASEATIFYAKEYINVILLGTIFNLMSFSLYSTIRADGNPKMSAAVMVLGCIINVILDAVFIFVFNLGIKGAALATVISQIVTTLIM---LYYYTF---GGSNLKLKFETLK---LDWRLVKIVLAIGIAPFSMQMAASVVQVI-------ANNALRMYGGDLAIGAMAAISSIAMIFLMPIF--------GINQGSQPIIGYNYGAKKYERAQKTVKLAMIAATTI-LVLGGILIQAF---PALVISMFNSD-PKLLEIGVPGLRIYLFMMPIIGISIIGSNYFQSIGKAKLATFLSLLRQVILLIPLTLVLPKIAGL----------GLTGVWLAGTVSDFLSTIITGLFIIKEFKKED 447
>gi|160893765|ref|ZP_02074549.1| hypothetical protein CLOL250_01319 [Clostridium sp. L2-50] >gi|156864750|gb|EDO58181.1| hypothetical protein CLOL250_01319 [Clostridium sp. L2-50] (466 aa)
Score = 154, Expect = 3.5e-08, Identities = 90/405 (22%), Positives = 166/405 (40%)
  Q:   100 NMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           N  V    V+ +V  +  ++G     GA    SR L +Q +Q+     + +    L   ++L       Q  +V+   +  T+ T                  A  Y ++I  + P++ +  +L   LRAEG   +         + N + + I     ++ I G GI+   G  V++ ++   +L       G     F  ++ K F+      T + I S   F R   + VA I+        LN  +   GD  V+A    N +        + ++F  + G   G  P++ YNY  +   RVK    + +++ ++ S +   + W   +F  P + S F  N   ++ VL+L    +   F  + L +SG+ LFQ+ G++   I+ S  +  IFF P+++
  S:    63 NSAVAAVGVLFSVLAMIQAVGYTFGMGAGSRISRFLGEQKEQEAGRDALVAVLMSLIAGLILMGAGFLWQKPLVDFLGSTDTIET-----------------FALDYGFWILLTAPVMCVSYVLNNVLRAEGMPVWALVGIGSGAVLNAVLDPILVSGLELGIRGAGIATFCGQSVSLAIMLIVML------SGKSVIGFRGQKGKPFRQTAADITRTGIPS---FFRQGLVCVATIL--------LNRAAREYGDDVVAAISVSNKV--------FAILFAVMVGYGQGFAPVVGYNYGAKENDRVKKAITFTLLSQIIASAVAGVLVW---IFASP-IISLFGENAALDLGVLSLRMHAVSLPFMAVCL-VSGM-LFQAIGEIGKAILISSTRQGIFFLPLIW 419
>gi|15896540|ref|NP_349889.1| cation efflux pump (multidrug resistance protein) [Clostridium acetobutylicum ATCC 824] >gi|15026374|gb|AAK81229.1|AE007826_2 Probable cation efflux pump (multidrug resistance protein) [Clostridium acetobutylicum ATCC 824] (461 aa)
Score = 154, Expect = 3.8e-08, Identities = 83/398 (20%), Positives = 178/398 (44%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           +  I I++GL I +GAS   +R + +++ ++ K I ++S    +   I ++ +I   ++ I+ +  A          N+Y           A +Y+  I      + + +++ + + + G++  + +  ++  L NII   +  +   M I G GI+ ++        V + + F     K ++ F   F+ +    I+ ++    +++   TF+ + + AV + V        LN +  A G  G SA +    I     T +Y  +F  + GI  G++PI+ YN+   NYK+ K +  + + T ++    I+A  W  F+     +  FF  +       ++  F  ++   PLL +    +  +Q+ G+  ++ + S+ + LI F P+   ++ I
  S:    60 IQKILIAMGLLIATGASTYAARVIGEKNYKELKKIVINSCALTIVSIISISFIIFQFKSSILYSLGASD--------NTYPM---------AVQYISIILFGSIFMCLASVMSYIMVSLGKTKTLLYTNIVGVLLNIILNYVLVIQLHMGIRGSGIATVLSQLA--AFVVALVQFAYMNKKQNFKF---FENISTNIISGDIIREIVLVGFSTFIIEIADAVVSAV--------LNNVLYAGG--GDSAIIMLGVI-----TKVYMFMFITVIGISSGMQPIVGYNFGAGNYKKAKDILKFSLKTVII----ISAFVWVGFIIWAQPLIGFFLKDAQLVSKTVS-AFRIVISMLPLLGIYYVAIYYYQAIGEARISFILSIYRELIMFIPMAVILFKI 415
>gi|15894170|ref|NP_347519.1| cation efflux pump (multidrug resistance protein) [Clostridium acetobutylicum ATCC 824] >gi|15023779|gb|AAK78859.1|AE007603_10 Probable cation efflux pump (multidrug resistance protein) [Clostridium acetobutylicum ATCC 824] (448 aa)
Score = 154, Expect = 4.0e-08, Identities = 70/277 (25%), Positives = 118/277 (42%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +RAEG         LI  + N I   +F  V K+ + G  ++ ++   V     + ++L+Y    K       +F ++K   I         ++S+G  +   ++ +A  +  I F  +L       GD  ++A    + IQ         LI   I+GI  G +PI+ YNY  +N KRVK   +Y +++ +  S L   +   IF      + S FN N    I V T      L   P++       + FQ+ GK   +++ SL + +IF  P L
  S:   157 MRAEGDPKMAMKTMLIGAVLNFIMNPLFIFVLKLGVRGSALATIVSQAV----CSVWVLYYFIKGK-------SFLKIKRENIRLRREVVREVISIG--MSPFAMQLAASLITITFNKSLEKYG---GDTSIAAFSLISSIQM--------LILMPIFGINQGSQPIIGYNYGAKNIKRVKKALWYAVLSALCISFL-GFIIVQIF---PTQIISLFNKNDMKLIGVGTRGISIFLLMLPVIGPQAVCTNYFQAVGKAKKSMLLSLLRQVIFLLPSL 405
>gi|148380740|ref|YP_001255281.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 3502] >gi|153931507|ref|YP_001385025.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|153935365|ref|YP_001388495.1| MATE efflux family protein [Clostridium botulinum A str. Hall] >gi|148290224|emb|CAL84343.1| putative drug/sodium antiporter [Clostridium botulinum A str. ATCC 3502] >gi|152927551|gb|ABS33051.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|152931279|gb|ABS36778.1| MATE efflux family protein [Clostridium botulinum A str. Hall] (473 aa)
Score = 153, Expect = 4.3e-08, Identities = 102/440 (23%), Positives = 189/440 (42%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGD-AGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           V  +  S+G+ I  GAS   +R+L ++D    KS+ +++        I +TV+IM + T+I+   I K  + T  +  S      Q I   A +Y+  +        +  ++ + + + G +     A  +  + N+I +  +FLV  ++    G +I   +   + LV +   F +   K              F++  ++    L +   TF+ + S AV  ++         N +S   GD A V  G+          T I   +F  + GI   ++PI A+NY  +N  RVK V    I+     +L++ AV   + +F  P +  F      S +      F  ++  FP + +    +  +QS GK   +++ S+ + +I F P+L+      ILV  + +M   A+    IS +   IT  IY+ + + +K K
  S:    60 VQRLMSSLGMMIAVGASTAVARSLGKKDYDNLKSVILNA--------INITVVIMVVLTFIIS--IFKKDMITGLLGAS------QSIYPYAKEYISIVVLGGLFQALTLVICYIMTSLGYTNITLKATSVGAILNVIID--YFLVMHLNFGVAGAAIATVFSQTVALVYAIYKFNKVRKK------IGLNLKLNFELKLDILKPILAVGFSTFIIEISDAVVAVILN-------NILSIYGGDKALVIVGVT---------TKISMFLFITVIGISSAMQPIAAFNYGAKNLVRVKEVVIKTIVAVTGATLILWAV---MLIFANPIIGLFLKDR--SLLGETVKAFRIIISLFPTIGIYYVSIYYYQSMGKARTSLILSVYRQMIIFIPLLF------ILVGKFDIM--GAWIAYPISDLISAITGVIYVRVALKEKNK 447
>gi|153940115|ref|YP_001392059.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] >gi|152936011|gb|ABS41509.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] (473 aa)
Score = 153, Expect = 4.3e-08, Identities = 102/440 (23%), Positives = 189/440 (42%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGD-AGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           V  +  S+G+ I  GAS   +R+L ++D    KS+ +++        I +T++IM I T+I+   I K  + T  +  S      Q I   A +Y+  +        +  ++ + + + G +     A  +  + N+I +  +FLV  ++    G +I   +   + LV +   F +   K              F++  ++    L +   TF+ + S AV  ++         N +S   GD A V  G+          T I   +F  + GI   ++PI A+NY  +N  RVK V    I+     +L++ AV   + +F  P +  F      S +      F  ++  FP + +    +  +QS GK   +++ S+ + +I F P+L+      ILV  + +M   A+    IS +   IT  IY+ + + +K K
  S:    60 VQRLMSSLGMMIAVGASTAVARSLGKKDYDNLKSVILNA--------INITIVIMVILTFIIS--IFKKDMITGLLGAS------QSIYPYAEEYISIVVLGGLFQALTLVICYIMTSLGYTNITLKATSVGAILNVIID--YFLVMHLNFGVAGAAIATVFSQTVALVYAIYKFNKVRKK------IGLNLKLNFELKLDILKPILAVGFSTFIIEISDAVVAVILN-------NILSIYGGDKALVIVGVT---------TKISMFLFITVIGISSAMQPIAAFNYGAKNLVRVKEVVIKTIVAVTGATLILWAV---MLIFANPIIGLFLKDR--SLLGETVKAFRIIISLFPTIGIYYVSIYYYQSMGKARTSLILSVYRQMIIFIPLLF------ILVGKFDIM--GAWIAYPISDLISAITGVIYVRVALKEKNK 447
>gi|170757400|ref|YP_001782387.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] >gi|169122612|gb|ACA46448.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] (473 aa)
Score = 153, Expect = 4.5e-08, Identities = 96/440 (21%), Positives = 184/440 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGD-AGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           V  +  S+G+ I  GAS   +R+L ++D    KS+ +++    + + +VLT +I   +  ++   +  S                Q I   A +Y+  +        +  ++ + + + G +     A  +  + N+I +  +FLV  ++    G +I   +   + LV +   F +   K              F++  ++    L +   TF+ + S AV  ++         N +S   GD A V  G+          T I   +F  + GI   ++PI A+NY  +N  RVK V    I+     +L++ AV   + +F  P +  F      S +      F  ++  FP + +    +  +QS GK   +++ S+ + +I F P+L+      ILV  + +M   A+    IS +   IT  IY+ + + +K K
  S:    60 VQRLMSSLGMMIAVGASTAVARSLGKKDYDNLKSVILNAINITIVIMVVLTFIISIFKKDMITGLLGAS----------------QSIYPYAEEYISIVVLGGLFQALTLVICYIMTSLGYTNITLKATSVGAILNVIID--YFLVMHLNFGVAGAAIATVFSQTVALVYAIYKFNKVRKK------IGLNLKLNFELKLDILKPILAVGFSTFIIEISDAVVAVILN-------NILSIYGGDKALVIVGVT---------TKISMFLFITVIGISSAMQPIAAFNYGAKNLVRVKEVVIKTIVAVTGATLILWAV---MLIFANPIIGLFLKDR--SLLGETVKAFRIIISLFPTIGIYYVSIYYYQSMGKARTSLILSVYRQMIIFIPLLF------ILVGKFDIM--GAWIAYPISDLISAITGVIYVRVALKEKNK 447
>gi|168217079|ref|ZP_02642704.1| MATE efflux family protein [Clostridium perfringens NCTC 8239] >gi|182380774|gb|EDT78253.1| MATE efflux family protein [Clostridium perfringens NCTC 8239] (456 aa)
Score = 153, Expect = 4.5e-08, Identities = 97/398 (24%), Positives = 167/398 (41%)
  Q:   107 SVIGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           S +G    +F  +G F   I+ G S   S  L +++K++ + I  ++F     LSI++ ++IM      +E  +     S   ++ + + +R  LI    N   + +  +I             RAEG         +I+   NII + IF  +F M I G  +  +I  F+  L    + ++Y  + K +       K L     N N+    ++++L  F  + +    +++       T   +    GD  + A          S T IY L    ++G+  G++ I+AYNY  + YKR K      II   +  L +  VF  I ++    +  F        I +  L   TL    P L +SI G   FQS G +  +I  SL + +I F PI++
  S:    53 SGLGVTMPLFTILGAFCVAISVGGSTNISIKLGEENKEEAERILGNTF----ILSIIVALIIMVFGFSFLEKILYFFGASKETIIYAKDYMRVILIGAWFNFPGFALNNAI-------------RAEGNPKLAGKIMIISCALNIILDPIFIFLFHMGIKGAALGTIICQFIVFL----WTMYYFTLGKSNLKLRIKGKIL-----NNNILRAIILIALTPFFMELAAGFIHLI-------TNRVLKDYGGDLAIGA--------MTSITSIYLLFLMPVFGLSQGMQTIVAYNYGAKEYKRAKKTLLMTIIIATLI-LTLGLVF--IRIYPREFINIFTKDKELINIALNGLKIYTL--ALPTLGVSILGAVYFQSIGNVKKSIFLSLLRQVILFIPIVF 407
>gi|18310258|ref|NP_562192.1| hypothetical protein CPE1276 [Clostridium perfringens str. 13] >gi|18144937|dbj|BAB80982.1| conserved hypothetical protein [Clostridium perfringens str. 13] (456 aa)
Score = 153, Expect = 4.6e-08, Identities = 93/398 (23%), Positives = 169/398 (42%)
  Q:   107 SVIGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           S +G    +F  +G F   I+ G S   S  L ++ +++ + I  ++F     LSIV+ ++IM      +E  +     S   ++ + + +R  LI    N   + +  +I             RAEG         +I+ + NII + IF  +F M I G  +  +I  F+  L    + ++Y  + K +       K L     N N+    ++++L  F  + +    +++       T   +    GD  + A          S T IY L    ++G+  G++ I+AYNY  + YKR K      ++T ++ +L++      I ++    +  F        I +  L   T+    P L +SI G   FQS G +  +I  SL + +I F PI++
  S:    53 SGLGVTMPLFTILGAFCVAISVGGSTNISIKLGEEKREEAERILGNTF----ILSIVVALIIMIFGLSFLEKILYFFEASKETIIYAKDYMRVILIGAWFNFPGFALNNAI-------------RAEGNPKLAGKIMIISCVLNIILDPIFIFLFHMGIKGAALGTIICQFIVFL----WTMYYFTLGKSNLKLRIKGKIL-----NKNILRAIILIALTPFFMELAAGFIHLI-------TNRVLKDYGGDLAIGA--------MTSITSIYLLFLMPVFGLSQGMQTIVAYNYGAKEYKRAKKTL---LMTIIIATLILTLGLVLIRIYPREFINIFTKDKELINIALNGLKIYTI--ALPTLGVSILGAVYFQSIGNVKKSIFLSLLRQVILFIPIVF 407
>gi|90961040|ref|YP_534956.1| Na+ driven multidrug efflux pump [Lactobacillus salivarius UCC118] >gi|90820234|gb|ABD98873.1| Na+ driven multidrug efflux pump [Lactobacillus salivarius UCC118] (419 aa)
Score = 153, Expect = 4.9e-08, Identities = 92/402 (22%), Positives = 167/402 (41%)
  Q:   102 IVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLIL----SLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLA-QGLIFFFPIL 503
           +V   +V   + +  ++IG     G S L SR   Q+  ++ K +   SFY  +  +I+LTVL++  +  I+    A +                Q    AA  Y   + GS+ I + L +    +R EG +     A +   +  II + IF   FK    G   + ++GY +N  L+  F        K     SF  K +K   ++W+ F   + +    S+  F++   +A+ N   VI     + A+                         +Y ++   + G   G +P++ YNY  +N KR + V  Y     VV++++ +     I +   P V   F  N P  I   + +    L   P +   +   ++FQS GK +  +V S++ QG+++F  ++
  S:    26 LVAGITVSSPLFMFMLAIGDIFGLGGSALISRLFGQKRYEESKHVSSFSFYGDIIFTIILTVLLLVFEAPIMHLLGANA----------------QTYQYAAEFYRVLVIGSVFITLSL-VPGNMIRTEGLAVKSMIATISGTVLAIILDPIFLFGFKWGAAGVAFANVLGYALNTGLLIYFTW------KDSKFLSFNPKYIK---VSWHHFKEIIAIGIPSSVTNFMQTFGMALLNNYLVIYGNDKVAAMGIT--------------------QKVYGIVTLVLVGFAFGAQPLIGYNYGAKNAKRFREVLRYDFKVEVVYAIIASL----ILIVLSPFVIKLF-MNNPQIIADGSYMLRVCLLTTPFIGAILVYTTVFQSAGKGWSALVMSISRQGVVYFISMV 381
>gi|168180812|ref|ZP_02615476.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] >gi|182668303|gb|EDT80282.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] (473 aa)
Score = 152, Expect = 5.3e-08, Identities = 96/440 (21%), Positives = 184/440 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGD-AGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           V  +  S+G+ I  GAS   +R+L ++D    KS+ +++    + + +VLT +I   +  ++   +  S                Q I   A +Y+  +        +  ++ + + + G +     A  +  + N+I +  +FLV  ++    G +I       + LV +   F +  NK              F++  ++    L +   TF+ + S AV  ++         N +S   GD A V  G+          T I   +F  + GI   ++PI A+NY  ++  RVK V    I+     +L++ AV   + +F  P +  F      S +      F  ++  FP + +    +  +QS GK   +++ S+ + +I F P+L+      ILV  + +M   A+    IS +   IT  IY+ + + +K K
  S:    60 VQRLMSSLGMMIAVGASTAVARSLGKKDYDNLKSVILNAINITIVIMVVLTFIISIFKKDMITGLLGAS----------------QSIYPYAEEYISIVVLGGLFQALTLVICYIMTSLGYTNITLKATSVGAILNVIID--YFLVMHLNFGVAGAAIATVVSQTVALVYAIYKFNKVRNK------IGLNLKLNFELELDILKPILAVGFSTFIIEISDAVVAVILN-------NILSIYGGDKALVIVGVT---------TKISMFLFITVIGISSAMQPIAAFNYGSKDLVRVKEVVIKTIVAVTGATLILWAV---MLIFANPIIGLFLKDR--SLLGETVKAFRIIISLFPTIGIYYVSIYYYQSMGKARTSLILSVYRQMIIFIPLLF------ILVGKFNIM--GAWIAYPISDLISAITGVIYVRIALKEKNK 447
>gi|66880452|ref|ZP_00405433.1| COG0534: Na+-driven multidrug efflux pump [Mycoplasma genitalium G-37] (167 aa)
Score = 152, Expect = 6.6e-08, Identities = 40/150 (26%), Positives = 82/150 (54%)
  Q:   189 NSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY 338
           NS+ Q  ++  ++ A++Y+Y + G   I M+  L  +  ++EGR  FI     IANL NI+   +      + +IG  ++ ++GY +N L   ++I++  ++NK +  +   FK +K  KI++N+     ++ + +F R+ S+++    Y
  S:    17 NSFQQFFNKKAIDVASEYVYILIGLNIIPMLSRLFFYLAQSEGRQLFIAIVPPIANLINILIVFLLVRYSSLGVIGSAVAGILGYLINFL---AYIIYLIYLNKRNLTY-LTFKTIKLNKIDFNLLVVVSLIGMASFFRNGSLSIVTTFY 162
>gi|168213027|ref|ZP_02638652.1| MATE efflux family protein [Clostridium perfringens CPE str. F4969] >gi|170715367|gb|EDT27549.1| MATE efflux family protein [Clostridium perfringens CPE str. F4969] (456 aa)
Score = 152, Expect = 6.9e-08, Identities = 93/398 (23%), Positives = 169/398 (42%)
  Q:   107 SVIGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           S +G    +F  +G F   I+ G S   S  L ++ +++ + I  ++F     LSIV+ ++IM      +E  +     S   ++ + + +R  LI    N   + +  +I             RAEG         +I+ + NII + IF  +F M I G  +  +I  F+  L    + ++Y  + K +       K L     N N+    ++++L  F  + +    +++       T   +    GD  + A          S T IY L    ++G+  G++ I+AYNY  + YKR K      ++T ++ +L++      I ++    +  F        I +  L   T+    P L +SI G   FQS G +  +I  SL + +I F PI++
  S:    53 SGLGVTMPLFTILGAFCVAISVGGSTNISIKLGEEKREEAERILGNTF----ILSIVVALIIMIFGFSFLEKILYFFGASKETIIYAKDYMRVILIGAWFNFPGFALNNAI-------------RAEGNPKLAGKIMIISCVLNIILDPIFIFLFHMGIKGAALGTIICQFIVFL----WTMYYFTLGKSNLKLRIKGKIL-----NKNILRAIILIALTPFFMELAAGFIHLI-------TNRVLKDYGGDLAIGA--------MTSITSIYLLFLMPVFGLSQGMQTIVAYNYGAKEYKRAKKTL---LMTIIIATLILTLGLVLIRIYPREFINIFTKDKELINIALNGLKIYTI--ALPTLGVSILGAVYFQSIGNVKKSIFLSLLRQVILFIPIVF 407
>gi|187780276|ref|ZP_02996749.1| hypothetical protein CLOSPO_03872 [Clostridium sporogenes ATCC 15579] >gi|187773901|gb|EDU37703.1| hypothetical protein CLOSPO_03872 [Clostridium sporogenes ATCC 15579] (457 aa)
Score = 151, Expect = 7.7e-08, Identities = 78/294 (26%), Positives = 128/294 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMI---LNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV--LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I  A+ K  Y+    + II+I    N L F L    RAEG         L+  + N+I + IF   F M I G  I+ +I    N + V  +     F  K     +   K+ + FK+   +F   + + +  F   A    A+I+ VI    + NA+    GD  + A    N +          ++   I+GI  G +PI+ YNY  + YKRVK      I +    ++++   F  + +F    +  F N     EI +  L ++ C L    P++   I   + FQ+ GK  +++  SL
  S:   124 IFGASTKTFYYAKEYVVIILIGSITNALGFGLNNSIRAEGNPKMAMVTMLLGAVLNLILDPIFIFGFNMGIKGAAIATVISQTANTIWVLRY-----FTGKKS---TLKLKK-ENFKVEKTIFLEIISIGMAPF---ALQLAASIITVI----SNNALKNTGGDLAIGAMTVVNSVSL--------MVLMPIFGINQGAQPIIGYNYGAEQYKRVKDTLKIAIFSA---TIVVTVGFLLVQIFPQYIIKIFNNDAKLMEIGISGLRIVLCML----PVIGFQIVSSNYFQAIGKAKISVFLSL 395
>gi|170758909|ref|YP_001786494.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169405898|gb|ACA54309.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] (455 aa)
Score = 151, Expect = 7.7e-08, Identities = 79/294 (26%), Positives = 129/294 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMI---LNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV--LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I  A+ K  Y+    + II+I    N L F L    RAEG         L+  + N+I + IF   F M I G  I+ +I    N + V  +     F +K     +   K+ + FKI   +F   + + +  F   A    A+I+ VI    + NA+    GD  + A    N +          ++   I+GI  G +PI+ YNY  + YKRVK      I +    ++++   F  + +F    +  F N     EI +  L ++ C L    P++   I   + FQ+ GK  +++  SL
  S:   124 IFGASAKTFYYAKEYVVIILIGSITNALGFGLNNSIRAEGNPKMAMVTMLLGAVLNLILDPIFIFGFNMGIKGAAIATVISQTANTIWVLRY-----FTSKKS---TLKLKR-ENFKIEKTIFLEIISIGMAPF---ALQLAASIITVI----SNNALKNTGGDLAIGAMTVINSVSL--------MVLMPIFGINQGAQPIIGYNYGAEQYKRVKDTLKIAIFSA---TMVVTVGFLLVQIFPQYIIKIFNNDPKLMEIGISGLRIVLCML----PVIGFQIVSSNYFQAIGKAKVSVFLSL 395
>gi|187778644|ref|ZP_02995117.1| hypothetical protein CLOSPO_02239 [Clostridium sporogenes ATCC 15579] >gi|187772269|gb|EDU36071.1| hypothetical protein CLOSPO_02239 [Clostridium sporogenes ATCC 15579] (473 aa)
Score = 151, Expect = 8.2e-08, Identities = 93/440 (21%), Positives = 181/440 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           V  +  S+G+ I  GAS   +R+L ++D    KS+ +++    + + + LT +I   +  ++   +  S                Q I   A KY+  +        +  ++ + + + G +     A  +  + N+I +  +FLV  ++    G +I       + LV +   F +   K              F++  ++    L +   TF+ + S AV  ++         N +S   GD  +        I     T I   +F  + GI   ++PI A+NY  ++  RVK V    I+     +L++ AV   + +F  P +  F      S +      F  ++  FP + +    +  +QS GK   +++ S+ + +I F P+L+      ILV  + +M   A+    IS +   IT  IY+ + + +K+K
  S:    60 VQRLMSSLGMMIAVGASTAVARSLGKKDYDNLKSVILNAINITIVIMVTLTFIISIFKKDMITGLLGAS----------------QSIYPYAEKYISIVVLGGLFQALTLVICYIMTSLGYTNITLKATSVGAILNVIID--YFLVMHLNFGVAGAAIATVVSQTVALVYAIYKFDKVKKKTGLNLKL------NFQLKLDILKPILAVGFSTFIIEISDAVVAVILN-------NILSIYGGDKAL--------IIVGVTTKISMFLFITVIGISSAMQPIAAFNYGAKDLVRVKEVVVKTIVAVTGATLILWAV---MLIFANPIIGLFLKDR--SLLGETVKAFRIIISLFPTIGIYYVSIYYYQSMGKARTSLILSVYRQMIIFIPLLF------ILVGKFNIM--GAWIAYPISDLISAITGVIYVRVALKEKDK 447
>gi|189463087|ref|ZP_03011872.1| hypothetical protein BACCOP_03789 [Bacteroides coprocola DSM 17136] >gi|189430066|gb|EDU99050.1| hypothetical protein BACCOP_03789 [Bacteroides coprocola DSM 17136] (452 aa)
Score = 151, Expect = 9.0e-08, Identities = 78/299 (26%), Positives = 125/299 (41%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFS---LLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           L  A  +M  I    PI  ++  L   +RA G       ++++    N+I   I   V +  I G  +S ++  FV ++ V      Y F +K  Y     FK+   FK+  ++      + +  F       + N+    +     N + T  GD  + A    N IQ         L    + GI  G++PI  YNY  ++Y RVK     GII G   +    LI+ +F  IF      V  F   +  +E   L L    +   FP++   I     FQS GK+ ++I+ SL++ L+F
  S:   132 LPYARNFMQVILLGSPISYVMVGLNNIMRATGYPKKAMLSSILTVGCNVILAPICIFVLEWGIRGAALSTIMSQFVGMIWV-----LYHFYDKKSY---IRFKR-PSFKLKKHIIMNIFGVGMSPF-------IMNVCACCIVIFINNRLLTYGGDLSIGAFGILNRIQM--------LFVMIVMGITMGMQPISGYNYGARHYDRVKQTLRLGIIAGCTITTVGFLISELFPSIF------VGMFTTNHELTEQATLALRIGVM--AFPIIGAQIVITQFFQSIGKVSISILLSLSRQLVF 401
>gi|168178525|ref|ZP_02613189.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] >gi|182671106|gb|EDT83080.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] (455 aa)
Score = 150, Expect = 9.7e-08, Identities = 78/294 (26%), Positives = 128/294 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMI---LNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV--LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I  A+ K  Y+    + II+I    N L F L    RAEG         L+  + N+I + IF   F M I G  I+ +I    N + V  +     F  K     +   K+ + FK+   +F   + + +  F   A    A+I+ VI    + NA+    GD  + A    N +          ++   I+GI  G +PI+ YNY  + YKRVK      I +    ++++   F  + +F    +  F N     EI +  L ++ C L    P++   I   + FQ+ GK  +++  SL
  S:   124 IFGASTKTFYYAKEYVVIILIGSITNALGFGLNNSIRAEGNPKMAMVTMLLGAVLNLILDPIFIFGFNMGIKGAAIATVISQTANTIWVLRY-----FTGKKS---TLKLKR-ENFKVEKTIFLEIISIGMAPF---ALQLAASIITVI----SNNALKNTGGDLAIGAMTVINSVSL--------MVLMPIFGINQGAQPIIGYNYGAEQYKRVKDTLKIAIFSA---TMVVTVGFLLVQIFPQYIIKIFNNDPKLMEIGISGLRIVLCML----PVIGFQIVSSNYFQAIGKAKVSVFLSL 395
>gi|170755092|ref|YP_001780735.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] >gi|169120304|gb|ACA44140.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] (455 aa)
Score = 150, Expect = 9.8e-08, Identities = 78/294 (26%), Positives = 128/294 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMI---LNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV--LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I  A+ K  Y+    + II+I    N L F L    RAEG         L+  + N+I + IF   F M I G  I+ +I    N + V  +     F  K     +   K+ + FK+   +F   + + +  F   A    A+I+ VI    + NA+    GD  + A    N +          ++   I+GI  G +PI+ YNY  + YKRVK      I +    ++++   F  + +F    +  F N     EI +  L ++ C L    P++   I   + FQ+ GK  +++  SL
  S:   124 IFGASAKTFYYAKEYVVIILIGSITNALGFGLNNSIRAEGNPKMAMVTMLLGAVLNLILDPIFIFSFNMGIKGAAIATVISQTANTIWVLRY-----FTGKKS---TLKLKR-ENFKVEKTIFLEIISIGMAPF---ALQLAASIITVI----SNNALKNTGGDLAIGAMTVINSVSL--------MVLMPIFGINQGAQPIIGYNYGAEQYKRVKDTLKIAIFSA---TMVVTVGFLLVQIFPQYIIKIFNNDPKLMEIGISGLRIVLCML----PVIGFQIVSSNYFQAIGKAKVSVFLSL 395
>gi|164687216|ref|ZP_02211244.1| hypothetical protein CLOBAR_00857 [Clostridium bartlettii DSM 16795] >gi|164603640|gb|EDQ97105.1| hypothetical protein CLOBAR_00857 [Clostridium bartlettii DSM 16795] (452 aa)
Score = 150, Expect = 1.1e-07, Identities = 70/277 (25%), Positives = 117/277 (42%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFN---ANTPSEIHVLTLL----FCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +RA+GR        ++ +L N++F+ +F   F   I G  I  +I   +N      FI    +  KG+        +LK  ++        L +S+  F  +      ++V             T     G    LA   + T+  T I  +    IYG+  G++ ++AYN+  + Y+R K +   G+ T  V            FLFGG  +T FF     N  ++  VL  +        L   PLL + + G   FQS GK+  ++  +L + +I F PI+
  S:   156 IRADGRPKLAATIMIVCSLLNLVFDPLFIFYFGFGIKGAAIGTVICQLIN------FIWTTYYFTKGNSNLKL---RLKNIRLKKEAVIAILTISITPFCMEVVTGSIHLV-------------TNKFLQGYGGDLAIGAMTTI--TSINLMFLMPIYGLSQGMQTLIAYNFGAKEYERTKKILLQGMFTAFV------------FLFGGFLLTRFFPNMFVNIFTKDAVLEKICLEGMKIYLMTLPLLGVCVLGPIYFQSIGKIKQSMFLTLLRQVILFIPII 403
>gi|164687714|ref|ZP_02211742.1| hypothetical protein CLOBAR_01356 [Clostridium bartlettii DSM 16795] >gi|164603488|gb|EDQ96953.1| hypothetical protein CLOBAR_01356 [Clostridium bartlettii DSM 16795] (471 aa)
Score = 150, Expect = 1.1e-07, Identities = 73/297 (24%), Positives = 119/297 (40%)
  Q:   206 YMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV----KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           Y   +    P  ++LN++   +RA+G   F   A ++  + NII + IF  + K  I G   +  IG  V+  + A +            P SF  K+   F  N  + +  + L   TF+   SI    +V  +       A   A    G    ++   IQ    T +Y ++   + GIV G +PI  YNY  +   RV    K+V    +ITG+  +++     WP       +V   F +            F   L    +  L       FQS GK    ++AS+ + +I F P+
  S:   138 YFRIVAAFFPFYLLLNVMNSMIRADGSPAFAMKAMVMGAIINIILDPIFIFLLKWGIAGAAWATAIGQVVSFAMCAVYFF---------KPKSFKLKK-SSFIPNITILSKMINLGAATFITQISIVAVTLVSNMTL-----ARYGALSKYGPDIPISVFSIQ----TKVYTIVLNIVTGIVLGGQPIFGYNYGAKRMDRVREAYKIVLRATLITGITATIIFQ--LWP------KAVVGIFGSGNGLYQEFAVKTFRIYLSLMTVTCLVKMTAVFFQSIGKSKYAVMASVIRDIICFAPL 411
>gi|170759214|ref|YP_001788097.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406203|gb|ACA54614.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] (473 aa)
Score = 150, Expect = 1.2e-07, Identities = 93/440 (21%), Positives = 184/440 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGD-AGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           V  +  S+G+ I  GAS   +R+L ++D    KS+ +++    + + +VLT +I   +  ++   +  S                + I   A +Y+  +        +  ++ + + + G +     A  +  + N+I +    +     + G  I+ ++   V ++        Y+F N+        FK    F++  ++    L +   TF+ + S AV  ++         N +S   GD A V  G+          T I   +F  + GI   ++PI A+NY  ++  RVK V    I+     +L++ AV   + +F  P +  F      S +      F  ++  FP + +    +  +QS GK   +++ S+ + +I F P+L+      ILV  + +M   A+    IS +   IT  IY+ + + +K K
  S:    60 VQRLMSSLGMMIAVGASTAVARSLGKKDYDNLKSVILNAINITIVIMVVLTFIISIFKKDMITGLLGAS----------------ESIYPYAEEYISIVILGGLFQALTLVICYIMTSLGYTNITLKATSVGAILNVIIDYFLVMHLNFGVAGAAIATVVSQTVGLVYA-----IYKF-NRVRKKIGLNFKL--NFELKLDILKPILAVGFSTFIIEISDAVVAVILN-------NILSIYGGDKALVIVGVT---------TKISMFLFITVIGISSAMQPIAAFNYGAKDLVRVKEVVIKTIVAVTGATLILWAV---MLIFANPIIGLFLKDR--SLLGETVKAFRIIISLFPAIGIYYVSIYYYQSMGKARTSLILSVYRQMIIFIPLLF------ILVGKFNIM--GAWIAYPISDLVSAITGVIYVRVALKEKNK 447
>gi|189465928|ref|ZP_03014713.1| hypothetical protein BACINT_02291 [Bacteroides intestinalis DSM 17393] >gi|189434192|gb|EDV03177.1| hypothetical protein BACINT_02291 [Bacteroides intestinalis DSM 17393] (453 aa)
Score = 149, Expect = 1.3e-07, Identities = 112/491 (22%), Positives = 185/491 (37%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDY-PFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           N  +  TESI KL L+  +P++    +  +Y  +D I + H +   GI         AGL      ++  P                            +NL+ ++    +++G S + S  L Q+D      +  ++   CL  ++V   L       I+    A S                   L  A  +M  I    PI   +  L   +RA G        +++  + NII   IF   F   I G   + +I  F+ ++ V        F++K  +  F   F +LK+  I       S I S+G      S  + N+   ++     N +    GD  + A    N + T        L    + G+  G++PI+ YN+  Q + RVK      I+TGV  +   ++ F    LF       F N     +I    +  C L+  FPL+   I   + FQS GK  ++I  SL + L++  P L
  S:     4 NPHILGTESIGKLLLQYSIPAIIGMTITSLYNIIDSIFIGHGVGAMGI---------AGL------AITFP---------------------------LMNLV-VAFCTLVSAGGSTISSIRLGQKDLDGATEVLGNTLMFCLINAVVFGGLAFLFLDDILRFFGASSET-----------------LPYARDFMQIILAGTPITYTMIGLNNIMRATGYPKKAMLTSMVTVVCNIILAPIFIFHFDWGIRGAATATVISQFIGMVWVVK-----HFLDKDSFVRFRPDFWKLKKRII-------SSIFSIGM-----SPFLMNVCACVIVIIINNTLQRHGGDMAIGAYGIINRLLT--------LYIMIVLGLTMGMQPIVGYNFGAQKHDRVKQTLKLSILTGVCIT---SSGFLICELFPHAVSVIFTNDQELIDIASRGVRICVLM--FPLVGAQIVIGNFFQSIGKAKISIFLSLTRQLLYLLPSL 405
>gi|153939624|ref|YP_001390458.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] >gi|152935520|gb|ABS41018.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] (455 aa)
Score = 148, Expect = 1.5e-07, Identities = 78/294 (26%), Positives = 128/294 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMI---LNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV--LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I  A+ K  Y+    + II+I    N L F L    RAEG         L+  + N+I + IF   F M I G  I+ +I    N + V  +     F  K     +   K+ + FK+   +F   + + +  F   A    A+I+ VI    + NA+    GD  + A    N +          ++   I+GI  G +PI+ YNY  + YKRVK      I +    ++++   F  + +F    +  F N     EI +  L ++ C L    P++   I   + FQ+ GK  +++  SL
  S:   124 IFGASAKTFYYAKEYVVIILIGSITNALGFGLNNSIRAEGNPKMAMVTMLLGAVLNLILDPIFIFGFNMGIKGAAIATVISQTANTIWVLRY-----FTGKKS---TLKLKR-ENFKVEKTIFLEIISIGMAPF---ALQLAASIITVI----SNNALKNTGGDLAIGAMTVINSVSL--------MVLMPIFGINQGAQPIIGYNYGAEQYKRVKDTLKIAIFSA---TMVVTVGFLLVQIFPQYIIKIFNNDPKLMEIGISGLRIVLCML----PVIGFQIVSSNYFQAIGKAKVSVFLSL 395
>gi|148379091|ref|YP_001253632.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 3502] >gi|153933692|ref|YP_001383475.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|153937174|ref|YP_001387022.1| MATE efflux family protein [Clostridium botulinum A str. Hall] >gi|148288575|emb|CAL82656.1| putative drug/sodium antiporter [Clostridium botulinum A str. ATCC 3502] >gi|152929736|gb|ABS35236.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|152933088|gb|ABS38587.1| MATE efflux family protein [Clostridium botulinum A str. Hall] (455 aa)
Score = 148, Expect = 1.5e-07, Identities = 78/294 (26%), Positives = 128/294 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMI---LNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV--LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I  A+ K  Y+    + II+I    N L F L    RAEG         L+  + N+I + IF   F M I G  I+ +I    N + V  +     F  K     +   K+ + FK+   +F   + + +  F   A    A+I+ VI    + NA+    GD  + A    N +          ++   I+GI  G +PI+ YNY  + YKRVK      I +    ++++   F  + +F    +  F N     EI +  L ++ C L    P++   I   + FQ+ GK  +++  SL
  S:   124 IFGASAKTFYYAKEYVVIILIGSITNALGFGLNNSIRAEGNPKMAMVTMLLGAVLNLILDPIFIFGFNMGIKGAAIATVISQTANTIWVLRY-----FTGKKS---TLKLKR-ENFKVEKTIFLEIISIGMAPF---ALQLAASIITVI----SNNALKNTGGDLAIGAMTVINSVSL--------MVLMPIFGINQGAQPIIGYNYGAEQYKRVKDTLKIAIFSA---TMVVTVGFLLVQIFPQYIIKIFNNDPKLMEIGISGLRIVLCML----PVIGFQIVSSNYFQAIGKAKVSVFLSL 395
>gi|16800058|ref|NP_470326.1| hypothetical protein lin0989 [Listeria innocua Clip11262] >gi|16413448|emb|CAC96220.1| lin0989 [Listeria innocua] (453 aa)
Score = 148, Expect = 1.8e-07, Identities = 117/432 (27%), Positives = 191/432 (44%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      I ++IG     G     SR L ++D  K K +     Y  L L I+  +++  +   +     A +T                  L+  N  +  +  S P I+    L   +RAEG S       LI  L N++F+ +  L F  +++G  +SI I   V+++  A ++       K DY  S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYN+   N  R  K + +  +  G++  ++ + VF  IF F    + S   +     +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V+LFT   NI I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEDGIKAKQVSAFVLYGSLVLGIICAIILGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRAEGASRISMNGMLIGTLVNLVFDPLLILYFNFNVVGAAVSIGIASTVSLIYYAWYL-----EKKSDY-LSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNFSAGNIARFEKAIRFTAVSIGLIVLVISSFVF--IFRFQVMHLFSDSQSVISLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTTTEILTCLIGVILFT-IHNIKIASSA 446
>gi|91773864|ref|YP_566556.1| MATE efflux family protein [Methanococcoides burtonii DSM 6242] >gi|91712879|gb|ABE52806.1| MATE efflux family protein [Methanococcoides burtonii DSM 6242] (455 aa)
Score = 147, Expect = 2.0e-07, Identities = 91/392 (23%), Positives = 168/392 (42%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           + +I + I L I  G++ + SR+L  +  ++      ++  + L LS+V+T+L I+ I+  +            +E +  +     ++IL     + + +T        LN ++   RAEG +       +I+   NII + IF     M I G  I+ +I   V+ L    F+L+Y    KG   F+F    +K F  +  +    + +   +F R AS ++  IV         N ++   GD  ++     N +        +   F  + GIV GL+PI+ +NY  +NY RV       +    + S+   A F  +F+F     + F       E     +   +L    PL+   I G S++Q+ GK       S+++ ++F  P++
  S:    63 IQMIIMGIALTIGIGSASIISRSLGAKIHERADIALGNAITAILALSVVMTILGIVYIEPLL-------RMFGATETIMPFAYDYTKIILYGTIFFAFSMT--------LNNIV---RAEGNARVAMLTMVISAGLNIILDPIFIFGLNMGIKGAAIATVISQVVSAL----FLLYY--FAKGMSSFNF---HIKHFVPHPEILKEMVTIGTSSFARSASGSLMVIV-------INNVLAVYGGDIPIAVFGIVNRL--------FMFTFMPMIGIVQGLQPIVGFNYGAKNYARVISSTALAMKITTLVSI---AGFLLLFIFPTQLFSIFTTDQELIEAGKAAMRIMSL--ALPLVGFQIVGASIYQTLGKAKPAFFLSISRQVLFLIPLV 408
>gi|160943756|ref|ZP_02090987.1| hypothetical protein FAEPRAM212_01251 [Faecalibacterium prausnitzii M21/2] >gi|158444930|gb|EDP21933.1| hypothetical protein FAEPRAM212_01251 [Faecalibacterium prausnitzii M21/2] (466 aa)
Score = 146, Expect = 3.2e-07, Identities = 65/304 (21%), Positives = 131/304 (43%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFV--NKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASI--AVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVY 410
           +V+  + ++ ++I + I  G     S +L Q +  K K    ++   CL  SIVL  L      Y++ A    +    +    +Y+          + +Y ++IT  +P  M    +   +RA+G   F   + L     NII + IF   F+  ++G  ++ +IG  V   L   ++L  + +   KGDY            ++  ++   +L L + +FL   S+  A+A I  +I  +G L+A+      A +   +    ++       + ++   + G+  G  P++ +N   +   RVK ++
  S:    57 TVVFPLTVVALAIAVMIGDGCCAFVSISLGQNEVPKAKRSVGNAVVMCLVSSIVLAAL------YLIFADTILAMFGGTVNAETYHH---------SQEYFFYITLGVPFYMFGQAMNPIIRADGNPRFAMISTLAGAALNIILDPIFIFGFRWGMMGAAVATVIGQLVTAALAVWYLLHMKIIRPEKGDY------------RLKGSICGRTLTLGMTSFLSQISLVAAMAAINNMIRKYGALDAVFGQEQYAQIPMAVVGIVMK------FFQIVISIVVGMAAGCIPVVGFNMGAKKPTRVKELF 331
>gi|167746826|ref|ZP_02418953.1| hypothetical protein ANACAC_01538 [Anaerostipes caccae DSM 14662] >gi|167653786|gb|EDR97915.1| hypothetical protein ANACAC_01538 [Anaerostipes caccae DSM 14662] (448 aa)
Score = 145, Expect = 4.1e-07, Identities = 59/248 (23%), Positives = 109/248 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN 446
           +      Y+  I    P+ M  NLL+ F+R +G  +    A +  +L NII + IF     M + G   +  +   ++IL+++ ++     +NK +         LK+ +++ N+        L + + + S  +  IV+ ++       I  A    GV A L+              L+  A+Y GI  G++P+L+ NY   N+K V V+  Y +   +V    I+A  +    FG   +T  FN++
  S:   131 VFQMTKTYLQVILLFAPMFMANNLLLCFVRNDGNPHLAMAAMICGSLSNIILDYIFIFPLGMGLFGAAFATGLAPVISILILSPYL-----INKRNQ------FHLKKCRLSANLLLDIFSSGLPSLITEVSSGIVIIVFNMILLRIAGNIGVAA--YGVIANLS--------------LVVMAVYTGIAQGIQPVLSSNYGAGNHKNVTVILRYAVTAVIV----ISACVYLCIFFGAEPITGVFNSS 348
>gi|114565873|ref|YP_753027.1| hypothetical protein Swol_0313 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336808|gb|ABI67656.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (455 aa)
Score = 145, Expect = 4.3e-07, Identities = 83/395 (21%), Positives = 162/395 (41%)
  Q:   100 NMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGII--TGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           ++ +  T+V   + ++ +++ L I  GA+ L S  L +Q K + + +  ++    + L   L VL +     I+ A         S  V  Y +   ++I+  +      + GSI + M       F+RAEG         ++  + ++    +F  +F   I G  ++ ++      L+ A ++L Y F  +     S      K  K  W V +  + +    F    +  +  ++    ++F+G         GD  ++A G+  +         I  L+   + G+  G +PI+ YNY    Y+RVK  +   ++  TG+  +  +    WP+ L G  S      A T   +H +   F  L    P++   +     FQ+ GK     + SL++
  S:    47 SLAIAATTVAFPIMILLMAVSLLIGVGATSLISLKLGEQKKDEAEKVAGNAMTMLIILPAALAVLFLLFTEPILIA------FGASAAVLPYARDFTRIIMLGS------VFGSISMGMN-----NFIRAEGNPAMAMSTQILGAVVSVALNYVFIFIFHWGIKGAALATILAQ----LISAIWVLSYFFTGR-----SLVKIHWKNLKPAWPVLSGIMAIGFAPFAMQTAACIQQLILNQTLMFYG---------GDLALAAIGIVMS---------ISMLLVMPVLGLGQGAQPIIGYNYGACQYQRVKETWKTAVLAGTGIAVAGYMALHIWPLQLVGLFSKGD--TALTTMTVHAMLTFFALL----PVVGFQVVSSMYFQAVGKARQAAILSLSR 396
>gi|196163449|ref|ZP_03123980.1| putative Na+ driven multidrug efflux pump [Clostridium difficile QCD-23m63] (467 aa)
Score = 144, Expect = 4.8e-07, Identities = 67/305 (21%), Positives = 124/305 (40%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IL  A+ Y    +  +P +++   +   + A+GR     F  LI  + N I   +F  VF M I G  ++ +IG  ++  +   +I  ++ +              K FK++  ++     L   +     ++ V  IV    + ++G  +   +    A V   +  N            +    I GI  G++PI+ YNY  + Y RVK  Y + + +  + S+    + +  F F    +TS F     +        F T LF   +  + I   + F S GK  L +  SL + ++F  P++
  S:   131 ILPYAHTYTKITSIGLPFLIMSTGMSKLILADGRPKASMFCMLIGAVINTILNPLFIFVFNMGIAGSALATVIGQLISFGISVHYIKNFQHIK----------LHKKSFKLDSIIYKHIFALGSSSCFNQLAMTVTQIVMNNTLAYYGARSVYGSEIPLACVGIIIKVN-----------MIFISIIIGISQGMQPIIGYNYGAEKYNRVKEAYKFAVGSATIISV----IAFLCFQFFPRQITSIFGNGNETYFIFAEHYFRTFLFLTFINGVQIVSSTFFTSIGKSVLGLFTSLTRQILFLIPLI 412
>gi|145953712|ref|ZP_01802720.1| hypothetical protein CdifQ_04003718 [Clostridium difficile QCD-32g58] >gi|168694489|ref|ZP_02726766.1| putative Na+ driven multidrug efflux pump [Clostridium difficile QCD-37x79] >gi|168726603|ref|ZP_02758880.1| putative Na+ driven multidrug efflux pump [Clostridium difficile QCD-76w55] >gi|168733236|ref|ZP_02765513.1| putative Na+ driven multidrug efflux pump [Clostridium difficile QCD-97b34] >gi|196126399|ref|ZP_03118148.1| putative Na+ driven multidrug efflux pump [Clostridium difficile ATCC 43255] >gi|196160625|ref|ZP_03121186.1| putative Na+ driven multidrug efflux pump [Clostridium difficile CIP 107932] (467 aa)
Score = 144, Expect = 5.1e-07, Identities = 67/305 (21%), Positives = 124/305 (40%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IL  A+ Y    +  +P +++   +   + A+GR     F  LI  + N I   +F  VF M I G  ++ +IG  ++  +   +I  ++ +              K FK++  ++     L   +     ++ V  IV    + ++G  +   +    A V   +  N            +    I GI  G++PI+ YNY  + Y RVK  Y + + +  + S+    + +  F F    +TS F     +        F T LF   +  + I   + F S GK  L +  SL + ++F  P++
  S:   131 ILPYAHTYTKITSIGLPFLIMSTGMSKLILADGRPKASMFCMLIGAVINTILNPLFIFVFNMGIAGSALATVIGQLISFGISVHYIKNFQHIK----------LHKKSFKLDSIIYKHIFALGSSSCFNQLAMTVTQIVMNNTLAYYGARSVYGSEIPLACVGIIIKVN-----------MIFISIIIGISQGMQPIIGYNYGAEKYNRVKEAYKFAVGSATIISV----IAFLCFQFFPRQITSIFGNGNETYFIFAEHYFRTFLFLTFINGVQIVSSTFFTSIGKSVLGLFTSLTRQILFLIPLI 412
>gi|154503529|ref|ZP_02040589.1| hypothetical protein RUMGNA_01353 [Ruminococcus gnavus ATCC 29149] >gi|153795629|gb|EDN78049.1| hypothetical protein RUMGNA_01353 [Ruminococcus gnavus ATCC 29149] (457 aa)
Score = 144, Expect = 5.5e-07, Identities = 100/470 (21%), Positives = 186/470 (39%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDA--SIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV--FWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL-SLSISGLSLFQSTGKMFLNIV 489
           +S+P L LK  +P +F   +  +Y  VD+I + +I  + G     ++L  AG+    I+++LS                                   S    I  G SV FS  L   DK+  + I  +SF   L  S VLTV+ + I+ +++      +    SEV   Y           AN Y+   T      ++   + +F+ A+G  +      LI  + NI+ + IF  VF+MDI G  ++ +I    + +    F+L      K   P           K  W +      +    FL  A  S+ +  +  V+ ++G       + GD  ++A         +  +P        + GI  G +P++++NY      R++    + ++  + F+ ++  V    P +     +  + +   +   I V TL+   L  Q+  + +L+  G++    +  +F  IV
  S:    10 DSVPLLVLKTSIPFMFAQFVNVLYSIVDRIYIGNIPGIGG-----DSLAGAGVCA-PIITLLS-----------------------------------SFAALIGIGGSVTFSVKLGAGDKKSAQRILANSFSMLLIFSAVLTVVFLLIKDFLL------NWFGASEVTFPY-----------ANTYLTIYTLGTFFALVSMGMNYFITAQGFPFLGMATTLIGAVVNIVLDPIFIFVFEMDIAGAAVATVIAQLSSCI----FVLLTLHSKKMQIPIHLV-------KPEWEIGKRICKIGFSPFLILATDSVIIIALNAVLQYYG-----GESQGDTLITAATIVQSYMLLITSP--------MLGITGGSQPLISFNYGANKPDRIRKTVKWVLVLCITFTTVMFLVSRILPQYFVQIFTDNARYRELSIWGIQVFTLMVIPLSLQYVFVDALTALGMTRLSLSLSLFRKIV 402
>gi|89896449|ref|YP_519936.1| hypothetical protein DSY3703 [Desulfitobacterium hafniense Y51] >gi|109647106|ref|ZP_01371010.1| MATE efflux family protein [Desulfitobacterium hafniense DCB-2] >gi|89335897|dbj|BAE85492.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109642352|gb|EAT51906.1| MATE efflux family protein [Desulfitobacterium hafniense DCB-2] (454 aa)
Score = 144, Expect = 5.6e-07, Identities = 89/389 (22%), Positives = 166/389 (42%)
  Q:   106 TSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV--FWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           T+V   + +I ++  + I  GA+ L S  L +Q K++ + I  ++    + L ++LT++ +     I    I K   +++EV+       H ++L +       ++GSI   M       F+RAEG   +     +I  + N+I    F     + I G  ++ +    V+ L    F+L Y F N+           L+  K   ++  + L++    F    ++ +AN +   +   TL       GD  +SA      I T+        IF  I GI  G +P++ +NY  + Y R+K      ++   + +++   V   WP  + G  S      A T   +H + + F  L    PL+ + I   S FQ+ GK   + + +L++
  S:    53 TTVAFPIMIINMATSMLIAIGATALISIRLGEQKKEEAEKIAGNATGLLILLPLLLTIVYL-----IFTDPILKLFGASAEVLPYARDFTHIIMLGS-------VSGSIAFGMN-----NFIRAEGNPRYAMLTQIIGAVLNVILNYTFIFKLGLGIKGSALASICSQTVSAL----FVLGYYFTNRSTIKI-----HLRNLKPQPSIVFSILVIGFAPF----AMQIANSIQQTILNKTLMVYG---GDIALSAVGIIMSISTI--------IFMPIVGISQGAQPLIGFNYGAKQYDRIKETLKKSVLFSTILAVVGYVVIRIWPYQIIGLFSKDDV--ALTQLTVHAMLVFFALL----PLIGIQILCSSYFQAVGKPLQSTLLNLSR 396
>gi|89894265|ref|YP_517752.1| hypothetical protein DSY1519 [Desulfitobacterium hafniense Y51] >gi|109649308|ref|ZP_01373196.1| MATE efflux family protein [Desulfitobacterium hafniense DCB-2] >gi|89333713|dbj|BAE83308.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109639484|gb|EAT49042.1| MATE efflux family protein [Desulfitobacterium hafniense DCB-2] (449 aa)
Score = 143, Expect = 6.1e-07, Identities = 71/296 (23%), Positives = 124/296 (41%)
  Q:   199 ILNAANKYMYFIT-GSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           +L  A +Y + I  G++P  +   +   F+RAEG         +I  + NI+   I+  +F   I G  ++ + G  V+ + V S  L            S    + K  +++ ++   ++ +    F    ++ +AN V   +   TL       GD  +SA G+  +         I  L+   I G+  G +PI+ YNY  QNY+RVK      ++ G   +      F  + LF  P V   F+ N  +   +        L   P++   I G S FQ+ GK   + + SL++
  S:   126 VLPYAKEYSHIIMMGAVPGALAFGM-NNFIRAEGNPRIAMLTQIIGAVINIVCNYIYIFIFDWGIQGSALATVTGQTVSAIWVLSHFLMGR---------SRIKLRAKYLRLDPSIVLKTITIGFAPF----AMQIANSVQQTLLNNTLREYG---GDIAISAVGIVMS---------ISMLLLMPIVGVSQGAQPIIGYNYGAQNYERVKETLKKAVLVGTAMAA---GGFVLLHLFAVP-VVGLFSKNDLALTELAVHASLVFLALMPIVGFQIIGSSYFQAVGKPIQSTILSLSR 393
>gi|73670928|ref|YP_306943.1| integral membrane protein [Methanosarcina barkeri str. Fusaro] >gi|72398090|gb|AAZ72363.1| integral membrane protein [Methanosarcina barkeri str. Fusaro] (485 aa)
Score = 143, Expect = 6.3e-07, Identities = 86/374 (22%), Positives = 158/374 (42%)
  Q:   132 SRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV-LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLI--FFFPILYS 505
           SR +  +DK    ++ V +F   L L++ LT L ++   +I E  +      T+E+   Y +V        A  +++F T         N+    LR+EG S     + ++ +  NI+ + IF  +  + I G  ++ +I +  + LL     +FY F  K D   SF F+  K +  I  ++F   +  S+  F    +  + N V           I+T     GV+       + +++  P        I GI   +  I    + ++N+K+ +    Y I  G     +I AV   ++LF       F +    + I   LT L   +   +P+++  +   SLFQ  GK    + A+L + L+    F +L++
  S:   107 SRRIGARDKAGADNVAVHAFVIMLILTVALTALGLA---FIKELFMYSGAGKTTELGVQYARVIF------AGSFIFFFT---------NIANSILRSEGDSKRAMRSMVLGSGLNIVLDPIFIYILGLGIAGAALATVISFASSGLL-----MFYWFFIKKDTYVSFRFRSFKFDKSIIRDIFRVGIPSSIEQFALALTALIMNFV-----------IATVGSTDGVAVYATAWRVTSIAVAP--------IIGISIAVVSISGAAFGEKNFKKAQNTLIYAIEVGFFVETIIAAV---VYLFAQDIAAVFTHTENAAHIAPELTRLLKIMTIFYPVITFGMLSGSLFQGAGKGTNALAATLLRSLVMTLLFSLLFA 439
>gi|168713697|ref|ZP_02745974.1| putative Na+ driven multidrug efflux pump [Clostridium difficile QCD-63q42] (467 aa)
Score = 143, Expect = 6.5e-07, Identities = 66/305 (21%), Positives = 124/305 (40%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IL  A+ Y    +  +P +++   +   + A+GR     F  LI  + N I   +F  +F M I G  ++ +IG  ++  +   +I  ++ +              K FK++  ++     L   +     ++ V  IV    + ++G  +   +    A V   +  N            +    I GI  G++PI+ YNY  + Y RVK  Y + + +  + S+    + +  F F    +TS F     +        F T LF   +  + I   + F S GK  L +  SL + ++F  P++
  S:   131 ILPYAHTYTKITSIGLPFLIMSTGMSKLILADGRPKASMFCMLIGAVINTILNPLFIFIFNMGIAGSALATVIGQLISFGISVHYIKNFQHIK----------LHKKSFKLDSIIYKHIFALGSSSCFNQLAMTVTQIVMNNTLAYYGARSVYGSEIPLACVGIIIKVN-----------MIFISIIIGISQGMQPIIGYNYGAEKYNRVKEAYKFAVGSATIISV----IAFLCFQFFPGQITSIFGNGNETYFIFAEHYFRTFLFLTFINGVQIVSSTFFTSIGKSVLGLFTSLTRQILFLIPLI 412
>gi|158320993|ref|YP_001513500.1| MATE efflux family protein [Alkaliphilus oremlandii OhILAs] >gi|158141192|gb|ABW19504.1| MATE efflux family protein [Alkaliphilus oremlandii OhILAs] (462 aa)
Score = 143, Expect = 7.4e-07, Identities = 85/392 (21%), Positives = 158/392 (40%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           + +I ++  + +  GA+ L S  L Q  K + + I  +S        +V+ +LIM++   I    + +   ++++V+         ++  A  + + F   +I            +RAEG       + LI  + N I + IF   FKM I G   + +I    + + V S  +       G     F  + L+ + KI +++F+      +         A+ N           + +    GD  +SA    N + T+        I   I+GI  G +PI+ +NY  + Y RVK  + Y        ++L+   F+ I +F    + S F     + I + T       F  P++   I   + FQ+ GK     + SL++ ++F  P L
  S:    59 IMIILMAFTMLVGLGATSLISIKLGQDRKDEAEKIMGNSM-----TLLVIIMLIMTVSGLIFLEPLLRIFGASADVMPYAKAYLRIILYGAVFQGIGFGINNI------------IRAEGNPKIAMLSMLIGAISNTILDPIFIYGFKMGIEGAAWATIISQAASAVWVVSHFI------SGRSNLKFRKENLRLQGKIIFDIFSIGFAPFMMQLAASLVTAILN-----------SQLGKFGGDIAISAMGIINSVSTI--------ILMPIFGINQGSQPIIGFNYGAKQYDRVKQTFRYAATAA---TILVVIGFFLIRIF-PVQLISLFAQGDQTLIDIGTNGIRIFFFAMPIIGFQIVSANYFQAVGKPKQAAILSLSRQVLFLIPAL 405
>gi|189465997|ref|ZP_03014782.1| hypothetical protein BACINT_02361 [Bacteroides intestinalis DSM 17393] >gi|189434261|gb|EDV03246.1| hypothetical protein BACINT_02361 [Bacteroides intestinalis DSM 17393] (453 aa)
Score = 143, Expect = 7.5e-07, Identities = 94/397 (23%), Positives = 156/397 (39%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSL-----ILSLGT--FLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           ++ +V  I  ++G F   G+    SR L  Q+    + +  + F+  LF+ I L V+ +   T +  A  +  T                 IL    KY+  I    P +    +L   +R +G + +     +   + N+I + I   VF M I G  ++ +I        + SF L      KG              +I +  FT SL     I+  GT    R    +VA I+        LN  + A GDA + AG++         T I   I   + G   G +P+  +NY    Y RV+  +++ +  G +F LL+ A+    F      + S F    P  I V           FPL S  +    + Q+  K     + S A+  +FF P+++
  S:    59 IVFSVMSIIQAVGFFFGHGSGNYISRKLGAQETGNAEKMAATGFFWALFMGIFLAVVGLIFLTPLSLALGSTPT-----------------ILPYTEKYLGIILLGAPFMTASLVLNNQIRFQGNAAYAMVGIVSGAVINVILDPILIFVFDMGISGAALATVISQ------ICSFSLLLYMGRKGG-----------NIRIRFKNFTPSLAFIKEIIGGGTPSLARQGLASVATIL--------LNVAAGAYGDAAI-AGMSIV-------TRIAMFINAFLIGFGQGFQPVCGFNYGAGLYARVRQGFWFCVKVGFIF-LLVCALAGMGF---AEEIVSLFRKGDPDVIAVGAAALRWQFITFPLGSWIVMSNMMLQTIRKPVKATIISSARQGLFFIPLIF 408
>gi|163941095|ref|YP_001645979.1| multi anti extrusion protein MatE [Bacillus weihenstephanensis KBAB4] >gi|163863292|gb|ABY44351.1| multi antimicrobial extrusion protein MatE [Bacillus weihenstephanensis KBAB4] (472 aa)
Score = 142, Expect = 7.7e-07, Identities = 89/394 (22%), Positives = 165/394 (41%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTP--SEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           TV +I   IG+ +  GA  + S  L +   ++ +SI   + +   FLS +L +L +  +  I+    A                     L  A +Y   +  S+P+ ++  +L      + +      + L+A +     E I  + + M ++G   +  I   + +LL+  F      +           K++ E  + W  F              AS +   ++++ + F T N + +  G   V+A        T+    I NL+  A  G + GL+PI++YNY   N  RVK     G+I  V F +++ A+   + +F  P + SFF+   P   ++ + T +    LF    +SL ISG   F+S  + +     S+++ L+F  P L+
  S:    77 TVMVITRMIGVLLGVGAGAVISLRLGKGKIEEARSIMGQTLWFTFFLSSLLAILGLVFENDIMILFGASDEA-----------------LPYAVQYSRLLWISLPLTILAVVLSILANIDEKPILSMNSWLVAAVVAGTMEWIMVVKYDMGMMGSSWANTISQSIPVLLIFYFWFGKTKLKPKMKDMMINLKKIGE--VVWTGF--------------ASFSSQFMMFIAIIF-TNNLLQSYGGGLHVAAF-------TIQNGYITNLLALAALGGMTGLQPIISYNYGAGNLDRVKQAIKMGLIFTVSFFVIVTAI---LVIFADP-IVSFFSGGNPELQKLGIWTTVVFNCLFTLSAVSLLISG--YFESQERNWSATFISVSKILLFMLPFLF 425
>gi|168182956|ref|ZP_02617620.1| MATE efflux family protein [Clostridium botulinum Bf] >gi|182673772|gb|EDT85733.1| MATE efflux family protein [Clostridium botulinum Bf] (455 aa)
Score = 142, Expect = 8.0e-07, Identities = 76/294 (25%), Positives = 127/294 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMI---LNLLIF----FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV--LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I  A+ +  Y+    I II+I    N L F     +RAEG         L+  + N+I + IF   F M I G  I+ +I      + V  +     F  K     +   K+ + FK+   +F   + + +  F   A    A+I+ VI    + NA+    GD  + A    N +          ++   I+GI  G +PI+ YNY  + YKRVK      I +    ++++   F  + +F    +  F N     EI +  L ++ C L    P++   I   + FQ+ GK  +++  SL
  S:   124 IFGASEQTFYYAKEYIVIILIGSITNALGFGLNNLIRAEGNPKMAMVTMLLGAVLNLILDPIFIFGFNMGIKGAAIATVISQTATTIWVLRY-----FTGKKS---TLKLKR-ENFKVEKTIFLEIISIGMAPF---ALQLAASIITVI----SNNALKNTGGDLAIGAMTVINSVSL--------MVLMPIFGINQGAQPIIGYNYGAEQYKRVKDTLKIAIFSA---TIVVTVGFSLVQIFPQYIIKIFNNDPKLMEIGISGLRIVLCML----PVIGFQIVSSNYFQAIGKAKVSVFLSL 395
>gi|196165319|ref|ZP_03125850.1| putative drug/sodium antiporter [Clostridium difficile QCD-23m63] (446 aa)
Score = 142, Expect = 8.4e-07, Identities = 71/306 (23%), Positives = 131/306 (42%)
  Q:   198 LILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVV---FSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
            IL A+   + +    + +I+   I NL+ F L    RAEG         ++  + N+I + IF  VF + I G  I+ ++   V    V  + +      +G          LK   +N ++      + +  F  + +I++ ++        T N++    GD  + A  A         T I  +    ++G+  G++ I++YNY  + Y+R K      II  VV   F  L+  VF  +F+         FN + P  +++        L   P++ +SI G   FQ   K+  ++  +L +  I F P++
  S:   123 FILGASKDSISYAKDYMSVILVGSIFNLVAFSLNNAIRAEGNPKLAARTMIVGCVLNLILDPIFIFVFNLGIKGAAIATVLCQIVVFFWVTHYFM------RGKSNLKLKICNLK---LNKDIVKKVFAIGMTPFAMEVAISITHMF-------TNNSLKVYGGDLAIGAMTAL--------TSILLMFMMPVFGLNQGMQTIISYNYGAKKYERAKKTLILSIIVSVVILSFGFLVVQVFPEVFV-------GIFNKD-PDLMNIAVRGININLITLPIMGISIVGPVYFQCISKVKHSMFLTLLRQFILFIPLI 406
>gi|162453672|ref|YP_001616039.1| hypothetical protein sce5396 [Sorangium cellulosum 'So ce 56'] >gi|161164254|emb|CAN95559.1| conserved hypothetical proteins [Sorangium cellulosum 'So ce 56'] (454 aa)
Score = 142, Expect = 8.6e-07, Identities = 85/377 (22%), Positives = 161/377 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV--FWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           S+I  V +   ++   + +G + + SRAL +QD +K      S+F      ++ +TVL       +V    A  +V+   +   Y ++   + L A        TG   I+          RA+G + + T   +I    NI+   +F LV +M + G  ++ + G   +  +   F  F +  N+     S+  K    FK +W +    + +   + ++ AS+++  IV       T N +    GD+ +S          VS   +Y+ +F  + GIV G++P++ YN+ ++  +RV+      +   VV+  L+  V    P  L    S  S   A   + + +L L        +PL  +++   + FQS G+
  S:    57 SIISPVQIALGAVATTVGAGGASVVSRALGEQDMEKASRTVASTFLIFWTAALAITVLGSVFIEPLVYLLGATDSVAPYAI--EYGRI---IFLGAIAG-----TGYSAIV----------RADGNAGYSTAMWIIPICVNIVLCWLFILVLQMGVSGAALATVCGQATSAGMGLHFFFFRK--NR-----SYRIKA-SYFKPDWPIIIEVVKIGTPSLIKSASVSLIAIV-------TNNLLRRIGGDSALSV------FAIVS--RLYSGLFAPLTGIVQGMQPLVGYNFGQKKLERVREAIRLSLGAAVVYGSLVCGVCLVMPAALIALLSRESAIIAEGQTALRLLAL-------SYPLTGVAMVTAASFQSVGR 385
>gi|116872391|ref|YP_849172.1| MATE family efflux protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741269|emb|CAK20391.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (453 aa)
Score = 142, Expect = 9.5e-07, Identities = 115/432 (26%), Positives = 191/432 (44%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      + ++IG     G     SR L +++  K K +     Y  L L I+  +L+     +++          T+  +++ N     LI +             P I+    L   +RAEG S       LI  L N++F+ +  L F  +++G  +SI +   V+++  A ++       K DY  S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   GD GV AG             +  L  F   G+  G+ P+LAYNY   N  R +    +   + + F +L+ + F  IF F    + S   +     +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V+LFT + NI I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTVLMAIGNMFGVGGGTYISRLLGKEEGIKAKQVSAFVLYGSLVLGILCAILL----GFLINPVTHFLGADTTSFLHTKNYTLALLICS-------------PFIIANFALEQVVRAEGASRVSMNGMLIGTLVNLVFDPLLILYFDFNVVGAAVSIGLASIVSLIYYAWYL-----EKKSDY-LSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGD-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYSSGNIARFEKAIRFTAFS-IGFIVLVISSFVFIFRFQVMHLFSDNQSVISLGVHIMIAMLISSLFS------GFTGLFTSTFQAIGKAVPATIMSVSQGIIFIPVIIIGQHYFGLMGVIWSLTATEILTCIIGVILFTIY-NIKIASSA 446
>gi|94992610|ref|YP_600709.1| Na+ driven multidrug efflux pump [Streptococcus pyogenes MGAS2096] >gi|94546118|gb|ABF36165.1| Na+ driven multidrug efflux pump [Streptococcus pyogenes MGAS2096] (472 aa)
Score = 142, Expect = 9.7e-07, Identities = 99/434 (22%), Positives = 182/434 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVR-HQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLN-IVASLAQGLIF-----FFPILYSMWNI--AILVSDYKVMLFTAFTNI------AISSIAIEITSSI 540
           SV+  +  + + +GL   +GA+   SR L Q++K +   +  ++ YS L +  ++ VL +     I+   +  +T S      +Y  +     I N  N  M  I  S                EG +     A L+  + NI  + +F   F   + G  I+  I   V+ L+     LFY F  K  +          +F+I    F+  ++  +        I V  +++ ++   +++ I+ A G+ G SA      +     T + ++    ++G + G +PI  Y+Y  + + R++      I+   +F +++  +F    LF    V+ F   NT   IH+ +         F L        SLF + GK     I+ S  QG+ F      FP ++ +  I  A  ++D    L T F  I       ++   ++IT+SI
  S:    66 SVVYPLGQVVVGLGLLFGNGAASYISRLLGQRNKDQANKVASTALYSSLVVGAIMIVLSIIFLKPILR--LLGATESVLPYATTYAGIYIISCIFNVFNVTMNNIVTS----------------EGAAKTTMCALLLGAVLNIGLDPLFIYTFNFGVAGAAIATAISQVVSTLVY----LFYIFRQKSAF----------QFRIKDCTFSKEILSEI------FKIGVPTLIFQLLTSISISLINNAAGNYGDSAIAGMGVV-----TRLISMGSLTVFGFIKGFQPIAGYSYGAKKFDRLRTAIKISILWSTIFCVIVGLLF---SLFSTTIVSQFTTGNT-EMIHIGSSSLRVNGITFMLFGYYTVYSSLFLALGKGKEGFILGSCRQGICFIPVILIFPFIWGLNGILYAQPIADVLSALITVFMAIPLHKSLTVAEQKMKITTSI 467
>gi|157962818|ref|YP_001502852.1| MATE efflux family protein [Shewanella pealeana ATCC 700345] >gi|157847818|gb|ABV88317.1| MATE efflux family protein [Shewanella pealeana ATCC 700345] (458 aa)
Score = 141, Expect = 1.0e-06, Identities = 84/366 (22%), Positives = 152/366 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSL-LINAVFWPIFLFGGPSVTSFFNAN-----TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           +  +IG  +  G + L S  L Q +    + I  ++F  CL   ++ TVL       I+    A+                   ILN+A+ Y+  YF  G+ PI+ +       LR +GR  F+TF  ++  + N + + +  +VF   ++G  I+ +I   V      +  L + F +K +   +     L++ K+ W+     + +   +FL +  + V   ++ + F               V   L       VS T  +  + F   GI  G++PIL++N   + + RVK          + FS+ L+ A    +F++  P +  +  A      TP  I  +   F  L    P+  L + G S FQ+
  S:    76 VLYAIGATLGMGGAALVSIHLGQGETSIARRILGNTFSLCLISGLITTVLGCYFSRDILMMLGAEGE-----------------ILNSADDYLFWYFALGTFPIVSMA--FTALLRNDGRPGFVTFVLILGGVLNTVLDWLLIVVFPYGLMGAAIATMISQAVT----GALCLQHFFSSKTEIGIN-----LEQMKLKWDHCANIIRVGTPSFLMNMYLTVVLTLHNVAFL-------------TVGTPLHVAAYGVVSYTEAFFYLLFE--GIAFGVQPILSFNAGAKRFDRVKQAL------KMAFSVTLVCAALGLVFIYSVPQLFVYIFAGDNDLLTPIAIEGMRWYFWGL----PMEGLLLVGASFFQA 396
>gi|166030689|ref|ZP_02233518.1| hypothetical protein DORFOR_00363 [Dorea formicigenerans ATCC 27755] >gi|166029481|gb|EDR48238.1| hypothetical protein DORFOR_00363 [Dorea formicigenerans ATCC 27755] (454 aa)
Score = 141, Expect = 1.2e-06, Identities = 85/406 (20%), Positives = 165/406 (40%)
  Q:    19 TESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLT-VLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           TE I KL L++ +P+L   L+  +Y  VD+I + HI  V  +     AL   G+    I+                                    I  +  + + +G +   S  + Q +K+  +    + F + + ++IVLT VL++  +T+++    +++T+S                  AA     +  G+I + + L L  F + A+G +     + LI  + NI+ + IF     M + G  ++ +I    + + V SF+   +         +F   Q K  K+   +   SL L L TF+  AS ++  + +        +++    GD  V A      +   +  P+         G+  G +PIL+YNY  +N  RV+  +   +   V +++++
  S:    10 TEPIGKLLLRLAIPTLAAQLINMLYNVVDRIYIGHIPKVGAL-----ALTGVGVCMPLIM------------------------------------IVSAFAVLVGNGGAPRASIYMGQNNKEDAEKTLGNCFATQILVAIVLTIVLLLGNRTFLLAFGASENTISY-----------------AAAYMNIYAVGTIFVQLTLGLNAF-ITAQGFAKTGMLSVLIGAVINIVLDPIFIFGLHMGVRGAALATIISQACSCIWVVSFLFGKK---------TFLKIQRKNMKLEARIILPSLALGLATFIMQASESIITVCFN-------SSLLKYGGDIAVGAMTILTSVMQFAMLPLQ--------GLGQGAQPILSYNYGAKNVDRVRGTFRLLLKVSVGYAVIL 333
>gi|150403639|ref|YP_001330933.1| MATE efflux family protein [Methanococcus maripaludis C7] >gi|150034669|gb|ABR66782.1| MATE efflux family protein [Methanococcus maripaludis C7] (447 aa)
Score = 141, Expect = 1.2e-06, Identities = 72/300 (24%), Positives = 130/300 (43%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV 406
           ++I    +I ++ G+    G S L SR L + D    +    +S  S L LS+++T++ +     I+      + + TS  V  Y +  +++IL       Y I  +       NL+    RAEG +    FA ++  + N+I + +F +VF M I G  I+ ++   + ++    +IL ++F       ++     + +F IN  +   ++      F+  +  A   I  V+V  G  N +    GD  ++       I          L+   + GIV GL+PI+ YNY K    RV
  S:    55 ALIFPFQMIIMAFGVTFGIGGSSLLSRKLGEGDLDSARKAGGNSISSVLILSVLITIIGIVFMVPIL------NILGTSAEVFPYAKDYYEIILYGTIFNSYLIAAN-------NLV----RAEGMAKVAMFAMVVPAIINMILDALFIMVFNMGIKGAAIATVLSQIIGVI----YILKHQFGKNTSIKYA-----MNDFLINLKILKETV------FIGSSEFAKLIISSVLVIVGN-NLLGIYGGDIAIAIYGVIMRIAM--------LLLMPVLGIVQGLQPIVGYNYGKGQLNRV 313
>gi|150403089|ref|YP_001330383.1| MATE efflux family protein [Methanococcus maripaludis C7] >gi|150034119|gb|ABR66232.1| MATE efflux family protein [Methanococcus maripaludis C7] (460 aa)
Score = 140, Expect = 1.4e-06, Identities = 69/307 (22%), Positives = 134/307 (43%)
  Q:   198 LILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQF-PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           + +  A +Y   + G   +++  N+    LR EG +    +A ++ ++ NI+ + IF  V  M I G   + L+   +  LL     +++ FV K     +F     K+FK+N N+     I S+G        +V+ +      F     ++ A G+ G++    F+    +  T +  ++ FA      G+  +    Y   N +++++ Y Y I  G++  L++ A+   I LF       F  + T   I    L+F   +F F P + L++   ++FQ   K   ++  S  + +I   P+ Y
  S:   128 ITVTMAVEYSTILFGGAVVLLFTNIANAILRGEGDTKRAMYAIILGSVLNIVLDPIFIYVLNMGIAGAAWATLLSMLITSLL----FVYWLFVKKD----TFVNIHFKDFKMNLNIIKE--IFSIGI-----PASVSQLTMAFSMFLLTAIVAKAGGNDGIA---VFSTGWRIVSTGVIPMVGFAA-----GVTAVTGAAYGSANPEKLEISYKYAIKMGILIELVVAAL---ILLFENQIAYLFTYSETSVHILGDLLVFLKYMFVFYPTMPLAVLTAAMFQGVSKGKNSLFISFLRTIILQVPMAY 409
>gi|168185714|ref|ZP_02620349.1| mate efflux family protein [Clostridium botulinum C str. Eklund] >gi|169296255|gb|EDS78388.1| mate efflux family protein [Clostridium botulinum C str. Eklund] (455 aa)
Score = 140, Expect = 1.4e-06, Identities = 79/305 (25%), Positives = 136/305 (44%)
  Q:   199 ILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTF-LRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +  A+   +Y+    I II+   I N+L F L    RA+G      F  ++  L NII + +F  VF + I G  ++ +I   ++ +    +I++Y    KG+        + + FK++  +      + +  F ++ AS AV  I        T N +    GD  + A      I  V   P        I+GI  G +PI+ YNY  + Y R+K      II   +  ++ + +   I  F   ++  F   +   EI V  +   T L   P++ +SI G + +QS GK    +  SL + +I F P++
  S:   124 VFGASENTLYYAKEYINIILFGAIFNILNFALNSTIRADGSPKMAAFTMILGCLVNIILDAVFIFVFNLGIKGAALATVIAQIISTI----WIIYY--YTKGNSNLKL---KKENFKLDGQLVKIIFTIGVAPFSMQIASSAVQVI--------TNNTLKLYGGDLAIGAMAVILSIAMVFLMP--------IFGINQGSQPIIGYNYGAKKYHRMKETVKLSIIAATIILIIGSVL---IQCFPEAAIKVFNKDDKLLEIGVKGIR--TFLIMMPVIGISIIGSNYYQSVGKAKTAMFLSLLRQVILFIPLM 406
>gi|134046535|ref|YP_001098020.1| MATE efflux family protein [Methanococcus maripaludis C5] >gi|132664160|gb|ABO35806.1| MATE efflux family protein [Methanococcus maripaludis C5] (460 aa)
Score = 140, Expect = 1.5e-06, Identities = 67/302 (22%), Positives = 136/302 (45%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVL--TLLFCTLLFQF-PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           A +Y   + G   I++  N+    LR EG +    +A ++ ++ NI+ + IF  V  M I G   + LI      +L+ S +  Y    K D   +F     K+FK+N N+     I S+G     + + +A  ++++        ++ A G+ G++           +G  I ++    + G   G+  +    Y   N +++++ Y Y I  G++  L++  +   I LF   +  ++    + S +H+L   L+F   +F F P + L++   ++FQ   +   ++  S  + +I   P+ Y
  S:   133 AVEYSTILFGGAVILLFTNIANAILRGEGDTKRAMYAIILGSVLNIVLDPIFIYVLNMGIAGAAWATLIS-----MLITSLLFVYWLFIKKD---TFVNIHFKDFKMNLNIIKE--IFSIGIPASVSQLTMATSMFLLTAI-----VAKAGGNNGIAV--------FSTGWRIVSMGIIPMVGFATGVTAVTGAAYGSANPEKLEISYKYAIKMGILIELVVAVL---ILLF--ENQIAYLFTYSESSVHILGDLLVFLKYMFVFYPTMPLAVLTSAMFQGVSRGKNSLFISFLRTIILQVPMAY 409
>gi|167747306|ref|ZP_02419433.1| hypothetical protein ANACAC_02020 [Anaerostipes caccae DSM 14662] >gi|167653284|gb|EDR97413.1| hypothetical protein ANACAC_02020 [Anaerostipes caccae DSM 14662] (454 aa)
Score = 140, Expect = 1.5e-06, Identities = 87/401 (21%), Positives = 168/401 (41%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPII--MILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKG--DYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           V   S+   V ++ +++G     G     SR L + + +K K I    FY  +   +++ ++ +     I++  +   + +T E   SY                Y   GS+ ++  M  N ++   R EG +       +I  + NI+ + +  L   M + G  I+ +IG   NI  V  ++ F+  +  G    P  F  K+    +I   VF   +  S+   L    ++ ANI+        LN    + GD  V+A G+A              L+     G+  G+ P++ Y Y   N +++K    + +   V+   +++ ++    LF  P + +F N  +     V  L    L+   P++ +    +  FQ+ GK   +++ SL++  + FFP+L
  S:    49 VAAVSLTTPVFMLLMAVGNIFGIGGCSYISRMLGEGETEKVKKISSFCFYGSIIAGVIMMIVFLGGMPVILK--LIGCSPNTEEYARSY--------------LTYIGLGSVFVVISMAFNNVV---RGEGAAKISMIGMMIGTIVNIVLDPVMILGMNMGVAGAAIATIIG---NICTVVFYLFFFAKMKTGLSISPKHFTAKE----RILSGVFAIGIPASINNIL----MSTANII--------LNNFLASYGDIPVAAMGVAMKANM---------LVILVQIGLGSGVAPLIGYCYGSGNLEKMKKTMKFSMACNVIMGTVLSLLY---LLFTEPIIQAFINDGSVVAHGVRMLR--VLMISGPVIGIMFVFMFGFQAMGKAIPSLILSLSRQGLVFFPVL 402
>gi|166032487|ref|ZP_02235316.1| hypothetical protein DORFOR_02202 [Dorea formicigenerans ATCC 27755] >gi|166026844|gb|EDR45601.1| hypothetical protein DORFOR_02202 [Dorea formicigenerans ATCC 27755] (455 aa)
Score = 140, Expect = 1.5e-06, Identities = 85/396 (21%), Positives = 172/396 (43%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVF----KMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           +++  V ++ +++G+    G + L +R L Q + +K   +  +S    LFL +++ V+ +    + V+A I+  TV    +    + +R   +++               I+  +L    L+A GRS + T   ++  + NII + I         +M + G   + +IG       VAS +L   F  K +  F    K +K    +  +      + L   +  A +++  +VYV      +N I      A  + GL +          +   + F  +G+ D + PI+A+ Y  ++ KR++    YG+I  V+  +++  V   IF  G     + FNA    E  +  +   ++ F F  ++++  G  ++Q+      ++V SL + LI   P+
  S:    56 TLVFPVQMLMVAVGIGTGVGTNALLARTLGQGNSKKAAKVAGNS----LFLGVIIYVVCLLFGIFGVKAYISSQTVDAEVLEMGVSYLRICCVISFG-------------IIFFSLFEKLLQATGRSLYSTIGQVVGAVVNIILDPIMIYGIGPCPEMGVKGAAYATVIGQ------VASAVLLLIFHIKLNKEFEHGAKYMKP---DGGIIKEIYTIGLPAIIAQALMSI--MVYV------MNLILKFNPSAQTAYGLFYK---------VQQFVLFLAFGLRDAITPIIAFAYGMRSKKRIQDGIKYGLIYTVIL-MILGIVITEIFPGG---FATLFNAGPSREYFIGAMRIISVSFLFAGINIAYQG--IYQALNGGVESLVISLLRQLIIILPL 406
>gi|167766095|ref|ZP_02438148.1| hypothetical protein CLOSS21_00588 [Clostridium sp. SS2/1] >gi|167712175|gb|EDS22754.1| hypothetical protein CLOSS21_00588 [Clostridium sp. SS2/1] (455 aa)
Score = 139, Expect = 1.8e-06, Identities = 96/401 (23%), Positives = 168/401 (41%)
  Q:   106 TSVIGTVNLIF---ISIGLFIN---SGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGT--FLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           T+ +G V L F   + I  F N   SG + LFS +  Q+  ++   I  +SF    F + VL    M I        +     S   +V ++  +            M ++ G++P ++ + +  F + A+G S    F+  I  + N++ +  F  V    + G  I+ +I       L ASF+LF+    K +    F  K     +++ ++     I+SLGT  F+   +  + +IV         N +S   GD  +S     + ++ +  TPIY         + +G  PIL+YNY  +   RV+      +I      L   AV W I +F   ++   F+++ PS +             F  + L   G ++F+S  K    I  SL + +    P+ Y M
  S:    48 TAALGAVGLCFPLVVIITAFANLFGSGGAPLFSISRGQKRNKQAVHIMNTSFTMVCFSAAVL----MIIGLLFAHPLLVLFGASKDALVYAFPYM------------MIYLIGTLPSMIAIGMNPF-INAQGYSTIGMFSVAIGAVANLLLDPFFIFVLGFGVRGAAIATVISQ----CLSASFVLFF-LTKKAELKVRFLHKN----ELSESLGYAKNIISLGTAGFIMQLTNGLVSIV-------CNNVLSVTGGDIYISVMTIVSSVRQLVETPIY--------AMNEGGSPILSYNYGARRPARVR----KAMIVMSAMILCYTAVMWSIIIFAPGTLIRVFSSD-PSLVKDSIPALNQYFAAFIFMDLQYIGQTVFKSLNKKKHAIFFSLLRKVFIVIPLTYFM 410
>gi|134045914|ref|YP_001097400.1| MATE efflux family protein [Methanococcus maripaludis C5] >gi|132663539|gb|ABO35185.1| MATE efflux family protein [Methanococcus maripaludis C5] (447 aa)
Score = 139, Expect = 1.9e-06, Identities = 89/397 (22%), Positives = 167/397 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL---SLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           ++I    +I ++ G+    G S L SR L + D    +    +S  S L LS+++T++ +     I+      + + TS  +  Y +  +++IL       Y +  +       NL+    RAEG +    FA ++  + NII + I  +VF M I G  I+ ++   + ++    +IL ++F       ++     + +F IN  +   ++ +    F   A + +++I+ ++      N +    GD  ++       I  +        +   + GIV GL+PI+ YNY K    RV       ++      LL    F  + +F    +  F    T  E+    +    + F F  L    ++I G  L+QS GK     + S A+  +F  P L
  S:    55 ALIFPFQMIIMAFGVTFGIGGSSLLSRKLGEGDLDSARKAGGNSISSVLILSVLITIIGIIFMVPIL------NILGTSADIFPYAKDYYEIILYGTVFNSYLVAAN-------NLV----RAEGMAKVAMFAMVVPAIINIILDPILIIVFNMGISGAAIATVLSQIIGVI----YILKHQFGKNTSIKYA-----MNDFFINIKILKETVFIGASEF---AKLIISSILLIV----GNNLLGIYGGDIAIAIYGVIMRIAMI--------LLMPVLGIVQGLQPIVGYNYGKGQLNRVSESIKLALVGTTGLCLL---GFTLVMIFPEMFIQIFI---TDPEVISQGVFATRIFFMFSFLIGAQMTIGG--LYQSLGKAKPAFIISCARQTLFLMPAL 405
>gi|83856154|ref|ZP_00949683.1| C-5 cytosine-specific DNA methylase:Multi antimicrobial extrusion (MatE) protein [Croceibacter atlanticus HTCC2559] >gi|83849954|gb|EAP87822.1| C-5 cytosine-specific DNA methylase:Multi antimicrobial extrusion (MatE) protein [Croceibacter atlanticus HTCC2559] (455 aa)
Score = 139, Expect = 2.0e-06, Identities = 84/402 (20%), Positives = 168/402 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY---GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFN-----ANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWN 508
           +V+  V+    ++G+ I  G S + SRAL   +K++    + +     L L++ + +L +     ++ A   K                   I   A  Y   +   +PI+ +  +    +RAEG+  F   A +I ++ N++ + +F  +  M + G G++  + Y    +L  ++IL++      +   S     L +F +N  +      L   T  R A +++  ++   + F           D G  + +A   I       I  ++ FA++   G+  G  PI  YNY    + RV+      I+   V  L    VF  I +F    V+ F +      +TP+ + +       +    P++ + + G + FQ+ GK    ++ +L +   FF P++  + N
  S:    56 NVVLPVSFFIAALGMAIGIGGSSIISRALGANNKKRALKTFGNQITVTLLLTVSMVILGLVFINDLIPAFGGKGD-----------------IFEPAKIYYKIVLYGVPILALSMMGNNVIRAEGKPKFAMIAMIIPSVGNLVLDYVFINLLDMGMYGAGLATTVSY----VLCFAYILYFFLSKHSELRIS-----LSDFGLNMPILKEMSALGFVTLARQAVVSITYLLMNNILF-----------DLGGESSVAVYAI-------IGRMLMFALFPVLGVTQGFLPIAGYNYGAYKFPRVRESINKAILYAGVLGLF---VFAFIMIFPTEIVSVFTDDERVLTDTPTAMRI-------VFMAVPIIGIQLIGSAYFQAIGKAIPALLLTLTRQGFFFIPLVLILPN 411
>gi|20090692|ref|NP_616767.1| hypothetical protein MA1842 [Methanosarcina acetivorans C2A] >gi|19915743|gb|AAM05247.1| conserved hypothetical protein [Methanosarcina acetivorans C2A] (452 aa)
Score = 139, Expect = 2.1e-06, Identities = 85/383 (22%), Positives = 162/383 (42%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           ++++ + I + +  G S + SRAL  ++  + +    + F+  +FL +  +++ +S    +++   A                    I+  A  Y+  I     +  +       +RAEG + +  F  L+    NI+ + +F     M + G  ++ ++    + +    F+L Y    KG   F   F  + +  I+  V    + + +G F+ +AS +V     +++F    NA++T  GD  ++A   F  I  +       LIF  + GI  GL+PI+ YNY  + + RV       +    +FSL     F  +FLF  P +  F  +  P      TL    ++   P +   + G ++FQ+ GK       SLA+
  S:    51 IHMLAMGIAIGLGVGGSSIVSRALGSKELHRAEKALGTVFFLGVFLGLAYSLIGLSFIEPLLKLFGATPG-----------------IMPYARSYLEIIMAGSVVFTLGIAAEDLVRAEGNARYAMFGMLLGAGLNIVLDPVFIFGLDMGVRGAAVATVLAQLASTV----FLLRYFLAGKGSVAFKPGF-LVPDSAISKEV----VAIGIGPFIVEASNSV-----MMIFVN--NALATYGGDVSIAA---FGIIHRLLL-----LIFLPMLGISFGLQPIVGYNYGAKQFSRVIESVKVALKVSTLFSL---PGFLVMFLFPAPIIHIF--SPDPELTAAGTLAMRIVVLILPFIGFQLVGTTVFQALGKPKPAFFLSLAR 387
>gi|150386096|ref|ZP_01924674.1| MATE efflux family protein [Victivallis vadensis ATCC BAA-548] >gi|150257520|gb|EDM94871.1| MATE efflux family protein [Victivallis vadensis ATCC BAA-548] (474 aa)
Score = 138, Expect = 2.4e-06, Identities = 95/465 (20%), Positives = 180/465 (38%)
  Q:    19 TESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTV---STSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAI--STAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           T+SI KL L+  +PSL  +L+F +Y  VD++                  +S  L  D I  V                           +   + +IFI++G+    G   L S  L ++DK+  + I           ++++  L+    T ++     K  +     SE    Y     +++L       +F+      +   N++    RAEG   F  +   +  + N++ + IF + +   I G   +  I    + LL     +F+ F      PF +   + +  +I+W+       + L   +  +  +V            LNA+  +T   + G  A  +   I T     I  LI    +G++ G +PI+ YNY  + ++RV        +   + +L +   + P+ +F  P+V  +F  + P  + +           FPL  +   G + FQ+TG+
  S:    15 TQSILKLLLRFSIPSLISNLMFTVYNVVDRLF-----------------ISWKLGTDAIAGV--------------------------GITFYLFMIFIAVGMMFGIGGGTLVSLKLGEKDKESAERI---------LGNVIMIFLVGGALTTLLGFLFLKPLLYCFGASEATYPYAAEYFRILL-------WFMAADFLSMGTTNII----RAEGSPNFSMWYIAVGCIANVVLDYIFIMEWNWGIAGAAWATGISKVFSTLL-----MFWHFSVG---PFRYLTLRRRNLRIDWHYLCAMSAIGLSPLILQSINSV------------LNALINTTLLRNGGDKAVASMTCIST-----IIMLIMIPTFGVMMGYQPIVGYNYGAEQFRRVAQTLKGAFLMSEIMTLFL---YIPVMIF-APAVVGWFCNSDPDVVPMAAHGLRVFFLLFPLWPIFCIGSNFFQATGR 392
>gi|47096322|ref|ZP_00233918.1| MATE efflux family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153179099|ref|ZP_01932340.1| hypothetical protein LMMG_02283 [Listeria monocytogenes F6900] >gi|153185835|ref|ZP_01936329.1| hypothetical protein LMOG_02276 [Listeria monocytogenes J0161] >gi|153190395|ref|ZP_01937797.1| hypothetical protein LMPG_01987 [Listeria monocytogenes J2818] >gi|47015280|gb|EAL06217.1| MATE efflux family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126941561|gb|EBA19445.1| hypothetical protein LMOG_02276 [Listeria monocytogenes J0161] >gi|127766081|gb|EBA26424.1| hypothetical protein LMPG_01987 [Listeria monocytogenes J2818] >gi|133733254|gb|EBA34952.1| hypothetical protein LMMG_02283 [Listeria monocytogenes F6900] (453 aa)
Score = 138, Expect = 2.4e-06, Identities = 117/432 (27%), Positives = 189/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      I ++IG     G     SR L +++  K K +     Y  L L I+  +L+  +   +     A +T                  L+  N  +  +  S P I+    L   +RAEG S       LI  + N++F+ +  L F  +++G  +S+ +    +++  A ++       K DY  S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K + +  I  G++  LL + VF  IF F    + S   +     +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   NI I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEEGTKAKQVSAFVLYGSLVLGIICAILLGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRAEGASRVSMNGMLIGTVVNLVFDPLLILYFDFNVVGAAVSVGLASLFSLIYYAWYL-----EKKSDY-LSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRFTAISIGLIVLLLSSLVF--IFRFQVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNIKIASSA 446
>gi|52786552|ref|YP_092381.1| hypothetical protein BLi02817 [Bacillus licheniformis ATCC 14580] >gi|52349054|gb|AAU41688.1| putative protein [Bacillus licheniformis DSM 13] (451 aa)
Score = 138, Expect = 2.4e-06, Identities = 88/399 (22%), Positives = 171/399 (42%)
  Q:   106 TSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           T+ +  VNL      + ++I L+I  G +  +S ++ +   +K  SI+  + +  L +S++L V  I++IQT  +      +   TS  V  Y  V              F+ G +  I +  +L  F+R +G       A    ++ NII      ++  M + G  IS ++G F  +L     +L   F N+       A  +   F+ +W        +   +FL +A + V    Y +       A+++  G  GV+A    N         ++  +F + +GI   L+P+++Y +  +  +++K     G  T V+  +L+  + W       P +   F   + +EI  L +    L F  +  L  +   +S FQS G+   ++V  + +  +  F +L+
  S:    49 TAALAGVNLSYPVISLIMAIALWIGIGGATKYSISIGENRPKKASSIFSLALFLALIISVLLGVFGILNIQTISI---WLGANSDTSSFVIEYLSV-------------MFLFGWV--ITLEQVLSIFVRNDGSPKLSMMALATTSIVNIILNFYTIMILDMGVTGAAISTVLGGFAGLL-----VLSLHFFNRQ------AQLRRPAFQWSWKSLMHIFAIGFPSFLAEAGLLVFVTGYNL-------AMASLAGTEGVAAFSVIN--------YLHGFMFLSFFGIEMALQPMISYYHGAEETEQIKSSMKIGEKTAVILGILLLVIGWG----AAPFLVGLFGIES-TEIQQLAIDGIRLFFIGYTFLGYNFVYMSYFQSIGRAGSSVVIIILRSFVSLFILLW 406
>gi|52081169|ref|YP_079960.1| multi anti extrusion protein MatE [Bacillus licheniformis ATCC 14580] >gi|52004380|gb|AAU24322.1| Multi antimicrobial extrusion protein MatE [Bacillus licheniformis ATCC 14580] (450 aa)
Score = 138, Expect = 2.4e-06, Identities = 88/399 (22%), Positives = 171/399 (42%)
  Q:   106 TSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           T+ +  VNL      + ++I L+I  G +  +S ++ +   +K  SI+  + +  L +S++L V  I++IQT  +      +   TS  V  Y  V              F+ G +  I +  +L  F+R +G       A    ++ NII      ++  M + G  IS ++G F  +L     +L   F N+       A  +   F+ +W        +   +FL +A + V    Y +       A+++  G  GV+A    N         ++  +F + +GI   L+P+++Y +  +  +++K     G  T V+  +L+  + W       P +   F   + +EI  L +    L F  +  L  +   +S FQS G+   ++V  + +  +  F +L+
  S:    48 TAALAGVNLSYPVISLIMAIALWIGIGGATKYSISIGENRPKKASSIFSLALFLALIISVLLGVFGILNIQTISI---WLGANSDTSSFVIEYLSV-------------MFLFGWV--ITLEQVLSIFVRNDGSPKLSMMALATTSIVNIILNFYTIMILDMGVTGAAISTVLGGFAGLL-----VLSLHFFNRQ------AQLRRPAFQWSWKSLMHIFAIGFPSFLAEAGLLVFVTGYNL-------AMASLAGTEGVAAFSVIN--------YLHGFMFLSFFGIEMALQPMISYYHGAEETEQIKSSMKIGEKTAVILGILLLVIGWG----AAPFLVGLFGIES-TEIQQLAIDGIRLFFIGYTFLGYNFVYMSYFQSIGRAGSSVVIIILRSFVSLFILLW 405
>gi|154482430|ref|ZP_02024878.1| hypothetical protein EUBVEN_00097 [Eubacterium ventriosum ATCC 27560] >gi|149736707|gb|EDM52593.1| hypothetical protein EUBVEN_00097 [Eubacterium ventriosum ATCC 27560] (457 aa)
Score = 138, Expect = 2.6e-06, Identities = 84/393 (21%), Positives = 154/393 (39%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSL----------FQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           +I  +    I+SG +   S  + +QD +  + I  + F   + +SIVLTV+++     ++ A  A                     L  A  YM         + +   +  F+ A+G +     + LI  + NI  + +F  VF M + G  ++ ++   ++ + V  F+       K        +  LK       +F   + L L TF+  AS +V  + +        +++    GD  V A      +   +  P+         GI  G +PI +YNY  +N  RVK  +   +IT + +S L+    W           S F ++              + F  P+L + + GL L          F S GK   +I+ ++ +  +   P++Y M
  S:    64 MIVTAFAALISSGGAPRASICMGKQDNKSAEQILGNCFSLQIVVSIVLTVVLLIWNKDLLMAFGASKNT-----------------LGYATDYMRIYALGTLFVQLTLGMNAFITAQGFTTTSMVSVLIGAICNITLDPVFIFVFNMGVKGAALATVLSQAISTIWVVVFL----SGKKTQLHLRKKYMGLKP-----KIFLPCVALGLATFIMQASESVVTVCFN-------SSLLHYGGDIAVGAMTILTSVMQFAMLPLQ--------GIAQGSQPIASYNYGAKNADRVKKTFRLLVITCLTYSTLL----WAAVQIIPKVFVSIFTSDAK-----------LVAFTAPMLKIYLGGLFLFGIQIACQITFTSLGKAVNSIIVAVVRKFVLLLPLIYIM 410
>gi|167767221|ref|ZP_02439274.1| hypothetical protein CLOSS21_01740 [Clostridium sp. SS2/1] >gi|167711196|gb|EDS21775.1| hypothetical protein CLOSS21_01740 [Clostridium sp. SS2/1] (461 aa)
Score = 138, Expect = 2.7e-06, Identities = 99/445 (22%), Positives = 179/445 (40%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVR-HQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           SV+  +  + + +GL   +GA+   SR L + DK+K   +  ++ YS +F+  V+ +L +     I+   I  +T S      +Y  +     I N  N  M  I  S                EG +     A LI  + NI  + IF  V  + + G  I+  I   V+ L+     LFY F  K  + F     ++K + ++  V   S I  +G         +  +V+ I+   +++ I+ A  D G +A      +     T + ++    I+G + G +PI  Y+Y  + + R+    Y  I T +++S +   V+  I      S+ S F +     I V             L        SLF + GK     +    +  I F P++     +  ++     +L+       +S+I I +  +I+LH  + + EK
  S:    57 SVVYPLGQVVVGLGLLFGNGAASYISRLLGRNDKEKANQVVSTALYSSVFVGAVMIILSVIFLKPILS--ILGATESILPYAVTYGSIYIISCIFNVFNVTMNNIVTS----------------EGAAKTTMCALLIGAVLNIALDPIFIYVLDLGVAGAAIATAISQVVSTLVY----LFYIFGKKSVFDF-----KIKNYCLSKEV--ASEIFKIG---------IPTLVFQILTSLSISLINNAAADYGDAAIAGMGVV-----TRLVSMGSLTIFGFIKGFQPIAGYSYGAKKFNRL----YEAIKTSIIWSTIFCVVYGLILALFSTSIVSQFASGNLEMIKVGASSLRVNGISLMLFGFYTVYSSLFLALGKGKEGFILGACRQGICFVPVIL----VLPMIWGLNGILYAQPVADVLSAI-ITVFMAIHLHRELNEAEK 450
>gi|126700826|ref|YP_001089723.1| putative Na+ driven multidrug efflux pump [Clostridium difficile 630] >gi|115252263|emb|CAJ70104.1| putative Na+ driven multidrug efflux pump [Clostridium difficile 630] (459 aa)
Score = 138, Expect = 2.7e-06, Identities = 66/305 (21%), Positives = 123/305 (40%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IL  A+ Y    +  +P +++   +   + A+GR     F  LI  + N I   +F  VF M I G  ++ +IG  ++  +   +I  ++ +              K FK++  ++     L   +     ++ V  IV    + ++G  +   +    A V   +  N            +    I GI  G++PI+ YNY  + Y RVK  Y + + +  + S+    + +  F      +TS F     +        F T LF   +  + I   + F S GK  L +  SL + ++F  P++
  S:   123 ILPYAHTYTKITSIGLPFLIMSTGMSKLILADGRPKASMFCMLIGAVINTILNPLFIFVFNMGIAGSALATVIGQLISFGISVHYIKNFQHIK----------LHKKSFKLDSIIYKHIFALGSSSCFNQLAMTVTQIVMNNTLAYYGARSVYGSEIPLACVGIIIKVN-----------MIFISIIIGISQGMQPIIGYNYGAEKYNRVKEAYKFAVGSATIISV----IAFLCFQLFPRQITSIFGNGNETYFIFAEHYFRTFLFLTFINGVQIVSSTFFTSIGKSVLGLFTSLTRQILFLIPLI 404
>gi|75764092|ref|ZP_00743687.1| Na+ driven multidrug efflux pump [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74488422|gb|EAO52043.1| Na+ driven multidrug efflux pump [Bacillus thuringiensis serovar israelensis ATCC 35646] (352 aa)
Score = 137, Expect = 3.0e-06, Identities = 61/306 (19%), Positives = 136/306 (44%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVF 420
           IF SI L+I  G + L+S AL +  +++ +SI+  S    + +++V+  ++ +I  + +E               +Y    +++IL  A  Y++ +     I ++ N+L  F+R +G         ++  + NI+F+ IF  +F   + G   + ++   +  L     +L   F  K       +  +  +F  +W+     +++   +F  ++++A+  I + I F           G+ GV++    N I  ++      L+ F  +G+   L+PI +++Y     +R++    + +   VV 
  S:    62 IFFSISLWIGMGGATLYSIALGENKRERARSIFTQS----MTVAVVIVGVLAAICLWRIEDL-------------AYLFGANEVILPYALDYLHVLLTFGMIYVLENILSTFIRNDGNPNLAMAGLVVTAVLNIVFDYIFIFIFGWGVTGAASATILSAAIGFL-----VLLTHFFRKS------SILKWTKFHFDWDTVKQIMVIGFPSFTAESTVAIVTIGFNIAFV-------QYAGEVGVASYAMVNSIHAMT------LLLF--FGVGAALQPIASFHYGANLSERLREGLKFAVKIAVVL 324
>gi|163726598|ref|ZP_02134108.1| MATE efflux family protein [Desulfatibacillum alkenivorans AK-01] >gi|161400066|gb|EDQ24324.1| MATE efflux family protein [Desulfatibacillum alkenivorans AK-01] (454 aa)
Score = 137, Expect = 3.5e-06, Identities = 66/291 (22%), Positives = 129/291 (44%)
  Q:   216 IIMILNLLIFF-------LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKI-NWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IIM+   L+ F       +RAEG +       +   + N I + IF  V KM I G   + +   F++ ++    +L Y    + + P    + +LK F I       +S  + +G     ASI VA + + + ++          GD GV+  G+ F          + + I   + G+  GL+P++ +NY  ++Y RV+     G++     +    + F  IFLF    V+ F  +  P  +   +      +   P++   + G + FQ+ GK    ++ +L + ++   P++ ++
  S:   142 IIMLAGPLMTFAMTANNAVRAEGAAKMAMLTMMSGAVLNTILDPIFIYVLKMGIRGAAWATVASMFLSTVM----LLLYFKSGRSEIPLGARYMRLKFFIIREIAAVGSSAFVRVGA----ASITVAILNHTLSYY---------EGDVGVATFGIIFR---------VLSFILMPVMGLSMGLQPVVGFNYGARSYSRVREAVKLGVMAATTVAA---SGFLVIFLFPEAIVSVF--SKDPLLMEYASNAIRLSMLALPVVGCHVVGTAFFQAIGKAAPALMLTLCRQVLVVMPLILTI 410
>gi|157376465|ref|YP_001475065.1| multi anti extrusion protein MatE [Shewanella sediminis HAW-EB3] >gi|157318839|gb|ABV37937.1| multi antimicrobial extrusion protein MatE [Shewanella sediminis HAW-EB3] (448 aa)
Score = 137, Expect = 3.6e-06, Identities = 88/369 (23%), Positives = 143/369 (38%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSL-----ILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV----KVVYYYGIITGVVFSLLIN-AVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           +  +  +IG     G + L S  L Q +  K + I  ++F  CL    V  +        +++   A+  V                 LN+A  Y+  YF  G  PII +       LR +GR  F+T+  ++    N + + +F +VF   ++G  I+ +I   V  LL                     F      +INW   +  L     IL +G  +FL    + +   ++ + F      I  A                 VS T  +  + F   GI  G +PI ++N     Y RV    K+ +   ++T  V  L I    FW +++F G +        TP  I  + L F  L    P+  L + G S FQ+
  S:    64 IGAVLYAIGALFGMGGAALVSINLGQGEVAKARKILGNTFSLCLISGTVFALFGTRYSRELLQLLGAEGEV-----------------LNSAYDYLFWYFALGYFPIISMA--FSALLRNDGRPGFVTYVLILGGCLNAVLDWLFIVVFPFGLVGAAIATMISQAVTGLLCLQHF----------------FTANTRLRINWQQMSLKLDHCLNILRVGLPSFLLSLYLTIVLTLHNMAFLWVGTPIHVAA-------------YGVVSYTEAFFYLIFE--GIAFGTQPIFSFNAGAGRYDRVFKTLKIAFGIALVTAFVGLLFIYIKPFWMVYIFAGDNPQL-----TPYAIEGMRLYFWGL----PMEGLLLVGASFFQA 387
>gi|168186568|ref|ZP_02621203.1| Na+ driven multidrug efflux pump [Clostridium botulinum C str. Eklund] >gi|169295401|gb|EDS77534.1| Na+ driven multidrug efflux pump [Clostridium botulinum C str. Eklund] (454 aa)
Score = 136, Expect = 4.2e-06, Identities = 81/391 (20%), Positives = 162/391 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKI-NWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           LI  +    I  G + L +  + ++D +  + I  +SF   + L ++LT+  M  +  ++ A  A                     +  AN Y+  ++ G+I + + L +  F +  +G +       +I    NII + IF   F M + G  I+ +IG FV+ + +  F+   + V           K  +E+ I + N+    + L +  F+  ++ +       +V     N +    GD  V A    + I  +        I   + GI  G +PI+++NY  +N KRV+  +   +I+ + ++ L+    W + L       S FN N P  I + +           L    I+    F + G+  ++++ +L + +I   P+++
  S:    63 LIISAFSGLIGLGGAPLVAIKMGEKDNKSAEKILSNSFCMLIILGVILTLSFMIFKEPLLWAFGASKET-----------------IGFANGYLTIYLIGTIFVEISLGMNPF-INTQGFAKTGMITVMIGAFVNIILDPIFIFGFNMGVKGAAIASIIGQFVSAIWILCFLFGKKSV----------LKVKREYIIPDMNIVKNIVGLGISPFIMQSTES-------LVLISQNNKLQMYGGDLAVGAMTIMSSIMQI--------ILLPLMGIAQGAQPIISFNYGAKNLKRVRKTFKLFLISCLGYATLM----WGLLLCVPKIFVSIFN-NKPELIQITSWSIRIFFAGIFLFGAQIACQQTFLALGQAKISLIMALLRKIILLVPLIF 407
>gi|153956100|ref|YP_001396865.1| cation efflux pump [Clostridium kluyveri DSM 555] >gi|146348958|gb|EDK35494.1| Predicted cation efflux pump [Clostridium kluyveri DSM 555] (453 aa)
Score = 136, Expect = 4.2e-06, Identities = 88/395 (22%), Positives = 179/395 (45%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKIN-WNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEI--HVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           I ++ G     G     +R +A+++ +K K I    FYS +  S  + ++ + I   +V+  I  +  ST     SY+              M+F   +  +   L  ++   RAEG S    +  +I+ + N IF+ +F L+  M+++G  +++++    N+     +I + E  ++    F   FK   + K+  + +  + L+++               V++I+    LN  S A GD  V+  G+A   +Q            F   G+  G+ P++AYN+  +N++R+K       +   V S++   V   +++F  P +  F N ++   I  +++T +F + LF         +GL   +FQ++G+     + S+ QG I + P++  + N+
  S:    66 ILMAFGNMFGVGGGTFVTRLVAKKEIEKAKHIAGYIFYSSIIASTCIAIIALFIINPLVK--ILGADTSTIAYTKSYSLT------------MFFGGFATVLNFALQQIV---RAEGASKESMYGMIISTILNFIFDPLFILLLNMNVVGAALAMILA---NLGSSIYYIYYLEIKSEHLKGFIHCFKISFQDKMEIYKIGVSELLMT---------------VFLIITTLLLNNFSIAYGDNVVAGFGIALRIVQVPE---------FLSMGLYLGIIPLIAYNFSNRNFERLKNGIRQSALCIAVLSIIFIGV---VYIFTMPIIQLFSNDSSVISIGTYIMTAMFISALFN------GFTGLFTGIFQASGQGIPTTIMSVTQG-ILYIPVIIVLHNL 412
>gi|150018458|ref|YP_001310712.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] >gi|149904923|gb|ABR35756.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] (453 aa)
Score = 136, Expect = 4.2e-06, Identities = 93/394 (23%), Positives = 175/394 (44%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKY-MYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIV---YVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWN 508
           I ++ G  + +G     +R +A+QDK+K K I   SFYS + + I+L ++ +     IV+   A ++                 I+N    Y +    G   IIM   L    +RAEG S    F  +++ +F +IF+ +F LVFK ++IG  +S+++    NI     +I + E  +          + LK F  N+N+       SL   +    + V+ +    ++I+    LN  S   G++ V++ G+A   +Q            F   G+  G+ P++AYN+  +N+KR+K      I    ++ L ++  F  +       +   F +N  + + V   +   +L        +     +FQ++G+   + +  + QG I F P++  + N
  S:    66 ILMAFGNMLGAGGGTFITRLIAKQDKEKAKKIAGYSFYSSIIIGILLGIIAIIALNPIVKILGADTSA----------------IINYTKSYSLTMFIGGFAIIMNFALEQV-VRAEGASKESMFGMVVSTIFGLIFDPLFILVFKFNVIGVAVSMILA---NIASSIYYIYYLETKS----------ENLKGFIKNFNI-------SLKDKIEIYKVGVSELFLAGFLIITTLLLNNYSIRYGESVVASFGIALRLVQVPE---------FLAMGLALGIIPLIAYNFSNENFKRLK----DSIKQSALWILGLSGGFVTLVFIFRNVIIRLF-SNDSAVLSVGVYIMAAMLISALFNGFTTLFTGIFQASGQGIPSTIMGITQG-ILFIPVIIVLNN 412
>gi|187605908|ref|ZP_02992090.1| MATE efflux family protein [Exiguobacterium sp. AT1b] >gi|187482018|gb|EDU20040.1| MATE efflux family protein [Exiguobacterium sp. AT1b] (465 aa)
Score = 136, Expect = 4.5e-06, Identities = 79/393 (20%), Positives = 164/393 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV--FWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           + +I +++   +  G + + SR L + D          +F + L L  +   L +S   ++++  I K   +T+E            I++ + +Y+  +  S P  M        +RAEG++ +     L   L N++   +F   F   + G   S  +   +  +L+  F     F  K      F ++Q   F+I ++     + +   +F+   S +       I+F G    + T  G   ++     N    + G PI         GIV G++PI+ YNY  + + R++   +  +  G+  +++I  +   +P  L G  S      A   + IH+L  +        P + + ++G  ++QS GK  + +  SL++  ++  P+++
  S:    60 IQMILMAVSSAVGLGGASISSRKLGRGDDAGA----AVTFLNVLVLVGLFAALAVSSAFFMLDD-ILKVFGATTE------------IMDLSRQYLSVVLISSPFFMFTLASSAMVRAEGQAPYQMKVMLTTVLVNLVTTPLFIFTFDWGMYGAASSTALAQVIGSVLMLRFF----FARKPKTELRFKWRQ---FRIRFDEMKEIMAIGSSSFIMMVSQS-------ILFVGVNVMLGTYGGTEELAIFAIINKFMALVGMPIM--------GIVQGMQPIVGYNYGAERFDRMRETIWTAMRAGIAIAVIIWLILQLFPQTLMGWFSTDEALIAGGVTAIHILFAVSF-----LPSVQMLVNG--IYQSLGKARVAMFLSLSRQTLYTIPLVF 408
>gi|167771399|ref|ZP_02443452.1| hypothetical protein ANACOL_02765 [Anaerotruncus colihominis DSM 17241] >gi|167666039|gb|EDS10169.1| hypothetical protein ANACOL_02765 [Anaerotruncus colihominis DSM 17241] (451 aa)
Score = 136, Expect = 4.7e-06, Identities = 90/419 (21%), Positives = 167/419 (39%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFS--RALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSF-FNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQG------LIFFFPIL-------YSMWNIAILVSDYKVMLFTAFT 525
           +V+  +  I  S+GL + +G SV+FS  R  + Q  +     + ++    + LS+++ + ++     I     A +                  +L+ A  Y+  I   IP+ +   +L  FLR +      T   L   LFNI  +  F  +  M I G G++  IG  ++ +++ S     +       P    +K               +I    TF  D ++ +  +++       L          G SA   +  I  VS       +    Y +    +PI++ NY  + + R+K    Y + T V FS     +FW +     P++  + F   T + + +   +  +    F LL L+I     FQ+  K       S+++G      LI   P+L       ++M    +LV+ Y V +   +T
  S:    50 AVVAPIWNIIYSLGLLMGTGGSVIFSTLRGTSTQKTENENEYFTTAIIGSIVLSVIVWLAVIFFDQPIFVFFGADTE-----------------LLSLAQAYLAPIKVVIPLFLFNQMLAAFLRNDNHPELATIGVLAGGLFNIFGDYAFVFLLDMGIFGAGLATAIGSAISFVVMLSHFWSKKNTLVLQKPVDIVYK-----------LKQVIITGFSTFFIDIAMGILTVLFNRQIMKYL----------GTSALAIYGPIVNVS-----TFVQCCAYSVGQAAQPIISINYGARKWNRIKETLRYALYTVVFFS-----IFWTVLSLICPNLYIYIFMKPTAAILQIAPAIIRSYSISFILLPLNIFSTYYFQALMKPKTAFTVSVSRGFIVSGILIMLLPVLAGADSVWFAMPITELLVAIYAVYMIFKYT 436
>gi|16801257|ref|NP_471525.1| hypothetical protein lin2192 [Listeria innocua Clip11262] >gi|16414705|emb|CAC97421.1| lin2192 [Listeria innocua] (443 aa)
Score = 135, Expect = 5.7e-06, Identities = 106/491 (21%), Positives = 203/491 (41%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWN--VFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAY----NYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           N  + ET+S+ K+  + LVPSL   LL  + I +D I + H +           +  AG+                                  ++   V  IF +I ++I  GA+  FS A+ +++  K +SI+ ++      L++V   ++++I  +I +  +A    +  E +          +L   N  + F       + + N+L  F+R +G       A ++  + N+I   +F  VF+  + G  ++ +I   + +L     IL   F  K          +LK  K+NWN   F  +L + L +FL +  ++V    Y I       +I+   G AGV+A    N   +V        I     G+   ++P+++Y      +++  + +K+       TGV F L        + LFG   + S F  N  +EI  L      L +  +  +  +   ++ FQ++ K+ +    ++++ +IF    L
  S:     4 NIEILETDSVKKIYFRYLVPSLVGMLLMSLNIVIDGIFVGHKL---------GGVALAGI----------------------------------NIAVPVFTIFTAISIWIGIGAATQFSFAIGEKNVPKAQSIFTNAI-----LAVVSITVVIAILAFIFKVPLAYFLGANDETIG--------YVLEYMNILLIFGFA----LTLENILSIFVRNDGDPNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIIGVL-----ILTTHFFKKS--------SRLKFVKVNWNKAFFKKTLGIGLPSFLAEVGVSVFTFGYNI-------SIAAIAGTAGVAAFSVLNYTHSV--------ILMLFLGMGSAIQPLISYYRGARAREKEIETLKIAIVVAFGTGVAFLL--------VGLFGSNLLVSMF-GNFSAEIRELASNGIKLFYSAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIFMVIFL 404
>gi|167767909|ref|ZP_02439962.1| hypothetical protein CLOSS21_02451 [Clostridium sp. SS2/1] >gi|167710238|gb|EDS20817.1| hypothetical protein CLOSS21_02451 [Clostridium sp. SS2/1] (428 aa)
Score = 135, Expect = 5.8e-06, Identities = 85/396 (21%), Positives = 170/396 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFL----VFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITG---VVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           +++  V ++ ++IG+    G + L +R L Q + +K   +  +S    LFL  ++ V+ +    + V+  I+  TV    +    + +R   I++               I+  +L    L+A GRS + T   ++  + NII + I       V +M + G   + +IG       V S +L + F  K +  F    K +K      +      I ++G     A   ++ +VYV      +N I      A  + GL +          +   + F  +G+ D + PI+A+ Y   + KR+K    YG++     ++F +LI  +F         S  + FNA +  E  +  +   ++ F F  ++++  G  ++Q+      +++ SL + L+   P+
  S:    71 TLVFPVQMLMVAIGIGTGVGTNALLARTLGQGNHKKAGKVAGNS----LFLGGIIYVVCLLFGIFGVKTYISSQTVDPQVISMGTSYLRICCIISMG-------------IIFFSLFEKLLQATGRSLYSTIGQVVGAVVNIILDPIMIYGIGPVPEMGVQGAAYATVIGQ------VVSTVLLFIFHMKFNKEFEHGAKYMKP-----DAGIIKEIYAIGLPAIIAQALMSIMVYV------MNLILKFSPSAQTAYGLFYK---------VQQFVLFLAFGLRDAITPIIAFAYGMGSKKRIKDGIKYGLMYTSVLMIFGILITEIF-------PSSFATLFNAGSSREYFIGAMRIISISFIFAGINVAYQG--IYQALDGGMESLIISLLRQLVIILPL 421
>gi|161507501|ref|YP_001577455.1| hypothetical protein lhv_1107 [Lactobacillus helveticus DPC 4571] >gi|160348490|gb|ABX27164.1| Membrane protein [Lactobacillus helveticus DPC 4571] (444 aa)
Score = 135, Expect = 5.9e-06, Identities = 84/384 (21%), Positives = 159/384 (41%)
  Q:   116 FISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGT----PIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLA-QGLIFF 499
            I++      G S L SR   ++     K I     +  + + I+LT+L++     I+    AK++  +                 A + Y     GS+ II  L +    +R EG ++    + +I  +  II + IF    K    G G++ +IGY V  LL+                  F  K      +N  +   S     G  ++D        V  I   G++   + + G A +++ LA      V+       IY+++   I G   G +P++ YNY  +N++R+K +  +  I  V +++++      + +   P VT+ F  N PS +   + +    +   P + + +   ++FQS G  +   V ++  QG+I+F
  S:    61 LIAVSDIFGLGGSSLISRLFGEKRYDLSKRISSFCLFGSVIVGIILTILLLVFAKPILILLGAKTSTYSY----------------AFDFYRIIALGSVFIIFSL-VPQNLIRTEGLAFEAMLSTMIGTILAIILDPIFLFGLKWGATGVGLANIIGYLVTDLLL----------------IFFTIKNAHYISLNPKIMKIS-----GQNIKD--------VIAIGIPGSITNFAQSFGMALLNSSLAAYGANKVAAMGITQKIYSIVILVIVGFAFGAQPLIGYNYGAKNWQRLKDILRFDTIVLVSYAIVVGGA---LIILAKP-VTALF-MNQPSIVSAGSYMLIATIITTPFVGIILVYTTVFQSIGNAWGAFVMAITRQGIIYF 398
>gi|167762571|ref|ZP_02434698.1| hypothetical protein BACSTE_00927 [Bacteroides stercoris ATCC 43183] >gi|167699677|gb|EDS16256.1| hypothetical protein BACSTE_00927 [Bacteroides stercoris ATCC 43183] (471 aa)
Score = 134, Expect = 6.7e-06, Identities = 80/357 (22%), Positives = 136/357 (38%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHL 559
           A +YM +         +LN  +FFLR +G   F  F  ++A++ NII + +F   F   + G   +  IG  V  L++  ++     V +  YP  F+   +K  K N         L    FL + +IA    V  +VF   L       G A  S    F           + +IF     I    +PI+++NY      RV+  Y   + T V   +     F  I +F    + + F   +     +           F   +++I  +  FQS  +     V +L +G I      Y +    +L+    + L T    +        +T+   L +YMG+K   K+ ++ L
  S:   136 AVEYMCWFVPFSAFTALLNSGMFFLRLDGSPNFAMFCNIVASVLNIILDYLFIFPFGWGMFGAAFASAIGTTVGALMIIIYLSRRNCVLRF-YPVKFSRNSMKLMKRNVGYMCR---LGSSAFLCEVAIACMMFVGNLVFIHYLK----EDGVAAFSIACYF-----------FPIIFMVYNAIAQSAQPIISFNYGLNETLRVRKTYLLALKTAVGCGI----CFALITIFCSREIVAMFIDRSYPAYDIAVKGLPLYASGFVFFAINIVSIGYFQSVERAKYATVITLLRGFILLTLCFYGL---PLLLGKPGIWLATPLAEL--------LTTLFILIIYMGRKRNGKENSISL 458
>gi|167772975|ref|ZP_02445028.1| hypothetical protein ANACOL_04363 [Anaerotruncus colihominis DSM 17241] >gi|167664908|gb|EDS09038.1| hypothetical protein ANACOL_04363 [Anaerotruncus colihominis DSM 17241] (471 aa)
Score = 134, Expect = 6.8e-06, Identities = 72/312 (23%), Positives = 136/312 (43%)
  Q:   198 LILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFG-TLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP---ILYSMWNI 509
           LI+     Y+  I+    I M+ + +   +R++G    +  AA   N+ NI+ + +F L   M   G G++ +IG  V  LL++   L                +   +       F+  L   +      + +   +  +VI+ F  TL  +S   G+  V+     ++I  V G  I+N       G+    +PI++ +Y    Y R+K V  + ++T + FSL+   VF  I LF G  +T F +++  ++I  +      L F   P   L+   +  FQST    +  + ++ +G++  +    I  S+W +
  S:   152 LIVGHVVGYLAPISPFSFIYMLSSAMCVIVRSDGNPRLVMVAATTGNILNIVLDYVFVLPLGMGTFGAGLATIIGPVVTCLLLSMHFL----------------RHYNQVHFTRRFFSPRLFARMVRNGAGSGVLETSSGFVILMFNLTLLRVS---GETAVAIFSIISNIGYV-GKGIFN-------GMAQAAQPIISISYGSGTYSRMKTVNRFAMLTALSFSLV---VFGLIVLFPGQIITLFISSD--AQIIAMGAPAVVLYFLSLPFTGLNTILMYYFQSTEHARITALVAVLRGIVLVYAALRIFSSLWGL 436
>gi|28210337|ref|NP_781281.1| Na+ driven multidrug efflux protein [Clostridium tetani E88] >gi|28202774|gb|AAO35218.1| Na+ driven multidrug efflux pump (mviN domain) [Clostridium tetani E88] (456 aa)
Score = 134, Expect = 7.0e-06, Identities = 69/293 (23%), Positives = 121/293 (41%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           L  A  YM +I     +  I   +   +RAEG         LI  + N I + IF  VFKM I G  ++ +    V+ +    ++L+Y F  +          +++   +N +  T   I+S+G  +   S+ +A  +   +F   L    T  GD  V A    N I          L F  ++GI  G++PI+ YNY  + YKRV+      I +    +++I  + + +      ++   FN +    + +        L   P++   +   + FQ+ GK  + I  SL
  S:   134 LPYARDYMKYIVAGALLQNIGFSMNNIIRAEGNPKIAMATMLIGAIINTILDPIFIFVFKMGIKGAALATIFAQTVSSI----WVLYYFFSGRSTL-------KIRRENLNLHKGTIKTIMSIG--ISPFSMQIAASLVTTIFNKNL---LTHGGDLAVGAMGIVNSISM--------LFFMPMFGINQGMQPIIGYNYGAKQYKRVRKTLKLAITS----AMIIATIGFIVVEVFPTALIKIFNKDE-QLVSIGAYGMRIFLSMLPIIGFQVVSSNYFQAVGKAKIAIFLSL 397
>gi|16803030|ref|NP_464515.1| hypothetical protein lmo0990 [Listeria monocytogenes EGD-e] >gi|16410392|emb|CAC99068.1| lmo0990 [Listeria monocytogenes] (453 aa)
Score = 134, Expect = 7.0e-06, Identities = 116/432 (26%), Positives = 189/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      I ++IG     G     SR L +++  K K +     Y  L L I+  +L+  +   +     A +T                  L+  N  +  +  S P I+    L   +RAEG S       LI  + N++F+ +  L F  +++G  +S+ +    +++  A ++       K DY  S  FK  +  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K + +  I  G++  LL + VF  IF F    + S   +     +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   NI I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEEGTKAKQVSAFVLYGSLVLGILCAILLGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRAEGASRVSMNGMLIGTVVNLVFDPLLILYFDFNVVGAAVSVGLASLFSLIYYAWYL-----EKKSDY-LSIRFKWFQASKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRFTAISIGLIVLLLSSLVF--IFRFQVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNIKIASSA 446
>gi|150017089|ref|YP_001309343.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] >gi|149903554|gb|ABR34387.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] (462 aa)
Score = 134, Expect = 7.0e-06, Identities = 68/294 (23%), Positives = 125/294 (42%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIV--YVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKR 405
           +  I +++   I+ GAS   S  L + +K++ ++   ++    L LSIVL +L+ S+      + +    ++               +L+    ++  I       M+   L F +R++G   F     +   + NI+ + +F  VF M I G  I+ +I  F  ++L      F +  N      +   K++  FK++ ++     ++ L  F    S++VA IV  Y +  +G         G+  + A    N I          L    +YGI  G +PI+ YNY K+NY R
  S:    61 ITTIVVALSALISMGASSNISIKLGEGNKEEAENFAGNA----LSLSIVLGLLVTSLYMIFQNSILGWLGINGE-------------VLSYTKDFITIIMAGTVFNMLGFCLPFIVRSDGNPIFSAAITITGCILNILLDALFIYVFHMGIKGAAIATVIAQFTTVIL--GLYYFMKLKN------TLILKKIN-FKLHISIVKAIFLIGLVPFSNQLSVSVAQIVSNYSLNLYG---------GELAIGAMTVLNSITI--------LFLMPVYGIAQGFQPIIGYNYAKKNYGR 313
>gi|160941311|ref|ZP_02088648.1| hypothetical protein CLOBOL_06204 [Clostridium bolteae ATCC BAA-613] >gi|158435872|gb|EDP13639.1| hypothetical protein CLOBOL_06204 [Clostridium bolteae ATCC BAA-613] (453 aa)
Score = 134, Expect = 7.6e-06, Identities = 87/378 (23%), Positives = 159/378 (42%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIV 489
           V LI  ++ L I +GAS   S  + + DKQ  + I      S   LSI+ +  I  I    ++  ++    +   +V  Y +    +IL+ +    +F+T        +N  +  +    R++  + ++++ N    I + +F  VFK  + G  +S +IG  V +LL   F+   +  + G+   S           N N+  +  I+S G     ASI    +  V + F  + A     G+ GV+A G+ +N            L++  I G+  G++PI  +NY   NY RV+    Y I    +F+     +F  I LF    +++F  A   + + +            P +   +   + FQ  GK+  ++V
  S:    59 VILIIQALSLLIAAGASASISLKMGKSDKQGAEKI----IGSACMLSILFSAAITIIGLLTIKPLLSLYGANADNMV--YAKEYITVILSGS---FFFVTAQS-----MNNCVKGMGYAKRAFLNSLSSVVTN---TILDAVFIFVFKWGVFGAALSTVIGNCVCMLLAMQFLCSKK--SAGNLKPS-----------NINLSASKKIMSTGA---PASITQFALSLVSLTFNHVAAFYG--GNVGVAAYGIMYNTTM---------LVYMPIIGLGQGIQPIFGFNYSAGNYTRVRSTLKYSITCATIFAA---GMFLVIELFSSQIISTFGGAGNKALMDMAVPGIRIFTLLLPAVGFQMISANYFQYIGKVKQSVV 390
>gi|150002941|ref|YP_001297685.1| putative transmembrane cation efflux protein [Bacteroides vulgatus ATCC 8482] >gi|149931365|gb|ABR38063.1| putative transmembrane cation efflux protein [Bacteroides vulgatus ATCC 8482] (450 aa)
Score = 134, Expect = 8.1e-06, Identities = 90/385 (23%), Positives = 161/385 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCK-SIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-EIHVLTL-LFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           LI   IGL    GASV+ S  L+Q   +  + ++  +   S LFL+++  V+ +      V        + +SE            +L  A +YMY+    +    +L+  +FF+R +G   +      I  + NI+ + +F  + K  ++G  ++  +GY    +L A  I+ Y    +    F       K  ++ W        L + TFL +A+IA        VF   L       G+ GV+A               + +IF     I    +PIL+YN+   +  RV+  +   + T V   L+  A+     LF    V  F + + P+ +I V  L LF +    F   +++I  +  FQS  +    ++ ++ +G +F
  S:    61 LISTGIGLMFGVGASVVASIHLSQGKLKTARINVTQAVVVSSLFLAVLWGVVCLFAPQVAV-------WLGSSE-----------RLLPLAVEYMYWFLPFLVFSALLSSGMFFVRLDGSPNYAMLCNAIPAVVNILLDYVFIFILKWGMMGAALATSLGY----ILGAGMIVVYLSRRRNVIHFCRVKLSKKSMRLTWRNVKYMCHLGVSTFLCEAAIACMMFAGNYVFIHYL-------GEDGVAA--------FSIACYFFPIIFMVYNAIGQSAQPILSYNFGAGDTMRVRSAFRLALGTAVTCGLVFFAL---TALFNHQIVAMFIDRSYPAYDIAVAGLPLFAS---GFIFFAVNIVSIGYFQSVERARPAMMVTVLRGFVF 405
>gi|159904578|ref|YP_001548240.1| MATE efflux family protein [Methanococcus maripaludis C6] >gi|159886071|gb|ABX01008.1| MATE efflux family protein [Methanococcus maripaludis C6] (449 aa)
Score = 134, Expect = 8.2e-06, Identities = 91/397 (22%), Positives = 167/397 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTF--LRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL---SLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           S+I    +I ++ G+    G S L SR L + D    +    ++  S L LS+++T++ +     I+      + + TS  V  Y +  +++IL       Y I  +       NL+    RAEG +    FA ++  + N+I + +F +VF M I G  I+ ++   + ++    +I+ ++F       ++     + +F IN  +   ++ +    F  L  +S+ +     ++  +G   AI+      GV   +A              L+   ++GIV G +PI+ YNY K    RV       ++      LL    F  + +F    +  F    T  E+    +    + F F  L    + I G  L+QS GK     + S A+  +F  P L
  S:    55 SLIFPFQMIIMAFGVTFGIGGSSLLSRKLGEGDLDFARKAGGNAISSVLILSVLITIIGIVFMVPIL------NLLGTSAEVFPYAKDYYEIILYGTVFNSYLIAAN-------NLV----RAEGMAKIAMFAMVVPAIINMILDAVFIIVFNMGIKGAAIATVLSQIIGVI----YIVKHQFGKNTSIKYA-----INDFIINLKILKETIFIGASEFAKLIISSVLLILGNNLLGAYGGDIAIAI----YGVIMRIAM-------------LLLMPVFGIVQGFQPIVGYNYGKGQLNRVSESIKLALVGTTGLCLL---GFVLVMIFPEKFIQIFV---TDPEVISQGVFATRIFFMFSFLIGAQMVIGG--LYQSLGKAKPAFIISCARQTLFLLPAL 405
>gi|187932573|ref|YP_001884350.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] >gi|187720726|gb|ACD21947.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] (459 aa)
Score = 133, Expect = 8.5e-06, Identities = 74/274 (27%), Positives = 119/274 (43%)
  Q:   219 ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGII--TGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I N+L F L    R++G       + LI  L NII + IF  V  + + GG I+ +I   V+     ++IL+Y    KG        K L   K+N  + T+  ++ +  F    S+ VA     ++   + N++    GDA + A    N +  +   P        I+G+  G++PI+ YN+  + Y R K    Y  I  T +V    I     P  L       S FN + P  + +        L   PL+   I   + FQS GK+ +++  SL
  S:   147 IFNMLSFGLNHSIRSDGSPKVAMLSMLIGALTNIILDPIFIFVLGLGVKGGAIATVISQMVS----TTWILYY--FTKGKSVLKIKRKYL---KLNKEIVTSIFLIGMSPF----SMQVAQCAVQVI---SNNSLQRYGGDAAIGAMTIINSLVMIFLMP--------IFGLNQGMQPIVGYNFGAKKYDRAKKTLKYTAIAATTIVTIGFIVVETIPELLI------SIFNRD-PELLRIGVSGMRIFLVMLPLIGAQIVTTNYFQSIGKVKVSMFLSL 395
>gi|160895424|ref|ZP_02076193.1| hypothetical protein CLOL250_02981 [Clostridium sp. L2-50] >gi|156862926|gb|EDO56357.1| hypothetical protein CLOL250_02981 [Clostridium sp. L2-50] (455 aa)
Score = 133, Expect = 8.8e-06, Identities = 87/396 (21%), Positives = 166/396 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFL----VFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGV---VFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           +++  V ++ +++G+    G + L +  L Q+D +K   +  +S    LFL  ++ V+ +    + V+A I+  TV    +      +R   +L+               I+  +L    L+A GRS + T   +   + NII + I       V +M + G   + +IG  V+  L+  F L      K +  F    K +K      +  T   I S+G     A   ++ +VY       +N I      A  + GL +          +   + F  +G+ D + PI+A+ Y   + KR+K    YG+I  +   +  +LI  +F   F        S FNA       +  +   ++ F F  ++++  G  ++Q+      ++V SL + L+   P+
  S:    56 TLVFPVQMLMVAVGIGTGVGTNALLAMTLGQRDMKKAARVAGNS----LFLGGIIYVVCLLFGIFGVKAYISSQTVDPEVISMGTTYLRVCCVLSFG-------------IVFFSLFEKLLQATGRSLYSTIGQVAGAVINIILDPIMIYGIGPVPEMGVAGAAYATVIGQIVSAGLLLVFHL------KLNKEFEHGIKHMKP-----SARTMKEIYSIGLPAIIAQALMSIMVY------AMNLILKFNPSAQTAYGLFYK---------VQQFVLFLAFGLRDAITPIIAFAYGMGSKKRIKDGIRYGLIYTIALMILGVLITEIFPNAF-------ASLFNAGQSRAYFIGAMRIISISFIFAGINVAYQG--IYQALNGGLESLVISLLRQLVIILPL 406
>gi|168714065|ref|ZP_02746342.1| putative drug/sodium antiporter [Clostridium difficile QCD-63q42] >gi|196126064|ref|ZP_03117813.1| putative drug/sodium antiporter [Clostridium difficile ATCC 43255] (446 aa)
Score = 133, Expect = 9.6e-06, Identities = 72/306 (23%), Positives = 134/306 (43%)
  Q:   198 LILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVV---FSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTL-LFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
            IL A+   +++    + +I+   I NL+ F+L    RAEG         ++  + N+I + IF  VF + I G  I+ ++       +V  F + + F+                  I   VF     + +  F  + +I++ ++        T N++    GD  + A  A         T I  +    ++G+  G++ I++YNY  + Y+R K      II  VV   F  L+  VF  +F+         FN +  S++  + +   +L L   P++ +SI G   FQ   K+  ++  +L +  I F P++
  S:   123 FILGASKDSIFYAKDYMSVILVGSIFNLVAFYLNNAIRAEGNPKLAARTMIVGCVLNLILDPIFIFVFNLGIKGAAIATVL-----CQIVVFFWVIHYFIRGKSNLKLKKCNLKLNKDIVKKVFA----IGMTPFAMEVAISITHMF-------TNNSLKVYGGDLAIGAMTAL--------TSILLMFMMPVFGLNQGMQTIISYNYGAKQYERAKKTLILSIIVSVVILSFGFLVVQVFPEVFV-------GIFNKD--SDLMDIAVRGISLNLITLPIMGISIVGPVYFQCISKVKHSMFLTLLRQFILFIPLI 406
>gi|110799016|ref|YP_695926.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|110673663|gb|ABG82650.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] (398 aa)
Score = 133, Expect = 1.0e-05, Identities = 89/378 (23%), Positives = 158/378 (41%)
  Q:   115 IFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           +F  +G F   I+ G S   S  L ++ K++ + I  ++F     LSIV+ ++IM      +E  +     S   ++ + + +R  LI    N   + +  +I             RAEG         +I+ + NII + IF  +F M I G  +  +I  F+  L    + ++Y  + K +       K L     N N+    ++++L  F  + +    +++       T   +    GD  + A          S T IY L    ++G+  G++ I+AYNY  + YKR K      ++T ++ +L++      I ++    +  F        I +  L   TL    P L +SI G   FQS G +  +I  SL
  S:     3 LFTILGAFCVAISVGGSTNISIKLGEEKKEEAERILGNTF----ILSIVVALIIMIFGFSFLEKILYFFGASKETIIYAKDYMRVILIGAWFNFPGFALNNAI-------------RAEGNPKLAGKIMIISCVLNIILDPIFIFLFHMGIKGAALGTIICQFIVFL----WTMYYFTLGKSNLKLRIKGKIL-----NKNILRAIILIALTPFFMELAAGFIHLI-------TNRVLKDYGGDLAIGA--------MTSITSIYLLFLMPVFGLSQGMQTIVAYNYGAKEYKRAKKTL---LMTIIIATLILTLGLVLIRIYPREFINIFTKDKELINIALNGLKIYTL--ALPTLGVSILGAVYFQSIGNVKKSIFLSL 337
>gi|153197570|ref|ZP_01941801.1| hypothetical protein LMRG_02090 [Listeria monocytogenes 10403S] >gi|127632991|gb|EBA22416.1| hypothetical protein LMRG_02090 [Listeria monocytogenes 10403S] (453 aa)
Score = 133, Expect = 1.0e-05, Identities = 116/432 (26%), Positives = 189/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      I ++IG     G     SR L +++  K K +     Y  L L I+  +L+  +   +     A +T                  L+  N  +  +  S P I+    L   +RAEG S       LI  + N++F+ +  L F  +++G  +S+ +    +++  A ++       K DY  S  FK  +  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K + +  I  G++  LL + VF  IF F    + S   +     +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   NI I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEEGTKAKQVSAFVLYGSLVLGILCAILLGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRAEGASRVSMNGMLIGTVVNLVFDPLLILYFDFNVVGAAVSVGLASLFSLIYYAWYL-----EKKSDY-LSIRFKWFQASKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRFTAISIGLIVLLLSSLVF--IFRFQVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQYYFGLMGVIWSLTATEILTCIIGVTLFT-IHNIKIASSA 446
>gi|153816346|ref|ZP_01969014.1| hypothetical protein RUMTOR_02598 [Ruminococcus torques ATCC 27756] >gi|145846307|gb|EDK23225.1| hypothetical protein RUMTOR_02598 [Ruminococcus torques ATCC 27756] (457 aa)
Score = 133, Expect = 1.0e-05, Identities = 88/411 (21%), Positives = 163/411 (39%)
  Q:    14 ESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNV-FTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           E+ +  +SIP L LK+ +P +F   +  +Y  VD+I + +I PV G + L  A + A      I+++LS                                   S G  I  G SVLFS  L   D++  K I  +SF   L  S +LT++ +  + Y++    A +                  I   AN YM   T      ++   + +F+ A+G         LI  + NI+ + +F    +MDI G  ++ +I    + +    F+L+     K   P +    + +  K    + F+  LIL+        S+ +  +  V+ ++G  +      GD  ++A         +   P        + G+  G +P+++YNY      R++    + ++  V F+ ++
  S:     4 ENDFGRDSIPLLVLKISIPFMFAQFVNVLYSIVDRIYIGNI-PVIGADSLAGAGVCA-----PIITLLS-----------------------------------SFGTLIGIGGSVLFSVRLGAGDEKSAKQILANSFSMLLIFSGILTIVFLLTKDYLLRWFGASAD-----------------IFPYANTYMTIYTLGTFFALLSMGMNYFITAQGYPGLGMLTTLIGAIVNIVLDPVFIFGLEMDIAGAAVATVIAQMSSCI----FVLYTLKRKKMRIPLTLVKPEREIGKRIVKIGFSPFLILA------SDSVIIIALNAVLQYYGGADY-----GDTLITAATIVQSYMLLITAP--------MLGVTGGSQPLISYNYGANRADRIRKTVLWVLMLCVFFTAVM 334
>gi|169825154|ref|YP_001692765.1| Na+driven multidrug efflux pump [Finegoldia magna ATCC 29328] >gi|167831959|dbj|BAG08875.1| Na+driven multidrug efflux pump [Finegoldia magna ATCC 29328] (433 aa)
Score = 133, Expect = 1.0e-05, Identities = 89/395 (22%), Positives = 165/395 (41%)
  Q:   109 IGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLT-------LLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IG V LIF      ++ G+ I  G + L S    +  K + + I  +S    + LSI+  VLI  I  +++           S+ +  Y     ++IL  A           P  M+   +  F+R EG          I  + NII + IF    +M + G   + +IG  ++ + V  + L        D       K+   F+++++       L +  F      +  NI++        N++    GD   S+      +  ++        F  I+GI  G++PIL +N+    Y+RV+      ++ G V+ +L  A     F    P +      + P +  V+         ++ +++F   +L  SI G SLFQ+ GK  +  + ++ + LI+  P++
  S:    24 IGGVYLIFPIFLFLMAFGMLIGVGGNSLSSIKFGEGKKTESEIILGTS----MVLSIIFGVLISGI--FLLNLKWFLKIFGASDTLMPYAYDYGKIILYGA-----------PFQMVGFAMNNFIRGEGNPRAAMVTMFIGAISNIILDYIFIFPMQMGVKGAAWATIIGQVLSSIWVVRYFL-------SDRALLRLTKE--TFRLDFHFCKQIFALGVSPFAMQLVASGINIIFN-------NSLKIYGGDLATSSMSVIYSVSQIA--------FMPIFGINQGIQPILGFNFGAHKYRRVQHTLRIAVVAGTVYMVLNWA-----FTMIRPDLLVKIFISRPEDYAVIKDIAIPGLRIYNSMIF---MLGYSIIGSSLFQAIGKPKIGFILTMTRQLIYLLPLM 382
>gi|148323440|gb|EDK88690.1| MOP/MATE family multidrug-resistance efflux pump NorM [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (455 aa)
Score = 133, Expect = 1.1e-05, Identities = 74/308 (24%), Positives = 127/308 (41%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY----VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAI-YGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           IL  + +Y    +  IP ++    +   +RA+G + +   A +I  + N I + +F  V+ + I G   + +I   ++ LL+  +                 F + K  K + N F    I  L    R  S+  A+ +Y    +IV   T N +     ++   + +       V      N+IF AI  G+V G +PI  +NY  +NY RV+      ++  V FS  I  + + +F      + S F           T      L    L S+ +S  + F S GK     + SL + LI  FP+L ++
  S:   133 ILEYSMEYTGITSYGIPFLLFSIGVNPLVRADGNAKYSMIAIVIGAILNTILDPLFMFVYNLGIAGAAWATVISQIISALLLLIY-----------------FPKFKSVKFSLNDF----IPQLHYLKRIISLGFASFIYQFSNMIVLVTTNNLLKIYGKNSIYGSDIPIAVFGIVMKI---NVIFIAIVLGLVQGAQPIFGFNYGAKNYHRVRETMR--LLLKVTFS--IATILFIVFQVFPKQIISLFGEGDKLYFEFATKYMRIFLAFISLNSIQVSIATFFPSIGKAIKGAIVSLTKQLIVLFPLLLTL 417
>gi|148643288|ref|YP_001273801.1| Na+-driven multidrug efflux pump [Methanobrevibacter smithii ATCC 35061] >gi|148552305|gb|ABQ87433.1| Na+-driven multidrug efflux pump [Methanobrevibacter smithii ATCC 35061] (453 aa)
Score = 133, Expect = 1.1e-05, Identities = 56/202 (27%), Positives = 93/202 (46%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVF--FGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY---GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
            RAEG     T    I+ + N+I + IF     + I G  I+ LI  F+ +L+    IL++ F+ K  Y F + FK    FKINW ++   L + +   L +  +AV  I   ++F   G  +A++T                     T +  LI  AI    GI      ++   Y  +N+K +K+   Y I  G++FS++ + +F
  S:   157 FRAEGDIKRATLPMCISAILNMILDPIFIYTLNLGITGAAIATLISIFIELLI----ILYWMFIKKDTY-FKYTFKN---FKINWGMYKEILNVGIPAGLEELLMAVVAIAVNLIFEIVGGTSAVATY--------------------TIVMRLISIAIMPTIGIATSTITVVGIAYGARNFKNIKIATRYSIKLGLIFSIVTSLIF 335
>gi|154482577|ref|ZP_02025025.1| hypothetical protein EUBVEN_00244 [Eubacterium ventriosum ATCC 27560] >gi|149736602|gb|EDM52488.1| hypothetical protein EUBVEN_00244 [Eubacterium ventriosum ATCC 27560] (433 aa)
Score = 132, Expect = 1.2e-05, Identities = 97/399 (24%), Positives = 163/399 (40%)
  Q:   106 TSVIGTVNLIFISIGL------FINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANT---PSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           T+ +G V L F  I +         SG + LFS +    D +K   I  +SF      ++VLT+L +     I+    A                     L+ A  YM  F+ G++P  MI   +  F+ A+G +     +  I  + N I + IF  V  + I G  I+ +I      +L ASF++F+              + L   +I   V     I+SLGT     +  +  +   +V     N +S   GD  +S     + ++ +  TPIY         I +G  PIL+YNY      RV+     G++ G +  L   A+ W + +     +   F++++      +  L L F   +F    + L   G + F+S  K    I  SL + ++   P+ Y
  S:    27 TAALGAVGLCFPIITIVTACSNLFGSGGAPLFSISRGMGDSKKANRIMNTSFSMVCAGAVVLTILGIVFAKPILVLFGASDNA-----------------LSYAYPYMTIFMLGTLPS-MISTGMNPFINAQGYATTGMLSVAIGAIANFILDPIFIFVLGLGIRGAAIATVISQ----ILSASFVIFFLRCKS-----ELKIRLLHLNEITDCVEYAKNIVSLGT-----AGFIMQVTNSLVSICCNNVLSVTGGDVYISVMTIVSSVRQMVETPIY--------AINEGSSPILSYNYGANRPGRVRKA---GVVMGCLI-LGYTAIMWTLIIVAPHFLIQIFSSDSALIADAVPALKLYFAAFIF----MDLQYIGQTFFKSLNKKKHAIFFSLLRKVVIVVPLTY 387
>gi|126699145|ref|YP_001088042.1| putative drug/sodium antiporter [Clostridium difficile 630] >gi|168693974|ref|ZP_02726251.1| putative drug/sodium antiporter [Clostridium difficile QCD-37x79] >gi|168713474|ref|ZP_02745751.1| putative drug/sodium antiporter [Clostridium difficile QCD-63q42] >gi|168723990|ref|ZP_02756267.1| putative drug/sodium antiporter [Clostridium difficile QCD-76w55] >gi|168731838|ref|ZP_02764115.1| putative drug/sodium antiporter [Clostridium difficile QCD-97b34] >gi|196126459|ref|ZP_03118208.1| putative drug/sodium antiporter [Clostridium difficile ATCC 43255] >gi|196161130|ref|ZP_03121691.1| putative drug/sodium antiporter [Clostridium difficile CIP 107932] >gi|115250582|emb|CAJ68406.1| putative drug/sodium antiporter [Clostridium difficile 630] (463 aa)
Score = 132, Expect = 1.3e-05, Identities = 68/303 (22%), Positives = 128/303 (42%)
  Q:   199 ILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           +  A+   + +    I II+   ++NLL F L    RA+G         ++  L NI+ + I    F + I G  I+ +     +  L A   + Y    K +  FS +       K++  +      + +  F    + ++  ++  I       A+ T  GD  + A    + I  V   PI+        GI  G +PI+ +NY  + Y RVK  Y    +  +V + +I  +   + +    ++   FN + P  +++        L   P++ LS++G +  QS GK  + ++ SL + +I   P
  S:   124 LFGASENTLIYAKSYINIILLGTVVNLLSFSLNHSIRADGSPKISAGIMIVGCLTNIVLDWILIFGFNLGIQGAAIATV----TSQALTAILTIGYYISGKSNLRFSKS-----NLKLDKKLIKAVFAIGMSPFAMQLAASLVQVISNI-------ALKTHGGDLAIGAMATISSIAMVFLMPIF--------GINQGAQPIIGFNYGAEKYDRVKKAY----LGSLVVATIILCMGMVVVMLFPEAIIGIFNKD-PELMNISVNGLRIYLLMLPIVGLSVTGTNFIQSIGKAKMAMLLSLLRQVILLIP 404
>gi|167747187|ref|ZP_02419314.1| hypothetical protein ANACAC_01901 [Anaerostipes caccae DSM 14662] >gi|167654147|gb|EDR98276.1| hypothetical protein ANACAC_01901 [Anaerostipes caccae DSM 14662] (455 aa)
Score = 132, Expect = 1.4e-05, Identities = 82/388 (21%), Positives = 164/388 (42%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           I ++    I  G + L S    + +++K + I  +SF+  + L ++LT +I+  +  I+ A  A    +T    +SY  +              ++ GS+  +MI   +  F+ ++G +       LI  + NII + +F  + ++ + G  ++ +I  FV+ + V  F+   + + K          + + F++ + +    + L L  F    +++V N +  I    TL       GD  V+     N I+ V   P+         GI +G +P+L YNY  + Y+RVK    +  +  + ++ ++    W I L         FN+ +P  I           F   ++SL  SG S + +  +    I  S+ + ++   P+
  S:    65 IIMAFANLIGMGGAPLCSIERGKGNQKKAEEIMGNSFFLLILLGLLLTAVILIFKKPIIYAFGASE--ATFPYADSYITI--------------YLLGSV-FVMIGLGMNSFINSQGFARTGMLTVLIGAVLNIILDPVFIFILQLGVRGAALATVISQFVSSVWVLLFLAGRKTILK---------LKKENFRLRFRLVRQIVTLGLSGF----TMSVTNSIVQIACNATLQVYG---GDLYVTVMTILNSIREVITMPVT--------GITNGAQPVLGYNYGAEQYERVKAAIRFMTLACIGYTFIV----WGILLLAPHFFIHIFNS-SPEIIAKGVPALKLYFFGIFMMSLQFSGQSTYIALNRSRQAIFFSIFRKVVIVLPL 406
>gi|89074530|ref|ZP_01161002.1| hypothetical MATE efflux family protein [Photobacterium sp. SKA34] >gi|89049634|gb|EAR55193.1| hypothetical MATE efflux family protein [Photobacterium sp. SKA34] (505 aa)
Score = 131, Expect = 1.5e-05, Identities = 72/313 (23%), Positives = 130/313 (41%)
  Q:   117 ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYF-VNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLI----FFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFW 429
           ISIG  I SGA  L SRAL Q D+ + KS+  +     +F+SIV+   ++     +++A  AK  V+                  AA++Y+  +  S P++ +       +R  G +       LI    N + + +F   F M + G  IS +I    V I  +   I  ++ + K D      F Q K              L++ T  +            I F   L   +T  G+A V++ +A      V+G  +   I    F  ++ +   + PI+  N+  + + R++ +    ++   V+ +L++ V W
  S:    76 ISIGTSIASGA--LVSRALGQNDRGQAKSMATNVMLFAVFISIVMVAAMLWNLPLLLDAIGAKGHVA-----------------EAASQYLIILLPSAPLMAVSMAAGAAMRGVGDARRSMMTTLIGGGVNAVLDPLFIFGFSMGMQGAAISSVIARLAVTIFSLYVVIYKHKLLAKPD------FSQFK--------------LAMPTIAK------------IAFPAILTNTATPIGNAVVTSNIAQFGESFVAGYAVIGRIMPVCFALVFSLSGAVGPIIGQNFGAERWDRIQQILRDAMLFTAVYCVLVSIVLW 342
>gi|167755192|ref|ZP_02427319.1| hypothetical protein CLORAM_00697 [Clostridium ramosum DSM 1402] >gi|167705242|gb|EDS19821.1| hypothetical protein CLORAM_00697 [Clostridium ramosum DSM 1402] (435 aa)
Score = 131, Expect = 1.6e-05, Identities = 58/304 (19%), Positives = 132/304 (43%)
  Q:   206 YMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           Y+  I    P+ M+ NLLI F+R +          LI +L N++ + IF   F + + G  ++  +   ++I +++ ++     + K ++ F        + K+  N      +L L   + + +  +  +++          I  A    G+ A +AF             +I     G+  G++PI++ N   + Y+ V + Y+YG+ T ++F++++    +    F    + + FN+++  E+  L +    + F  F    +++   + F ++ K     + S  +G I   P+++ +  I
  S:   129 YLKTIMFFAPMFMLNNLLIGFVRNDDNPRLAMMGMLIGSLTNVVLDYIFIFPFGLGMFGAALATGVAPVISISIMSPYV-----IKKANFKF-------LKTKLCLNHCKDIFLLGLSALIGELATGIVMLLFNFTLLKYSGNIGVAA--YGIIANIAF-------------VIVSMFTGVAQGIQPIISKNLSFKEYRNVNLAYHYGLWTVIIFAVIVYLSSY----FAAAQIVALFNSSSNPELLDLAVRGIHIYFGGFIFAGVNMISATFFSASDKPRQAFIISSLRGFILIAPVIFILSTI 402
>gi|20089232|ref|NP_615307.1| uncharacterized membrane protein [Methanosarcina acetivorans C2A] >gi|19914109|gb|AAM03787.1| uncharacterized membrane protein [Methanosarcina acetivorans C2A] (466 aa)
Score = 131, Expect = 1.6e-05, Identities = 102/488 (20%), Positives = 196/488 (40%)
  Q:    16 MYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKY-MYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGII--TGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           M   E I KL LK+ VP++   L+   Y  VD I + H                                         Y A+    +   +V   + ++ +++ L I  G S + SR + +++ +K       +F + +FLSI+ ++LI       +   +       +E +  Y+    ++IL     + +  +T SI             R+EG +     + ++A   NII + IF   F M I G  I+ ++   + +L +A + L       G     F    LK    +  +    L +    F R+ S +   I+   ++ F+G         GD  ++          +S   ++ L+   ++GI+ GL+PI+ +NY  +N+ RV+      II  TG+  +  +    +P  LFG  S          + + ++ L         PL+   + G +L+Q+ GK   ++  S+ + ++F  P++
  S:     7 MLANEKISKLLLKLSVPAMVGMLVQAFYNLVDTIFVGHA----------------------------------------YGADSIQAIGGIAVAFPIQMVGMAVSLAIGIGGSSIISRRMGEREMKKANK----TFSNLIFLSILSSLLITGAGISFIVPLL--KLFGATETILPYSLEYLEVILYGTVLFSLAMVTNSIA------------RSEGNAKVAMNSMMMAGGLNIILDPIFIFGFGMGIRGAAIATVLAQGIGVLYIARYFL------SGKSTLRFHPADLKP---DSKIIKEVLAIGASPFARNVSSSFMIIILNNLLAFYG---------GDIAIAI------FGIISKLLMFTLM--PMFGIIQGLQPIVGFNYGAKNFGRVRESVKLAIIITTGMSIAGFLVLYLFPEQLFGIFSGDHQLIVEGKNAVRIVVL-------ATPLIGFQVVGGALYQALGKARPSLFLSMCRQVLFLIPLV 408
>gi|188587211|ref|YP_001918756.1| MATE efflux family protein [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351898|gb|ACB86168.1| MATE efflux family protein [Natranaerobius thermophilus JW/NM-WN-LF] (459 aa)
Score = 131, Expect = 1.8e-05, Identities = 96/398 (24%), Positives = 166/398 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFL----VFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQ-LKEFKINW----NVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL--INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           SV   + L  I++ +    G S L SR L + D+       +S     L +S + +V++  I   + E+ I             Y      LI   A +Y   I      +    L+   LR +G +       +   + NI+ + I       + ++++ G  I+ +I   V   +V     FYE +  G+      F+  LK FK N     N++   L  ++   L    I+  NI+      G LNA++ +      + G+ F          I + +F  ++G+  G  P++ YN+   N +RVK V  YG +    F+ L  I   F P  +  GP V S         + ++   F T+   FP++  +I G + FQ+ GK   ++  S  + +I   PI Y
  S:    55 SVAFPMQLFLIALSVGTGVGTSSLISRMLGKGDRNGA----ISVVEHVLVISAIYSVVVFLIGFLLPESFI-------------YIFTDDHLIAQYAFEYGRVILMGASPLFFGFLISDALRGQGNTLIPMIGMVSGAITNILLDPILIYGMGPIPRLEVQGAAIATVISKTVTFAVV-----FYELL-IGENEVKPKFRDGLKNFKFNKEIIKNIYAVGLPAAVMQMLASIMISGLNII-----VGNLNALALS------ATGIYFR---------IQSFVFMPVFGLNQGYIPLVGYNFSNGNAERVKKVIGYGALIACGFTSLGFIGFQFIP-EIIAGPFVES------QELMDIVVTAFKTISIAFPIIGPAIIGATTFQAIGKGIPSLTLSFFRQIILLLPIAY 413
>gi|154484996|ref|ZP_02027444.1| hypothetical protein EUBVEN_02714 [Eubacterium ventriosum ATCC 27560] >gi|149733949|gb|EDM50068.1| hypothetical protein EUBVEN_02714 [Eubacterium ventriosum ATCC 27560] (455 aa)
Score = 131, Expect = 1.8e-05, Identities = 80/396 (20%), Positives = 173/396 (43%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFL----VFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           +++  V ++ +++G+    G + L +R L Q + +K   +  +S    LFL  ++  + +    + V+  I+  TV +  +    + +R   +++               I+  +L    L+A GRS + T   ++  + NII + I       V +M + G   + +IG       ++S +L + F  K +  F   FK +K E +I   +++  L           +I    ++ ++V+   +N I      A  + GL +          +   + F  +G+ D + PI+A+ Y   + KR+K    YG+   +   +L  A+     +F G +  + FNA    E  +  +   ++ F F  ++++  G  ++Q+      +++ SL + L+   P+
  S:    56 TLVFPVQMLMVAVGIGTGVGTNALLARTLGQGNNKKAAKVAGNS----LFLGAIIYAVCLLFGIFGVKIYISSQTVDSQVISMGTSYLRICCVISFG-------------IIFFSLFEKLLQATGRSLYSTIGQVVGAVVNIILDPIMIYGIGPVPEMGVEGAAYATVIGQ------ISSALLLFVFHIKLNKEFEHEFKYMKPEGRIIKEIYSIGL----------PAIIAQALMSIMVY--VMNLILKFSPSAQTAYGLFYK---------VQQFVLFLAFGLRDAITPIIAFAYGMGSKKRIKDGIKYGLAYTMALMILGIAI---TEVFPG-AFATLFNAGESREYFIWAMRIISISFIFAGINVAYQG--IYQALDGGIESLIISLIRQLVLILPL 406
>gi|160939328|ref|ZP_02086678.1| hypothetical protein CLOBOL_04221 [Clostridium bolteae ATCC BAA-613] >gi|158437538|gb|EDP15300.1| hypothetical protein CLOBOL_04221 [Clostridium bolteae ATCC BAA-613] (467 aa)
Score = 131, Expect = 1.9e-05, Identities = 62/278 (22%), Positives = 114/278 (41%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFA-IYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
            +RA+G   F     L   + N I + +F   F M + G  ++ +IG  ++ ++V  ++  ++ V             +K              L +  F    ++ V  IV   ++ ++G       A    G    LA   I T       N+IFF+ + G+  GL+PI+++NY  + ++RV+  Y    +  V+ + +I+ + +  F      +   F + +    H     F   LF   L  L     + F S GK    I  SL + +IF  P++
  S:   160 LIRADGSPRFSMMCTLTGAVLNTILDPLFIFGFHMGMAGAALATIIGQIISGIMVIVYLTRFKTVRLSLGSLVPVPSHMKAIAA----------LGMAPFFNQMAMMVVQIVMNNILRYYG-------AQSHYGSEIPLACAGIITK-----VNMIFFSLVIGLSQGLQPIVSFNYGARKFRRVREAY----LKAVLIATMISTLSFLCFQLIPRQIIGIFGSGSEEYFHFAEQYFRIFLFFTFLNGLQPITANYFTSIGKAAKGIFISLTRQIIFLLPLI 414
>gi|150388932|ref|YP_001318981.1| MATE efflux family protein [Alkaliphilus metalliredigens QYMF] >gi|149948794|gb|ABR47322.1| MATE efflux family protein [Alkaliphilus metalliredigens QYMF] (455 aa)
Score = 130, Expect = 1.9e-05, Identities = 64/269 (23%), Positives = 110/269 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGII--TGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           F+R EG         LI  + NII + IF + F   + G   + LI   V+ + V  + L    V K          + K  K+  N+      + L  F    +    NI+         N+++   GD  +S  G+ ++         I  L+   + GI  G++PI+ +NY  + + RVK    + I+  T +V +  I+   +P        + S FN      I   +      LF  P++   I G + FQ+ GK    ++ SL++
  S:   156 FIRGEGNPKIAMLTMLIGAITNIILDYIFIIRFGWGVEGAAWATLIAKLVSAIWVLYYFLGGTSVVK---------IKKKNLKLELNIVKGIFAIGLAPFAMQFAATFLNIILN-------NSLNYYGGDLAISGMGIIYS---------IMTLLLMPVIGISQGVQPIIGFNYGAKKFNRVKEALLWAILMATIIVVTGFISIRAFP------HQLVSLFNPEDLELIEFASHALKIFLFFLPIIGFQIIGANYFQAVGKPKQAMILSLSR 396
>gi|153855335|ref|ZP_01996484.1| hypothetical protein DORLON_02498 [Dorea longicatena DSM 13814] >gi|149752155|gb|EDM62086.1| hypothetical protein DORLON_02498 [Dorea longicatena DSM 13814] (453 aa)
Score = 130, Expect = 2.0e-05, Identities = 83/396 (20%), Positives = 169/396 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFL----VFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           +++  V ++ +++G+    G + L +R L Q + +K   +  +S    LFL +++ V+ +    +  +A I+  T     +    + +R   +++               I+  +L    L+A GRS + T   ++  + NII + I       V +M + G   + +IG       +AS +L   F  K +  F    K +K      +      I ++G     A   ++ +VYV      +N I      A  + GL +          +   + F  +G+ D + PI+A+ Y  ++ KR++    YG+I  V   +L  A+     +F G +  + FNA       +  +   +L F F  ++++  G  ++Q+      ++V SL + L+   P+
  S:    56 TLVFPVQMLMVAVGIGTGVGTNALLARTLGQGNSKKAAKVAGNS----LFLGVIIYVVCLLFGIFGAKAYISSQTTDAEVLEMGVSYLRICCVISFG-------------IIFFSLFEKLLQATGRSLYSTIGQVVGAVVNIILDPIMIYGIGPVPEMGVKGAAYATVIGQ------IASAVLLLVFQIKLNKEFEHDVKYMKP-----DAGIIKEIYAIGLPAIIAQALMSIMVYV------MNLILKFNPSAQTAYGLFYK---------VQQFVLFLAFGLRDAITPIIAFAYGMRSKKRIQDGIKYGLIYTVALMILGIAI---TEIFPG-AFATLFNAGQSRAYFISAMRVISLSFLFAGINVAYQG--IYQAVNSGMESLVISLLRQLVIILPL 406
>gi|149369461|ref|ZP_01889313.1| uncharacterized membrane protein [unidentified eubacterium SCB49] >gi|149356888|gb|EDM45443.1| uncharacterized membrane protein [unidentified eubacterium SCB49] (458 aa)
Score = 130, Expect = 2.1e-05, Identities = 94/403 (23%), Positives = 159/403 (39%)
  Q:   101 MIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY---GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFS-LLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLT----LLFCT------LLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           M +   +V+  V     +IGL I  G S + SRAL + D  K   ++ +        S +L VL +  Q Y ++   A  +                   + A  Y   +   I ++ +  +    +RAEG+  F  +A +   + NI  + +   V    + G   +  I Y +  L +  F +F   +             LK F ++  +      LS  T  R   IAV  I+        LN +  + GDA          I   S   I   + FA++   G+  G  PI  YNY    ++RV+      I T + +S  L   +F  I  F  P V  F +  +  +   L     LL  T      +    P++ + + G S FQS G++   ++ +L +   F  P++
  S:    49 MAISAITVVLPVTFFIAAIGLAIGIGGSSVLSRALGEGDDVKALKVFGNQTTLTFLTSGLLAVLGLVFQDYAIDFFGADDSFK-----------------DLALTYYRIVLYGIVMLAMCMMGNNVIRAEGKPKFAMYAMMFPAVGNIGMDYLLVNVLGYGMEGAAWATFISYALCFLFIVWFFIFKSELR----------LNLKSFILDAKIVKEIGGLSSVTLARQGVIAVLTIL--------LNNVLISNGDA----------IDVASYGIISRALMFALFPVIGVNQGFMPIAGYNYGAGKFERVR----EAINTSIKYSGFLALGIFIIIMFFAEPFVGIFISNKSGQDAETLANNAELLSRTPNALRWVFAATPVIVIQLIGGSYFQSIGRVVPALLLNLTKQGFFLIPLV 416
>gi|168265551|ref|ZP_02687516.1| MATE efflux family protein [Listeria monocytogenes FSL J2-071] (453 aa)
Score = 130, Expect = 2.1e-05, Identities = 116/432 (26%), Positives = 189/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      + ++IG     G     SR L +++  K K +     Y  L L I+  +L+  +   +     A +T                  L+  N  +  +  S P I+    L   +RAEG S       +IA + N++F+ +  L F  +++G  +S+ +    +++  A ++       K DY  S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K +    I  G++  LL + VF  IF F    + S   +     +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   NI I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTVLMAIGNMFGVGGGTYISRLLGKEEGIKAKQVSAFVLYGSLVLGILCAILLGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRAEGASRVSMNGMIIATVVNLVFDPLLILYFDFNVVGAAVSVGLASLFSLIYYAWYL-----EKKSDY-LSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRATAISIGLIVLLLSSLVF--IFRFQVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNIKIASSA 446
>gi|196164687|ref|ZP_03125218.1| putative drug/sodium antiporter [Clostridium difficile QCD-23m63] (463 aa)
Score = 130, Expect = 2.2e-05, Identities = 70/303 (23%), Positives = 126/303 (41%)
  Q:   199 ILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           +  A+   + +    I II+   ++NLL F L    RA+G         ++  L NI+ + I    F + I G  I+ +     +  L A   + Y    K +  FS +       K++  +      + +  F    + ++  ++  I       A+ T  GD  + A    + I  V   PI+        GI  G +PI+ +NY  + Y RVK  Y   +    +   +   V   I LF   ++   FN + P  +++        L   P++ LS++G +  QS GK  + ++ SL + +I   P
  S:   124 LFGASENTLIYAKSYINIILLGTVVNLLSFSLNHSIRADGSPKISAGIMIVGCLTNIVLDWILIFGFNLGIQGAAIATV----TSQALTAVLTIGYYISGKSNLRFSKS-----NLKLDTKLIKAVFAIGMSPFAMQLAASLVQVISNI-------ALKTHGGDLAIGAMATISSIAMVFLMPIF--------GINQGAQPIIGFNYGAEKYDRVKKAYLGSLAVATIILCMGMVV---IMLF-PEAIIGIFNKD-PELMNISVNGLRIYLLMLPIVGLSVTGTNFIQSIGKAKMAMLLSLLRQVILLIP 404
>gi|160892122|ref|ZP_02073125.1| hypothetical protein BACUNI_04585 [Bacteroides uniformis ATCC 8492] >gi|156858600|gb|EDO52031.1| hypothetical protein BACUNI_04585 [Bacteroides uniformis ATCC 8492] (468 aa)
Score = 130, Expect = 2.2e-05, Identities = 79/358 (22%), Positives = 137/358 (38%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIIT----GVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLD 560
           A +YM +         +LN  +FFLR +G   F     ++A + NI+ + +F   F   + G  ++  IG  V  L++  F L         +P   + K ++  + N         L    FL + +IA    V   VF   L       G A  S    F           + +IF     I    +PI++YNY     +RV   Y   + T    GV F+L        + +F  P +   F   +     +           F   +++I  +  FQS  +     V +L +G I      + +    +L+ D  + L T    +        +T+   L +Y+  K+++K+ +V LD
  S:   138 AVEYMLWFVPFSLFTALLNSGMFFLRLDGSPNFAMMCNVVAAVLNILLDYLFIFPFGWGMFGAALASAIGTTVGALMIV-FYLMRRRCALRFHPIKMSRKSMQLMRRNIGYMCR---LGSSAFLCEVAIACMMFVGNQVFIHYLK----EDGVAAFSIACYF-----------FPIIFMVYNAIAQSAQPIISYNYGLNESQRVCRAYLLALKTAIGCGVCFAL--------VTIFCSPEIVGMFIDRSYPAYDIAVKGLPLYATGFVFFAVNIVSIGYFQSVERAKYATVITLLRGFILLTACFFGL---PLLLGDRGIWLATPLAEM--------LTTLFILVIYISGKKEHKEKSVSLD 461
>gi|145953376|ref|ZP_01802384.1| hypothetical protein CdifQ_04003362 [Clostridium difficile QCD-32g58] >gi|168695479|ref|ZP_02727756.1| putative drug/sodium antiporter [Clostridium difficile QCD-37x79] >gi|168725956|ref|ZP_02758233.1| putative drug/sodium antiporter [Clostridium difficile QCD-76w55] >gi|168730016|ref|ZP_02762293.1| putative drug/sodium antiporter [Clostridium difficile QCD-97b34] >gi|196161994|ref|ZP_03122555.1| putative drug/sodium antiporter [Clostridium difficile CIP 107932] (446 aa)
Score = 130, Expect = 2.2e-05, Identities = 72/306 (23%), Positives = 129/306 (42%)
  Q:   198 LILNAANKYMYFITGSIPIIMI---LNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVV---FSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
            IL A+   +++    + +I+I    NL+ F L    RAEG         ++  + N+I + IF  VF + I G  I+ ++       +V  F + Y F+                  I   VF     + +  F  + +I++ ++        T N++    GD  + A  A         T I  +    ++G+  G++ I++YNY  + Y+R K      II  VV   F  LI  VF  +F+         FN ++   + +        L   P++ +SI G   FQ   K+  ++  +L +  I F P++
  S:   123 FILGASKDSIFYAKDYMSVILIGSIFNLVAFSLNNAIRAEGNPKLAARTMIVGCVLNLILDPIFIFVFNLGIKGAAIATVL-----CQIVVFFWVTYYFIRGKSTLKLKKCNLKLNKDIVKKVFA----IGMTPFAMEVAISITHMF-------TNNSLKVYGGDLAIGAMTAL--------TSILLMFMMPVFGLNQGMQTIISYNYGAKQYERAKKTLILSIIVSVVILSFGFLIVQVFPEVFV-------GIFNKDS-DLMDIAVRGISINLITLPIMGISIVGPVYFQCISKVKHSMFLTLLRQFILFIPLI 406
>gi|15644449|ref|NP_229501.1| hypothetical protein TM1701 [Thermotoga maritima MSB8] >gi|4982278|gb|AAD36768.1|AE001810_7 conserved hypothetical protein [Thermotoga maritima MSB8] (458 aa)
Score = 130, Expect = 2.2e-05, Identities = 88/386 (22%), Positives = 161/386 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL-------SLFQSTGKMFLNIVASLAQGLI 497
           V ++ IS+   I  GAS + S+ + ++DK+   +    S    + LSIV+  L I  I  +I +  I       +              L  A +Y   +   IP+IM  N+     R EG +     A  I +L NI  + +F  VF M I G   + ++   V+ LL+A    ++ F  K  Y           F++ W+      IL +G     A I+++  +YV+  F   +      GD GV+           S   + N     + G+   +  +    + ++N ++++  + Y +  G    L   AV + I +F  P +   F  +   E      L+  L+    +LSL + G+       S+FQ  G+   +++ ++ + +I
  S:    63 VFMVIISLAAGIGVGASSVVSQKIGERDKEGADTAASVS----ILLSIVIGFLSIAVILPFISDILIFAGAQGET--------------LRLALEYSVILVYFIPLIMFNNVANGVFRGEGDAKRAMVAITIGSLLNIGLDPVFIYVFGMGIRGAAYATVVSIAVSSLLIA----YWMFFKKDTY---------VSFRLKWDGEILKRILKIGIPASLAQISMSVAIYVLNVFAVRSG-----GDYGVAV--------FTSAWRVINFGTVPLIGMAMAVTSVTGAAFGERNGEKLETAHLYAVKLGFFVGL---AVMFTILIF-APYIARLFTYSQEGE-----KLYSDLVKALRILSLFLPGVPFGMFTSSMFQGVGQGLKSLIVTIMRTVI 403
>gi|187932803|ref|YP_001885610.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] >gi|187720956|gb|ACD22177.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] (460 aa)
Score = 130, Expect = 2.3e-05, Identities = 94/440 (21%), Positives = 180/440 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLL-FCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKD 554
           I I+ G  I  G++   S  L +  ++K + I  ++    L + I+LT+L                T+  ++++  +      +I   A  YM  I       ++  +    +R +G          I  + NI+ + +F  VF M I G  ++ +I    + +L  S+ L    + K +  F     +    K++  +  T   + +  F    + ++  +++        +++    GD      LA   + T+S   I  L     YG V G++PI+ +NY  + Y R K      +++      ++ A+F  I L     V +F   N  S++  +T+       F  P++ +SI G +  QSTGK  + ++ SL + +I   P+      IAIL        F     I  +    +I SS+   +++ K+ K  D
  S:    65 IIIAFGTLIGVGSTTNISIKLGEGKREKAEHIVGNAISLALIIGIMLTIL---------------GTIFLNKILTIFGASADTIIY--AKAYMSVILIGTVFSLMSMMFSNLIRGDGSPKLSATIMAIGCVMNIVLDGVFIFVFNMGIQGAALATIISQATSSILGLSYYL----IGKSNVKF-----RKINLKLDIKIMKTIFAIGMAPFAMQLATSMVQVMFN-------SSLKNYGGD------LAIGAMATISS--INMLFVMPAYGFVQGMQPIVGFNYGAKKYDRAKKTLKISLMSATAV-FILGALF--IQLAPHILVGAF---NKDSQLMSITINGLRKYGFAMPIIGISIVGTNYIQSTGKAKMAMLLSLLRQVIVLIPM------IAILPK------FFGLNGIWFAQPTADIVSSVVTGIFLLKEIKKYD 446
>gi|46908322|ref|YP_014711.1| MATE efflux family protein [Listeria monocytogenes str. 4b F2365] >gi|153167964|ref|ZP_01928016.1| hypothetical protein LMHG_02393 [Listeria monocytogenes FSL N1-017] >gi|153203190|ref|ZP_01944513.1| hypotehtical protein [Listeria monocytogenes HPB2262] >gi|167015221|ref|ZP_02277754.1| MATE efflux family protein [Listeria monocytogenes FSL J1-194] >gi|167214862|ref|ZP_02285169.1| MATE efflux family protein [Listeria monocytogenes FSL R2-503] >gi|167218034|ref|ZP_02287670.1| MATE efflux family protein [Listeria monocytogenes FSL J1-175] >gi|46881593|gb|AAT04888.1| MATE efflux family protein [Listeria monocytogenes str. 4b F2365] >gi|133726553|gb|EBA28251.1| hypothetical protein LMHG_02393 [Listeria monocytogenes FSL N1-017] >gi|133734685|gb|EBA36383.1| hypotehtical protein [Listeria monocytogenes HPB2262] (443 aa)
Score = 130, Expect = 2.3e-05, Identities = 99/491 (20%), Positives = 200/491 (40%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWN--VFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAY----NYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           N  + ET+S+ K+  + L+PSL   LL  + I +D I + H +           +  AG+                                  ++   V  IF +I ++I  GA+  FS A+ +++  K ++I+ ++      L++V   +I+ I  +I +  +A    +  + +          +L   N  + F       + + N+L  F+R +G       A ++  + N+I   +F  VF+  + G  ++ +I   + +L     IL   F  K          +LK  K++WN   F  +L + L +FL +  ++V  + Y I       +I+   G AGV+A    N   +V        I     G+   ++P+++Y      +++  + +K+       TGV F L        + LFG   + S F   +P    + +         +  +  +   ++ FQ++ K+ +    ++++ +IF    L
  S:     4 NMEILETDSVKKIYFRYLIPSLVGMLLMSLNIVIDGIFVGHKL---------GGVALAGI----------------------------------NIAVPVFTIFTAISIWIGIGAATQFSFAIGEKNVAKAQTIFTNAI-----LAVVSITVIIGIIAFIFKVPLAYFLGANDDTIG--------YVLEYMNILLVFGFA----LTLENILSIFVRNDGDPNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIIGVL-----ILITHFFKKS--------SRLKFVKVDWNKAFFKKTLAIGLPSFLAEVGVSVFTLGYNI-------SIAAIAGTAGVAAFSVLNYTHSV--------ILMLFLGMGSAIQPLISYYRGAKARQKEIETLKIAIMVAFSTGVGFLL--------VGLFGSNLLVSMFGNFSPEIKDLASNGIKLFYTAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIFMVIFL 404
>gi|167756669|ref|ZP_02428796.1| hypothetical protein CLORAM_02207 [Clostridium ramosum DSM 1402] >gi|167702844|gb|EDS17423.1| hypothetical protein CLORAM_02207 [Clostridium ramosum DSM 1402] (444 aa)
Score = 130, Expect = 2.4e-05, Identities = 84/373 (22%), Positives = 144/373 (38%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQF-PLLSLSISGLSLFQSTGKM 484
           V L+ ++I L +  G +  FS +L Q++K K      ++    +   ++ TVL     T ++E   A  TV                 L  A+ Y+  +        +      F RA+G       + LI   FNI+F+ I  +   M + G  I+ + G F++++    + L Y   N+          +LK            LI +L          +  +   ++ F   + +    GD  +S        QT+   P+         G++ G +P+++YN+   NY RVK    Y II G     +I  V +    F   ++   FN    +E+  L      + F F PLL   I   + FQ  GK+
  S:    60 VTLVLMAISLMVGVGGATRFSISLGQKEKDKASIYQGNAIVLTVVFGLMFTVLGNIFITPMLEVLGASKTV-----------------LPYASDYLSIVLYGAVFQCVAMCGNNFSRAQGNPKNAMISQLIGAGFNIVFDYILIIQLHMGMSGAAIATIGGQFLSMI----WQLCYLCSNRSLIKLDIEHMKLK------------LIYALDIIKTGIPAFLMQMANSVLNFILNSTLGMYGGDIAISTVGIITSFQTICQMPLT--------GLMQGQQPLISYNFGAGNYHRVKETLKYAIIGGT----MIAVVGFLAVQFFPETIIRMFNGE--AEVVKLGTKAIRIWFLFLPLLGAQIMTANYFQCIGKI 386
>gi|81427942|ref|YP_394941.1| putative drug:Na(+) antiporter (drug efflux pump) [Lactobacillus sakei subsp. sakei 23K] >gi|78609583|emb|CAI54629.1| Putative drug:Na(+) antiporter (drug efflux pump) [Lactobacillus sakei subsp. sakei 23K] (455 aa)
Score = 130, Expect = 2.4e-05, Identities = 87/391 (22%), Positives = 160/391 (40%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFF 500
           G +N++ I       +G S+L ++    QD +  K  + +S    L ++++LT+L M     I+   + K+  +               I+  A +++  I   I   M  NLL   +RA G S    F  ++  + NI+ + IF L FKM + G G + +    V+ +L    I  Y  +       +   ++ K+F+I        L + L    + + IA+  IV  I+    LN +  +   A  +AG        V  +          +G+   L    A NY  + Y R++V     ++  + FS+++ A+   I  FG P V  F     P    +  + F      + +L++  +     Q  G+  +  +A LA+ L+  F
  S:    54 GGLNMLIIGFCTGTTAGLSILTAQRYGAQDYRGVKRSFATSILISLVITVILTILSMVFSRQIL--VLMKTPTA---------------IIADAQQFIMIIFAGIFASMAFNLLSNIIRALGDSRTPLFFLIVGVVVNIVLDFIFILGFKMGVEGAGFATVSAQVVSAVLC--LIYIYRRIP------ALVLRR-KDFRITPKEVREHLKVGLPMGFQSSIIAIGAIVIQIM----LNTLGASAVAAYTAAGKIDQLANQVGNS----------FGV--ALATYAAQNYGARQYDRIRVGVRQTLLVSITFSIIMGAL---IITFGRPLVNIFIGTQQPHVTALAQIYFRYNSSCYFILAILFAIRYTLQGLGQSVMPTLAGLAELLMRIF 399
>gi|164687663|ref|ZP_02211691.1| hypothetical protein CLOBAR_01305 [Clostridium bartlettii DSM 16795] >gi|164603437|gb|EDQ96902.1| hypothetical protein CLOBAR_01305 [Clostridium bartlettii DSM 16795] (464 aa)
Score = 129, Expect = 2.5e-05, Identities = 97/476 (20%), Positives = 183/476 (38%)
  Q:    19 TESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLS-IVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           T+SIPKL  K  VPS+   ++  +Y  VDQ+ +        +  L NA                                       T++   ++   I++ L    GA+  F+ ++ + +K+K    ++ +    LF S ++L ++     T I++AC + + V                 L  A  Y+   +   P +++       +RA+G      F  ++ ++ N+I + IF   F M + G   + +IG   + ++V  ++  ++ V     P        K FK+N N       + + + +   S+ +  I+    + ++G L+    A   A   AG+            +  L F  + G+  G +PI ++NY  + Y RVK  Y      G + S+    + + +F      + S F + T       T  F   LF   +  +     + F S GK    I  SL +
  S:    11 TDSIPKLMFKFSVPSIIAMIVGALYNIVDQLFIGQ-----AVGTLGNA--------------------------------------ATNIAFPLSTSCIAVSLLFGIGAASCFNLSMGRGEKEK-SPFYIGNAIIMLFSSGVILFIITQLFLTQILKACGSPNDV-----------------LPYAQTYVRITSFGFPFLILSVGGGHIIRADGSPKISMFCNILGSVINVILDAIFIFGFNMGMAGAAYATIIGQIASTVVVIIYMKNFKTV-----PL-----LAKHFKLNINYIKEVASIGMASGINQLSMMIVQIILNNSLRYYGGLSIYGEAIPIA--CAGITMK---------VSQLFFSVVIGLSQGSQPIESFNYGAKKYHRVKYTYILANKAGAIISI----IAFILFQLFPMEIISLFGSGTEEYYQFATKFFRIFLFFICINFIQPITSTFFTSIGKPIKGIFLSLTR 403
>gi|90579064|ref|ZP_01234874.1| hypothetical MATE efflux family protein [Vibrio angustum S14] >gi|90439897|gb|EAS65078.1| hypothetical MATE efflux family protein [Vibrio angustum S14] (505 aa)
Score = 129, Expect = 2.5e-05, Identities = 68/313 (21%), Positives = 131/313 (41%)
  Q:   117 ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILF-YEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLI----FFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFW 429
           ISIG  I +GA  L SRAL + D+++ KS+  +     +F+SIV+   ++     +++A  AK  V+                  AA++Y+  +  S P++ +       +R  G +     A LI    N + + +F   F M + G  IS +I      L     +++ ++ + K D      F Q K              L++ T  +            I F   L   +T  G+A V++ +A      V+G  +   I    F  ++ +   + PI+  N+  + + R++ +    ++   V+ + ++ V W
  S:    76 ISIGTSIAAGA--LVSRALGKNDREQAKSMATNVMLFAVFISIVMVAAMLWNLPLLLDAIGAKGHVA-----------------EAASQYLIILLPSAPLMAVSMAAGAAMRGVGDARRSMMATLIGGGVNAVLDPLFIFGFSMGMQGAAISSVIARLAVTLFSLYVVIYKHKLLAKPD------FSQFK--------------LAMPTIAK------------IAFPAILTNTATPIGNAVVTSNIAQFGESFVAGYAVIGRIMPVCFALVFSLSGAVGPIIGQNFGAERWDRIQQILRDAMLFTAVYCIFVSVVLW 342
>gi|145955318|ref|ZP_01804322.1| hypothetical protein CdifQ_04001739 [Clostridium difficile QCD-32g58] (446 aa)
Score = 129, Expect = 2.7e-05, Identities = 68/303 (22%), Positives = 128/303 (42%)
  Q:   199 ILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           +  A+   + +    I II+   ++NLL F L    RA+G         ++  L NI+ + I    F + I G  I+ +     +  L A   + Y    K +  FS +       K++  +      + +  F    + ++  ++  I       A+ T  GD  + A    + I  V   PI+        GI  G +PI+ +NY  + Y RVK  Y    +  +V + +I  +   + +    ++   FN + P  +++        L   P++ LS++G +  QS GK  + ++ SL + +I   P
  S:   124 LFGASENTLIYAKSYINIILLGTVVNLLSFSLNHSIRADGSPKISAGIMIVGCLTNIVLDWILIFGFNLGIQGAAIATV----TSQALTAILTIGYYISGKSNLRFSKS-----NLKLDKKLIKAVFAIGMSPFAMQLAASLVQVISNI-------ALKTHGGDLAIGAMATISSIAMVFLMPIF--------GINQGAQPIIGFNYGAEKYDRVKKAY----LGSLVVATIILCMGMVVVMLFPEAIIGIFNKD-PELMNISVNGLRIYLLMLPIVGLSVTGTNFIQSIGKAKMAMLLSLLRQVILLIP 404
>gi|188589856|ref|YP_001919535.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] >gi|188500137|gb|ACD53273.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] (459 aa)
Score = 129, Expect = 2.8e-05, Identities = 73/274 (26%), Positives = 118/274 (43%)
  Q:   219 ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGII--TGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           I N+L F L    R++G       + LI  L NII + IF  V  + + GG I+ +I   V+     ++IL+Y    KG        K L   K+N  +  +  ++ +  F    S+ VA     ++   + N++    GDA + A    N +  +   P        I+G+  G++PI+ YN+  + Y R K    Y  I  T +V    I     P  L       S FN + P  + +        L   PL+   I   + FQS GK+ +++  SL
  S:   147 IFNMLSFGLNHSIRSDGSPKVAMLSMLIGALTNIILDPIFIFVLGLGVKGGAIATVISQIVS----TTWILYY--FTKGKSVLKIKRKYL---KLNKEIVASIFLIGMSPF----SMQVAQCAVQVI---SNNSLQRYGGDAAIGAMTIINSLVMIFLMP--------IFGLNQGMQPIVGYNFGAKKYDRTKKTLKYTAIAATTIVTIGFIVVETIPELLI------SIFNRD-PELLRIGVSGMRIFLVMLPLIGAQIVTTNYFQSIGKVKVSMFLSL 395
>gi|170727817|ref|YP_001761843.1| multi anti extrusion protein MatE [Shewanella woodyi ATCC 51908] >gi|169813164|gb|ACA87748.1| multi antimicrobial extrusion protein MatE [Shewanella woodyi ATCC 51908] (449 aa)
Score = 129, Expect = 2.8e-05, Identities = 98/461 (21%), Positives = 179/461 (38%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV----KVVYYYGIITGVVFSLLI-NAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           + IPKL  +  VP++   L+ GIY+ +D + + H +   G+         AG+                            M+ Y       V  +  ++G  +  G + L S  L Q    K + I  ++F  CL       +        I++   A+  V                 L++A+ Y+  Y+  G  PII +       LR +GR  F+T   ++    NI+ + +F +VF  +++G  I+ ++   V         L++   +K     + +  +L E    +N+  T     + +FL +  +++   ++ I F               V + L       VS T  +  + F   GI  G +PI ++N     Y RV    K+ +   ++T  +  L I     W +++F G ++       TP  I  + L F  L    P+  L + G S FQ+
  S:    15 DPIPKLLWRYTVPTILSMLVTGIYVAIDGMFVGHYLGETGL---------AGM----------------------------MLAY------PVGALLYAVGALLGMGGAALVSIYLGQGSVPKARKILGNTFSLCLIFGAFFAIFGSYFSRDILQLLGAEGAV-----------------LDSADDYLFWYYALGIFPIISVA--FTALLRNDGRPGFVTGVLILGGCLNIVLDWLFIVVFPFELVGAAIATMMSQAVT----GGLCLWHFLSDKTRLKITLSQMKL-ELDHCFNILKT----GVPSFLMNLYLSIVLTLHNIAFL-------------WVGSPLHVAAYGVVSYTEAFFYLVFE--GIAFGTQPIFSFNAGAGRYDRVFKTLKIAFGITLVTAFLGLLFIYTKPQWVVYIFAGDNLEL-----TPYAIEGMGLYFWGL----PMEGLLLVGASFFQA 387
>gi|88859206|ref|ZP_01133846.1| MATE efflux family protein [Pseudoalteromonas tunicata D2] >gi|88818223|gb|EAR28038.1| MATE efflux family protein [Pseudoalteromonas tunicata D2] (462 aa)
Score = 129, Expect = 2.9e-05, Identities = 86/398 (21%), Positives = 156/398 (39%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKE-FKINWNVFTTSL--ILSLGTFLRDASIAVANIVYVI--VFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           S +  + +  ISI   + SG + L +R L  + ++    ++ +SF   +  + +  +       +I E      T+                  + A+ Y+  I     I  I N +    RA G    +      A++ NII + +F  VF+ D+ G   + +I   + +++  +         KG+   SF+FK L    KI++ + +  L  +LS G F    SI +A  VY I  VF      +  A G                     +  +F  I G++  L+ +  YN+  + Y+RVK  Y   I     + +++      I  F   ++ + F +N  + I  L      + F  F   S  +    LFQ  GK     +   A+  +   P++Y
  S:    66 SSVFPIQMFLISISTMLGSGMASLIARYLGAKRQRDADIVFSTSFLLSIICAFIFCLFTFLALDHIYELLAVPLTLR-----------------DQASSYITPIIIFWVIGFISNQITEGFRASGNPKAMMQVLSTASILNIILDALFIFVFEWDVAGAAWATIIAVSLGLMMAIAL------QKKGESAVSFSFKNLTSPIKIHFKILSLGLPVLLSHGGF----SITIAVTVYSISTVFIDVSEPLIAAHGIL----------------VRCFMFLFLPIIGMMVALQTLSGYNFGAKQYQRVKQAYLVAIAMSATWGVVVTG----ILCFYSDTLLAMFTSN--ANIIKLGANIAPICFSGFITASFCMMSSGLFQGLGKALPATLLDAARTYVLLLPLMY 420
>gi|21226450|ref|NP_632372.1| putative cation efflux pump [Methanosarcina mazei Go1] >gi|20904712|gb|AAM30044.1| putative cation efflux pump [Methanosarcina mazei Go1] (489 aa)
Score = 129, Expect = 3.0e-05, Identities = 82/374 (21%), Positives = 167/374 (44%)
  Q:   132 SRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIV--YVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV-LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF--FFPILYS 505
           SR +  +DK    ++ V +F   L L++VLT + +S+   + +  +      T+ +  +Y +V        A  +++F T         N+    LR+EG S     + ++ +L N++ + IF  V  + + G  ++ +  +  + LL     +FY F  K +   SFAF+    FK N ++      +++ + +   ++A+  ++  Y+IV     +         GV+       I +++ +P        + GI   +  I    + +++YK+ +    Y   TG    L+  AV   +++F      +F  A   ++I   LT L   +   +P ++  +   SLFQ  GK    ++A+L + LI    F +L++
  S:   111 SRRIGARDKAGADNVAVHTFVIMLVLTVVLTGIGLSL---VRDLFVFSGAGETTPLGVAYARVLF------AGSFVFFFT---------NVANSILRSEGDSKRAMQSMVLGSLLNVVLDPIFIYVLDLGVAGAALATVFSFSCSGLL-----MFYWFFIKKNTYISFAFRS---FKFNRDIAKDIFRVAIPSSIEQVALALTALIMNYIIVNVSNTD---------GVAVYATAWRITSIAVSP--------LIGISISVVSISGAAFGERSYKKARSALLYATRTGF---LVEAAVAVAVYIFAPYIAGAFTQAENTAQIAPELTRLLKIMTVFYPAVAFGMLSASLFQGAGKGTSALIATLLRSLILTPVFALLFA 443
>gi|167625002|ref|YP_001675296.1| MATE efflux family protein [Shewanella halifaxensis HAW-EB4] >gi|167355024|gb|ABZ77637.1| MATE efflux family protein [Shewanella halifaxensis HAW-EB4] (458 aa)
Score = 128, Expect = 3.2e-05, Identities = 107/486 (22%), Positives = 190/486 (39%)
  Q:    19 TESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSL-LINAVFWPIFLFGGPSVTSFFNAN-----TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQG--LIFFFPILY 504
           TE I KL  +  +P++   L+ GIY+ +D + + H        YL    L+  +    I +VL                                    +IG  +  G + L S    Q +    + I  ++F  CL   ++ TVL       I+    A+                   IL++A+ Y+  YF  G+ PI+ +       LR +GR  F+TF  ++  + N + + +  +VF   ++G  I+ +I   V      +  L + F ++ +   +     L++ K+ W+     + +   +FL +  + V   ++ + F               V   L       VS T  +  + F   GI  G++PIL++N   + + RVK          + FS+ L+ A    +F++  P +  +  A      TP     +   F  L    P+  L + G S FQ+      +  AS+  G  LI F  ILY
  S:    23 TEPIGKLFWRYSIPTILSMLVTGIYVTIDGMFIGH--------YLGEVGLAGMILAYPIAAVL-----------------------------------YAIGATLGMGGAALVSIHQGQGEPHIARRILGNTFSLCLISGLITTVLGCYFSRDILVLLGAEGE-----------------ILSSADDYLFWYFALGTFPIVSMA--FTTLLRNDGRPGFVTFVLILGGVLNTVLDWLLIVVFPYGLMGAAIATMISQAVT----GALCLQHFFSSRTEIGIN-----LEQMKLKWDHCVNIIRVGTPSFLMNMYLTVVLTLHNVAFL-------------TVGTPLHVAAYGVVSYTEAFFYLLFE--GIAFGVQPILSFNAGAKRFDRVKQAL------KMAFSVTLVCAALGLVFIYSVPQLFVYIFAGDNALLTPIATEGMRWYFWGL----PMEGLLLVGASFFQAIN---YSKEASILTGAKLILFAAILY 419
>gi|126700490|ref|YP_001089387.1| putative drug/sodium antiporter [Clostridium difficile 630] >gi|115251927|emb|CAJ69762.1| putative drug/sodium antiporter [Clostridium difficile 630] (446 aa)
Score = 128, Expect = 3.3e-05, Identities = 72/306 (23%), Positives = 133/306 (43%)
  Q:   198 LILNAANKYMYFITGSIPIIM---ILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVV---FSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTL-LFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
            IL A+   +++    + +I+   I NL+ F L    RAEG         ++  + N+I + IF  VF + I G  I+ ++       +V  F + + F+                  I   VF     + +  F  + +I++ ++        T N++    GD  + A  A         T I  +    ++G+  G++ I++YNY  + Y+R K      II  VV   F  L+  VF  +F+         FN +  S++  + +   +L L   P++ +SI G   FQ   K+  ++  +L +  I F P++
  S:   123 FILGASKDSIFYAKDYMSVILVGSIFNLVAFSLNNAIRAEGNPKLAARTMIVGCVLNLILDPIFIFVFNLGIKGAAIATVL-----CQIVVFFWVIHYFIRGKSNLKLKKCNLKLNKDIVKKVFA----IGMTPFAMEVAISITHMF-------TNNSLKVYGGDLAIGAMTAL--------TSILLMFMMPVFGLNQGMQTIISYNYGAKQYERAKKTLILSIIVSVVILSFGFLVVQVFPEVFV-------GIFNKD--SDLMDIAVRGISLNLITLPIMGISIVGPVYFQCISKVKHSMFLTLLRQFILFIPLI 406
>gi|153811948|ref|ZP_01964616.1| hypothetical protein RUMOBE_02341 [Ruminococcus obeum ATCC 29174] >gi|149832082|gb|EDM87167.1| hypothetical protein RUMOBE_02341 [Ruminococcus obeum ATCC 29174] (425 aa)
Score = 128, Expect = 3.5e-05, Identities = 75/278 (26%), Positives = 116/278 (41%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLI-------LSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAI-YGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF--WP---IFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
            +RA+    +     LI  + N I + +F   FK  I GG  + +IG F++ +LV  +                 F + +   +  N+F   LI       L L + +   +I    IV    + ++G   A S    D  ++          V      N++F AI  GI  G +PI  +NY  + Y RV+  Y Y      + +      F  +P   I +FGG S   F  A     I      F  L F   +  +S SG   F S GK  L I+ SL + +IF  P++
  S:   130 LIRADRSPTYSMVCTLIGAIINTILDPLFIFGFKWGIKGGAWATVIGQFISAMLVVLY-----------------FAKFRHMHLERNMFKPQLIHLKAISSLGLASCINQIAIGAVQIVMNNTLRYYG---ASSVYGSDIPIAC---------VGIVSKVNMVFLAICIGIAQGAQPIWGFNYGAKKYDRVRQAYRYSATACTIIATFFFLCFQIFPHQIISMFGGGSDLYFKFAENYLRI------FMLLTFANGIQPMS-SG--FFTSIGKAGLGIIMSLTRQVIFLLPLI 384
>gi|47091755|ref|ZP_00229550.1| MATE efflux family protein [Listeria monocytogenes str. 4b H7858] >gi|47019766|gb|EAL10504.1| MATE efflux family protein [Listeria monocytogenes str. 4b H7858] (413 aa)
Score = 128, Expect = 3.5e-05, Identities = 81/389 (20%), Positives = 168/389 (43%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWN--VFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAY----NYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IF +I ++I  GA+  FS A+ +++  K ++I+ ++      L++V   +I+ I  +I +  +A    +  + +          +L   N  + F       + + N+L  F+R +G       A ++  + N+I   +F  VF+  + G  ++ +I   + +L     IL   F  K          +LK  K++WN   F  +L + L +FL +  ++V  + Y I       +I+   G AGV+A    N   +V        I     G+   ++P+++Y      +++  + +K+       TGV F L        + LFG   + S F   +P    + +         +  +  +   ++ FQ++ K+ +    ++++ +IF    L
  S:    33 IFTAISIWIGIGAATQFSFAIGEKNVAKAQTIFTNAI-----LAVVSITVIIGIIAFIFKVPLAYFLGANDDTIG--------YVLEYMNILLVFGFA----LTLENILSIFVRNDGDPNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIIGVL-----ILITHFFKKS--------SRLKFVKVDWNKAFFKKTLAIGLPSFLAEVGVSVFTLGYNI-------SIAAIAGTAGVAAFSVLNYTHSV--------ILMLFLGMGSAIQPLISYYRGAKARQKEIETLKIAIMVAFSTGVGFLL--------VGLFGSNLLVSMFGNFSPEIKDLASNGIKLFYTAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIFMVIFL 374
>gi|164687052|ref|ZP_02211080.1| hypothetical protein CLOBAR_00678 [Clostridium bartlettii DSM 16795] >gi|164603937|gb|EDQ97402.1| hypothetical protein CLOBAR_00678 [Clostridium bartlettii DSM 16795] (454 aa)
Score = 128, Expect = 3.5e-05, Identities = 75/294 (25%), Positives = 136/294 (46%)
  Q:   216 IIMILNLLIFF-------LRAEGRSYFITFAALIANLFNIIFELIF----FLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN-TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           I+++L+  +FF        +A G+    T + +I  + NII + IF    F + K+ + G  I+ +IG  V+ L++  F +  + V K D         LK FK +WN+      + + + L         I    +   +LN++     +  VS    +  +QT    P+         G+V G+RPI+ +NY  ++  R+       +I  VV  L    +   +F+F    + S F+A+     + V+TL   +L F F  +S  IS  ++++S GK   ++  SL +  I   P+    + I
  S:   140 IVVLLSFSLFFQLTFEKVFQATGKMLLPTISQIIGAILNIILDPIFIFGWFGMPKLGVTGAAIATVIGQIVSFLILLIFFIRNDSVLKID---------LKLFKFDWNIIKQIYAVGIPSALM--------ISISSILTISLNSVLVKFSNTAVSIYGIYYRLQTFITMPVN--------GLVQGIRPIIGFNYGAKDRGRIIETLKISLIVSVVLML----IGLLLFMFIPRQLLSMFSASENMMSLGVVTLRIMSLGFLFSAISFIIS--AMYESIGKGTYSLAISLVRQCIIIIPVSMFFYKI 414
>gi|164687386|ref|ZP_02211414.1| hypothetical protein CLOBAR_01027 [Clostridium bartlettii DSM 16795] >gi|164603810|gb|EDQ97275.1| hypothetical protein CLOBAR_01027 [Clostridium bartlettii DSM 16795] (453 aa)
Score = 128, Expect = 4.0e-05, Identities = 86/385 (22%), Positives = 157/385 (40%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILS-LGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTL-LFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           LIF  +GL    G+ +L S      +K+K    +++   S + L++VL+++      Y+   CI              N     L+L      M F     P+ ++ N L   +R       +    L  +  NII + +F     M + G  ++ +IG    +L++++  +                K+    KIN    +  L+   L        + VAN   + +F   +  +     +  V  G+  N +  + G  ++N       G+    +PI+A N+  +   RVK V  Y +IT  +  + + AV   +FLF G  +  F  AN  +EI  + +    L L  F +++++I     FQS GK  + I  S+ +G + 
  S:    62 LIFNGLGLLFGIGSGILISAEDGMGNKKKSNQYFITGLVSVVSLALVLSLIW---NHYLESLCIFLGA----------NDDTIGLVLEYGKCIMMFA----PVFIMSNYLAPIIRNMKNPKLVMCGVLTGSFLNIILDYVFVFPMDMGMFGAALATVIGSVTTVLVLSTHFI----------------KKQNRVKINKETISLKLVTPILKCGFSSLIMEVANGFVIFIF--NIQILKYIGNNGIVVYGIISNCV--LVGLALFN-------GVAQAAQPIIATNFGAKESSRVKKVLKYAMITTTIIGISLFAV---VFLFTGQVIQIFVKAN--AEILSVGIPALRLYLSAFCIMNINILISGYFQSVGKEKIAIYVSIVRGFLL 399
>gi|189459758|ref|ZP_03008543.1| hypothetical protein BACCOP_00386 [Bacteroides coprocola DSM 17136] >gi|189433540|gb|EDV02525.1| hypothetical protein BACCOP_00386 [Bacteroides coprocola DSM 17136] (448 aa)
Score = 128, Expect = 4.1e-05, Identities = 106/505 (20%), Positives = 203/505 (40%)
  Q:    17 YETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-EIHVLTL-LFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLI------FFFPILYSMWNIAILVSDYKVMLF 521
           ++T +IPKL  K+L+P++   +   I+I  D I                  +  G+  D + +V                          ++   + LI   + L    GASV+ S  L+Q    K K   ++   + +  S++L +  + I             VS  E V  +     +L L  A +YMY+    +    +L   +FF+R +G   +     +I  + NI+ + +F  + K  + G  ++  +GY V  +++ +++   E +            +L +  +   +     +  LG  +FL + +IA    V   VF   L       G+ GV+A               + ++F     I    +PIL+YNY  +   RV+  +   + T +   L    VF   ++F    V  F +++ P+  I V  L LF +    F    ++I  +  FQS  +    ++ +L +G +      +  PI++  W I + V   +++ F
  S:     7 FKTMNIPKLFRKLLIPTVLGMIFNAIFIITDGIF-----------------VGKGIGSDALAAV--------------------------NITAPLFLINTGVALMFGIGASVVASVHLSQG---KAKVARINVTQAIIVSSVLLLIYAIGI-------------VSNVERVAVWLGSSERL-LPLAVEYMYWFVPFLVFSALLCSGMFFVRLDGAPNYAMVCNIIPAIINIVLDYVFIFILKWGMFGAALATSLGYIVGAVMILAYLFHPERI------LHVCRVKLSKKSLYLTIRNVGYMCRLGFSSFLCETAIATMMFVGNYVFIRYL-------GEDGVAA--------YSIACYFFPIVFMVYNAIAQSAQPILSYNYGAKCTARVRETFRLALTTAI---LCGAGVFLLTWIFSHQIVGMFLDSSYPAYNIAVKGLPLFAS---GFVFFGINIVSIGYFQSLERDCPAMIITLLRGFVLILLCFWILPIIWGSWGIWLAVPMSELLTF 434
>gi|169829925|ref|YP_001700083.1| hypothetical protein Bsph_4502 [Lysinibacillus sphaericus C3-41] >gi|168994413|gb|ACA41953.1| conserved hypothetical protein [Lysinibacillus sphaericus C3-41] (449 aa)
Score = 128, Expect = 4.1e-05, Identities = 86/389 (22%), Positives = 160/389 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL--INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           I +SI L+I  G + L+S +L + +KQ+   ++  +F +   L +VLT++          + I  ++  T   V  Y    H ++L     +  F T       I NLL  F+R +G         +  ++ NII   IF  V    + G  ++  I   +      + +  + F  + +  F  +F        N         + L +F+ +AS+AV  I+Y + F   L       G +GV+A    N I TV        +     GI   L+P+++Y++  +  +R+  +   G+ T  +  L   + A+ +P        + + F  ++    H+ T  F      +  L +++     FQS  K+ +     L + +I F P L
  S:    64 ILLSISLWIGMGGATLYSISLGEGNKQRAHQLFTLAFTT--MLVVVLTIIGFLAFNLKDISYIFGASDDTYPYVQEY---LHVILL-----FGVFYT-------IENLLSIFIRNDGNPKLAMLGLITTSVLNIILNYIFIFVLDYGVTGCALATAIATIIG----TAVLCLHFFRPQSELKFVSSF-------FNKTDLRKIFAIGLPSFIVEASVAVIIILYNVTFLHYL-------GASGVTAYAMVNYIHTV--------LLTIFLGIGMALQPLVSYHHGARLLERLTALLKIGLATAFILGLTTALIAMLFP------SQLMALFGDSSFEIRHMATQGFVHFAIGYVFLGINMVLAEFFQSIEKIRIATTIMLLRSIILFIPTL 405
>gi|28211993|ref|NP_782937.1| Na+ driven multidrug efflux pump [Clostridium tetani E88] >gi|28204436|gb|AAO36874.1| Na+ driven multidrug efflux pump [Clostridium tetani E88] (452 aa)
Score = 128, Expect = 4.2e-05, Identities = 85/436 (19%), Positives = 175/436 (40%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLH 543
           V   + +I  +  + +  G + + S  + ++D +  + I  + F + + +S++LT  +M     ++    A                     L  A +YM   T     + +   +  F+ ++G +        I  + NI+ + IF   FKM++ G  ++ +I   ++    A +++++   NK +        + +  K++ N+    L+L L  F+   + +     ++I+ F +  ++    GD  V A            +      F  + G+  G +PI++YNY   N +R+K  + Y  I+ VV+S L    FW +F+   P V S    N    I + T      +     L + I+    F + G    ++  +L + +    P+++      IL       +F  F +  IS I   I + I  +
  S:    57 VTAPILIIISAFSVLVGMGGAPIASIKMGEKDDKGAEKIIGNCFVALIIISVILTGFLMIFNEKLLIMFGASDKT-----------------LPYALEYMKIYTIGTIFVQLAIGMNPFISSQGFAKISMITVSIGAIINIVLDPIFIYGFKMNVKGAALATIISQAIS----AIWVIYFLKGNKTNLKL-----RRENLKLDRNIMGAILLLGLSPFVMQITES-----FIIIAFNS--SLQKYGGDVAVGAMTIL--------SAAMQFTFLPLSGLTQGAQPIMSYNYGAGNKERMKDTFKYLCISTVVYSTL----FW-LFIMIAPQVFSQLFTNNKDIIDMATQGLRIYMGGAFALGIQIACQQTFIALGNAKTSLFLALLRKVFLLIPLVF------ILPKIIPNRVFAVFLSEPISDIIAAIVTGILFY 440
>gi|159905171|ref|YP_001548833.1| MATE efflux family protein [Methanococcus maripaludis C6] >gi|159886664|gb|ABX01601.1| MATE efflux family protein [Methanococcus maripaludis C6] (460 aa)
Score = 127, Expect = 4.5e-05, Identities = 63/302 (20%), Positives = 129/302 (42%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQF-PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           A +Y   + G   +++  N+    LR EG +    +A ++ ++ NI+ + IF  V  M + G   + L+      L++   +  Y    K D     +F++   FK+++N+      + L   +   ++AV+  +   +       ++ A G+ G++           +G  I ++    + G+  G+  +    Y   N ++++  Y Y I  GV+  L+I  +   I LF       F  ++    I    L+F   +F F P + L +   ++FQ   K   ++  SL + +I   P+ Y
  S:   133 AVEYSTILFGGAVVLLFTNIANAILRGEGDTKRAMYAIILGSVLNIVLDPIFIYVLNMGVAGAAWATLLS-----LVITGILFVYWLFIKKDTFLKISFEK---FKLDFNIIKEIFSIGLPASISQLTMAVSMFLLTAI-------VAKAGGNDGIAV--------FSTGWRIVSMGTIPLVGLATGVTVVTGAAYGSANPEKLETSYKYAIKIGVIVELIIAVL---ILLFENQIAYLFTYSDNSVHILGDLLVFLKYMFIFYPTVPLGMLTAAMFQGVSKGNNSLFISLLRTIILQIPMAY 409
>gi|168335078|ref|ZP_02693188.1| Na+ driven multidrug efflux pump [Epulopiscium sp. 'N.t. morphotype B'] (469 aa)
Score = 127, Expect = 4.8e-05, Identities = 91/393 (23%), Positives = 151/393 (38%)
  Q:    14 ESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV 406
           E  + TES+ KL   +++P+    L+  +Y  VD++ +  I P  G    E AL   GLT      +L                                 I +++  F  SG + L SR L +QD  K K I  +S    +  SI+LTV+      YI +  +       SE    Y      + L     ++ F  G  P          F+  +G +    F+ LI  + NII + IF  VF M + G  I+ +I    + + +  ++   + V + D+         K+  +  +     + + +   +  ++ ++ NIV    F           GD  V A    + I T+         F  I  +  G+ PILAYNY  +N KR+
  S:    15 EKRFATESLNKLIWAMVMPAFMAQLINALYNIVDRVYIGRI-PGEG----ELALTGLGLT----FPILQ--------------------------------IVVAMSAFAGSGGAPLASRYLGRQDYNKAKDILQTSATLLIIFSIILTVVF-----YIAKEPLL-YLFGASEHTAPYADAYLSIYL-LGTIFVQFSVGLNP----------FISGQGNAKIAMFSTLIGAVINIILDPIFIFVFDMGVQGAAIATVISQAASAIWIVRYLTSDKSVVRLDF---------KKLGLKKDCVMAIVAIGISPVIMQSTNSLVNIVLNSSF-------QHYGGDMYVGAMTILSSIATMQ--------FIPIDAVRQGVIPILAYNYGARNKKRL 325
>gi|167764433|ref|ZP_02436554.1| hypothetical protein BACSTE_02817 [Bacteroides stercoris ATCC 43183] >gi|167697102|gb|EDS13681.1| hypothetical protein BACSTE_02817 [Bacteroides stercoris ATCC 43183] (450 aa)
Score = 127, Expect = 4.9e-05, Identities = 73/304 (24%), Positives = 123/304 (40%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           L  A  +M  I    P+   +  L   +RA G        +++  + NII   IF   F   I G   + +I  F+ ++ V S      F+ K     S    Q   +K+   + ++   + +  FL + +   A ++ +IV     N++    GD  + A    N +          L    + G+  G++PI+ YN+  Q Y RVK      I+TGV  +   +  F    LF  P   S    +    I + +      +  FPL+   I   + FQS GK  ++I  SL + L++  P L
  S:   130 LPYARNFMQIILLGTPVTYTMIGLNNIMRATGYPKKAMLTSMVTVVCNIILAPIFIFHFDWGIRGAATATVISQFIGMIWVVS-----HFLQKT----SIVRLQPGFWKMKKRIISSIFSIGMSPFLMNVT---ACVIVIIVN----NSLQRYGGDMAIGAYGIMNRLLV--------LYVMIVLGLTMGMQPIVGYNFGAQKYDRVKATLRLSILTGVCIT---STGFIICELF--PHAVSAVFTSDGQLIDMASRGVRIGIAMFPLVGAQIVIGNFFQSIGKAKISIFLSLTRQLLYLLPGL 404
>gi|167749721|ref|ZP_02421848.1| hypothetical protein EUBSIR_00679 [Eubacterium siraeum DSM 15702] >gi|167657344|gb|EDS01474.1| hypothetical protein EUBSIR_00679 [Eubacterium siraeum DSM 15702] (452 aa)
Score = 127, Expect = 5.0e-05, Identities = 75/327 (22%), Positives = 134/327 (40%)
  Q:   109 IGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLIN--AVFWPIFLFG 435
           IG  + I I I  F   +  G + L S AL + D+++   I  + F     L ++ TV+   I    +E  +    +  S+    Y          A +    ++TG++  +M    L  F+ A+GR      A +I  + NI  + +F  VF M + G  ++ +I   V+  ++  F++  +   K          + K  K +  +  +   L +  F+  ++ ++   V        LN   +A GD  VS           +  P+         G   G  PI++YNY K N  RV++ + Y +I    F  L N   + +P F+ G
  S:    57 IGVTSSIIILISAFSQIVGGGGAPLASIALGKGDRERAHRILGNGFS----LLVLFTVVTSGITYIFMEPLL--RLIGASDATIGY----------ATDYLSVYLTGTL-FVMFATGLNSFINAQGRPGISMIAVIIGAILNIGLDPLFIYVFGMGVTGAALATVISQAVSAFVIVGFLVSDKATLK---------IKPKYLKPDIKIIGSLFALGIAPFIMASTESLVGFV--------LNGSLSAYGDIYVSTLTVMQSAMQFAAVPLS--------GFAQGFVPIVSYNYGKGNTDRVRLCFKYSVIIMFSFFALTNLFMITFPEFVAG 346
>gi|160941385|ref|ZP_02088722.1| hypothetical protein CLOBOL_06278 [Clostridium bolteae ATCC BAA-613] >gi|158435946|gb|EDP13713.1| hypothetical protein CLOBOL_06278 [Clostridium bolteae ATCC BAA-613] (468 aa)
Score = 127, Expect = 5.0e-05, Identities = 88/467 (18%), Positives = 172/467 (36%)
  Q:    16 MYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTG 482
           ++E   +PK  +++ VP++  SL+  IY   D            +  + N + +A +T                                  +   V L F ++      G+S + SRAL ++D +  +      FY  LF  ++ +VL                TV  + ++       + +   A       + G+ P I+ + ++ + +RAEG S   +   +   L NII + IF L +  D+   G   L  +  N +    F +      K  +             IN   F+    + LG        A+ N++ V      LN  +++ G   V+A       Q ++  P+         G   G+ P+++YNY   N++R+K   ++ I T + F ++++  +     F G  + +    +  + +   T          P L +    + +FQ+ G
  S:     8 LFEKTPVPKAVMQLAVPTILSSLVMVIYNLADTYF---------VGMMNNPVQNAAVT----------------------------------LAAPVLLAFNAVNNLFGVGSSSMMSRALGRRDYESVRRSSAFGFYCALFFGLLFSVL---------------CTVGLNPLLILLGADANTMDATAGYLKWTVLFGAAPAILNV-VMAYMVRAEGSSLHASIGTMSGCLLNIILDPIFILPWGFDMGAAGAG-LATFLSNCVACVYFFVLLRVRRKTTF-----------VCINPEKFSLQKYIVLGVCAVGIPAAIQNLLNV-TGMTILNNFTSSYGAQAVAA---MGITQKINMVPLQ-----VAMGFSQGIMPLISYNYASGNHRRMKETIFFTIKTLLPFLVVVSLGY-----FAGAGLLTRAFMDNEAIVAYGTRFLRGFCLGLPFLCMDFLAVGVFQAVG 389
>gi|167754814|ref|ZP_02426941.1| hypothetical protein CLORAM_00318 [Clostridium ramosum DSM 1402] >gi|167704864|gb|EDS19443.1| hypothetical protein CLORAM_00318 [Clostridium ramosum DSM 1402] (446 aa)
Score = 127, Expect = 5.0e-05, Identities = 89/381 (23%), Positives = 155/381 (40%)
  Q:   126 GASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVF----KMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKR----VKVVYYYG---IITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           G + L SR+L ++++       V+S +  L  +++  +  +++                        Q  +  I+NA  +Y   + G    +    L    L+A GR+ F      +  + NII + IF        KM + G  ++ + G  +  LL   F L      K ++   F FK+ +      N      I S+G      SI + +I  V+ F G    + T    A    G+ F          + + +F  ++G+ +G+ PI+AYN   +  KR    +K+   Y    +I GV+F   I     P  L G      FFNA + + I + T     +   F     SI   + FQ+ GK   +++ SL + L+   P  Y +
  S:    72 GVNALLSRSLGEKNQDHVNQTAVNSVFIFLVTAVIFMIAGLTLSNLFFNV-----------------QTTNTEIVNAGTQYSMIVVGCSIGLFCQFLFERLLQATGRTLFTMVTQGLGAIINIILDPIFIFGLCGFPKMGVAGAALATITGQIIACLLALFFNL------KFNHDIHFKFKRFRP-----NAHIVKQIYSVGI----PSIIMQSIGSVMTF-GMNTILITFSTTATAVFGVYFK---------LQSFVFMPVFGLNNGMIPIIAYNLGAKQKKRMFDTIKLAMIYATGMMIIGVIFFETI-----PQTLLG------FFNA-SEAMIKIGTPALRIIAIHFIFAGFSIVCSATFQAVGKGTYSLLTSLIRQLLVLLPCAYVL 409
>gi|88804390|ref|ZP_01119910.1| Na+-driven multidrug efflux pump [Robiginitalea biformata HTCC2501] >gi|88785269|gb|EAR16438.1| Na+-driven multidrug efflux pump [Robiginitalea biformata HTCC2501] (458 aa)
Score = 127, Expect = 5.1e-05, Identities = 92/402 (22%), Positives = 175/402 (43%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVF-----TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN----TPSEI----HVLTLLFCTLLFQF---PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWN 508
           +V+  V+    ++G+ I  G S + SRAL     +K     + +F + + L+I++T  ++++  Y V+A I                     I + A  Y   +   +P + +  +    +RAEG+  F   A +I ++ N++ + +F  +F   + G   +    Y    LL   +IL+            F   +  E K  W+         S I SLG F+  A  AV +I Y+++       +    G+A V+       +  + G  +     F ++G+  G  PI  +NY  + Y RVK   Y    T V ++ L+    + + +     +   F +N    + +EI     VL      + + F   P+++L + G + FQ+ GK    ++ +L +   FF P++  + N
  S:    56 NVVLPVSFFIAALGMAIGIGGSSIISRALGADHPEKA----LKTFGNQITLTILITCSMVALGLYFVDALIPAFGGKGD-------------IFDPAKIYYKIVLYGVPFLALCMMGNTVIRAEGKPKFAMIAMIIPSVGNLVLDYVFIYIFDWGMHGAAWATTGSY----LLCFGYILY------------FFLSRNSELKPGWHHLGLDRPILSEIGSLG-FVTLARQAVTSITYLLLNN----ILFNLGGEASVA-------VYAIIGRMLM-FALFPVFGVTQGFLPIAGFNYGARKYPRVKESIY----TAVKYAALVATGVFVLLMVFPAEIADLFLSNREDMSAAEIAANNFVLEHAPAAMRWVFAATPIIALQLIGAAYFQAIGKATPALLLTLTRQGFFFIPLILILPN 423
>gi|187250812|ref|YP_001875294.1| MATE efflux family protein [Elusimicrobium minutum Pei191] >gi|186970972|gb|ACC97957.1| MATE efflux family protein [Elusimicrobium minutum Pei191] (456 aa)
Score = 127, Expect = 5.3e-05, Identities = 85/381 (22%), Positives = 154/381 (40%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGI--ITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           L  ++  + I  G SVLFS +L ++  +  + +  ++F   LF+ + L V I  +    +   +  S                + +   A  YM  I    PI  +   +  FLRA+GR     F  LI  + N I   +F   ++  + G    +++   V+ + V      + FV K    F   FK    F +   + + +L +    F+ + +++V N++  +   G         GD  VSA    + + T        LI   + GI  GL+ I+ Y Y  + YKR+      GI   +G+  +  I      I +   P + + F+  TP   H+ +          PL+   I   + FQ+T +    I+ +L++
  S:    73 LFIMACSIMIGVGGSVLFSISLGKKGYKLAERVLGNTFV-LLFIVVSLVVGIWELSMDHMLKLLGAS----------------KAVAPLAKAYMRIILIGAPIQAVGMGMNNFLRAQGRPLLAMFTMLIGAVINCILGPLFIFYYQWGMEGAAWGVVLSQLVSAVWVC-----WHFVGK-KARFKLKFKN---FVLKAKIVSKTLTIGSSQFVLNTAVSVLNVILNLTLVGF-------GGDLAVSAMGIVSSVNT--------LIIMPVIGIGQGLQSIIGYYYGAKYYKRMLQFLKMGINWASGITLTGFI------IVMLFAPYIVALFHRGTPELTHLASYALRVFNICIPLVGFQIVASTFFQATERAGKAIILTLSR 408
>gi|188993870|ref|YP_001928122.1| putative Na+driven multidrug efflux pump [Porphyromonas gingivalis ATCC 33277] >gi|188593550|dbj|BAG32525.1| putative Na+driven multidrug efflux pump [Porphyromonas gingivalis ATCC 33277] (459 aa)
Score = 127, Expect = 5.4e-05, Identities = 64/277 (23%), Positives = 113/277 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +RA G         +I  + N++ + IF     M I G  I+ +I      ++V S  +   F  K     S        F+++  V      + +  F    + ++ NI+        +N    + G+   +  LA      ++G  +  L F  I G+  G++PI+ +NY  +N  RVK  Y Y    GV  +LL++ + + + +    ++ S F  N+   I +      T L    L+   ++    FQS G     I  SL + +IF  P L
  S:   159 MRASGYPRKAMITMIIGAMTNVVLDYIFIYPLGMGISGAAIATVIS-----MIVCSVYVLSHFFRKD----SIVRFHRSAFRLSLPVIGGITAIGVAPFAMHLTGSLVNII--------MNRSFVSYGETADATDLAIGAFGIINGYAM--LFFMIIIGVAQGMQPIVGFNYGAKNPGRVKSAYRYS--CGV--NLLVSFLGFALAMLMPRTIVSLF-TNSEQMIELSASALRTALIGLSLVGFQVTTTQFFQSIGFSHKAIFLSLTRQIIFLIPCL 411
>gi|116334271|ref|YP_795798.1| Na+-driven multidrug efflux pump [Lactobacillus brevis ATCC 367] >gi|116099618|gb|ABJ64767.1| Na+-driven multidrug efflux pump [Lactobacillus brevis ATCC 367] (443 aa)
Score = 126, Expect = 5.5e-05, Identities = 83/385 (21%), Positives = 157/385 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGT--LNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLA-QGLIFF 499
           + I+IG     G S L SR L ++  Q    +     Y  +   ++ T+L+++ +  I+    A +                     AA  Y     G++PII+ + +    +R EG +       ++  +  II + I      M+  G  ++ +IGY ++  ++      Y  V   D   S         +I+ ++    L + +            +I  ++  FGT  LN      G   V+A G+            +Y +I   + G   G +P++ Y +  +N  R K + ++ ++  VV++L    VF  I +   P + + F  N P+ I   T +    L   P +   +   ++FQSTGK     + S+A QG++F+
  S:    60 LLIAIGDIFGLGGSSLISRLLGEKAFQTGSRVSSFCLYGAVVFGLLTTILLLAFERPILHLLGATTATYAY----------------AAQFYRIMALGAMPIIVSI-VPGNLIRTEGFATQSMIGTMVGTVITIILDPILIFSLGMEAAGAALATVIGYMISASVLVYLTWRYCQVVSVDVRLS---------RIDGHLLRQVLFIGIP----------GSITNLMQAFGTAVLNRYLVDYGPTRVAAMGIVLK---------VYMIIMLVMVGFAFGAQPLIGYTFGAKNRARFKQILHFDLLVEVVYAL----VFAVILMIFAPQLMALFLHN-PAVIQTGTYMLRAFLVTTPFVGAVLVYTTVFQSTGKASGAFIMSIARQGVVFY 398
>gi|21226446|ref|NP_632368.1| putative cation efflux pump [Methanosarcina mazei Go1] >gi|20904708|gb|AAM30040.1| putative cation efflux pump [Methanosarcina mazei Go1] (478 aa)
Score = 126, Expect = 5.8e-05, Identities = 83/367 (22%), Positives = 152/367 (41%)
  Q:   132 SRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV---LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           SR +  +DK    ++ V +    + L ++ T+       +I     A  T   +++  +Y +V                 GSI +I   N+    LR+EG S    +A ++    NI+ + IF   FKM I G   + L+   V+  ++ +++ F     K D   SF FK    E  I  ++F  ++  S        S+ V N++ V         +S+  G A  S G     + T++  P        + GI   +  +    +  +++++ K  + Y +  G+   L+   V    F+F  P + + F   T    H+   L      +   +P +SL +   SLFQ  GK F  + A+L + ++F
  S:    96 SRKIGARDKAGADNVAVHTIIIMMLLVLIFTIPFYVFAPHIFSLVGAGKT---TDLAVAYARV--------------IFLGSI-VIFFTNVANSILRSEGDSKRAMYAMVLGAALNIVIDPIFIYTFKMGIAGAAWATLLSLAVSSAMMLNWLFF-----KKDTFVSFDFKDFSFEKSIINDIFRIAVPASAQQLSMSLSMLVLNLIIV--------NVSSTDGVAVYSTGWR---VATIAIAP--------LVGIATAVVSVSGAAFGAKDFEKAKTAHTYAVKVGL---LIEGGVAAFTFIF-APQIAAVF-TQTEEAAHIAPDLIQFLRIICIFYPTVSLGMLSTSLFQGAGKGFSALTANLLRTIVF 419
>gi|19704279|ref|NP_603841.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714513|gb|AAL95140.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (455 aa)
Score = 126, Expect = 6.4e-05, Identities = 82/346 (23%), Positives = 140/346 (40%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY----VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAI-YGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHL 544
           IL  + +Y    +  IP ++    +   +RA+G + +   A +   + N I + +F  V+   I G   + +I   V+ LL+  +                 F + K  K + N F    I  L    R  S+  A+ +Y    +IV   T N +     ++   + +       V      N+IF AI  G+V G +PI  +NY  ++Y RV+      ++  V FS  I  + + IF      + S F           T      L    L S+ IS  + F S GK     + SL + LI  FP+L ++    I      V+  T  T++   ++AI   ++   H+
  S:   133 ILEYSMEYTGITSFGIPFLLFSIGVNPLVRADGNAKYSMIAIVTGAILNTILDPLFMFVYNWGIAGAAWATVISQIVSALLLLIY-----------------FPRFKSVKFSLNDF----IPQLHYLKRIISLGFASFIYQFSNMIVLVTTNNLLKIYGKNSIYGSDIPIAVFGIVMKI---NVIFIAIVLGLVQGAQPIFGFNYGAKSYHRVRETMR--LLLKVTFS--IATILFIIFQVFPKQIISLFGEGDKLYFEFATKYMRIFLAFISLNSIQISIATFFPSIGKAIKGAIVSLTKQLIVLFPLLLTL---PIFFGVEGVIYATPLTDLIAFTVAIIFLTNELKHM 452
>gi|153173939|ref|ZP_01929618.1| hypothetical protein LMIG_02345 [Listeria monocytogenes FSL N3-165] >gi|133730566|gb|EBA32264.1| hypothetical protein LMIG_02345 [Listeria monocytogenes FSL N3-165] (453 aa)
Score = 126, Expect = 6.7e-05, Identities = 112/432 (25%), Positives = 186/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      I ++IG     G     SR L +++  K K +     Y  L L I+  +L+  +   +     A +T                  L+  N  +  +  S P I+    L   +RAEG S       LI  + N++F+ +  L F  +++G  +S+ +    +++  A ++       K DY  S  FK  +  K I  NVF            +     +   +++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K + +  I  G++  LL + VF  IF F    + S   +     +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   NI I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEEGTKAKQVSAFVLYGSLVLGILCAILLGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRAEGASRVSMNGMLIGTVVNLVFDPLLILYFDFNVVGAAVSVGLASLFSLIYYAWYL-----EKKSDY-LSIRFKWFQASKEIVQNVF------------KIGLSELLLSLFLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRFTAISIGLIVLLLSSLVF--IFRFQVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNIKIASSA 446
>gi|53713448|ref|YP_099440.1| putative Na+-driven multidrug efflux pump [Bacteroides fragilis YCH46] >gi|52216313|dbj|BAD48906.1| putative Na+-driven multidrug efflux pump [Bacteroides fragilis YCH46] (454 aa)
Score = 126, Expect = 6.9e-05, Identities = 73/295 (24%), Positives = 122/295 (41%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDY-PFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           L  A  +M  I    PI   +  L   +RA G        +L+  + N+I   IF   F   I G  ++ ++  F+ ++ V +      F NK  +  F   F ++K  +I  ++F+  +           S    N+   I+     N++    GD  + A    N +          L    + G+  G++PI+ YNY  Q   RVK     GII GV   L+ ++ F    LF       F +++   ++    L  CTL+F F    + IS  + FQS G   ++I  SL++
  S:   133 LPYARDFMQVILLGTPITYTMIGLNNVMRATGYPKKAMLTSLVTVIANVIIAPIFIFHFGWGIRGAAMATVLSQFIGMIWVVN-----HFRNKESFVHFMPGFWKMKR-RIIGSIFSIGM-----------SPFAMNVTACIIVILINNSLQKYGGDMAIGAYGIINRLLM--------LYVMVVMGLTMGMQPIVGYNYGAQKIDRVKHTLRLGIIVGV---LITSSGFIICELFPHTVSAIFTDSDELIDMASSGLRICTLMFPFVGAQIVIS--NFFQSIGMAKISIFLSLSR 398
>gi|60681695|ref|YP_211839.1| MatE family transport-related membrane protein [Bacteroides fragilis NCTC 9343] >gi|37538069|gb|AAQ92937.1| putative Na+-driven multidrug efflux pump [Bacteroides fragilis] >gi|60493129|emb|CAH07910.1| putative MatE-family transport-related membrane protein [Bacteroides fragilis NCTC 9343] (454 aa)
Score = 125, Expect = 7.6e-05, Identities = 72/295 (24%), Positives = 123/295 (41%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDY-PFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           L  A  +M  I    PI   +  L   +RA G        +L+  + N+I   +F   F   I G  ++ ++  F+ ++ V +      F NK  +  F   F ++K+ +I  ++F+  +           S    N+   I+     N++    GD  + A    N +          L    + G+  G++PI+ YNY  Q   RVK     GII GV   L+ ++ F    LF       F +++   ++    L  CTL+F F    + IS  + FQS G   ++I  SL++
  S:   133 LPYARDFMQVILLGTPITYTMIGLNNVMRATGYPKKAMLTSLVTVIANVIIAPVFIFHFGWGIRGAAMATVLSQFIGMIWVVN-----HFRNKESFVHFMPGFWKMKK-RIIGSIFSIGM-----------SPFAMNVTACIIVILINNSLQKYGGDMAIGAYGIINRLLM--------LYVMVVMGLTMGMQPIVGYNYGAQKIDRVKHTLRLGIIVGV---LITSSGFIICELFPHTVSAIFTDSDELIDMASSGLRICTLMFPFVGAQIVIS--NFFQSIGMAKISIFLSLSR 398
>gi|167768064|ref|ZP_02440117.1| hypothetical protein CLOSS21_02608 [Clostridium sp. SS2/1] >gi|167710393|gb|EDS20972.1| hypothetical protein CLOSS21_02608 [Clostridium sp. SS2/1] (453 aa)
Score = 125, Expect = 8.5e-05, Identities = 86/386 (22%), Positives = 153/386 (39%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGT--FLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAI-YGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +I L    G +  F+  + QQ+K++  S   ++      L ++L ++    + ++    I     S+              +L+ +  Y    +   P +++       +RA+G   F     L   + N I +      F M I G   + +IG  V+ ++V  ++  ++ V            +L + K+  +      I+SLG   F    S+ V  IV   V++ +G       A    G    LA   I T       N+IFFAI  GI  GL+PI++YNY  +   RV+  Y    I+  +    I+ V +  F      +   F + + +        F   LF   +  L     + F + GK    I  SL + +IF  P++
  S:    67 AIALMCGIGGAANFNLCMGQQEKEEAASFAGNAITMLFSLGMILCIIT---RLFLKPMMILFGATSS--------------VLDYSLIYTGITSLGFPFLILTTGGTNLVRADGSPKFSMTCTLTGAIINTILDPTLIFGFHMGIAGAAWATVIGQVVSGIMVILYLRKFKTV------------KLTKEKLRPHSHYIGRIVSLGMAPFFNQVSMMVVQIVMNNVLIRYG-------AKSSYGSDIPLACAGIITK-----INMIFFAINIGISQGLQPIISYNYGARKLDRVREAYLKAAISATI----ISTVSFICFQLFPRQIIGIFGSESEAYFRFAEKFFRIFLFCTFINGLQPITANFFTAIGKANRGIFLSLTRQVIFLLPLM 412
>gi|167746843|ref|ZP_02418970.1| hypothetical protein ANACAC_01555 [Anaerostipes caccae DSM 14662] >gi|167653803|gb|EDR97932.1| hypothetical protein ANACAC_01555 [Anaerostipes caccae DSM 14662] (461 aa)
Score = 125, Expect = 8.7e-05, Identities = 93/398 (23%), Positives = 167/398 (41%)
  Q:   106 TSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKY-MYFITGSIPIIMILNLLI-FFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG----TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFN-----ANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           TS +G V+++F      I +G+   +GAS   SR L +++         ++ +S L     +  LI+   T ++ A  A  T                 IL  A +Y + +++GS  I+ + N+ +   L A+G + F   A +  ++ N+I + I      M I G   + +I   VN L+   ++   + V K           +++  I   V+    IL +G    TF   AS A+          G  N  +   GD  V+A  A + + TV          + ++G + G +P   +N+    Y+R++       +    F +L++ +     L+ G  +  F       A     + +  L+F T  FQ           SL+ S G+     + SL +  IFFFP +
  S:    50 TSQMGAVSVVFPVVQLVIGLGMMFGAGASSYISRLLGEKEYTLADQTASTALFSGLLTGAAVIGLILCFLTPVLSALGATET-----------------ILPYAREYSVIYVSGS--ILNVFNVTMNNLLTAQGSTRFTMAAMMAGSVTNLILDPILIYGLHMGIRGAAAATVISLCVNSLMYVYYLRKQKGVLK---------PSIRKITIKGAVYKE--ILKIGIPVLTFQLFASAAL----------GLTNTAAKEYGDYAVAAMGAVSRVMTVG--------IYIVFGFMKGFQPFAGFNFGAGQYERLRKAVKLCSLWSTAFCILMSFL---CILYSGEVIGLFGTDPQMLALGGKALRLNALMFLTFGFQMVY-------ASLYLSAGRSGAGSILSLGRQGIFFFPCI 406
>gi|163798782|ref|ZP_02192689.1| multi antimicrobial extrusion protein MatE [Methanococcus voltae A3] >gi|158972789|gb|EDP40257.1| multi antimicrobial extrusion protein MatE [Methanococcus voltae A3] (475 aa)
Score = 125, Expect = 9.0e-05, Identities = 81/376 (21%), Positives = 165/376 (43%)
  Q:   119 IGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL---------FYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           +G+    G + L S  L  ++K + + I  ++F   + +S ++T+  M I T I+   I    +  +E +N Y+ +              FI G++  +  ++     +R +G      +A     + NII + I   +    I+G  ++ L+  FV  ++     L          +E ++K      +  K+ +      N+ T   I   G   FL + + A+   V+ I F    + +  +          AF  +  +SG     L FF IYG+  G++P+++YNY      RV+ ++    +  ++F ++I A+     +F  P V   FNA+  + ++            F ++ +++  ++ FQS  K  ++I+  LA+
  S:    65 LGIMFGLGGATLISINLGMKNKDEAEKILSTTFLYMIIVSAIITITGMPI-TEILLKVIGAEGIYYTEALN-YSSI--------------FIYGALITLSTVSF-DSLVRNDGFPKKAMYAMATGAVLNIILDGIAIAILGYGIMGAAVATLLSQFVVFIIYLEHFLGGKSNLKLKLFEKLDKTSLNNKYNSKKEEILDYLKNIHTVKKIFLAGFSGFLGEFAFAMLIFVHNIQFLAYGSPLQVS----------AFGTVSYLSG-----LAFFIIYGVSIGIQPLISYNYGADKIHRVREIFKKSSLLNLIFGMIIFAI---ASIFAEPLV-QLFNASDTAFVNASAFGLKIHSAYFAIVGITLVCITYFQSVYKYKISILLMLAR 415
>gi|153809948|ref|ZP_01962616.1| hypothetical protein RUMOBE_00329 [Ruminococcus obeum ATCC 29174] >gi|149834126|gb|EDM89206.1| hypothetical protein RUMOBE_00329 [Ruminococcus obeum ATCC 29174] (460 aa)
Score = 124, Expect = 9.9e-05, Identities = 102/534 (19%), Positives = 214/534 (40%)
  Q:    18 ETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISS-IAIEITSSIYLHLYMG--KKEK 551
           ET SIPKL  ++ +P++   ++  +Y  VD+I + HI  +        AL   GL         +P                            + ++  +  + + SG +   + A+ ++D    + I  + F   + L++VLT++      + V A         S+V  +Y          A +    +I GS  ++++L +  F +  +G +       +I  + NII + IF     M + G  ++ ++   V  + +  F+   + + +          +     ++  VF   L L + TF+  ++ ++ +I +        +++S   GD  V A            T I  L+   + GI  G +PI++YN+      RVK  ++    T V+++ L    FW + +    +  + F ++     +    L   +   F  L   +S    F + G+  ++++ +  + ++   P+++      IL + +   +F  F    +S  IA  +T+  +  L+    KKEK
  S:    16 ETGSIPKLLAQLAIPAVVAQVINLLYNIVDRIYIGHIPGIGAA-----ALTGVGL--------FTP----------------------------ILMLLNAFAMLVGSGGAPRAAIAMGKKDNDLAEKILGNCFTLLVGLAVVLTIV------FYVSAPTLLRLFGASDVTLTY----------ATDYARIYILGSFFVLIVLGMNTF-ITTQGFAKISMMTTIIGAVINIILDPIFIFALGMGVKGAALATVLSQTVGAVWILRFLTGRKTILR---------LKRSNMHLDPKVFGPCLALGISTFVMLSTESLLSISFT-------SSLSRFGGDVAVGAMTII--------TSISQLVTLPLQGICQGGQPIISYNFGANKPDRVKKAFFTQFCTCVIYTTL----FWLVVMIFPKAFATIFTSDKELVTYSAWALRIYMAGIFS-LGFQVSCQQSFMALGQAKVSLLLACLRKIVLLIPLIF------ILPNFFDNKVFAVFLAEPVSDIIAAAVTTITFFTLFNSILKKEK 459
>gi|154494810|ref|ZP_02033815.1| hypothetical protein PARMER_03852 [Parabacteroides merdae ATCC 43184] >gi|154085360|gb|EDN84405.1| hypothetical protein PARMER_03852 [Parabacteroides merdae ATCC 43184] (451 aa)
Score = 124, Expect = 1.0e-04, Identities = 75/326 (23%), Positives = 129/326 (39%)
  Q:   117 ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSF 442
           IS+ + + SG +V+ S+    +  QK     V   +S  F+ +++  +I+SI   I    + + T +  EV+              A  Y     G   + +  N +I  LR  G S       LI  + NI F+L+F LVFK  I G   + ++   + + +  +++          +P     KQ  +   +W +F  SL + L T ++  +IA+     +I   G +N+  T    A  +AG             I  +I  AI  +   L      N       RVK    + + T +   LL    F  ++LFG   +  F
  S:    67 ISLVIGVGSGTTVVISQLFGAKQYQK-----VQLAFSSFFIFMLVGGIILSIAGIIFAEPVFRLTNTPEEVIPQ------------AVAYFRIYIGGTFLFVTFNSIISILRGVGESVRPMLFILITTVLNIAFDLLFILVFKWGIEGAARATVVSQGIGMCIALAYV-------NNTHPLLSIKKQ--DMLFDWKLFKESLKIGLPTSVQQCAIALG----LIALLGIVNSFGTNTLTAYGAAG------------KIDTIITQAILTLSGALAAFCGQNIGAGRLDRVKKGVQFTMYTNIALGLL---TFAAVYLFGNEMMRIF 347
>gi|154151398|ref|YP_001405016.1| MATE efflux family protein [Candidatus Methanoregula boonei 6A8] >gi|153999950|gb|ABS56373.1| MATE efflux family protein [Candidatus Methanoregula boonei 6A8] (467 aa)
Score = 124, Expect = 1.1e-04, Identities = 80/385 (20%), Positives = 155/385 (40%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEG--RSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIV-FFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFA---IYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSF-FNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           ++ +  G  + +GA+ L +R +   D+    S  V S      +S+V T L+++    I+ A  A  T                  L  A +Y   I     ++++ ++L   LRAEG  +  F  F A  +++ N+I + I      M I G       G  ++ ++VA  +L+  FV K  Y             ++WN F      ++G        +    +  I+  F  L  +  A  DA                T  + L+ FA   I GI   +  +    Y  +++ ++ +++++ I+ G+  +L  +A+ W   LF     T F +++ T      +      +   +P +   +   S+FQ  GK   ++   + + L+F
  S:    77 MVLVGFGNGLGAGAASLIARRIGAGDRAGADSAAVHSLVIITVISVVTTALLLAFAGPILIAFGAGPT------------------LGLALEYGQIIFAGTLLLLVTSILGAILRAEGDMKRTFYVFGA--SSILNMILDPILIYRAHMGIAGAA----WGMIISQVMVALVLLYLFFVKKDTY-----------VSLSWNGFVPDKKTAMGILGVGLPASTEFFMMAILSIFVNLMLVMVAGTDA------------VAVYTAGWRLVMFAVIPIVGIALAVVSVAGAAYGGRHFDKLPIIHHFSILLGLAIALCTSAITW---LFSSQIATVFTYSSETAYLTPEIAAFLSVMCLFYPFVPPGMMSTSIFQGVGKGMTSLAIVVLRELVF 418
>gi|163799568|ref|ZP_02193475.1| MATE efflux family protein [Methanococcus voltae A3] >gi|158973575|gb|EDP41043.1| MATE efflux family protein [Methanococcus voltae A3] (454 aa)
Score = 124, Expect = 1.1e-04, Identities = 91/393 (23%), Positives = 168/393 (42%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLT-VLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGD----YPFSFAFKQLKEFK-INWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLI--FFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           + ++ IS  + I  GAS   S  L + D +K ++I+ ++F   + L + LT V +++I+  ++   I  S ++ S        + +  I    +  + F  G  PII          R +G         ++  L NI+F+ +F +VF   + G  I+ ++G       + + I  + F+ K         ++  K +  FK  + N+    ++  +  FL   S A+  +VY   F           G   VSA           G  IY  I  F  I G+  G++P+++YNY  + Y +VK +     ITG + +L+I  + +  +      + + FN+     I   T       +   +L      ++ FQS G   ++ + SL +   F  P+LY
  S:    58 LKMMIISFAIMIGIGASAHISINLGRNDPEKAQNIFKNAFCILILLGVFLTFVGLLAIKPLLLSFGIEGSLLNLS--------LTYLSIAFIGSMGLLFNVGLEPII----------RNDGFPKKAMNVMIVCALTNIVFDALFIIVFGWGVAGAAIATMMGE-----TLGAIIFLHHFLAKKSNLKIEDITYRLKNILNFKSYDKNILKLIILTGISPFLLQFSSAIVALVYSTQFL-------KYGGSLYVSA----------YGIVIYIFITLFMTILGLCSGVQPLISYNYGAKRYDKVKNILK---ITGTL-TLIIGIISFIAYNLFPTYLINIFNSTDIELIKTATTGLNIYSYGTLVLGPVFLIITYFQSIGDSKVSNIVSLFKSFGFLIPLLY 414
>gi|153854665|ref|ZP_01995915.1| hypothetical protein DORLON_01911 [Dorea longicatena DSM 13814] >gi|149752769|gb|EDM62700.1| hypothetical protein DORLON_01911 [Dorea longicatena DSM 13814] (426 aa)
Score = 124, Expect = 1.1e-04, Identities = 70/305 (22%), Positives = 118/305 (38%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGV-SAGLAFNDIQTVSGTPIYNLIFFAI-YGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IL  A  Y       IP +++       +RA+    +     L   + N + + +F   F   I G   + +IG  V+ I+++  F  F +   K +            F+   ++    L L + + +   ++AV  I        T+N      G A V    +    +  +S     N++F AI  GI  G +PI  YNY   +Y RVK  Y+         ++ +  VF+  F F    + S F   +          F   +F   +  +       F S GK  L IV SL + +IF  P++
  S:   103 ILPYAQDYTGITAFGIPFLILTTGGNHLIRADRSPTYSMTCMLTGAIINTVLDPLFIFGFHWGIKGAAWATVIGQIVSGIMVIVYFGRFRKMELKKEM-----------FRPRGHLLKMILSLGMASCINQIAMAVVQI--------TMNNTLRYYGAASVYGTDIPLACVGVISKV---NMVFMAIAIGISQGCQPIWGYNYGAGSYDRVKRTYW----KAFRVAMTVGIVFFLCFQFFPTQLVSIFGTGSKEYYEFAARYFRIFMFMTFVNGIQPMSSGFFTSIGKAKLGIVVSLTRQVIFLLPLI 384
>gi|196127234|ref|ZP_03118983.1| putative drug/sodium antiporter [Clostridium difficile ATCC 43255] (454 aa)
Score = 124, Expect = 1.1e-04, Identities = 72/323 (22%), Positives = 136/323 (42%)
  Q:   106 TSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           TS +G +++ F      + +GL   +GA+   +R L   D +K   +  +S YS + +  ++ ++IM     I++   A  ++    +  +   V    I N  N  M  I  S                EG +     A L+  L N+I + IF   F + + G  I+  I    + L+   +IL  + +      FSF   ++ E   +  +F+  L + + T +     ++A            N  +T  GD+ V AG+        + T I +L    ++G + G +PI  YN+  +NY R+ +     I+   VF +++  + 
  S:    50 TSQMGAISVAFPLGQLVVGLGLLFGNGAASYIARLLGHGDNEKAGKVVSTSIYSSIIVGTLVIIVIMIFLNPILKLLGATKSIMPYAISYASIYVVSS-IFNIFNVTMTNIVTS----------------EGAAKTTMCAMLLGTLLNMILDPIFIYTFGLGVRGASIATAISQIASTLVYVGYILSKKSI------FSF---RINECCFSKEIFSEILKIGIPTLIFQLLTSLA--------ITLTNMEATKYGDS-VIAGMG-------AVTRITSLGSLVVFGFIKGFQPIAGYNFGSKNYDRLHIAIKTSILWTTVFCVVLGLIL 336
>gi|160890492|ref|ZP_02071495.1| hypothetical protein BACUNI_02934 [Bacteroides uniformis ATCC 8492] >gi|156860224|gb|EDO53655.1| hypothetical protein BACUNI_02934 [Bacteroides uniformis ATCC 8492] (459 aa)
Score = 124, Expect = 1.2e-04, Identities = 85/397 (21%), Positives = 155/397 (39%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSL-----ILSLGT--FLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           ++ +V  I  ++G F   G+    SR L  Q+ +  + +  + F+  LF+   L VL +   T +  A  +  T                 IL    +Y+  I    P +    +L   +R +G + +     +   + N++ + I   V  M I G  ++ ++        + SFIL      +G              +I +  FT +L     I+  GT    R    +VA I+        LN  + A GDA + AG++         T I   I   + G   G +P+  +NY    Y RV+  +++ +  G  F LL+ AV    +      + S F    P+ +             +PL +  +    + Q+  K     + S A+  +FF P+++
  S:    60 IVFSVMSIIQAVGFFFGHGSGNYISRKLGAQETESAEKMASTGFFFALFIGAALAVLGLLFLTPLSLALGSTPT-----------------ILPYTERYLGIILLGTPFMTASLVLNNQIRFQGNAAYAMVGIVSGAVINVVLDPILIFVCDMGISGAALATVVSQ------ICSFILLLYMGRRGG-----------NIRIRYRNFTPTLAFIKEIIGGGTPSLTRQGLASVATIL--------LNVAAGAYGDAAI-AGMSIV-------TRISMFINAFLIGFGQGFQPVCGFNYGAGLYARVRQGFWFCVKVGFFF-LLVCAVAGMGY---AEEIVSIFRKGDPAVVATGAAALRWQFITYPLGAWIVVSNMMLQTIRKPVRATILSSARQGLFFIPLIF 409
>gi|34539886|ref|NP_904365.1| MATE efflux family protein [Porphyromonas gingivalis W83] >gi|34396197|gb|AAQ65264.1| MATE efflux family protein [Porphyromonas gingivalis W83] (442 aa)
Score = 124, Expect = 1.2e-04, Identities = 63/277 (22%), Positives = 113/277 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +RA G         +I  + N++ + IF     M I G  I+ ++      ++V S  +   F  K     S        F+++  V      + +  F    + ++ NI+        +N    + G+   +  LA      ++G  +  L F  I G+  G++PI+ +NY  +N  RVK  Y Y    GV  +LL++ + + + +    ++ S F  N+   I +      T L    L+   ++    FQS G     I  SL + +IF  P L
  S:   142 MRASGYPRKAMITMIIGAMTNVVLDYIFIYPLGMGISGAAIATVVS-----MIVCSVYVLSHFFRKD----SIVRFHRSAFRLSLPVIGGITAIGVAPFAMHLTGSLVNII--------MNRSFVSYGETADATDLAIGAFGIINGYAM--LFFMIIIGVAQGMQPIVGFNYGAKNPGRVKSAYRYS--CGV--NLLVSFLGFALAMLMPRTIVSLF-TNSEQMIELSASALRTALIGLSLVGFQVTTTQFFQSIGFSHKAIFLSLTRQIIFLIPCL 394
>gi|126650592|ref|ZP_01722815.1| Na+ driven multidrug efflux pump [Bacillus sp. B14905] >gi|126592748|gb|EAZ86747.1| Na+ driven multidrug efflux pump [Bacillus sp. B14905] (447 aa)
Score = 124, Expect = 1.2e-04, Identities = 86/389 (22%), Positives = 158/389 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL--INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           I +SI L+I  G + L+S +L + +KQ+   ++  +F +   L +VLT++          + I  ++  T   V  Y    H ++L     +  F T       I NLL  F+R +G         +  ++ NII   IF  V    + G  ++  I   +      + +  + F    +  F  +F        N         + L +F+ +AS+AV  I+Y + F   L       G  GV+A    N I TV        +     GI   L+P+++Y++  +  +R+  +   G+ T  +  L   + A+ +P        + + F  ++    H+ T  F      +  L +++     FQS  K+ +     L + +I F P L
  S:    62 ILLSISLWIGMGGATLYSISLGEGNKQRAHQLFTLAFTT--MLVVVLTIIGFLALNLKDISYIFGASDDTYPYVQEY---LHVILL-----FGVFYT-------IENLLSIFIRNDGNPKLAMLGLITTSVLNIILNYIFIFVLDYGVTGCALATAIATIIG----TAVLCLHFFRPHSELKFVSSF-------FNKTNLRKIFAIGLPSFIVEASVAVIIILYNVTFLHYL-------GANGVTAYAMVNYIHTV--------LLTIFLGIGMALQPLVSYHHGARLLERLTALLKIGLATAFILGLTTALIAMLFP------SQLMALFGDSSFEIRHMATQGFVHFAIGYVFLGINMVLAEFFQSIEKIRIATTIMLLRSIILFIPTL 403
>gi|47095796|ref|ZP_00233401.1| MATE efflux family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153175349|ref|ZP_01930707.1| hypothetical protein LMIG_00734 [Listeria monocytogenes FSL N3-165] >gi|153180113|ref|ZP_01933252.1| hypothetical protein LMMG_00876 [Listeria monocytogenes F6900] >gi|153183567|ref|ZP_01934427.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|153191607|ref|ZP_01938797.1| hypothetical protein LMPG_02097 [Listeria monocytogenes J2818] >gi|47015800|gb|EAL06728.1| MATE efflux family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126943858|gb|EBA21575.1| hypotehtical protein [Listeria monocytogenes J0161] >gi|127765041|gb|EBA25393.1| hypothetical protein LMPG_02097 [Listeria monocytogenes J2818] >gi|133729268|gb|EBA30966.1| hypothetical protein LMIG_00734 [Listeria monocytogenes FSL N3-165] >gi|133732288|gb|EBA33986.1| hypothetical protein LMMG_00876 [Listeria monocytogenes F6900] (443 aa)
Score = 124, Expect = 1.2e-04, Identities = 103/491 (20%), Positives = 201/491 (40%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWN--VFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAY----NYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           N  + ET+S+ K+  + L+PSL   LL  + I +D I + H +           +  AG+                                  ++   V  IF +I ++I  GA+  FS A+ +++  K ++I+ ++      L++V   +I+ I  +I +  +A    +  + +          +L   N  + F       + + N+L  F+R +G       A ++  + N+I   +F  VF+  + G  ++ +I   + +L     IL   F  K          +LK  K++WN   F  +L + L +FL +  ++V  + Y I       +I+   G AGV+A    N   +V        I     G+   ++P+++Y      +++  + +K+       TGV F L        I  FG   + S F  N   EI  L      L +  +  +  +   ++ FQ++ K+ +    ++++ +IF    L
  S:     4 NMEILETDSVKKIYFRYLIPSLVGMLLMSLNIVIDGIFVGHKL---------GGVALAGI----------------------------------NIAVPVFTIFTAISIWIGIGAATQFSFAIGEKNVAKAQTIFTNAI-----LAVVSITVIIGIIAFIFKVPLAYFLGANDDTIG--------YVLEYMNILLVFGFA----LTLENILSIFVRNDGDPNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIIGVL-----ILTTHFFKKS--------SRLKFVKVDWNKAFFKKTLAIGLPSFLAEVGVSVFTLGYNI-------SIAAIAGTAGVAAFSVLNYTHSV--------ILMLFLGMGSAIQPLISYYRGAKARQKELETLKIAIVVAFSTGVGFLL--------IGFFGSNLLVSMF-GNFSVEIRELASNGIKLFYTAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIFMVIFL 404
>gi|160881000|ref|YP_001559968.1| MATE efflux family protein [Clostridium phytofermentans ISDg] >gi|160429666|gb|ABX43229.1| MATE efflux family protein [Clostridium phytofermentans ISDg] (451 aa)
Score = 124, Expect = 1.2e-04, Identities = 65/300 (21%), Positives = 119/300 (39%)
  Q:   203 ANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           AN+Y+  ++ GS+  +MI   +  F+ A+G      ++ +I  + NI  + I   VF M + G  I+ +I   ++ L +  F+   + + K          + K  K++         L +  F+  A+     I            + +  GD  V      N ++ +   P+         GI +  +P++ +NY    YKRVK    +  +T + ++L    V W +  +        FN + P  I           F F ++SL   G + F + GK    I  SL +  I   P+
  S:   135 ANQYISIYLLGSV-FVMIGLGMNSFINAQGFGKIGMYSVIIGAITNIFLDPILIFVFDMGVQGAAIATVISQMISALWILKFLTGKKTILK---------LRRKTMKLSLQRVKAITGLGMSGFIMSATNGAVQI-------ACNTTLQSYGGDLYVGVMTVINSVREIISMPVS--------GITNSAQPVMGFNYGASEYKRVKKAIKFMAVTSISYTL----VMWGLLNWFPEFFIRLFN-HEPDLIKAAVPAMKIYYFGFFMMSLQFVGQATFVALGKSKYAIFFSLLRKAIIVVPL 405
>gi|153954354|ref|YP_001395119.1| efflux pump [Clostridium kluyveri DSM 555] >gi|146347235|gb|EDK33771.1| Predicted efflux pump [Clostridium kluyveri DSM 555] (460 aa)
Score = 123, Expect = 1.2e-04, Identities = 87/408 (21%), Positives = 171/408 (41%)
  Q:    96 QANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPG-DAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTL-LFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           QAN ++ +   S++  +  I +++   I  G + + SR+L   +K + +    ++  S    S++L +LIM I    +   +      +SE +  Y     ++ L  +  +++ I  +             +++EG +     + +I  + NI  + I     K  I G  I+  I   +  + +  +I F                ++K   IN  +   ++ L + TF+   +  + +IV         N++    G D  +SA   +N I        +  I   +YGI   L+PI+ +NY  + + RVK     GI+T VV SL     F  I +     +   F ++  +E+  LT+ +   +L   PL+ + +   S FQ  GK    +  S+ +  +F  P++
  S:    45 QANGSLGIAALSIVFPIQQIILALSQMIGVGIASITSRSLGAGNKLRAEKAVGTALTS----SVLLGILIMVIGLAFIRPIL--YIFGSSETILPYAVTFFRITLYCSVFFVFSIVSNS-----------IIQSEGHANIAMISMIIGPVINIPLDYILVTRLKYGIKGAAIATDISQIICFIFLLVYICFNS---------KILGVKVKNLVINIKLLKEAISLGVSTFMTQLAYGILSIVLN-------NSLRIYGGSDLYLSAIGIYNRI--------FGFITVPMYGIRQALQPIIGFNYGAKKFNRVKQSLKLGILTSVVISL----GFLVIIISFTNKIAGVFTSD--NELIALTVPILRVILLMSPLVGVQVIAASFFQYIGKPKPALFLSIMKQFLFLIPLM 407
>gi|182420239|ref|ZP_02951469.1| putative multidrug efflux protein [Clostridium butyricum 5521] >gi|182375937|gb|EDT73528.1| putative multidrug efflux protein [Clostridium butyricum 5521] (452 aa)
Score = 123, Expect = 1.3e-04, Identities = 56/209 (26%), Positives = 90/209 (43%)
  Q:   215 PIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL 423
           P IM+  +  +F    G+S F  F +++  + N+I + +F +VF M + G  I+ +IGY +  ++    I+F+   N        +     + KI  NV   S I      +   S AV   +Y I     L       G+AGV+A      IQ         L+  A  G   G+ P + YNY  +N   +K +  Y  I   +FSL+
  S:   143 PFIMLKLIFDYFYVTVGKSSFGLFVSVLGGVTNMILDYVFIVVFNMGVSGAAIATVIGYVLPSII---GIIFFARRN--------SLIHFTKLKIKLNVLKESCINGSSEMITQLSTAVTTFLYNIAMLKYL-------GEAGVAAITVILYIQF--------LLSAAYIGFTSGVAPRIGYNYGAKNKDEIKKLVKYSYIIITIFSLI 325
>gi|16804126|ref|NP_465611.1| hypothetical protein lmo2087 [Listeria monocytogenes EGD-e] >gi|153196594|ref|ZP_01940964.1| hypothetical protein LMRG_01238 [Listeria monocytogenes 10403S] >gi|16411557|emb|CAD00165.1| lmo2087 [Listeria monocytogenes] >gi|127634055|gb|EBA23447.1| hypothetical protein LMRG_01238 [Listeria monocytogenes 10403S] (443 aa)
Score = 123, Expect = 1.4e-04, Identities = 102/491 (20%), Positives = 201/491 (40%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWN--VFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAY----NYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           N  + ET+S+ K+  + L+PSL   LL  + I +D I + H +           +  AG+                                  ++   V  IF +I ++I  GA+  FS A+ +++  K ++I+ ++      L++V   +I+ I  +I +  +A    +  + +          +L   N  + F       + + N+L  F+R +G       A ++  + N+I   +F  VF+  + G  ++ +I   + +L     IL   F  K          +LK  K++WN   F  +L + L +FL +  ++V  + Y I       +I+   G AGV+A    N   +V        I     G+   ++P+++Y      +++  + +K+       TGV F L        +  FG   + S F  N   EI  L      L +  +  +  +   ++ FQ++ K+ +    ++++ +IF    L
  S:     4 NMEILETDSVKKIYFRYLIPSLVGMLLMSLNIVIDGIFVGHKL---------GGVALAGI----------------------------------NIAVPVFTIFTAISIWIGIGAATQFSFAIGEKNVAKAQTIFTNAI-----LAVVSITVIIGIIAFIFKVPLAYFLGANDDTIG--------YVLEYMNILLVFGFA----LTLENILSIFVRNDGDPNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIIGVL-----ILTTHFFKKS--------SRLKFVKVDWNKAFFKKTLAIGLPSFLAEVGVSVFTLGYNI-------SIAAIAGTAGVAAFSVLNYTHSV--------ILMLFLGMGSAIQPLISYYRGAKARQKELETLKIAIVVAFSTGVGFLL--------VGFFGSNLLVSMF-GNFSVEIRELASNGIKLFYTAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIFMVIFL 404
>gi|188527972|ref|YP_001910659.1| hypothetical protein HPSH_06135 [Helicobacter pylori Shi470] >gi|188144212|gb|ACD48629.1| hypothetical protein HPSH_06135 [Helicobacter pylori Shi470] (459 aa)
Score = 123, Expect = 1.4e-04, Identities = 88/426 (20%), Positives = 178/426 (41%)
  Q:   116 FISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFF--AIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFF---NANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGL---IFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIY 541
            ++  L    GA+ +    L Q    + + ++ S FY             ++I T+I+   +   + + + +  S     +  +L+ + +Y+  I      +++  L   F+  + R      A LI +L NI F  +F  V K+ + G  I+ +IG+ + +L++     F     KG   F      +K F +      +S+I S  + +  ++   +  V +++F     AI    G+  VS          V G  +YN I F   ++ I  G++PI +++Y  +N +RVK V+ +G+      +  I  VF+  + F    +   +   +   P  +             +  L +++     FQS  +   + + +L+  L   +   PIL   + I  +   Y ++ F AF  +A+     EI   ++
  S:    64 LVAYELLFGFGAASIVGYFLGQNKTHRARLVFSSVFY------------FVAISTFILSMALLPFSETIARLFGS-----NDALLSMSKRYIEIILMGAVFMVLHPLADVFVINDKRPILAMVAMLIGSLANIFFNYLFIFVLKVGVQGSAIATVIGHAIGVLVLMQHFWF----KKGQLYF------IKRFSL------SSVISSAKSGVPQSTAEFSTSVMILLFN---TAIMHTAGERFVS----------VYGIVMYNAIIFFTTLFAISQGIQPIASFSYGARNLERVKEVFVFGLKV----AFCIGIVFYGAYYFLDEFLIKLYLQPSEQDPLFMQETKRAMNIYYVGYVFLGMTLLCAVFFQSIQRTKSSFIITLSHTLGFMVILLPILSHFYGINGVWVTYPIVQFLAFL-VALGVTYYEIKKGVF 446
>gi|148270131|ref|YP_001244591.1| MATE efflux family protein [Thermotoga petrophila RKU-1] >gi|147735675|gb|ABQ47015.1| MATE efflux family protein [Thermotoga petrophila RKU-1] (437 aa)
Score = 123, Expect = 1.5e-04, Identities = 83/386 (21%), Positives = 160/386 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL-------SLFQSTGKMFLNIVASLAQGLI 497
           V ++ IS+   I  GAS + S+ + ++DK+   +    S    + LSIV+  L +++    +   ++ +                   L  A +Y   +   IP+IM  N+     R EG +     A  I +L NI  + +F  VF M + G   + ++   V+ LL+A    ++ F  K  Y           F++ W+      IL +G     A  +++  +YV+  F        A GD GV+           S   + N     + G+   +  +    + ++N ++++  + Y +  G    L   AV + I +F  P +   F  +   E      L+  L+    +LSL + G+       S+FQ  G+   +++ ++ + +I
  S:    42 VFMVIISLAAGIGVGASSVVSQKIGERDKEGADTAASVS----ILLSIVIGFLSIAVILPFISDILSFAGAQGE-------------TLRLALEYSVILVYFIPLIMFNNVANGVFRGEGDAKRAMVAITIGSLLNIGLDPVFIYVFGMGVRGAAYATVVSIAVSSLLIA----YWMFFKKDTY---------VSFRLKWDGEILKRILKIGIPASLAQASMSVAIYVLNVFAV-----RAGGDYGVAV--------FTSAWRVINFGTVPLIGMAMAVTSVTGAAFGERNGEKLETAHLYAVKLGFFVGL---AVMFTILIF-APYIARLFTYSQEGE-----KLYSDLVKALRILSLFLPGVPFGMFTSSMFQGVGQGLKSLIVTIMRTVI 382
>gi|86133602|ref|ZP_01052184.1| uncharacterized membrane protein [Tenacibaculum sp. MED152] >gi|85820465|gb|EAQ41612.1| uncharacterized membrane protein [Polaribacter dokdonensis MED152] (462 aa)
Score = 123, Expect = 1.5e-04, Identities = 68/306 (22%), Positives = 124/306 (40%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           IL  A+ Y   +   +P +    +    +RAEG+  F  +A +I  + NI+ ++IF   F   + G G++  I +    L    +IL++    K +          K FK++  +    + L   + +R  +I++  IV     F       T  G+  +S     N +   + +P        + G+  G  P+  +N       RVK      I  G   SLL   +F  I +F    + S F  +T         +    L   P++++ + G + FQ+ GK    ++ +L +  IF  P+ Y
  S:   147 ILPIASDYFTVVIYGVPFLAFAMMGNPVIRAEGKPKFAMYAMMIPAVLNIVLDIIFIKYFDWGMTGAGLATSISFASCGL----YILYFFLSKKSELKII-----PKNFKLDLKIVREIVELGGVSVVRQGAISILMIVLNYSLF-------TYGGEISISIFGIINRVMMFALSP--------VLGVSQGFLPVAGFNIGANKNDRVKETIKKSIYFG---SLLGTIIFIGIVVF-KEQIISIFTRDTTLLSETPNAMLIVFLVT-PIVTMQLIGSAYFQAAGKAVPALILTLLKQGIFLIPLAY 423
>gi|168208028|ref|ZP_02634033.1| MATE efflux family protein [Clostridium perfringens E str. JGS1987] >gi|170660666|gb|EDT13349.1| MATE efflux family protein [Clostridium perfringens E str. JGS1987] (442 aa)
Score = 123, Expect = 1.5e-04, Identities = 64/293 (21%), Positives = 124/293 (42%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVK 407
           ++ +IGL I  G +   S A+ Q+   +   I    F S +F +I+  ++I  ++ + ++  +             Y     +     A +Y+  I    P  +  +  I F+R +G      +A + +N  NI+ + +F  +F + + G  ++  IG      LVA  +L   F+ K +         ++   IN +     L   + +FL + S      ++ IV +          GD GVSA     +I          LIF A++ G+  G++P+++ N+  +  +RVK
  S:    62 LYSAIGLTIGVGGATALSVAMGQKKFHRVNRI----FTSAVFATIIFCIIISLLEVFFLDKIV-------------YMLGASEATFPLAKEYLKIILAFNPAFIFASAFIVFVRNDGEPKLAMYAVIGSNTTNIVLDYVFIYIFNLGMFGAALATSIGQ-----LVALGVLSIHFIKKNNT------MHIELGGINLDNIGKVLKNGVPSFLNEISAGFVIFIFNIVIY-------KFEGDLGVSAYGIITNIV---------LIFMAVFNGVSQGVQPLISVNFGAKKEERVK 311
>gi|167765697|ref|ZP_02437750.1| hypothetical protein CLOSS21_00185 [Clostridium sp. SS2/1] >gi|167712605|gb|EDS23184.1| hypothetical protein CLOSS21_00185 [Clostridium sp. SS2/1] (465 aa)
Score = 122, Expect = 1.6e-04, Identities = 76/396 (19%), Positives = 163/396 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLT-VLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           +I  +    + +G +   S  + ++D    ++I  + F   + +S++LT ++    +T+++    +++T+   E   SY  +              +  G+I + + L +  F + A+G +    ++ LI  + NII + IF     M + G  ++ +I    + + V SF+             S    + +   +   V    L L L  F+  AS ++ ++ +        +++    GD  V A      +   +  P+         G+  G +PI++YNY  +N  RVK  ++  +   + +S+++    W + +         F +N    I     L   +   F +  + IS    F S GK   +IV ++ +  +   P++Y M +I
  S:    74 MIISAFAALVGNGGAPRASILMGKKDLDSAENILGNCFTMQIIISVILTLIMFFGNRTFLMAFGASENTI---EYAVSYMNI--------------YSLGTIFVQLTLGMNAF-ITAQGFAKTGMYSVLIGAVINIILDPIFIFACHMGVRGAALATIISQACSCIWVLSFLFGTR---------STLRIKKQNLTLKAPVILPCLALGLSLFIMQASESIISVCFN-------SSLLKYGGDVAVGAMTILTSVMQFAMLPLQ--------GLGQGAQPIMSYNYGAKNTDRVKGTFFLLLKASLTYSIIL----WGLVMLFPQVFAGIFTSNPALVIFTKKALRVYMAVMF-MFGIQISCQMAFNSLGKAISSIVVAVMRKFVLLIPLIYIMPHI 423
>gi|108563549|ref|YP_627864.1| hypothetical protein HPAG1_1123 [Helicobacter pylori HPAG1] >gi|107837322|gb|ABF85191.1| conserved hypothetical integral membrane protein [Helicobacter pylori HPAG1] (459 aa)
Score = 122, Expect = 1.6e-04, Identities = 92/426 (21%), Positives = 177/426 (41%)
  Q:   116 FISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFF--AIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFF---NANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGL---IFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIY 541
            I+  L    GA+ +    L Q    + + ++ S FY   F++I   +L M++  +             SE +  +      L L  + +Y+  I      +++  L   F+  + R      A LI +L NI F  +F  V K+ + G  I+ +IG+ + +L++     F     KG   F      +K F +      +S+I S  + +  ++   +  V +++F     AI    G+  VS          V G  +YN I F   ++ I  G++PI +++Y  +N +RVK V+ +G+      +  I  VF+ ++ F    +   +   +   P  +             +  L +++     FQS  +   + + +L+  L   +   PIL   + I  +   Y +  F AF  +A+     EI   ++
  S:    64 LIAYELLFGFGAASIVGYFLGQNKTHRARLVFSSVFY---FVAISAFILSMALLPF-------------SETIARFFGSNDAL-LGMSKRYIEIILMGAVFMVLHPLADVFVVNDKRPVLAMVAMLIGSLANIFFNYLFIFVLKVGVQGSAIATVIGHAIGVLVLMQHFWF----KKGQLYF------IKRFSL------SSVISSAKSGVPQSTAEFSASVMILLFN---TAIMHTAGERFVS----------VYGIVMYNAIIFFTTLFAISQGIQPIASFSYGARNLERVKEVFVFGLKA----AFCIGVVFYGVYYFLDEFLIKLYLQPSEQDPLFMQETKRAMNIYYVGYVFLGMTLLCAVFFQSIQRAKSSFIITLSHTLGFIVILLPILSHFYGINGVWVTYPIAQFLAFL-VALGVTYYEIKKGVF 446
>gi|153954311|ref|YP_001395076.1| efflux pump [Clostridium kluyveri DSM 555] >gi|146347192|gb|EDK33728.1| Predicted efflux pump [Clostridium kluyveri DSM 555] (452 aa)
Score = 122, Expect = 1.7e-04, Identities = 88/408 (21%), Positives = 170/408 (41%)
  Q:    96 QANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPG-DAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTL-LFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           QAN ++ +   +++  +  I +++   I  G + + SR+L   +K + +    ++  S    S++L +LIM I    +   +      + E +  Y     ++ L  +  +++ I  +             +++EG +     + +I  + NI  + I     K  I G  I+  I   +  + +  +I F                ++K   IN  +   ++ L + TF+         + Y IV     N+I    G D  +SA   +N I        +  I  ++YGI   L+PI+ +NY  + + RVK     GI+T VV SL     F  I +     +   F +N  +E+  LT+ +   L+   PL+ + +   S FQ  GK    +  S+ +  +F  P++
  S:    45 QANGSLGIAALTIVFPIQQIILALSQMIGVGIASIISRSLGAGNKLRAEKAVGTALTS----SVLLGILIMVIGLAFIRPIL--YIFGSLETILPYAVTFFKITLYCSVFFVFSIVSNS-----------IIQSEGHANIAMISMIIGPVINIPLDYILVTRLKYGIKGAAIATDISQIICFIFLLVYICFNS---------KILGVKVKNLVINIKLLKEAISLGVSTFM-------TQLAYGIVAIVLNNSIRIYGGSDLYISAIGIYNRI--------FGFITVSMYGIRQALQPIIGFNYGAKKFNRVKQSLKLGILTSVVISL----GFLVIIISFTNKIAGVFTSN--NELIALTVPILRVLILMSPLVGVQVIAASFFQYIGKPKPALFLSIMKPFLFLIPLM 407
>gi|126698208|ref|YP_001087105.1| putative drug/sodium antiporter [Clostridium difficile 630] >gi|115249645|emb|CAJ67462.1| putative drug/sodium antiporter [Clostridium difficile 630] (457 aa)
Score = 122, Expect = 1.7e-04, Identities = 72/323 (22%), Positives = 136/323 (42%)
  Q:   106 TSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           TS +G +++ F      + +GL   +GA+   +R L   D +K   +  +S YS + +  ++ ++IM     I++   A  ++    +  +   V    I N  N  M  I  S                EG +     A L+  L N+I + IF   F + + G  I+  I    + L+   +IL  + +      FSF   ++ E   +  +F+  L + + T +     ++A            N  +T  GD+ V AG+        + T I +L    ++G + G +PI  YN+  +NY R+ +     I+   VF +++  + 
  S:    53 TSQMGAISVAFPLGQLVVGLGLLFGNGAASYIARLLGHGDNEKAGKVVSTSIYSSIIVGTLVIIVIMIFLNPILKLLGATKSIMPYAISYASIYVVSS-IFNIFNVTMTNIVTS----------------EGAAKTTMCAMLLGALLNMILDPIFIYTFGLGVRGASIATAISQIASTLVYVGYILSKKSI------FSF---RINECCFSKEIFSEILKIGIPTLIFQLLTSLA--------ITLTNMEATKYGDS-VIAGMG-------AVTRITSLGSLVVFGFIKGFQPIAGYNFGSKNYDRLHIAIKTSILWTTVFCVVLGLIL 339
>gi|170288923|ref|YP_001739161.1| MATE efflux family protein [Thermotoga sp. RQ2] >gi|170176426|gb|ACB09478.1| MATE efflux family protein [Thermotoga sp. RQ2] (437 aa)
Score = 122, Expect = 1.8e-04, Identities = 83/384 (21%), Positives = 159/384 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL-------SLFQSTGKMFLNIVASLAQGLI 497
           ++ IS+   I  GAS + S+ + ++DK+   +   ++  S LF  ++  + I  I  +I +  I       +              L  A +Y   +   IP+IM  N+     R EG +     A  I +L NI  + +F  VF M + G   + ++   V+ LL+A    ++ F  K  Y           F++ W+      IL +G     A  +++  +YV+  F        A GD GV+           S   + N     + G+   +  +    + ++N ++++  + Y +  G    L   AV + I +F  P +   F  +   E      L+  L+    +LSL + G+       S+FQ  G+   +++ ++ + +I
  S:    44 MVIISLAAGIGVGASSVVSQKIGERDKEGADT---AASVSILFSIVIGFLSIAVILPFISDILIFAGAQGET--------------LRLALEYSVILVYFIPLIMFNNVANGVFRGEGDAKRAMVAITIGSLLNIGLDPVFIYVFGMGVRGAAYATVVSIAVSSLLIA----YWMFFKKDTY---------VSFRLKWDGEILKRILKIGIPASLAQASMSVAIYVLNVFAV-----RAGGDYGVAV--------FTSAWRVINFGTVPLIGMAMAVTSVTGAAFGERNGEKLETAHLYAVKLGFFVGL---AVMFTILIF-APYIARLFTYSQEGE-----KLYSDLVKALRILSLFLPGVPFGMFTSSMFQGVGQGLKSLIVTIMRTVI 382
>gi|160934035|ref|ZP_02081422.1| hypothetical protein CLOLEP_02897 [Clostridium leptum DSM 753] >gi|156866708|gb|EDO60080.1| hypothetical protein CLOLEP_02897 [Clostridium leptum DSM 753] (429 aa)
Score = 122, Expect = 1.8e-04, Identities = 43/176 (24%), Positives = 81/176 (46%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL 285
           G+ N + +   + + SG SV+ ++     D+   K     S    + LS  +TV+I ++   + E  +A   + T E            I+  A  YMY I G     +  NL+   LRA G S    +  ++A++ N++ +L+F L + M +IG   + +I   ++ +L   +I+
  S:    35 GSFNYLILGFVIGLTSGFSVIIAQRFGAGDEAGVKRATAMS----VLLSAAITVIITAVSMLLTEPVLA--VMQTPEN-----------IMQDACGYMYVIFGGTAATLFFNLVSSVLRALGDSKTPLYILVVASILNVLLDLLFVLKYNMGVIGTAYATVIAQAISCILCVIYII 193
>gi|168213764|ref|ZP_02639389.1| MATE efflux family protein [Clostridium perfringens CPE str. F4969] >gi|170714742|gb|EDT26924.1| MATE efflux family protein [Clostridium perfringens CPE str. F4969] (442 aa)
Score = 122, Expect = 1.9e-04, Identities = 64/293 (21%), Positives = 123/293 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVK 407
           ++ +IGL I  G +   S A+ Q+   +   I    F S +F +I+  ++I  ++ + ++  +             Y     +     A  Y+  I    P  +  +  I F+R +G      +A + +N  NI+ + +F  +F + + G  ++  IG      LVA  +L   F+ K +         ++   IN +     L   + +FL + S      ++ IV +          GD GVSA     +I          LIF A++ G+  G++P+++ N+  +  +RVK
  S:    62 LYSAIGLTIGVGGATALSVAMGQKKFHRVNRI----FTSAVFATIIFCIIISLLEVFFLDKIV-------------YMLGASEATFPLAKDYLKIILALNPAFIFASAFIVFVRNDGEPKLAMYAVIGSNTTNIVLDYVFIYIFNLGMFGAALATSIGQ-----LVALGVLSIHFIKKNNT------MHIELGGINLDNIGKVLKNGVPSFLNEISAGFVIFIFNIVIY-------KFEGDLGVSAYGIITNIV---------LIFMAVFNGVSQGVQPLISVNFGAKKEERVK 311
>gi|45357729|ref|NP_987286.1| MATE family drug/sodium antiporter [Methanococcus maripaludis S2] >gi|45047289|emb|CAF29722.1| MatE family member (drug/sodium antiporters) [Methanococcus maripaludis S2] (460 aa)
Score = 121, Expect = 2.1e-04, Identities = 65/308 (21%), Positives = 137/308 (44%)
  Q:   198 LILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLT--LLFCTLLFQF-PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYS 505
           + +  A +Y   + G   +++  N+    LR EG +    +A ++ ++ NI+ + IF  V  M + G   + L+      L++   +  Y    K D     +F++   FK++ N+     I S+G        +++++      F     ++ A G+ G++           +G  I ++    + G+  G+  +    Y   N +++++ Y Y +  G++   +I A+   I +F    +T  F  +  S +H+L   L+F   +F F P L L +   ++FQ   K   ++  SL + +I   P+ Y+
  S:   128 ITVTMAVEYSTILFGGAVVLLFTNIANAILRGEGDTKRAMYAIILGSVLNIVLDPIFIYVLNMGVAGAAWATLLS-----LVITGILFVYWLFIKKDTFLKISFEK---FKLDINIIKE--IFSIGL-----PASISHLTMAFSMFLLTAIVAKAGGNDGIAV--------FSTGWRIVSMGTIPLVGLATGVTVVTGAAYGSANPEKLEISYKYALKMGILVETIIAAL---ILIFEN-QITYLFTYSENS-VHILEGLLVFLKYMFLFYPTLPLGMLTAAMFQGVSKGNNSLFISLLRTIILQIPMAYT 410
>gi|150008342|ref|YP_001303085.1| putative transmembrane cation efflux protein [Parabacteroides distasonis ATCC 8503] >gi|149936766|gb|ABR43463.1| putative transmembrane cation efflux protein [Parabacteroides distasonis ATCC 8503] (449 aa)
Score = 121, Expect = 2.2e-04, Identities = 89/391 (22%), Positives = 170/391 (43%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYS---CLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGT--FLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFF--NANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLI 497
           +++    ++   IGL    GAS++ S  L+ Q K K  +I ++   S   C+ LS+ L V+    +  ++        + +SE            +L +  +YM +I   +   M+LN+ +F +R +G   +    + I  L N+  + IF       ++G  ++  I   V  +++  +I+ +  V     P  F+ K      I   +     ++ LG+  FL +A+IA   +V   +F   L       G+ GV+A               + ++F     I    +PI++YNY  Q +KRV+  +   ++  VV   L  A    I     P V+S F  N     EI V  + + +L + F   +L+I  +  +QS  +     + ++ +G++
  S:    55 NIVAPFFMLATGIGLMFGVGASIVASIHLSHQ-KVKVANINITQALSISLCIMLSLSLLVMTFRAEVALL--------LGSSE-----------QLLPSVLEYMNWIVPFLAFYMLLNIGLFIIRLDGSPTYAMLCSAIPALINLTLDYIFVFPLHWGLMGAALASAISVIVGSIMIVVYIVGFSKVLHLYRP-KFSLKS-----ILLTIRNIGYMVKLGSSAFLTEAAIACMMLVGNYIFMRYL-------GEDGVAA--------YSVACYCFPIVFMVNNAIAQSTQPIISYNYGIQQWKRVRQAFKLALLCAVVCGGL--ACVGTILFC--PEVSSLFLGNHGNAYEIAVSGIPYFSLGYVF--FALNIVCIGYYQSIERFKPATLFTILRGIV 405
>gi|168716324|ref|ZP_02748601.1| putative drug/sodium antiporter [Clostridium difficile QCD-63q42] (454 aa)
Score = 121, Expect = 2.2e-04, Identities = 72/323 (22%), Positives = 136/323 (42%)
  Q:   106 TSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           TS +G +++ F      + +GL   +GA+   +R L   D +K   +  +S YS + +  ++ ++IM     I++   A  ++    +  +   V    I N  N  M  I  S                EG +     A L+  L N+I + IF   F + + G  I+  I    + L+   +IL  + +      FSF   ++ E   +  +F+  L + + T +     ++A            N  +T  GD+ V AG+        + T I +L    ++G + G +PI  YN+  +NY R+ +     I+   VF +++  + 
  S:    50 TSQMGAISVAFPLGQLVVGLGLLFGNGAASYIARLLGHGDNEKAGKVVSTSIYSSIIVGTLVIIVIMIFLNPILKLLGATKSIMPYAISYASIYVVSS-IFNIFNVTMTNIVTS----------------EGAAKTTMCAMLLGALLNMILDPIFIYTFGLGVRGASIATAISQIASTLVYVGYILSKKSI------FSF---RINECCFSKEIFSEILKIGIPTLIFQLLTSLA--------ITLTNMEATKYGDS-VIAGMG-------AVTRITSLGSLIVFGFIKGFQPIAGYNFGSKNYDRLHIAIKTSILWTTVFCVVLGLIL 336
>gi|15895750|ref|NP_349099.1| membane protein, cation efflux pump (MDR-type) [Clostridium acetobutylicum ATCC 824] >gi|15025505|gb|AAK80439.1|AE007747_8 Predicted membane protein, probable cation efflux pump (MDR-type) [Clostridium acetobutylicum ATCC 824] (442 aa)
Score = 121, Expect = 2.3e-04, Identities = 88/384 (22%), Positives = 163/384 (42%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYP-------FSFAFKQLKE-FKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           I ++ G     G     +R +A+    + KS    +FYS +   +++ V  +     IV+   A S  S      SY +          N  +    G   +I+   L    +RAEG S    +   ++   N IF+ +F LVFK++++G   ++L      +  + S I +  +++K           F  + K   E +KI  +    S  L + T L                   LN  S   GD+ V+  G+A   +Q            F   G++ G+ P++AYN+ K+N+ R+      GI T V+F ++++A+F  I       V  FF+ + PS + +   +   +L        +     +FQ++GK   + + ++ QG+++
  S:    64 ILMAFGNMFGVGGGNFITRLIAKNKVNEAKSAAGYTFYSSMIAGVIIAVAAVVFINPIVKILGADSLSS------SYTK----------NYALTMFLGGFAVILNFALEQM-VRAEGASKESMYGMFVSTALNFIFDPLFILVFKLNVVGAAAAML------LANLGSSIYYIYYLDKKSEKLRGFMGYFKISIKNKMEIYKIGISELLMSFFLIITTLL-------------------LNNFSIGYGDSVVAGFGIALRIVQVPE---------FLSMGVMMGVMPLIAYNFSKKNFARLT----EGIKTSVLFIVILSAIFGGIVYVFRVEVLHFFSKD-PSVMKIGGYIMLAMLISSMFNGTTGLFTGIFQASGKGISSTIMAVTQGMLY 400
>gi|160913575|ref|ZP_02076265.1| hypothetical protein EUBDOL_00051 [Eubacterium dolichum DSM 3991] >gi|158434036|gb|EDP12325.1| hypothetical protein EUBDOL_00051 [Eubacterium dolichum DSM 3991] (456 aa)
Score = 121, Expect = 2.3e-04, Identities = 80/391 (20%), Positives = 164/391 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTL-LFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           +I  +    +  G S   S  + ++D    + I  + F + +  +I LT++++  +  ++         + SE    Y          A +    +  G+I + + L L  F + A+G S       +I  + NI  + IF  +F M + G  ++ +        L A++ +++ F        +    + + FK +W +    + L +  F+  A+ +V     V+ F  +L A     G   V A    + +   +  P+         G+  G +PI++YNY  +N +RVK  +    I+   ++ ++ A+   I LF G  V+ F      SEI +  L ++   +F   ++ L IS    F + G   ++   ++ + +I   P++Y
  S:    67 MIISAFAFLVGVGGSPRASIYMGKKDNDTAEKILGNCFTALIVCAIALTIIVLLFKEPLL------YLFAASEDTIGY----------AMDYITIYAVGTIFVQLTLGLNAF-ISAQGFSKISMLTVIIGAVTNIALDPIFIFLFDMGVKGAALATVFSQ----ALSAAWAIWFLFSKH-----TVLRLRKENFKPSWKILAPCIALGVAPFVMQATESV----LVLCFNSSLLAYG---GKLAVGAMTILSSVMQFAMLPLQ--------GLTQGGQPIISYNYGAKNAERVKKAFKLQTISCFAYAFILWAL---IMLFPGMFVSIFTGDPALSEITIWALRIYMATIF---MMGLQISCQQTFIAFGNSKISAFLAVFRKIIVLIPLIY 411
>gi|15614726|ref|NP_243029.1| hypothetical protein BH2163 [Bacillus halodurans C-125] >gi|10174782|dbj|BAB05882.1| BH2163 [Bacillus halodurans C-125] (464 aa)
Score = 121, Expect = 2.6e-04, Identities = 90/485 (18%), Positives = 189/485 (38%)
  Q:    19 TESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACI---AKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLR--DASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN---TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           TE+IPKL   + +P++    +  +Y  VD I + + + + G+         AG+T                                  +   + +I +S+   +  G + + SR L ++  ++   +         F +I+  +L++S+  +I    +   A      + V   Y           A  Y++ I                +R+EG + F     ++  + NI+ +++F     M ++G  I+ +I        V   +L Y    K      ++     + ++  +V     ++ L  F++   AS+ +  I  +++ FG+   +              F  +Q      I   +   + GI+  ++PI+ YNY  + Y R++     G     +FS+    +F  + LF   ++   F A+     + +  + +LFC       L+   I    L+QS GK    ++ SL++ +IF  P++
  S:    12 TEAIPKLLRSLSIPAMIGMFVMALYNVVDTIFISYAVGIEGV---------AGVT----------------------------------IAFPIMMIMMSMAGALGIGGASVISRRLGERRGEEANQV---------FGNILTVILVLSVIGFISAFTLLGPALQLFGATSVTQGY-----------ATDYLFPILLGSIFFFFAFAANNIIRSEGNATFAMVTMIVPAVLNILLDVLFIFGLNMGVLGASIATVIAQAS----VTGLVLRYFLTGKSTLSLHWS-----DLRMKGSVIKEVCLVGLPAFVQQSSASLMMIAINSMLLRFGSDFYVGV------------FGLVQR-----IMMFVMMPMMGIMQAMQPIVGYNYGAKQYSRLRETVMLGFKVATIFSI---GIFALLMLF-PEALLRVFTADREVIQAGVSAMHILFCVTF----LIGAQIVAGGLYQSLGKPKQALILSLSRQIIFLIPLV 407
>gi|160889927|ref|ZP_02070930.1| hypothetical protein BACUNI_02361 [Bacteroides uniformis ATCC 8492] >gi|156860315|gb|EDO53746.1| hypothetical protein BACUNI_02361 [Bacteroides uniformis ATCC 8492] (458 aa)
Score = 121, Expect = 2.7e-04, Identities = 87/388 (22%), Positives = 157/388 (40%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQL----KEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYG--IVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF--WPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           ++F  IGL + +G SV+ S    Q  + K KS  ++   + LF++IV   LI S+      A  A+   S+              +L     Y+ +   S    + + + +F +R +G        +LI  + N++ + +F   F   ++G   +  I   V  L+   ++LFY    +   P  ++ K L    +     W + +++L       L +A++AV   V   VF   L       GD GV A           G   Y + F  + G  I    +PI++YN+     +RV       ++T VV  ++    F  +P  L G       F +       +    F      F    ++I+ +  FQS  ++    + +L +G +F  P
  S:    62 MLFTGIGLMVGAGCSVVAS---IQLSRGKSKSARLNVTQALLFVTIV--ALIPSVLMMAFPAETARMLGSSEH------------LLPMVTDYLLWFVPSWVFQIWITVSLFVIRLDGSPKLAMLCSLITAVINVVLDWLFIFPFGWGVMGAAFATSISIMVGGLVAMVYLLFYARHLRLQ-PLKWSVKSLRLSVRNIGYQWRIGSSAL-------LGEATLAVLMFVGNQVFMSYL-------GDDGVGA----------FGIACYYIPFVFMVGNAIAQSAQPIISYNFGLGYKERVMTAERIALLTAVVCGVVATVAFTVYPYLLVG------LFISLDSEAAKIAIHGFPYFASGFVFFIVNIAVVGYFQSVERIKPATIFALLRGFVFLIP 409
>gi|110004414|emb|CAK98752.1| hypothetical drug/sodium antiporter extrusion transmembrane protein [Spiroplasma citri] (532 aa)
Score = 120, Expect = 3.1e-04, Identities = 81/391 (20%), Positives = 163/391 (41%)
  Q:    89 NYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYG--IVDGLRPILAYNYQKQNYKRVKVVYYYG--IITGVVFSLLINAVFWPIFLFGGPSVTS--FFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQ 479
           N   L Y++ +  +   T     +  +  +  +    G S+ F+    Q +KQ+ +S+  ++    +  SIV    +          C+         ++   ++    ++ +    Y++ +  S P++ +  LL+  LR +G+S+   +  + A   N++F +IF    +M + G     ++G  +  + +    LF  + NK  Y   F ++ L  F ++         L   +F+        N+  V+V   +   IS+ PG             Q  +      + FF      I  G++ I+ YNY  + Y R+    +YG  II+G +F  L+      +F+  GP +     F ++   E   + +L   +L  +P  ++S  G+SLFQ
  S:    72 NNGELTYESAKIFVNLSTHFAMQIYNLLFAFAILFAIGTSITFAIKSGQSNKQQTQSLAGNALTITVLFSIVAAFFVF---------CLVFPQWDNIMILIQLSKKGTWIVQDLTWHYVFPMLLSSPLMFVSYLLLTLLRTDGKSHAAIYITIGAIAINVLFSIIFVKYGRMLLEG----TMLGTIIAWIFIIIVSLFCIYYNKNSY-LRFHWRDL--FYLHKTTIKEIFRLGFSSFIN-------NLGAVLVSILSSAIISSLPGQFAQRQQYGLASFQLFNSAVSPWIAFFTAIALEIAQGMKTIIGYNYGAKKYLRMYQTCWYGLAIISGWLFFTLL------LFIAIGPQLLMDFAFPSDLVDEYRWIAVL---MLMSYPFAAISFLGVSLFQ 436
>gi|150399968|ref|YP_001323735.1| MATE efflux family protein [Methanococcus vannielii SB] >gi|150012671|gb|ABR55123.1| MATE efflux family protein [Methanococcus vannielii SB] (452 aa)
Score = 120, Expect = 3.1e-04, Identities = 100/485 (20%), Positives = 193/485 (39%)
  Q:    19 TESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF-----WPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           TESI KL LK  +PS    ++ GIYI VD I + + +  + I  +  A+                                             + +    GL    GAS   S  L   +++  ++I  + FY      I+LT+L +      ++  +A   VS + +  SY+ +    ++     ++ F  G  PII          R +G      +A ++++L NI+F+ IF ++F   + G  ++ +IG         + I  + F+          F+++ + K         L +    F+ + S ++  +++ I F    N +  +      + G+          + I+ +I     G+ +G++PI++YN+  + Y RVK +     I   +  +L+  +F      P+ LF           N    + + T +F    F + L    ++ L  + FQS G   ++   SL +  +F  P+L
  S:     8 TESINKLILKYALPSTIGFVVLGIYIIVDGIFLGNYVGSDAIAAVTVAI-------------------------------------------PFSFLLTGFGLMFGIGASSHISMNLGAGNQKDAENILKTVFYLIFITGIILTLLSL----IFIKPLLALFGVSENLLNLSYDYLN---LIYLFGIFIMFKVGLDPII----------RNDGFPKKAMYAIILSSLLNILFDAIFIVIFGWGVFGAALASVIGE-----TFGALIYIHHFLAGKSNLKIKLFEKVSDIKYEIKNVKKILSVGFSPFILEMSASIVMLIHTIQFLRYGNELDVS------AYGIV---------SYIFAIIMLIFIGLGNGVQPIISYNFGAKEYFRVKEIIRTSSILCSIVGILVFLLFSIFPKIPVMLF-----------NQTDSLLIETSIFGLRYFAYGLSVFGLNYLIITYFQSIGNSIVSNTLSLIRVFVFLIPLL 408
>gi|168333834|ref|ZP_02692077.1| putative drug/sodium antiporter [Epulopiscium sp. 'N.t. morphotype B'] (458 aa)
Score = 120, Expect = 3.5e-04, Identities = 98/494 (19%), Positives = 188/494 (38%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPF-SFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           ++ +  TESI KL  K  +P++   ++ G+Y  VD++ + +I    G+ +L  A+   G+T    L +++                                I ++ GL I  GA+   S  L + +K + + I  ++   C+   + ++V+ +     I+    A                     L  A +Y+  I       +    +   +R++G               NII + +F   F M I G   + +I   V     A++ L Y F  K +  F     K  +++     VF    +L++G+      +A++ +  +       NA+ T  GD  + A    N I  +  TPI         G+  G +PI+ +N+  + Y R  +          VF L++ A+   I      ++ S F+ N P  + +            PL+  ++ G    Q+ GK    ++  L + +I   P++  M
  S:     4 HQELLATESIGKLIFKYSLPAIIGMMVNGLYNVVDRMFIGNI---PGVGHL--AISGLGVT----LPIMT--------------------------------IIMAFGLLIGIGAATNISIKLGENNKDQAEGILGNAISLCILSGLAISVIGLVFVNPILSMFGASPDS-----------------LPFAKEYIEVILIGSVFNITAGSMTNLIRSDGNPKLSAIIMATGCFLNIILDALFIFGFGMGIAGAAWATIISQAVT----AAWSLGYYFAGKSNLSFHKSGLKLARKY-----VFP---MLAIGSAPFAMQVAMSGVQIICN-----NALGTYGGDMAIGAFATINSIVLMMVTPII--------GVAQGTQPIIGFNFGAKQYDRATLTLKISAGFTFVFLLVVVAIMQII----PETLVSPFSGNNPELVAMTVEGLRKYTIMMPLMGPAMLGSQYIQAIGKAKSAMILGLLRQVILLIPLMLIM 411
>gi|187736300|ref|YP_001878412.1| MATE efflux family protein [Akkermansia muciniphila ATCC BAA-835] >gi|187426352|gb|ACD05631.1| MATE efflux family protein [Akkermansia muciniphila ATCC BAA-835] (461 aa)
Score = 119, Expect = 3.7e-04, Identities = 89/385 (23%), Positives = 152/385 (39%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSL--ILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFA--IYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL--INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGL 496
           +NL F ++G  +  G + + S  L ++D++  +    +     L  ++VL +  +   T I+ A  A                     L  A  +M      +P+  +   L   +RA G       + L++   NII   IF   FK  I G  ++ L+   V ++ V                FS A   +   +  W +  T +  ILS+G      +  + N+    V       ++   GD  + A    N I          LI FA  + G+  G++PI+ YN+      RV +   YG++ G  F+ L  +  VF+P  + G      F +  +   +    L+ C L   FPL+   I   + FQ+ GK  L I  SL + +
  S:    64 MNLTF-ALGTLVGIGGAAISSIRLGRKDQEGTERTLGNVLIMSLIAAVVLVIPTLLFLTEILTAFGASGQT-----------------LTYAYDFMLITLLGLPVTYVFFNLNHVMRATGYPKKAMGSTLLSVGINIILAPIFIFWFKWGITGAAVATLLAQVVGMVRVL-------------LHFSDAASTVHFRRGIWQLRKTIVTGILSIGM-----APCLVNVCGSAVTVAINRQLADHGGDLAIGAYGIINRI----------LILFAMLVIGLTQGMQPIIGYNHGAMKPGRVLLTLKYGVLAGTSFTTLGFLACVFFPRGIAG-----LFTDDASLISLAANGLIICVL--AFPLIGSQIIIGNFFQAIGKARLAIFLSLTRQM 401
>gi|118726997|ref|ZP_01575610.1| MATE efflux family protein [Clostridium cellulolyticum H10] >gi|118663637|gb|EAV70285.1| MATE efflux family protein [Clostridium cellulolyticum H10] (417 aa)
Score = 119, Expect = 4.1e-04, Identities = 52/254 (20%), Positives = 108/254 (42%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKE-FKINWNVFTTSLILSLGTFLRDASIAVANIVYVIV--FFGTLNAISTAPGDA 356
           V    ++ ++N + +++ + +++GA+V  ++ L   +++        +  + L +SI     I  +  YI            ++++N       +++  AA  YM     S PI+ + ++    LRA        +A + +NL N +   +F  VF   ++G GI ++       ++VA  I     ++     F   +K LK    I       SL+ + G  L  A +A      +      G++N++   PG+A
  S:    11 VSAVGIVDSINFVVMNLFVAVSTGATVTIAQHLGASNREDASKTASQAITAVLIMSI-----IAGLGLYIF----------GNQIINFLFGDAEKIVKTAARTYMICSAISYPILGLFDVCTGILRASNNFRAAMYAVVASNLVNFLVGALFIFVFDFGVLGAGIGLICARLTGTIIVAYSICKSHHLDVLRSSFKIKYKILKPVLYIGLPAGIDSLVFNGGKLLVQAIVASLGTAALAANSIAGSINSLLNIPGNA 252
>gi|91215563|ref|ZP_01252534.1| uncharacterized membrane protein [Psychroflexus torquis ATCC 700755] >gi|91186515|gb|EAS72887.1| uncharacterized membrane protein [Psychroflexus torquis ATCC 700755] (458 aa)
Score = 119, Expect = 4.2e-04, Identities = 62/305 (20%), Positives = 130/305 (42%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-----KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           I + A  Y   +   +P++ +  +    +RAEG+  F   A +I ++ N+I + +F  +    ++G   +    Y    +L  S+I+++      +    F+     +F  ++ +      L   T  R A ++V  ++   + F  L   S+    A +S  L F                F + G+  G  PI +YNY  + Y R+     K + Y   +  +VF+L++    +P  +    +  +    +TPS +         +    P+++L + G + FQ+ GK    ++ +L++    F P++
  S:   131 IFDPARIYYRVVLYGVPVLALAMMGNTVIRAEGKPKFAMVAMIIPSVGNLIMDYVFINILDYGMLGAAWATTGSY----ILCLSYIVWFFLSKNSELKIRFS-----DFGFDYEILKEIGALGFVTLSRQAIVSVTYLLLNNILF-DLGGESSVATYAIISRMLMF--------------ALFPVLGVTQGFLPIASYNYGAEEYGRLRETINKAIGYASAVAFIVFALIM---IFPETIVSVFTQDAQVLRDTPSAMR-------WVFAAVPVIALQLIGSAYFQAIGKAGPALLLTLSRQGFTFIPLI 406
>gi|20091999|ref|NP_618074.1| integral membrane protein [Methanosarcina acetivorans C2A] >gi|19917206|gb|AAM06554.1| integral membrane protein [Methanosarcina acetivorans C2A] (508 aa)
Score = 119, Expect = 4.4e-04, Identities = 74/389 (19%), Positives = 163/389 (41%)
  Q:   117 ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV-LTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF--FFPILYS 505
           ++ GL +  GA++  SR +  +DK    ++ V +F   + L++ LT+  ++   ++ +  +      T+++  +Y +V        A  +++F           N+    LR+EG +     + ++ ++ NI  + IF  V  + + G  ++ ++ +  + LL     +FY F  K D   SF F     FK N  +      + + + +   ++A+  ++  ++     N    A                  +G  + ++    + G+   +  I    + ++N+K+ +    Y    G +   LI      +++F       F  A T + I   LT L   +   +P ++  +   SLFQ  GK    ++A+L + L+    F +L++
  S:   117 LTSGLGVGGGAAI--SRRIGARDKAGVDNVAVHTFVLMVILTVALTIFGLA---FVRDLFMYSGAGGTTDLGVAYARVIF------AGSFVFFFA---------NVSNSILRSEGDAKRAMQSMILGSVLNIGLDPIFIYVLGLGVAGAALATVVSFACSGLL-----MFYWFFVKKDTYVSFDFHS---FKFNLAIANDIFRVGIPSSVEQVALAMTALLMNLIIVNVSNTDGVA---------------VYATGWRVASIAVAPLIGVSISVVSISGAAFGEKNFKKARHALIYATEIGFLAEALIGIA---VYVFAPQISAVFTQAETAARIAPELTRLLKIMTVFYPAVTFGMLSASLFQGAGKGTSALIATLLRSLVLTPLFAVLFA 462
>gi|168334824|ref|ZP_02692948.1| putative drug/sodium antiporter [Epulopiscium sp. 'N.t. morphotype B'] (458 aa)
Score = 119, Expect = 4.5e-04, Identities = 98/494 (19%), Positives = 188/494 (38%)
  Q:    13 NESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPF-SFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           ++ +  TESI KL  K  +P++   ++ G+Y  VD++ + +I    G+ +L  A+   G+T    L +++                                I ++ GL I  GA+   S  L + +K + + I  ++   C+   + ++V+ +     I+    A                     L  A +Y+  I       +    +   +R++G               NII + +F   F M I G   + +I   V     A++ L Y F  K +  F     K  +++     VF    +L++G+      +A++ +  +       NA+ T  GD  + A    N I  +  TPI         G+  G +PI+ +N+  + Y R  +          VF L++ A+   I      ++ S F+ N P  + +            PL+  ++ G    Q+ GK    ++  L + +I   P++  M
  S:     4 HQELLATESIGKLIFKYSLPAIIGMMVNGLYNVVDRMFIGNI---PGVGHL--AISGLGVT----LPIMT--------------------------------IIMAFGLLIGIGAATNISIKLGENNKDQAEGILGNAISLCILSGLAISVIGLIFVNPILSMFGASPDS-----------------LPFAKEYIEVILIGSVFNITAGSMTNLIRSDGNPKLSAIIMATGCFLNIILDALFIFGFGMGIAGAAWATIISQAVT----AAWSLGYYFAGKSNLSFHKSGLKLARKY-----VFP---MLAIGSAPFAMQVAMSGVQIICN-----NALGTYGGDMAIGAFATINSIVLMMVTPII--------GVAQGTQPIIGFNFGAKQYDRATLTLKISAGFTFVFLLVVVAIMQII----PETLVSPFSGNNPELVAMTVEGLRKYTIMMPLMGPAMLGSQYIQAIGKAKSAMILGLLRQVILLIPLMLIM 411
>gi|150014941|ref|YP_001307195.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] >gi|149901406|gb|ABR32239.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] (457 aa)
Score = 119, Expect = 4.5e-04, Identities = 80/381 (20%), Positives = 156/381 (40%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           +  I ++ G+ I  G +   S  L + DK+  + +  ++F   + + ++LT+        +++A         SE +  Y +   ++I++                 I NL+ F L    R++G       + L++ + NII + IF     + + GG +  ++   ++ +    +IL+Y    KG        K LK  K   +   +   + +  F    + +   ++       T N++ +  GD  V A    N +  +   PI+        G+  GL+PI+ YN+  + Y RVK    YG+I   +  ++   +   I      ++   FN N  S I V        L   P +   I   + FQS G++ +++  SL
  S:    61 IMFIILAFGMLIGIGTATKVSIKLGEHDKEGAERLLGNAFTLIIIIGVLLTLFGHIFANPLLKA------FGASENIIGYGEDFIRVIISGC---------------IFNLMSFGLNHSIRSDGSPKIAMASMLMSAIINIILDPIFIFGLGLGVKGGALGTVVAQTISSI----WILYY--FTKGSSVLKIRRKNLKLEK---DAVLSIFAIGVSPFSMQLAQSAVQVI-------TNNSLQSYGGDLAVGAMTIVNSLAMIFLMPIF--------GLNQGLQPIIGYNFGARKYDRVKQAVKYGVIIATIIVVIGFIIIEGI----PETLVKIFN-NESSLIEVTAHGMRIFLIMLPFIGAQIIITNFFQSIGRVKISMFLSL 395
>gi|34540604|ref|NP_905083.1| MATE efflux family protein [Porphyromonas gingivalis W83] >gi|34396917|gb|AAQ65982.1| MATE efflux family protein [Porphyromonas gingivalis W83] (452 aa)
Score = 119, Expect = 4.6e-04, Identities = 93/427 (21%), Positives = 180/427 (42%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLR--------AEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVL-----TLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI---LYSMWNI-----AILVSDYKVMLFTAFTNIAI 529
           V   SV+  ++L+F+ IGL    G  V  SR L    KQ  K+  V+S      +S++ +V++ ++   +  A + +                  L+   AN+ M  +  +   + I++ +I  L         ++G S     A +I ++ N+  + +F   F   + G   + ++   +  ++   F +      K +   SFA                  + ++  +L    I ++ +   ++   +++ +  A    G  A  A   +       I  L    ++G V GL+P+  YNY  +N++R+K      +I    F +L +     I +F  P ++ F    T  EI  +     TL+F T  FQF          +L+ + G+   +++ ++ +  +FF P+   L S W +     A  V+D    L T F  I I
  S:    50 VAAVSVVFPLSLVFLGIGLMFGVGGGVYISRLLGA--KQIVKAGQVAS------VSVITSVILAALIALVCNAFLPEI-----------------LLFMGANEEMMSLAEAYGRLFIVSCVIGTLNVSMSNIIVSQGASKTSASAMIIGSVINVALDPLFIYAFGWGVKGAAWATILSRIITTIIYTCFFM------KAEVKVSFAL----------------FVPTIRMYLDIIKIGISMLCLQLLQTLSISLLQRAAVKYGAEAVAAVGIV-----LKIVTLGTNVVFGFVKGLQPMAGYNYGAENFQRLKEAVRCSLILTTSFCVLWSTF---ILVFASPVISCFGKDETMQEIARIALRANTLMFFTFGFQFVY-------STLYMAIGRARQSLLLNIGRQGLFFIPVILLLPSYWGLNGVLYAQPVADVFATLMTLFFAIQI 435
>gi|34541117|ref|NP_905596.1| MATE efflux family protein [Porphyromonas gingivalis W83] >gi|34397433|gb|AAQ66495.1| MATE efflux family protein [Porphyromonas gingivalis W83] (439 aa)
Score = 119, Expect = 4.6e-04, Identities = 93/427 (21%), Positives = 180/427 (42%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLR--------AEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVL-----TLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI---LYSMWNI-----AILVSDYKVMLFTAFTNIAI 529
           V   SV+  ++L+F+ IGL    G  V  SR L    KQ  K+  V+S      +S++ +V++ ++   +  A + +                  L+   AN+ M  +  +   + I++ +I  L         ++G S     A +I ++ N+  + +F   F   + G   + ++   +  ++   F +      K +   SFA                  + ++  +L    I ++ +   ++   +++ +  A    G  A  A   +       I  L    ++G V GL+P+  YNY  +N++R+K      +I    F +L +     I +F  P ++ F    T  EI  +     TL+F T  FQF          +L+ + G+   +++ ++ +  +FF P+   L S W +     A  V+D    L T F  I I
  S:    37 VAAVSVVFPLSLVFLGIGLMFGVGGGVYISRLLGA--KQIVKAGQVAS------VSVITSVILAALIALVCNAFLPEI-----------------LLFMGANEEMMSLAEAYGRLFIVSCVIGTLNVSMSNIIVSQGASKTSASAMIIGSVINVALDPLFIYAFGWGVKGAAWATILSRIITTIIYTCFFM------KAEVKVSFAL----------------FVPTIRMYLDIIKIGISMLCLQLLQTLSISLLQRAAVKYGAEAVAAVGIV-----LKIVTLGTNVVFGFVKGLQPMAGYNYGAENFQRLKEAVRCSLILTTSFCVLWSTF---ILVFASPVISCFGKDETMQEIARIALRANTLMFFTFGFQFVY-------STLYMAIGRARQSLLLNIGRQGLFFIPVILLLPSYWGLNGVLYAQPVADVFATLMTLFFAIQI 422
>gi|145955470|ref|ZP_01804471.1| hypothetical protein CdifQ_04000663 [Clostridium difficile QCD-32g58] >gi|168694619|ref|ZP_02726896.1| putative drug/sodium antiporter [Clostridium difficile QCD-37x79] >gi|168726486|ref|ZP_02758763.1| putative drug/sodium antiporter [Clostridium difficile QCD-76w55] >gi|168731199|ref|ZP_02763476.1| putative drug/sodium antiporter [Clostridium difficile QCD-97b34] (454 aa)
Score = 118, Expect = 5.5e-04, Identities = 70/323 (21%), Positives = 136/323 (42%)
  Q:   106 TSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           TS +G +++ F      + +GL   +GA+   +R L   D +K   +  +S YS + +  ++ ++IM     I++   A  ++    +  +   V    I N  N  M  I  S                EG +     A L+  L N+I + IF   F + + G  I+  I    + L+   +IL  + +      FSF   ++ E   +  +F+  L + + T +     ++A            N  +T  GD+ V AG+        + T I +L    ++G + G +PI  YN+  +NY ++ +     I+   +F +++  + 
  S:    50 TSQMGAISVAFPLGQLVVGLGLLFGNGAASYIARLLGHGDNEKAGKVVSTSIYSSIIVGTLVIIVIMIFLNPILKLLGATKSIMPYAISYASIYVVSS-IFNIFNVTMTNIVTS----------------EGAAKTTMCAMLLGALLNMILDPIFIYTFGLGVRGASIATAISQIASTLVYVGYILSKKSI------FSF---RINECCFSKEIFSEILKIGIPTLIFQLLTSLA--------ITLTNMEATKYGDS-VIAGMG-------AVTRITSLGSLVVFGFIKGFQPIAGYNFGSKNYDKLHIAIKTSILWTTIFCVVLGLIL 336
>gi|160940914|ref|ZP_02088254.1| hypothetical protein CLOBOL_05806 [Clostridium bolteae ATCC BAA-613] >gi|158436158|gb|EDP13925.1| hypothetical protein CLOBOL_05806 [Clostridium bolteae ATCC BAA-613] (455 aa)
Score = 118, Expect = 5.6e-04, Identities = 71/299 (23%), Positives = 136/299 (45%)
  Q:   206 YMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINA-VFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           Y+  I    P  ++ ++L+ F+R +G       A L  ++ NI+ + +F     M I G  ++  +   ++I +++     +   NKG   F  A  +++         T  LILSLG  + + + S  +  IV+ ++  G         G+ GV+   A+  I  +S      L+  +I+ GI  G++P+++  Y + +  R++ +  YG+ T V  SL + A + W     G   +T+ FN+    ++  +      L F   P   L+I     F ST +     + SL +G++   PI +
  S:   144 YLKMILLFAPAFILNDILVCFVRNDGNPRLSMLAMLGGSMANILLDYVFIFPLGMGIFGAVLATGLAPLISIAIMSG---HWMGKNKG---FHLAKTEIQG-------QTALLILSLGFPSLITEVSSGIVIIVFNVIILGL-------KGNVGVA---AYGVIANLS------LVVISIFTGIAQGMQPLISSAYGRGDSARIRGILRYGLATAVFISLTLYAGICW-----GAAPITAVFNSENNLKLQEIAEYGLRLYFTGIPAAGLNIILSIFFTSTEQAVPAHIISLLRGMVLIIPIAF 413
>gi|167770437|ref|ZP_02442490.1| hypothetical protein ANACOL_01780 [Anaerotruncus colihominis DSM 17241] >gi|167667444|gb|EDS11574.1| hypothetical protein ANACOL_01780 [Anaerotruncus colihominis DSM 17241] (465 aa)
Score = 118, Expect = 5.9e-04, Identities = 47/202 (23%), Positives = 92/202 (45%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           F+ A+G +     + LI  + NII + IF    +M + G  ++ +I   ++ + V +F+L  +   K          ++K  ++  N+   SL L L TF+  AS +V ++ +        +++    GD  V A      +   +  P+         G+  G +PI++YN+  QN  RVK  +   +   + +S+L+ A+
  S:   159 FITAQGFARTGMLSVLIGAVANIILDPIFIFGLEMGVRGAALATIISQAMSCVWVLAFLLGKKTRLK---------IRMKNLRLRANIILPSLALGLSTFIMQASESVISVCFN-------SSLLRYGGDIAVGAMTILTSVMQFAMLPLQ--------GLGQGAQPIISYNFGAQNAGRVKDAFKLLLKASLCYSVLLWAL 336
>gi|160934160|ref|ZP_02081547.1| hypothetical protein CLOLEP_03028 [Clostridium leptum DSM 753] >gi|156866833|gb|EDO60205.1| hypothetical protein CLOLEP_03028 [Clostridium leptum DSM 753] (458 aa)
Score = 118, Expect = 6.0e-04, Identities = 58/281 (20%), Positives = 115/281 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           F+ A+G +     + LI  + NII + IF   F MD+ G  ++ +I   ++   V +F+     + K          + K   +   +    L L L  F+  AS +V ++ +        +++    GD  V A      +   +  P+         G+  G +PI++YNY  +N  RVK  +   + T V++++      W + +       + F ++        T L   +   F L  + ++    F S G+   +I+ ++ +  I   P++Y M
  S:   159 FITAQGFAKTGMLSVLIGAVANIILDPIFIFGFNMDVQGAALATIISQALSCAWVLAFLFGKRTMLK---------IKRKNLFLEAKIILPCLALGLSVFIMQASESVISVCFN-------SSLLRYGGDIAVGAMTILTSVMQFAMLPLQ--------GLGQGAQPIISYNYGARNVGRVKAAFRLLLKTSVLYAV----ALWGLVMIFPQLFAAMFTSDAELMEFTKTALRIYMASMF-LFGIQMACQMTFNSLGRAKESIIVAVMRKFILLIPLIYIM 410
>gi|47095532|ref|ZP_00233141.1| MATE efflux family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153180916|ref|ZP_01933883.1| hypothetical protein LMMG_01572 [Listeria monocytogenes F6900] >gi|153185922|ref|ZP_01936400.1| hypothetical protein LMOG_02351 [Listeria monocytogenes J0161] >gi|153192485|ref|ZP_01939477.1| hypothetical protein LMPG_01491 [Listeria monocytogenes J2818] >gi|47016142|gb|EAL07066.1| MATE efflux family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126941485|gb|EBA19370.1| hypothetical protein LMOG_02351 [Listeria monocytogenes J0161] >gi|127763989|gb|EBA24807.1| hypothetical protein LMPG_01491 [Listeria monocytogenes J2818] >gi|133731434|gb|EBA33132.1| hypothetical protein LMMG_01572 [Listeria monocytogenes F6900] (450 aa)
Score = 117, Expect = 6.1e-04, Identities = 79/401 (19%), Positives = 170/401 (42%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           V   S+   V +I +++      G + + SR+L   ++++   +    F+  ++L ++ ++ I +I T+I    +     + +++ +  +     ++L A  +       +I            +R+EG +       +I+ + N+I   IF + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    51 VAALSIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKQADKV----FHQVIWLVLISSIFI-AIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNI------------VRSEGNAKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGL---VEIFPGLLVRIF--SNDPELIAQGTTAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|187934934|ref|YP_001885710.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] >gi|187723087|gb|ACD24308.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] (441 aa)
Score = 117, Expect = 6.2e-04, Identities = 63/300 (21%), Positives = 126/300 (42%)
  Q:   204 NKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           N Y+  I    P  ++ N+LI F+R +          ++ +L NII + IF     + + G   +  +   ++I+L++     + F NK ++        +K  + +  +F   + L L + + + S  +  I++ IV       I  A    G+ A LA   I   +             GI  G++P+++ +Y  +NY ++K +  Y I   ++ S++I   ++ I LF    ++ F + N        T         F  + ++I  +S   S     +  + SL +G I   P++
  S:   128 NTYLKTIFLFSPCFILNNILIAFIRNDNSPKLAMGGMILGSLSNIILDYIFVFPLNLGMFGAAFATGLAPIISIVLLS----LHFFKNKNNF-------SIKRCEFDLTIFKNIINLGLSSLVTEISSGIVLIIFNIVILNIAGNIGVAA--YGIIANLALVAIGIFT-------------GIAQGMQPLVSNSYGNKNYLQLKQLLKYSITLSLIVSVVI---YFTITLFSSELISLFNSENNLLLKTYATTGLSLYFIGFIFVGINIVIISFLNSIESSKVAFIISLIRGFIAIIPLV 398
>gi|153204368|ref|ZP_01945165.1| hypothetical protein LMSG_00147 [Listeria monocytogenes HPB2262] >gi|133734148|gb|EBA35846.1| hypothetical protein LMSG_00147 [Listeria monocytogenes HPB2262] (450 aa)
Score = 117, Expect = 6.3e-04, Identities = 78/397 (19%), Positives = 169/397 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           S+   V +I +++      G + + SR+L   ++++   +    F+  ++L ++ ++ I +I T+I    +     + +++ +  +     ++L A  +       +I            +R+EG +       +I+ + N+I   IF + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+    +  + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    55 SIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKQADKV----FHQVIWLVLISSIFI-AIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNI------------VRSEGNAKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLI---AWGSVEIFPGMLVRIF--SNDPELIAQGTNAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|88803176|ref|ZP_01118702.1| uncharacterized membrane protein [Polaribacter irgensii 23-P] >gi|88780742|gb|EAR11921.1| uncharacterized membrane protein [Polaribacter irgensii 23-P] (445 aa)
Score = 117, Expect = 6.5e-04, Identities = 69/306 (22%), Positives = 130/306 (42%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLN-AISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFN-----ANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           IL  A +Y   I   +P +    +    +RAEG+  +  +A ++  + N++ +++F  VF   + G G++  I Y    L    +IL++   +K +          K FK++  +      L   T +R  +++V  IV        LN ++ T  G+  ++     N +   + +P        + G+  G  P+  +N      +RVK      I  G +   LI   F  I +F    +  F N     A TP  + +  L+        P++++ + G + FQ+ GK    +  +L +  IF  P+ Y
  S:   130 ILPIAAEYYNVIIYGVPFLAFAMMGNPTIRAEGKPKYAMYAMMVPAVLNVLMDIVFIKVFDWGMWGAGLATSISYASCGL----YILYFFLSSKSELQII-----PKNFKLDIPILKKIGKLGGVTVVRQGAVSVLMIV--------LNYSLYTYGGEISIAVYGIINRVMMFALSP--------VLGVTQGFLPVAGFNIGAHKNERVKETIKKSIYFGSILGTLI---FIVIVIFKEEIIWIFTNDATLLAQTPDAMLIAFLM-------TPIVTMQLIGSAYFQAAGKALPALFLTLLKQGIFLIPLAY 406
>gi|182420528|ref|ZP_02643465.2| MATE efflux family protein [Clostridium perfringens NCTC 8239] >gi|182380105|gb|EDT77584.1| MATE efflux family protein [Clostridium perfringens NCTC 8239] (464 aa)
Score = 117, Expect = 6.6e-04, Identities = 48/279 (17%), Positives = 109/279 (39%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           F+  +G +       ++  + NI+ + I    F M + G  ++ +IG   + + V  F+L  + + +    F          K    +  + + L +  F+  A+ +       +V     N +    GD  V A    + +  +        I   + G+  G +PI++YNY    + RVK  +   +++ +VF+     + W   +         FN+N P  + + +           L    ++    F + G+  ++++ +L + ++   P +Y
  S:   162 FINTQGFAKVGMITVMVGAVINIVLDPILIFGFNMGVKGAALATIIGQCASAIWVLYFLLGKQSILRIRKKF---------LKPKLKILFSIIALGVSPFIMQATES-------LVIISMNNNLLKYGGDLAVGAMTIMSSVMQI--------ILLPLMGLSQGAQPIISYNYGANKFYRVKKAFKLLLVSSIVFT----TIMWSALMILPDVFVKIFNSNNPQLMEITSWSIRIYFEGILLFGAQVACQQTFLALGQAKISLILALLRKIVLLIPFIY 412
>gi|114567572|ref|YP_754726.1| Na+-driven multidrug efflux pump-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338507|gb|ABI69355.1| Na+-driven multidrug efflux pump-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (560 aa)
Score = 117, Expect = 6.9e-04, Identities = 62/245 (25%), Positives = 112/245 (45%)
  Q:   209 FITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAF-NDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYY----YGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV 453
            I G+I  IM + L + + R EGR++      LI    +II +L F +V  M ++G  ++ +I   + + +++ F+    F+  G Y F+   + L+            L+ ++       S    N +Y +V    LN +  A G     A  AF N + T++           I GI   + P++   Y +++   +K V +    YGIIT  +FS+ I+ +  PI L         FN ++P ++H+
  S:   106 LIPGAI-CIMAVYLPLNYFRIEGRAFLGMIMFLIMAALDIILDLWFTVVMGMGMLGLALATVISALLAVAIMSPFL----FIKGGGYRFAPIGQSLR------------LVYAIAI---TGSPPALNNLYTVVRTFVLNMLILAVGGPIAVASFAFVNSVNTLAQA--------IISGISQTVSPLVGVFYGERDVLSIKKVVFLAFRYGIITMAIFSISISLLAKPICL--------AFNLSSPEQLHI 319
>gi|42525849|ref|NP_970947.1| MATE efflux family protein [Treponema denticola ATCC 35405] >gi|41815899|gb|AAS10828.1| MATE efflux family protein [Treponema denticola ATCC 35405] (451 aa)
Score = 117, Expect = 7.2e-04, Identities = 68/275 (24%), Positives = 112/275 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK--VVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           +R EGR         I+ + NII + +F +V K  + G  I+ +I   V  L + +F  F  F             + K FK+  ++   +L +     L    + V  ++   V + TL        D  +  G  F  +          L F  ++GI  G +P    N+  Q ++RVK     +YG      F L ++ +FW +FL     V   F  N   E+  L      L    FPL ++ I  L+LFQ+ GK     +  +A+  + + P
  S:   158 MRGEGRMGLAMLLMGISAVLNIILDAVFVIVLKKGLEGTAIATVISQVV--LAICNFCYFAFFSKN---------VKFKHFKLQKSIVKETLSIGFSAML----MQVFALLQQAVMYSTLKRYGGE--DQVILMGAFFRYMM---------LSFIPLWGISQGYQPFAGTNFGAQKFERVKKGTFLFYG------FGLFLSLIFWLVFLIIPEQVLGLFLKN--KELISLGRTNAMLAMSLFPLSAIMIINLTLFQALGKAKYAGILVIARQFLLYIP 401
>gi|189468337|ref|ZP_03017122.1| hypothetical protein BACINT_04734 [Bacteroides intestinalis DSM 17393] >gi|189436601|gb|EDV05586.1| hypothetical protein BACINT_04734 [Bacteroides intestinalis DSM 17393] (450 aa)
Score = 117, Expect = 7.2e-04, Identities = 79/334 (23%), Positives = 137/334 (41%)
  Q:    88 ANYDNLIYQANRNMIVYQTSVIGTVNL----IFISIGLFINS-------GASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFS 421
           A + NL+Y     + +     IGT  L    + IS+ + I+S       G + L + AL Q D+Q+   I  + F       ++L  LI S   Y     I   T ++   +             A +    ++ G++  + I   L  F+ A+GR      + LI  L NII + IF   F M + G  ++ +I    +    A+++L + F  K   P      + +  K+N  +    L L +  F+  ++ ++   V        LN+     GD  VSA          +  P        + G   G  P+++YNY   + +RVK  +   +IT   F+
  S:    28 AQFVNLLYSIVDRIYIGHIPGIGTDALAGVGVTISLVVLISSFSAIVGGGGAPLAAIALGQGDRQRAGKILGNGF-----TLLILFTLITSFIAYTFMEPILLFTGASEHTLGY-----------AVDYLSIYLLGTV-FVEISTGLNSFINAQGRPAIAMCSVLIGALLNIILDPIFIFWFDMGVKGAALATVISQACS----AAWVLSFLFSRKASLPL-----ERRYMKLNRGIVIAMLGLGVSPFIMASTESLVGFV--------LNSSLKDFGDIYVSALTILQTSMQFASVP--------LTGFAQGFIPVVSYNYGHDDKQRVKDCFRIALITMFSFN 330
>gi|15673466|ref|NP_267640.1| hypothetical protein L112499 [Lactococcus lactis subsp. lactis Il1403] >gi|12724478|gb|AAK05582.1|AE006378_11 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (459 aa)
Score = 117, Expect = 7.3e-04, Identities = 75/297 (25%), Positives = 125/297 (42%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNL-LIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK 407
           T+ ++F++IG     G     +R L   DK+K K I   SFY  L + +++ ++ +   + I  A I  S  +T      Y  V               + G     MILN  L   +RAEG S    +   +    +I+ + +F LV  + +IG G+S++I    N+   A ++ F E  NK +    F    LK FKI+         + +    + A + V  ++        LN  S   GD  +++ G+A           I  L  F   G+  G  P+ AY++   N +R+K
  S:    61 TITIVFMAIGNLFGVGGGTYITRLLGSGDKEKGKKIAGYSFYMSLIIGLLIGLVSLFFLSPI--AHILGSDAATLTYTKEYAAV--------------LLGGGFS--MILNYGLEQLVRAEGASKESMYGMFVGVATSIVLDALFILVLNLHVIGAGLSMVIA---NLASTAYYVWFLE--NKSESLKGF----LKHFKISLKDQFEIYKIGIAEVFKSAFMIVTTLL--------LNHFSVQYGDNVLASFGIALR---------ITQLPEFLTMGLFLGAIPLFAYSFASNNTQRLK 315
>gi|153806541|ref|ZP_01959209.1| hypothetical protein BACCAC_00805 [Bacteroides caccae ATCC 43185] >gi|149131218|gb|EDM22424.1| hypothetical protein BACCAC_00805 [Bacteroides caccae ATCC 43185] (452 aa)
Score = 117, Expect = 7.7e-04, Identities = 71/295 (24%), Positives = 120/295 (40%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           L  A  +M  I    PI   +  L   +RA G        ++   L NII   IF   F+  + G   + +I   + ++ V S         K D    F  K  K + +I  N+F     + + +FL        N+   ++     N++    GD  + A    N + T        L    + G+  G++PI+ YN+  Q   RVK     GI++GVV +   ++ F+   LF       F +++   ++ V  L    ++  FP +   I   + FQS GK  ++I  SL +
  S:   132 LPYARSFMQVILLGTPITYTMIGLNNVMRATGYPKKAMITSMATVLSNIILAPIFIFHFEWGMRGAATATVISQLIGMVWVVSHFF------KQDSTVHFEGKVWKMKRRIVGNIFA----IGMSSFL-------MNVCACVIVIIINNSLQNHGGDMAIGAYGIINRLLT--------LYVMIVLGLTMGMQPIVGYNFGAQKIDRVKQTLKLGIVSGVVIT---SSGFFICELFPHAVSAIFTDSDHLIDLAVDGLRITVIM--FPFVGAQIVIGNFFQSIGKAKISIFLSLTR 397
>gi|160879738|ref|YP_001558706.1| MATE efflux family protein [Clostridium phytofermentans ISDg] >gi|160428404|gb|ABX41967.1| MATE efflux family protein [Clostridium phytofermentans ISDg] (460 aa)
Score = 117, Expect = 7.7e-04, Identities = 61/300 (20%), Positives = 118/300 (39%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAP--GDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK 407
           V G +  +  S G  +  G S+L +  + +Q K++ + I  +SF   L LS  LT++ +  + +++           S+V   Y           AN YM   T      ++   L +F+  +G S       +I  + NII + +F   F M + G  I+ +I    + L                +   F F++    +I +  ++ +++  + +      + +A+   +I+    +   S  P  GD  +SA         +   P        + GI  G + I++YNY      R+K
  S:    57 VCGPIVTLLSSFGTLVGLGGSILMAMKMGEQKKKEAEQILANSFLMLLILSGTLTLIFLLSKDFLL------YQFGASDVTFPY-----------ANTYMTIYTAGTFFALLSIGLNYFITCQGYSMVSMTTVIIGAISNIILDSVFVFGFHMGVAGAAIATVIAQMFSCL----------------FALIFLFRKQVPIRITFGGYSKAIMKKIISIGLSPFLILASDSIIIIIMNAVLQYSGGPSEGDLLISAATIVQSYMLLITGP--------LVGITGGTQAIISYNYGAARADRIK 317
>gi|150400314|ref|YP_001324081.1| MATE efflux family protein [Methanococcus vannielii SB] >gi|150013017|gb|ABR55469.1| MATE efflux family protein [Methanococcus vannielii SB] (447 aa)
Score = 117, Expect = 7.8e-04, Identities = 73/300 (24%), Positives = 131/300 (43%)
  Q:   202 AANKYMYFITGSI--PIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRD--ASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIIT-------GVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL---SLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           A + Y+  + G+I    +++ N L+   RAEG +    F  +   + N + +++F +   M + G  I+ +I   V ++    ++ +Y+        +     ++ +F I+       +++    F R   +S+ +     ++ F+G         GD  ++     N I          L+F  ++GIV GL+PI+ YNY K N KRV       +I+       G +F +     F  IF+             T SE+    +L   + F F  L    + ISG  L+QS GK     V S A+  +F  P
  S:   134 AKDYYLIILYGTIFNSYLIVANNLV---RAEGLAKIAMFGMVFPAVLNTMLDVLFIIGLNMGVKGAAIATVISQVVGVI----YLTYYQLGKHTSIKY-----KVNDFLIDIKTCVEIILIGASEFARTIMSSVLLVLGNNLLGFYG---------GDIAIAIFGVVNRIAM--------LLFMPVHGIVQGLQPIVGYNYGKGNLKRVSEAVKLALISTTSLCFLGFIFIIAFPEQFIRIFI-------------TDSEVISKGILPIRIFFGFSFLIGAQMVISG--LYQSLGKALPAFVLSCARQTLFLIP 403
>gi|167769622|ref|ZP_02441675.1| hypothetical protein ANACOL_00956 [Anaerotruncus colihominis DSM 17241] >gi|167667983|gb|EDS12113.1| hypothetical protein ANACOL_00956 [Anaerotruncus colihominis DSM 17241] (456 aa)
Score = 116, Expect = 8.0e-04, Identities = 67/321 (20%), Positives = 124/321 (38%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           S++  +  + + +GL   +GA+   SR L + DK     +  ++ YS L +  ++ +        I+    A  T+    +  S   +    + N  N  M  I  S                EG +     A L+  + NI  + +F   F M + G  I+  I   V+ L+  ++IL      +    FSF+   LK F  N  +    L            I V  +V+ ++   ++  I+ A  D G S       +     T I ++    ++G + G +PI  ++Y  + + R++      II    F L++  V
  S:    57 SIVFPLGQVVVGLGLMFGNGAASYLSRLLGRGDKDTANKVASTALYSSLLIGAIIILFSTIFLKPILTMLGATETIMPYALTYSRIYIL-SCVFNVFNVTMNNIVSS----------------EGAAKTTMCALLLGAVLNIGLDPLFIYTFNMGVAGAAIATAISQLVSTLVYLTYIL------RKRSAFSFS---LKAFSPNGQMMAEIL-----------KIGVPTLVFQLLTSLSIALINRAASDYGDSVIAGMGAV-----TRITSMGTLVVFGFLKGFQPIAGFSYGAKKFDRLREAIKTSIIWSTSFCLVVGLV 335
>gi|29346106|ref|NP_809609.1| hypothetical protein BT_0696 [Bacteroides thetaiotaomicron VPI-5482] >gi|29338000|gb|AAO75803.1| putative membrane protein [Bacteroides thetaiotaomicron VPI-5482] (456 aa)
Score = 116, Expect = 8.0e-04, Identities = 71/295 (24%), Positives = 119/295 (40%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           L  A  +M  I    PI   +  L   +RA G        +++  + NII   IF   F+  + G   + +I   + ++ V S         K D    F   + K +K+   +  +   + +  FL +  +    IV VI      N++    GD  + A    N + T        L    + G+  G++PI+ YN+  Q   RVK     GII+GVV +   ++ F     F       F +++    + V  L    L+  FP +   I   + FQS GK+ ++I  SL +
  S:   132 LPYARSFMQVILLGTPITYTMIGLNNVMRATGYPKKAMLTSMVTVVANIILAPIFIFHFEWGMRGAATATVISQLIGMVWVVSHFC------KKDSTVHF---EGKVWKMKGRIVESIFAIGMSPFLMN--VCACAIVIVIN-----NSLQEHGGDMAIGAYGIINRLLT--------LYVMIVLGLTMGMQPIVGYNFGAQKIDRVKQTLKLGIISGVVIT---SSGFLICEFFPHAVSAVFTDSDELIGLAVDGLRLTVLM--FPFVGAQIVIGNFFQSIGKVKISIFLSLTR 397
>gi|160933507|ref|ZP_02080895.1| hypothetical protein CLOLEP_02353 [Clostridium leptum DSM 753] >gi|156867384|gb|EDO60756.1| hypothetical protein CLOLEP_02353 [Clostridium leptum DSM 753] (466 aa)
Score = 116, Expect = 8.1e-04, Identities = 69/286 (24%), Positives = 124/286 (43%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFK----MDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSV-TSFFNANTPS-EIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAIL 512
           L+A G   +     L+  + NII + +F   F     M + G  I+ +IG  +  +LV+ F++ ++     D+  +  F++   FK +W +      +     +  A  +V  +    + F       TA    GV   L              + +F  ++G+  GL PI+ YN+  +  +R+     YG +  +V       VFW +     P V  S FNA+    +I V  L   +L F  P  +L I G + FQ+ GK   +++ SL + LI   P  + +  + ++
  S:   158 LQATGNMIYPMAFQLVGAVTNIILDPVFIFGFAFIPAMGVSGAAIATVIGQIL-AMLVSLFVIIFK-----DHAVNINFRR---FKPDWRIIKEIYAVGFPGIIMQAIGSVMVVGMNAILFTFPQNAVTAVAFFGVYFKLQ-------------SFVFMPVFGLNQGLMPIMGYNFGARKKQRLNSATKYGCVIALVLMGAGMLVFWLM-----PDVLLSIFNASADMLKIGVPGLRIISLCF-LP-AALGIVGSTFFQAVGKGVNSLLVSLLRQLIVLLPAAFLLAKLGVV 420
>gi|110799573|ref|YP_696171.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|168210072|ref|ZP_02635697.1| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] >gi|168216869|ref|ZP_02642494.1| MATE efflux family protein [Clostridium perfringens NCTC 8239] >gi|110674220|gb|ABG83207.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|170711866|gb|EDT24048.1| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] >gi|182381025|gb|EDT78504.1| MATE efflux family protein [Clostridium perfringens NCTC 8239] (442 aa)
Score = 116, Expect = 8.5e-04, Identities = 63/293 (21%), Positives = 123/293 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVK 407
           ++ +IGL I  G +   S A+ Q+   +   I    F S +F +I+  ++I  ++ + ++  +             Y     +     A +Y+  I    P  +  +  I F+R +       +A + +N  NI+ + +F  +F + + G  ++  IG      LVA  +L   F+ K +         ++   IN +     L   + +FL + S      ++ IV +          GD GVSA     +I          LIF A++ G+  G++P+++ N+  +  +RVK
  S:    62 LYSAIGLTIGVGGATALSVAMGQKKFHRVNRI----FTSAVFATIIFCIIISLLEVFFLDKIV-------------YMLGASEATFPLAKEYLKIILAFNPAFIFASAFIVFVRNDREPKLAMYAVIGSNTTNIVLDYVFIYIFNLGMFGAALATSIGQ-----LVALGVLSIHFIKKNNT------MHIELGGINLDNIGKVLKNGVPSFLNEISAGFVIFIFNIVIY-------KFEGDLGVSAYGIITNIV---------LIFMAVFNGVSQGVQPLISVNFGAKKEERVK 311
>gi|45358262|ref|NP_987819.1| MATE efflux family protein [Methanococcus maripaludis S2] >gi|44921019|emb|CAF30255.1| C-5 cytosine-specific DNA methylase:Multi antimicrobial extrusion (MatE) protein [Methanococcus maripaludis S2] (447 aa)
Score = 116, Expect = 8.5e-04, Identities = 86/397 (21%), Positives = 163/397 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL---SLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           ++I    ++ ++ G+    G S L SR L + +    +    ++  S L LS+++T++ +     I+      + + TS  +  Y +  +++IL       Y +  +       NL+    RAEG +    FA ++  + NII + I  +VF M I G  I+ ++   + ++    +IL ++F       ++     + +F IN  +   ++ +    F +    ++  I+   +       I+ A    GV   +A              L+   + GIV G +PI+ YNY K    RV       ++      LL    F  + +F    +  F    T  E+    +    + F F  L    ++I G  L+QS GK     + S A+  +F  P L
  S:    55 ALIFPFQMMIMAFGVTFGIGGSSLLSRKLGEGNLDFARKAGGNAISSVLILSVLITIVGVVFMVPIL------NLLGTSADIFPYAKDYYEIILYGTIFNSYLVAAN-------NLV----RAEGMAKVAMFAMVVPAIINIILDPILIIVFNMGIKGAAIATVLSQIIGVI----YILKHQFGKNTSIKYA-----MNDFLINLKILKETVFIGASEFAKLIISSILLILGNNLLGIYGGDIAIAI--YGVIMRIAM-------------LLLMPVLGIVQGFQPIVGYNYGKGQLNRVSESIKLALVGTSGLCLL---GFILVMIFPEKFIQIFI---TDPEVISQGVFATRIFFMFSFLIGAQMTIGG--LYQSLGKAKPAFIISCARQTLFLMPAL 405
>gi|150403707|ref|YP_001331001.1| MATE efflux family protein [Methanococcus maripaludis C7] >gi|150034737|gb|ABR66850.1| MATE efflux family protein [Methanococcus maripaludis C7] (448 aa)
Score = 116, Expect = 9.0e-04, Identities = 81/390 (20%), Positives = 161/390 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMS-IQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK-VVYYYGIITGVV--FSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
            +     +    GAS   S  L  + K++ + I  +  Y  +   I+LTVL ++ I+  +V+  I  + +  S    +Y QV +      A  ++    G  P+I          R +G      F  ++  + NI+F+ IF + F   + G  ++ + G     L+     L  +   K D    F     ++ K    +    + + +  F+ + S +V  +++ I F         +P +      +++          ++ L+     G+ +G++P+++YNY  + Y RVK ++   GI+T ++   S +  +VF  I +         FN    + I           +   +  L    ++ FQSTGK  ++   SL++  IF  P+L
  S:    60 FVMTGFAIMFGIGASAHISMKLGAKKKEEAEKILKTVVYMIVIGGIILTVLGLTLIKPLLVQFGITGNLLEYSY---TYLQVSY-----LACVFIMIRVGLDPVI----------RNDGFPKKAMFTVVLGAILNIVFDAIFIVFFGWGVFGAALASITGETFGALVYLHHFLGGKSNLKLDLSSKF-----EDLKSELEIVKNIIAVGISPFILELSASVVMVLHTIQFLKY-----GSPLEVSAYGIVSY----------LFALVMLVYMGLCNGVQPLISYNYGAKEYSRVKEILKKTGILTAIIGLVSFVTLSVFPKIPIM-------LFNKTDLTLISSTVFGLKYFAYGLSVFGLGFLIITYFQSTGKSKISNFLSLSRTAIFLVPLL 408
>gi|46908911|ref|YP_015300.1| MATE efflux family protein [Listeria monocytogenes str. 4b F2365] >gi|47092345|ref|ZP_00230136.1| MATE efflux family protein [Listeria monocytogenes str. 4b H7858] >gi|153168910|ref|ZP_01928649.1| hypothetical protein LMHG_00431 [Listeria monocytogenes FSL N1-017] >gi|167015812|ref|ZP_02278345.1| MATE efflux family protein [Listeria monocytogenes FSL J1-194] >gi|167215379|ref|ZP_02285686.1| MATE efflux family protein [Listeria monocytogenes FSL R2-503] >gi|167455196|ref|ZP_02321419.1| MATE efflux family protein [Listeria monocytogenes FSL J2-064] >gi|46882184|gb|AAT05477.1| MATE efflux family protein [Listeria monocytogenes str. 4b F2365] >gi|47019324|gb|EAL10066.1| MATE efflux family protein [Listeria monocytogenes str. 4b H7858] >gi|133725858|gb|EBA27556.1| hypothetical protein LMHG_00431 [Listeria monocytogenes FSL N1-017] (450 aa)
Score = 116, Expect = 9.5e-04, Identities = 79/401 (19%), Positives = 170/401 (42%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           V   S+   V +I +++      G + + SR+L   ++++   +    F+  ++L ++ ++ I +I T+I    +     + +++ +  +     ++L A  +       +I            +R+EG +       +I+ + N+I   IF + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    51 VAALSIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKQADKV----FHQVIWLVLISSIFI-AIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNI------------VRSEGNAKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGL---VEIFPGMLVRIF--SNDPELIAQGTNAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|153176033|ref|ZP_01931292.1| hypothetical protein LMIG_00143 [Listeria monocytogenes FSL N3-165] >gi|167344821|ref|ZP_02290662.1| hypothetical protein LmonocyFSL_20751 [Listeria monocytogenes FSL J1-208] >gi|133728746|gb|EBA30444.1| hypothetical protein LMIG_00143 [Listeria monocytogenes FSL N3-165] (450 aa)
Score = 116, Expect = 9.7e-04, Identities = 78/397 (19%), Positives = 168/397 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           S+   V +I +++      G + + SR+L   +++    +    F+  ++L ++ ++ I +I T+I    +     + +++ +  +     ++L A  +       +I            +R+EG +       +I+ + N+I   IF + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    55 SIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKHADKV----FHQVIWLVLISSIFI-AIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNI------------VRSEGNAKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGL---VEIFPGLLVRIF--SNDPELIAQGTTAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|56962238|ref|YP_173961.1| Na+-driven multidrug efflux pump [Bacillus clausii KSM-K16] >gi|56908473|dbj|BAD63000.1| Na+-driven multidrug efflux pump [Bacillus clausii KSM-K16] (456 aa)
Score = 116, Expect = 9.8e-04, Identities = 62/277 (22%), Positives = 119/277 (42%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +R+EG + F     +I  + NII + IF     M + G G++ ++        V+ FIL Y    +     S+    L+     ++V    L +    F++ AS ++  I         +NA+    G + +  G+ F  IQ +    +  +I     G++ G+ PI+ YNY  + + R++   +  +   VV +  I  VF    +   P+++       P  I   T     +   F L  + +    L+Q+ GK    ++ SL++ +IF  P++
  S:   160 IRSEGNARFAMVTMVIPAILNIILDPIFIFALDMGVKGAGVATVVAQGA----VSFFILRYYVKGESSLRLSWTSVSLR-----FSVVKEILSVGFPAFVQQASGSLMMI--------AINAMLIQHG-SDMHVGV-FGIIQRIMMFTVMPMI-----GVMQGMMPIVGYNYGAKQFARMRETIW--LTLKVVVACSIGVVF---IMMAFPALSMRIFTTDPLAIETGTTAMRIMFAGFFLAGVQVVAGGLYQALGKPIPALILSLSRQIIFLIPLV 407
>gi|160942957|ref|ZP_02090195.1| hypothetical protein FAEPRAM212_00434 [Faecalibacterium prausnitzii M21/2] >gi|158445651|gb|EDP22654.1| hypothetical protein FAEPRAM212_00434 [Faecalibacterium prausnitzii M21/2] (462 aa)
Score = 116, Expect = 9.9e-04, Identities = 65/322 (20%), Positives = 134/322 (41%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVL-IMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFW 429
           V+ ++  I  ++G  +  G+  + SR L  QD         +SF++ L   +VL V+ + ++  +++     K+                  IL  A  Y   I  + P+++   ++   LR EG++       +   L NI  + +F     +   G GI+  +   ++  ++    L  + V++  +  S   ++ +EF           IL+ G  +F R    ++  ++        LN  + + GDA V AG++         + I+  I     G+  GL+P+ ++NY  + Y RV+    + +       +++ AV W
  S:    61 VVSSLMAIIQALGFMLGHGSGTIISRRLGSQDTHAATRFASTSFFTALAFGVVLAVVGLATLPDFMMLLGSTKT------------------ILPHACAYARPILLAAPLMISSLVMNNILRYEGKANLAMVGLVTGGLLNIALDPLFMFALGLGTAGAGIATALSQTISFGILLYMFLRGKTVSQ--FRLSAVTREPREF---------LQILAGGAPSFGRQGLNSIGGML--------LNIAARSYGDAAV-AGMSIV-------SRIFMFILSVAIGVGQGLQPVASFNYGARKYHRVRQAAVFTLKAAFALLVVLIAVCW 340
>gi|169347244|ref|ZP_02866183.1| MATE efflux family protein [Clostridium perfringens C str. JGS1495] >gi|169296640|gb|EDS78771.1| MATE efflux family protein [Clostridium perfringens C str. JGS1495] (442 aa)
Score = 116, Expect = 1.0e-03, Identities = 63/293 (21%), Positives = 123/293 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVK 407
           ++ +IGL I  G +   S A+ Q+   +   I    F S +F +I+  ++I  ++ + ++  +             Y     +     A +Y+  I    P  +  +  I F+R +       +A + +N  NI+ + +F  +F + + G  ++  IG      LVA  +L   F+ K +         ++   IN +     L   + +FL + S      ++ IV +          GD GVSA     +I          LIF A++ G+  G++P+++ N+  +  +RVK
  S:    62 LYSAIGLTIGVGGATALSVAMGQKKFHRVNRI----FTSAVFATIIFCIIISLLEVFFLDKIV-------------YMLGASEATFPLAKEYLKIILAFNPAFIFASAFIVFVRNDREPKLAMYAVIGSNTTNIVLDYVFIYIFNLGMFGAALATSIGQ-----LVALGVLSIHFIKKNNT------MHIELGGINLDNIGKVLKNGVPSFLNEISAGFVIFIFNIVIY-------KFEGDLGVSAYGIITNIV---------LIFMAVFNGVSQGVQPLISVNFGAKKEERVK 311
>gi|153197436|ref|ZP_01941686.1| hypothetical protein LMRG_01971 [Listeria monocytogenes 10403S] >gi|127633155|gb|EBA22573.1| hypothetical protein LMRG_01971 [Listeria monocytogenes 10403S] (450 aa)
Score = 116, Expect = 1.0e-03, Identities = 79/401 (19%), Positives = 169/401 (42%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           V   S+   V +I +++      G + + SR+L   +++    +    F+  ++L ++ ++ I +I T+I    +     + +++ +  +     ++L A  +       +I            +R+EG +       +I+ + N+I   IF + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    51 VAALSIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKHADKV----FHQVIWLVLISSIFI-AIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNI------------VRSEGNAKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGL---VEIFPGLLVRIF--SNDPELIAQGTTAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|16804762|ref|NP_466247.1| hypothetical protein lmo2725 [Listeria monocytogenes EGD-e] >gi|167213344|ref|ZP_02283651.1| hypothetical protein LmonL_24338 [Listeria monocytogenes LO28] >gi|16412225|emb|CAD00938.1| lmo2725 [Listeria monocytogenes] (450 aa)
Score = 116, Expect = 1.0e-03, Identities = 78/397 (19%), Positives = 168/397 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           S+   V +I +++      G + + SR+L   +++    +    F+  ++L ++ ++ I +I T+I    +     + +++ +  +     ++L A  +       +I            +R+EG +       +I+ + N+I   IF + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    55 SIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKHADKV----FHQVIWLVLISSIFI-AIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNI------------VRSEGNAKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGL---VEIFPGLLVRIF--SNDPELIAQGTTAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|154483116|ref|ZP_02025564.1| hypothetical protein EUBVEN_00817 [Eubacterium ventriosum ATCC 27560] >gi|149735924|gb|EDM51810.1| hypothetical protein EUBVEN_00817 [Eubacterium ventriosum ATCC 27560] (462 aa)
Score = 115, Expect = 1.0e-03, Identities = 56/230 (24%), Positives = 102/230 (44%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQL---KEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAI-YGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           +L  A +Y+  +    P +M+ N     +RA+G   F  +  L+  + N+I + +F + F   + G  ++ +IG  V+ ++V  ++  Y+             K L   KEF     VF T L L +   L   ++ +  IV    + ++G L+    +   A   AG+              N ++F+I  G+  G++PI ++N    NY RVK  Y   +    V S +   +F
  S:   131 VLPYAKEYVGVVAFGFPFVMVANGGSHLVRADGSPKFSMYCNLVGAIINVILDYLFVMRFGWGMSGAALATVIGQIVSFMMVVWYMRHYKTA-------KIERKHLIPCKEF-----VFRT-LHLGMAQGLNQLAMMIVQIVMNKSLKYYGGLSIYGASIPIA--CAGIIMK----------VNQLYFSICIGVAQGIQPIASFNTGAGNYDRVKKTYKIAVTCNTVVSTIAFLIF 341
>gi|196161346|ref|ZP_03121907.1| putative drug/sodium antiporter [Clostridium difficile CIP 107932] (427 aa)
Score = 115, Expect = 1.0e-03, Identities = 70/323 (21%), Positives = 136/323 (42%)
  Q:   106 TSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           TS +G +++ F      + +GL   +GA+   +R L   D +K   +  +S YS + +  ++ ++IM     I++   A  ++    +  +   V    I N  N  M  I  S                EG +     A L+  L N+I + IF   F + + G  I+  I    + L+   +IL  + +      FSF   ++ E   +  +F+  L + + T +     ++A            N  +T  GD+ V AG+        + T I +L    ++G + G +PI  YN+  +NY ++ +     I+   +F +++  + 
  S:    23 TSQMGAISVAFPLGQLVVGLGLLFGNGAASYIARLLGHGDNEKAGKVVSTSIYSSIIVGTLVIIVIMIFLNPILKLLGATKSIMPYAISYASIYVVSS-IFNIFNVTMTNIVTS----------------EGAAKTTMCAMLLGALLNMILDPIFIYTFGLGVRGASIATAISQIASTLVYVGYILSKKSI------FSF---RINECCFSKEIFSEILKIGIPTLIFQLLTSLA--------ITLTNMEATKYGDS-VIAGMG-------AVTRITSLGSLVVFGFIKGFQPIAGYNFGSKNYDKLHIAIKTSILWTTIFCVVLGLIL 309
>gi|169344393|ref|ZP_02630241.2| MATE efflux family protein [Clostridium perfringens C str. JGS1495] >gi|169297466|gb|EDS79574.1| MATE efflux family protein [Clostridium perfringens C str. JGS1495] (464 aa)
Score = 115, Expect = 1.1e-03, Identities = 67/393 (17%), Positives = 151/393 (38%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           +I  +    I  G + L +  + ++ K+  + I  +SF + + L++ LTV     +  I+ A  A                    I  A +    ++ G+I + + L +   F+  +G +       ++  + NI+ + I    F M + G  ++ +IG   + + V  F+   + + +    F          K    +  + + L +  F+  A+ +       +V     N +    GD  V A    + +  +        I   + G+  G +PI++YNY      RVK  +   +++ +VF+     + W   +         FN+N P  + + +           L    ++    F + G+  ++++ +L + ++   P +Y +
  S:    67 MIVAAFSGLIGMGGAPLAAIKMGEKKKEDAEEIMTNSFSALIGLALFLTVFFFIFKEPILWAFGASDAT----------------IGYALDYLGIYLVGTIFVQIALGM-NSFINTQGFAKVGMITVMVGAIINIVLDPILIFGFNMGVKGAALATIIGQCASAIWVLYFLFGKQSILRIRKKF---------LKPKLKILFSIMALGVSPFIMQATES-------LVIISMNNNLLKYGGDLAVGAMTIMSSVMQI--------ILLPLMGLSQGAQPIISYNYGANKVYRVKKAFKLLLVSSMVFT----TIMWSALMILPDVFVKIFNSNNPQLMEITSWSIRIYFAGILLFGAQVACQQTFLALGQAKISLILALLRKIVLLIPFIYVL 414
>gi|116873524|ref|YP_850305.1| MATE efflux family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742402|emb|CAK21526.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (443 aa)
Score = 115, Expect = 1.1e-03, Identities = 83/389 (21%), Positives = 169/389 (43%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWN--VFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAY----NYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           IF +I ++I  GA+  FS A+ +++  K ++I+ ++      L+++   +I+ +  +I +  +A    +  E +          +L   N  + F       + + N+L  F+R +G       A ++  + N+I   +F  VF+  + G  ++ +I   V +      IL   F  K          +LK  K++WN   F  +L + L +FL +  ++V  + Y I       +I+   G AGV+A    N   +V        I     G+   ++P+++Y      +++  + +K+       TGV F L        +  FG   + S F   +P EI  L      L +  +  +  +   ++ FQ++ K+ +    ++++ +IF    L
  S:    63 IFTAISIWIGIGAATQFSFAIGEKNVAKAQTIFTNAI-----LAVISITIIIGVIAFIFKVPLAYFLGANDETIG--------YVLEYMNILLVFGFA----LTLENILSIFVRNDGDPNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIVGVC-----ILITHFFKKT--------SRLKFVKLDWNKAFFKKTLAIGLPSFLAEVGVSVFTLGYNI-------SIAAIAGTAGVAAFSVLNYTHSV--------ILMLFLGMGSAIQPLISYYRGAKARQKELETLKIAIIVAFSTGVGFLL--------VGFFGSNLLVSMFGNFSP-EIRDLASNGIKLFYTAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIFMVIFL 404
>gi|152999864|ref|YP_001365545.1| multi anti extrusion protein MatE [Shewanella baltica OS185] >gi|160874486|ref|YP_001553802.1| multi anti extrusion protein MatE [Shewanella baltica OS195] >gi|151364482|gb|ABS07482.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS185] >gi|160860008|gb|ABX48542.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS195] (451 aa)
Score = 115, Expect = 1.2e-03, Identities = 99/461 (21%), Positives = 174/461 (37%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK----VVYYYGIITGVV-FSLLINAVFWPIFLFGGPSVTSFFNAN-TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  +IG  I  G++ L S  L Q +  K + +  ++F  CL    +  ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +T+  ++  + N   + +F +VF   + G  I+ ++   V  LL                P +     L++ K+  +       + L +FL +  +++   ++   F               V   L       VS T  +  + F   GI  G +PI ++N     + RVK    + +   ++T V+  +L+ +   W ++LF G       N N TP  I  +   F  L    P+  L + G S FQ+
  S:    18 EPIAKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGETGL---------AGM----------------------------MLAY------PVGAILYAIGAMIGMGSAALVSINLGQGNVAKARKLLGNAFSLCLLAGAIFALMGGIFSRDILIALGAQGD-----------------ILENANEYLFWYFALCHFPIISM--TFTTLLRNDGRPSMVTWVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMMSQAVTGLLCLQHFF---------SPRTQLRIDLEQMKLKLDNCLNIARVGLPSFLMNLYLSIVLTLHNTAFL-------------WVGGPLHVAAYGVVSYTEAFFYLIFE--GIALGTQPIYSFNAGAGRFDRVKQARNIAFGMTLLTAVLGLALIYSRPEWLVYLFAGD------NQNLTPVAIEGMRWYFWGL----PMEGLILVGASFFQA 390
>gi|188589425|ref|YP_001920819.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] >gi|188499706|gb|ACD52842.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] (445 aa)
Score = 115, Expect = 1.2e-03, Identities = 81/386 (20%), Positives = 155/386 (40%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           + GL I  G +  F+    Q +  K   +    F  C+ L IV            + +  A + +  SE ++ +     +   +  N Y+  I    P  ++ N+LI F+R +          ++ +L NII + IF     + + G   +  +   ++I+L++   +      K +  FS     +K+ K +  +F   + L L +F+ + S  +  I++ IV       I  A    G+ A LA   I   +             GI  G++P+++ +Y  +NY ++K +  Y I      SL+I+ + +         + S FN+   S +         L F  F  + ++I  +S   S     +  + SL +  I   PI+
  S:    59 ATGLMIGIGGATKFTILKTQSENSKADEV----FTHCIILGIV------------IGSIFALTGILGSEYLSRFLGANEE-TFSMTNTYLKTIFLFSPCFILNNVLIAFIRNDNSPKLAMGGMILGSLSNIILDYIFIFPLNLGMFGAAFATGLAPIISIILLSLHFI------KNNNNFS-----IKKCKFDLTIFKNIINLGLSSFVTEISSGIVLIIFNIVILNIAGNIGVAA--YGIIANLALVAIGIFT-------------GIAQGMQPLVSNSYGNKNYLQLKQLLKYSI----TLSLIISVIIYSTINLFSSELISLFNSENNSLLKTYATKGLLLYFIGFIFVGINIVIISFLNSIENSKVAFIISLIRCFIAIIPIV 398
>gi|110799381|ref|YP_695854.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|110674028|gb|ABG83015.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] (460 aa)
Score = 115, Expect = 1.2e-03, Identities = 68/393 (17%), Positives = 154/393 (39%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           +I  +    +  G + L +  + ++ K+  + I  +SF + + L++ LTV     +  I+ A  A                    I  A +    ++ G+I + + L +   F+  +G +       ++  + NI+ + I    F M + G  ++ +IG   +    A ++L++ F  +     S    + K  K    +  + + L +  F+  A+ +       +V     N +    GD  V A    + +  +        I   + G+  G +PI++YNY      RVK  +   +++ +VF+     + W   +         FN+N P  + + +           L    ++    F + G+  ++++ +L + ++   P +Y +
  S:    63 MIVAAFSGLVGMGGAPLAAIKMGEKKKEDAEEIMTNSFSALIGLALFLTVFFFIFKEPILWAFGASDAT----------------IGYALDYLGIYLIGTIFVQIALGM-NSFINTQGFAKVGMITVMVGAVINIVLDPILIFGFNMGVKGAALATIIGQCAS----AIWVLYFLFEKQ-----SILRIRKKFLKPKLKILFSIMALGVSPFIMQATES-------LVIISMNNNLLKYGGDLAVGAMTIMSSVMQI--------ILLPLMGLSQGAQPIISYNYGANKVYRVKKAFKLLLVSSMVFT----TIMWSALMMLPDVFVKIFNSNNPQLMEITSWSIKIYFAGILLFGAQVACQQTFLALGQAKISLILALLRKIVLLIPFIYVL 410
>gi|148642474|ref|YP_001272987.1| Na+-driven multidrug efflux pump, NorM [Methanobrevibacter smithii ATCC 35061] >gi|148551491|gb|ABQ86619.1| Na+-driven multidrug efflux pump, NorM [Methanobrevibacter smithii ATCC 35061] (458 aa)
Score = 115, Expect = 1.2e-03, Identities = 67/281 (23%), Positives = 119/281 (42%)
  Q:   212 GSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL--SLSISGLSLFQSTGK----MFLNIVASL 492
           G + + +  ++L   LR+EG     T A  I  + NII + IF     M I G   + +I   ++ +++A +I       K D   + +F Q K+ K I   +   ++  +    +        N + VIV   T  A+ TA                      I ++    + GI   L  +    Y  +NY+++K  + Y I  G+V SL++ A+    F+F  P +   F+ +  +      + F   +F F L+     I+G  +FQ  GK    + + I+ SL
  S:   144 GLLIVFLFSSVLSSILRSEGDVNRATIAIAITAVLNIIIDPIFIYYLNMGIAGAAWATVISAGISCIVMAYWIWV-----KKDTYMNLSFDQFKKSKGIVIEIMKVAIPSTAEQLIMSGLTMAINAMLVIVSTTTAVAVYTA-------------------SMRIVSMAMIPLMGIATALLTVAGAAYGARNYEKLKTSFTYSIKFGLVISLILGAL---TFIF-APQIALLFSYSAATAYLTPQIAFALRIFCFFLIFVPFGIAGSFVFQGVGKGTSSLLITIIRSL 403
>gi|18310466|ref|NP_562400.1| MATE efflux family protein [Clostridium perfringens str. 13] >gi|18145146|dbj|BAB81190.1| conserved hypothetical protein [Clostridium perfringens str. 13] (442 aa)
Score = 115, Expect = 1.2e-03, Identities = 63/293 (21%), Positives = 122/293 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVK 407
           ++ +IGL I  G +   S A+ Q    +   I    F S +F +I+  ++I  ++ + ++  +             Y     +     A +Y+  I    P  +  +  I F+R +       +A + +N  NI+ + +F  +F + + G  ++  IG      LVA  +L   F+ K +         ++   IN +     L   + +FL + S      ++ IV +          GD GVSA     +I          LIF A++ G+  G++P+++ N+  +  +RVK
  S:    62 LYSAIGLTIGVGGATALSVAMGQNKFHRVNRI----FTSAIFATIIFCIIISLLEVFFLDKIV-------------YMLGASEATFPLAKEYLKIILAFNPAFIFASAFIVFVRNDREPKLAMYAVIGSNTTNIVLDYVFIYIFNLGMFGAALATSIGQ-----LVALGVLSIHFIKKNNT------MHIELGGINLDNIGKVLKNGVPSFLNEISAGFVIFIFNIVIY-------KFEGDLGVSAYGIITNIV---------LIFMAVFNGVSQGVQPLISVNFGAKKEERVK 311
>gi|160879466|ref|YP_001558434.1| MATE efflux family protein [Clostridium phytofermentans ISDg] >gi|160428132|gb|ABX41695.1| MATE efflux family protein [Clostridium phytofermentans ISDg] (443 aa)
Score = 115, Expect = 1.2e-03, Identities = 73/280 (26%), Positives = 118/280 (42%)
  Q:   204 NKYMYF---ITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           N  MYF     G I I+M  N  +   +A G S    +  +IA + N++ +L+F  V    I G  I+ +I  FV+ +L    +L  +    G++       Q+ + +I  N+ T  L + + T ++++ I  AN   VIV     N  S A    G             S + +    F  I      L   +  N   + ++RVK    +GI++GV+ +  +  V W IF    P +  FFN N P  I    +   T    F LL+ S     + +  GK
  S:   126 NSIMYFQLYFAGGIGIVM-YNACMGIFQAVGDSRHPLYYLIIAAIINVVLDLLFVAVLGFGIGGAAIATVISQFVSAILGFVKLLRVD----GEHRI-----QINKIRIQRNMLTRILKMGIPTGVQNSVIGFAN---VIVQSNINNFGSIAMAGCG-------------SYSKLEGFAFLPITSFSVALTTFIGQNLGAKQFERVKKGARFGILSGVLLAETVGIVLW-IF---APVLIGFFN-NQPDVIEFGVMQSRTEALFFCLLAFSHCLAGILRGAGK 377
>gi|169347317|ref|ZP_02866255.1| hypothetical protein CLOSPI_00032 [Clostridium spiroforme DSM 1552] >gi|169293934|gb|EDS76067.1| hypothetical protein CLOSPI_00032 [Clostridium spiroforme DSM 1552] (450 aa)
Score = 115, Expect = 1.3e-03, Identities = 89/411 (21%), Positives = 169/411 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQF---PLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWN--------IAILVSDYKVMLFT 522
           + L+ ++I L I  G +  FS +L  + K        ++    +   I+ T+        I+E       + +S+ V  Y      +IL  A      I G+            F RA+G       + LI   FNI+F+ I  +   M + G  I+ + G F++++    + L Y   N+          +LK  K + ++  T     +  FL   + ++ N +         +++    GD  +S        QT+   P        + G++ G +P+++YNY      RV     Y II G + +L+    F  + L    ++   FN     E+ V+TL    +   F   P+L + I   + FQ  GK+ +  + +L + +I   P++  + +        IA+ ++D+   + T
  S:    60 ITLVLMAISLMIGVGGATRFSISLGMKKKDHAAIYQGNAIILTVIFGIIFTIFGNIFINPILE------ILGSSKQVLPYASDYLSIILFGAVFQCIAICGN-----------NFSRAQGNPKNAMISQLIGAGFNILFDYILIMKMNMGMQGAAIATIGGQFLSMI----WQLCYLCSNRSLIKLDLEHLRLKA-KYSIDIIKT----GIPAFLMQMANSILNFILN-------SSLGKYGGDIAISTVGIITSFQTICQMP--------LTGLMQGQQPLISYNYGANKPNRVIETLKYSIIGGTIIALI---GFLAVQLLPD-TIIRMFN----DEVEVITLGTKAIRIWFICLPVLGIQIMAANYFQCIGKIKVASILNLLRQIIILIPVMLLLSSLIGLDGIFIAVPIADFSAFVIT 432
>gi|168183154|ref|ZP_02617818.1| MATE efflux family protein [Clostridium botulinum Bf] >gi|182673585|gb|EDT85546.1| MATE efflux family protein [Clostridium botulinum Bf] (473 aa)
Score = 115, Expect = 1.3e-03, Identities = 93/440 (21%), Positives = 181/440 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGD-AGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           V  +  S+G+ I  GAS   +R+L ++D    KS+ +++    + + +VLT +I   +  ++   +  S                Q I   A +Y+  +        +  ++ + + + G +     A  +  + N+I +  +FLV  ++    G +I       + LV +   F +  NK              F++  ++    L +   TF+ + S AV  ++         N +S   GD A V  G+          T I   +F  + GI   ++PI A+NY  ++  RVK V    I+     +L++ AV   + +F  P +  F      S +      F  ++  FP + +    +  +QS GK   +++ S+      +  I+  +  + ILV  + +M   A+    IS +   IT  IY+ + + +K K
  S:    60 VQRLMSSLGMMIAVGASTAVARSLGKKDYDNLKSVILNAINITIVIMVVLTFIISIFKKDMITGLLGAS----------------QSIYPYAEEYISIVVLGGLFQALTLVICYIMTSLGYTNITLKATSVGAILNVIID--YFLVMHLNFGVAGAAIATVVSQTVALVYAIYKFNKVRNK------IGLNLKLNFELELDILKPILAVGFSTFIIEISDAVVAVILN-------NILSIYGGDKALVIVGVT---------TKISMFLFITVIGISSAMQPIAAFNYGSKDLVRVKEVVIKTIVAVTGATLILWAV---MLIFANPIIGLFLKDR--SLLGETVKAFRIIISLFPTIGIYYVSIYYYQSMGKARTSLILSV------YRQIIIFIPLLFILVGKFNIM--GAWMAYPISDLISAITGVIYVRVALREKNK 447
>gi|167756455|ref|ZP_02428582.1| hypothetical protein CLORAM_01988 [Clostridium ramosum DSM 1402] >gi|167703863|gb|EDS18442.1| hypothetical protein CLORAM_01988 [Clostridium ramosum DSM 1402] (452 aa)
Score = 115, Expect = 1.3e-03, Identities = 43/167 (25%), Positives = 79/167 (47%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN 276
           G++N + I  G+ I SG  +  +++   +  Q  K   V+SFY C+ ++      IM+I T I    + +   + S++   Y Q         A  Y+  I   +   M+ N+L   LRA G S    +  +++++ NI+ +LIF   F M  +G   + +I  F++
  S:    56 GSLNFMIIGFGIGICSGFGIPIAQSFGGKKIQDMKKYIVNSFYLCMLITA-----IMTIATVIALPSVLELMQTPSDI---YQQ---------AYDYIVVIFIGLFATMLYNILSSILRAIGDSRTPLYFLILSSIINIVLDLIFITQFDMGAVGAAYATVIAQFLS 205
>gi|154501069|ref|ZP_02039107.1| hypothetical protein BACCAP_04757 [Bacteroides capillosus ATCC 29799] >gi|150269897|gb|EDM97425.1| hypothetical protein BACCAP_04757 [Bacteroides capillosus ATCC 29799] (459 aa)
Score = 115, Expect = 1.3e-03, Identities = 80/387 (20%), Positives = 161/387 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFE--LIFFL--VFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKR----VKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           I I++ +    G + L S++L +QD ++      ++ +  L  +I   V       ++V   +        +V N        +I+    +YM   +     I +  +    L++ GR+ +  F   +  +FNIIF+  LIF +    ++++ G  ++ ++G FV  +L    ILF  F N              + K++   F     +    ++  A   + N +  ++ FG    + T    A    G+ F          + + +F  ++G+ +G+ PI+AYNY  +   R    VK+   Y ++  +V  +++  +   IFL        F        I V  L   +L F F      +   + FQ+ G+   +++ S+ + L+   P
  S:    65 IMIALAVGTGVGVNALLSKSLGEQDAERANR---TAEHGVLLAAITCVV-------FMVLGTLLARPFYMVQVAN------EPVIVEYGTQYMQICSLFSAGIFMEVMFERLLQSTGRTMYTMFTQGVGAVFNIIFDPLLIFGIGPFPRLEVAGAAVATVMGQFVAAILA---ILFNHFRNH-------------DIKLSLKGFRFDGWIVRRIYMVGAPSIIMNAIGSLMVFGMNQILLTFTKTATAVLGVYFK---------VQSFVFMPVFGLNNGMVPIIAYNYGARKKDRLLKTVKLGVLYAVLIMIVGLVVMQTIPDKIFLL-------FQADENMLSIGVPALRIISLSFVFA--GYCVVASATFQALGEGIQSMIVSVVRQLVVLLP 409
>gi|153808355|ref|ZP_01961023.1| hypothetical protein BACCAC_02649 [Bacteroides caccae ATCC 43185] >gi|149129258|gb|EDM20474.1| hypothetical protein BACCAC_02649 [Bacteroides caccae ATCC 43185] (457 aa)
Score = 115, Expect = 1.3e-03, Identities = 66/314 (21%), Positives = 125/314 (39%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFS 421
           V  ++ ++  S    +  G + L + AL Q D+ +   I  + F        VL +L   + ++I    +    + T    N+           A +    ++ G+I  + I   L  F+ A+GR     F+ LI  L NII + IF   F M + G  ++ ++    +    A+++L + F  +   P    +      K++  +  + L L +  F+  ++ ++   V        LN+     GD  +SA          +  P        + G   G  PI++YNY   + +RVK  +   +IT   F+
  S:    59 VTTSLIILISSFSAIVGGGGAPLAAIALGQGDRVRAGKILGNGF--------VLLILFTLLTSFIAYTFMEPILLFTGASANTLEY--------AVDYLSIYLLGTI-FVEISTGLNSFINAQGRPAIAMFSVLIGALLNIILDPIFIFGFNMGVKGAALATVLSQACS----AAWVLTFLFSKRASLPLEKPY-----MKLDRKIILSILALGVSPFIMASTESLVGFV--------LNSSLKEFGDIYISALTILQSAMQFASVP--------LTGFAQGFVPIISYNYGHGDKQRVKECFRIVLITMFSFN 330
>gi|160915149|ref|ZP_02077362.1| hypothetical protein EUBDOL_01157 [Eubacterium dolichum DSM 3991] >gi|158432948|gb|EDP11237.1| hypothetical protein EUBDOL_01157 [Eubacterium dolichum DSM 3991] (466 aa)
Score = 114, Expect = 1.3e-03, Identities = 86/386 (22%), Positives = 168/386 (43%)
  Q:   107 SVIGTVNLIFISIGLF--INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           +V  + NLIF+ IG F  I  GA V+ +R    +   K +    ++    L  S+VLT+L +    +++E       V    V  SY +V             YF+ GS+ ++M  N+ +  L+A G S    +  +I+++ NII +++F  VF   +    ++ ++  FV+  L    +L  + V +          +L + + + +     +   L + L+++ IA+AN+V        + +   A G+  ++   AF+ I+  +  P+ +            L   +  N     Y+R +    +GI+  ++ + +I  +   IF+F  P + + FN N P  +   T         F LLS S    ++ +  GK  + ++  L
  S:    70 AVSSSGNLIFLMIGFFNGIALGAGVVIARYFGARQYDKLQDAMHTTVAFGLVTSVVLTILGVWSAPWLLELMDTPLNVMPESV--SYFRV-------------YFM-GSLGMVM-YNIFVGILQAVGDSKHPLYYLVISSIVNIILDILFVAVFHWGVGAAALATILSQFVSAFLCMVQLLRSKSVYR---------MELAKIRFHKDAMKLIIRYGLPSGLQNSIIAIANVV--------VQSNINAFGEMAMAGCGAFSKIEGFAFLPVTSFTM--------ALTTFVGQNLGASQYERTRKGAKFGILCSMILAEIIGIL---IFIF-APVLIAAFN-NEPQVVLYGTQRARYAALFFCLLSYSHCVSAILRGAGKSMVPMLVML 410
>gi|188587736|ref|YP_001919760.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] >gi|188498017|gb|ACD51153.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] (447 aa)
Score = 114, Expect = 1.4e-03, Identities = 81/399 (20%), Positives = 168/399 (42%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLL-FQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           T++L++ + G    +G++ ++S    + + +  + ++   F S L + I+  +L +     I  A    +T +T E+                 +YM  I    P  ++   +  F R +   +    A +     NI+ +++F   F + + G  I+  I   V+ ++  S+ L  +           +  +LK F    N F   +   + +F+ + S+ V  I +  V    +       G+ GVS+     +I         NLIFF+I+ G    ++P+++ NY    YKR     +     GV F++++  VF    +F    ++S F   T SEI  +T     +    + ++ +++   + F S  K    +  SL++ L+    +L+ + N+
  S:    59 TISLMY-ATGFLFATGSATIYSIFKGKNEDENARKMYTFGFISALVMGIIYCILGILFVDKI--AYFLGATDNTIEM---------------TKQYMLTILSFAPFFVLDIFMNVFARNDKAPHISMLATIACCSLNIVLDVLFVFGFNLGMFGAAIATAISTVVSFIITFSYSLSKK-----------SGLKLKRFIPKLNDFLRIVTNGVSSFISEMSVGVVTIAFNRVILSHI-------GEIGVSSYGIIANI---------NLIFFSIFMGNAQAMQPLVSINYGANEYKRT----FNFFKLGVTFAMIVGVVFTSTSVFLSYQLSSLF--ITDSEIIKVTASALKIYGLAYLIMGINLLFDAFFYSVEKPKFAVSISLSRALVIVLSMLFILSNV 408
>gi|170763927|ref|ZP_02635302.2| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] >gi|170712273|gb|EDT24455.1| MATE efflux family protein [Clostridium perfringens B str. ATCC 3626] (464 aa)
Score = 114, Expect = 1.4e-03, Identities = 66/393 (16%), Positives = 151/393 (38%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           +I  +    +  G + L +  + ++ K+  + I  +SF + + L++ LTV     +  I+ A  A                    I  A +    ++ G+I + + L +   F+  +G +       ++  + NI+ + I    F M + G  ++ +IG   + + V  F+   + + +    F          K    +  + + L +  F+  A+ +       +V     N +    GD  V A    + +  +        I   + G+  G +PI++YNY      RVK  +   +++ +VF+     + W   +         FN+N P  + + +           L    ++    F + G+  ++++ +L + ++   P +Y +
  S:    67 MIVAAFSGLVGMGGAPLAAIKMGEKKKEDAEEIMTNSFSALIGLALFLTVFFFMFKEPILWAFGASDAT----------------IGYALDYLGIYLIGTIFVQIALGM-NSFINTQGFAKVGMITVMVGAVINIVLDPILIFGFNMGVKGAALATIIGQCASAIWVLYFLFGKQSILRIRKKF---------LKPKLKILFSIMALGVSPFIMQATES-------LVIISMNNNLLKYGGDLAVGAMTIMSSVMQI--------ILLPLMGLSQGAQPIISYNYGANKVYRVKKAFKLLLVSSMVFT----TIMWSALMILPDVFVKIFNSNNPQLMEITSWSIRIYFAGILLFGAQVACQQTFLALGQAKISLILALLRKIVLLIPFIYVL 414
>gi|110803975|ref|YP_698782.1| MATE efflux family protein [Clostridium perfringens SM101] >gi|110684476|gb|ABG87846.1| MATE efflux family protein [Clostridium perfringens SM101] (440 aa)
Score = 114, Expect = 1.5e-03, Identities = 68/306 (22%), Positives = 130/306 (42%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVK----VVYYYGIITGVVF 420
           ++ +IGL I  G +   S A+ Q+   +   I    F S +F +I+  ++I  ++ + ++  +             Y     +     A +Y+  I    P  +  +  I F+R +       +A + +N  NI+ + +F  +F + + G  ++  IG      LVA  +L   F+ K +         ++   IN +     L   + +FL + S      ++ IV +          GD GVSA     +I          LIF A++ G+  G++P+++ N+  +  +RVK    +     +I GVVF
  S:    62 LYSAIGLTIGVGGATALSVAMGQKKFHRVNRI----FTSAVFATIIFCIIISLLEVFFLDKIV-------------YMLGASEATFPLAKEYLKIILAFNPAFIFASAFIVFVRNDREPKLAMYAVIGSNTTNIVLDYVFIYIFNLGMFGAALATSIGQ-----LVALGVLSIHFIKKNNT------MHIELGGINLDNIGKVLKNGVPSFLNEISAGFVIFIFNIVIY-------KFEGDLGVSAYGIITNIV---------LIFMAVFNGVSQGVQPLISVNFGAKKEERVKEFLRLTRIIVLILGVVF 328
>gi|125623852|ref|YP_001032335.1| hypothetical protein llmg_1015 [Lactococcus lactis subsp. cremoris MG1363] >gi|124492660|emb|CAL97609.1| putative membrane protein [Lactococcus lactis subsp. cremoris MG1363] (459 aa)
Score = 114, Expect = 1.5e-03, Identities = 72/297 (24%), Positives = 124/297 (41%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNL-LIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK 407
           T+ ++F++IG     G     +R L   DK+K K I   SFY  L + +++ ++ +     I     A +   T      Y +    ++L                 MILN  L   +RAEG S    +   +    +I+ + +F LV  + +IG G+S++I    N+   A ++ F E  NK +    F    LK FKI+         + +    + A + V  ++        LN  S   GD  +++ G+A           I  L  F   G+  G  P+ AY++  +N +R+K
  S:    61 TITIVFMAIGNLFGVGGGTFITRLLGSGDKEKGKKIAGYSFYMSLTIGLLIGLVSLFFLRPIAHLLGADAATLT------YTKEYAAVLLGGG------------FSMILNYGLEQLVRAEGASKESMYGMFVGVATSIVLDALFILVLNLHVIGAGLSMVIA---NLASTAYYVWFLE--NKSESLKGF----LKHFKISLKDQFEIYKIGIAEVFKSAFMIVTTLL--------LNHFSVEYGDNVLASFGIALR---------ITQLPEFLTMGLFLGAIPLFAYSFASKNTQRLK 315
>gi|170764078|ref|ZP_02631449.2| MATE efflux family protein [Clostridium perfringens E str. JGS1987] >gi|170663013|gb|EDT15696.1| MATE efflux family protein [Clostridium perfringens E str. JGS1987] (464 aa)
Score = 114, Expect = 1.5e-03, Identities = 66/393 (16%), Positives = 151/393 (38%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           +I  +    +  G + L +  + ++ K+  + I  +SF + + L++ LTV     +  I+ A  A                    I  A +    ++ G+I + + L +   F+  +G +       ++  + NI+ + I    F M + G  ++ +IG   + + V  F+   + + +    F          K    +  + + L +  F+  A+ +       +V     N +    GD  V A    + +  +        I   + G+  G +PI++YNY      RVK  +   +++ +VF+     + W   +         FN+N P  + + +           L    ++    F + G+  ++++ +L + ++   P +Y +
  S:    67 MIVAAFSGLVGMGGAPLAAIKMGEKKKEDAEEIMTNSFSALIGLALFLTVFFFIFKEPILWAFGASDAT----------------IGYALDYLGIYLVGTIFVQIALGM-NSFINTQGFAKVGMITVMVGAIINIVLDPILIFGFNMGVKGAALATIIGQCASAIWVLYFLFGKQSILRIRKKF---------LKPKLKILFSIMALGVSPFIMQATES-------LVIISMNNNLLKYGGDLAVGAMTIMSSVMQI--------ILLPLMGLSQGAQPIISYNYGANKVYRVKKAFKLLLVSSMVFT----TIMWSALMILPDVFVKIFNSNNPQLMEITSWSIRIYFAGILLFGAQVACQQTFLALGQAKISLILALLRKIVLLIPFIYVL 414
>gi|153166300|ref|ZP_01926919.1| hypothetical protein LMHG_00174 [Listeria monocytogenes FSL N1-017] >gi|167214150|ref|ZP_02284457.1| MATE efflux family protein [Listeria monocytogenes FSL R2-503] >gi|133727816|gb|EBA29514.1| hypothetical protein LMHG_00174 [Listeria monocytogenes FSL N1-017] (453 aa)
Score = 114, Expect = 1.6e-03, Identities = 113/432 (26%), Positives = 188/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS---EIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      + ++IG     G     SR L +++  K K +     Y  L L I+  +L+  +   +     A +T                  L+  N  +  +  S P I+    L   +R+EG S       +IA + N++F+ +  L F  +++G  +S+ +    +++  A ++       K DY  S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K +    I  G++  LL + VF   F      V   F+ +       +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   N+ I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTVLMAIGNMFGVGGGTYISRLLGKEEGIKAKQVSAFVLYGSLVLGIICAILLGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRSEGASRVSMNGMIIATVVNLVFDPLLILYFDFNVVGAAVSVGLASLFSLIYYAWYL-----EKKSDY-LSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRATAISIGLIVLLLSSLVFLFRF-----QVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNVKIASSA 446
>gi|169335192|ref|ZP_02862385.1| hypothetical protein ANASTE_01600 [Anaerofustis stercorihominis DSM 17244] >gi|169257930|gb|EDS71896.1| hypothetical protein ANASTE_01600 [Anaerofustis stercorihominis DSM 17244] (451 aa)
Score = 114, Expect = 1.6e-03, Identities = 93/438 (21%), Positives = 176/438 (40%)
  Q:    65 NALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNL-----------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           NA  S G     IL +  P  + A   NL+Y     + + +    GT+ L           I  +     + G + LFS    +++ ++ + I  +SF   +   + LT++ +  Q  I+           S+V   +          A +    ++TG+I ++  L +   F+ A+G +       ++    N+I + IF   F M + G  I+ +I  F++ + V  F+   +           A  +L +  ++  V     I+ LG  +    ++V N +  I+   TL       GD  V      N I+ +   P+         GI DG  P+++YNY  +N+ ++K    +  I  + ++ L     W   +         FN + P  I           F F +++L  +G  +F S GK    +  S+ + +I   P+
  S:     4 NADFSIGSPAKNILKLAVPM-TVAQLINLLYNMIDRIYIGRIPTTGTLALTGLGLCFPIIMIVTAFANLFSFGGAPLFSMERGRENDEEAQKIMGNSFLMMILFGVSLTIIGLLFQKPIL------YLFGASDVTYPF----------ARDYITIYLTGNIFVMTSLGM-NSFINAQGFAKTGMLTVMLGAFTNLILDPIFIFHFGMGVKGAAIATIISQFLSSVWVMKFLTGKK-----------AIIKLTKESMHLRVSRVKRIIDLG--MSGFIMSVTNSIVQIICNATLQIYG---GDLYVGVMTILNSIREIFTMPVS--------GITDGATPVMSYNYGAKNFHKLKKAIKFMSIVCIAYTFLA----WLTIIEFPDIFIKIFNHD-PKLIAKSIPAIEIYFFGFFMMALQFAGQRVFVSLGKSGYAVFFSIFRKVIIVTPL 405
>gi|109947001|ref|YP_664229.1| hypothetical protein Hac_0394 [Helicobacter acinonychis str. Sheeba] >gi|109714222|emb|CAJ99230.1| conserved hypothetical protein [Helicobacter acinonychis str. Sheeba] (461 aa)
Score = 114, Expect = 1.7e-03, Identities = 68/314 (21%), Positives = 134/314 (42%)
  Q:   116 FISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFF--AIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFW 429
            I+  L    GA+ +    L Q    + + ++ S FY             ++I T+I+   +   + + + +  S +      +L+ + +Y+  I      +++  L   F+  + R      A LI +L N+ F  +F  V ++ + G  I+ +IG+ +  L++     F     KG   F      +K F ++  + +T   +   T    ASI       +I+ F T  AI    G+  VS          + G  +YN + F   ++ I  G++PI +++Y  ++ KRVK V+ +G+       +L   V++
  S:    66 LIAYELLFGFGAASIVGYFLGQNKTHRARLVFSSVFY------------FVAISTFILSMILLPFSENIARLFGSSDA-----LLSMSKRYIEIILMGAVFMVLHPLADVFVVNDKRPILAMVAMLIGSLVNVFFNYLFIFVLEVGVQGSAIATVIGHAIGFLVLMQHFWF----KKGQLYF------IKRFSLSSIISSTKSGVPQSTAEFSASI-------MILLFNT--AIIHTAGERFVS----------MYGIIMYNAVIFFTTLFAISQGIQPIASFSYGAKSLKRVKEVFVFGLKVAFCVGILFYGVYY 335
>gi|116874094|ref|YP_850875.1| integral membrane protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742972|emb|CAK22096.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (450 aa)
Score = 114, Expect = 1.7e-03, Identities = 61/277 (22%), Positives = 120/277 (43%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +R+EG +       +I+ + N+I   IF + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       ++   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:   158 VRSEGNAKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMMAATVMSLIAWGL---VEIFPGLLVRIF--SNDPELIAQGTTAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|116496049|ref|YP_807783.1| Na+-driven multidrug efflux pump [Lactobacillus casei ATCC 334] >gi|116106199|gb|ABJ71341.1| Na+-driven multidrug efflux pump [Lactobacillus casei ATCC 334] (451 aa)
Score = 114, Expect = 1.7e-03, Identities = 79/386 (20%), Positives = 154/386 (39%)
  Q:   107 SVIGTVNLIFISIGLF--INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           +V  T +++F+ IG      +G S+L ++A    D ++ +  + +S +  + +S++LTV  +++   ++                         I++ +  ++  I   I   M  NLL   LRA G S    F  +IA + NI+ +  F L F   + G G + +    +  LL   +I                  + ++ + +W+     L + L    + + IA+  ++  ++    LN +    G   V+A  A   I  ++  P       A +G+   +    A N   + Y R++   Y  ++  V  S ++  V   I LF  P V  F   N P+   +    F      + LL++  +  +L Q  G+  +  VA  
  S:    49 AVGATSSIVFLIIGFAQGTTAGLSILTAQAYGAHDYRRVRRSFGTSIWITVGISLILTVAAVTMTRPLLTVMQTPPD-----------------IMDGSIAFVRVIYFGIIASMSFNLLSNMLRALGDSRTPLFFLIIATIINIVLDFWFILGFHSGVAGAGYATVSAQVIAALLCWIYIRMR---------IPLLMIRRRDLRFDWHDIVQHLKVGLPMGFQMSIIAIGAVILQVM----LNTL----GTNAVAAYTAAGRIDQLATLPS------ASFGV--AMATFAAQNLGAKEYGRIRRGVYQTLMVNVGLSAVLGVV---IILFSKPLVNLFLGPNQPAVTALAQTYFHFNASMYWLLAILFTIRNLLQGLGQTLVPTVAGF 391
>gi|170764228|ref|ZP_02638746.2| MATE efflux family protein [Clostridium perfringens CPE str. F4969] >gi|170715319|gb|EDT27501.1| MATE efflux family protein [Clostridium perfringens CPE str. F4969] (464 aa)
Score = 114, Expect = 1.7e-03, Identities = 66/393 (16%), Positives = 151/393 (38%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           +I  +    +  G + L +  + ++ K+  + I  +SF + + L++ LTV     +  I+ A  A                    I  A +    ++ G+I + + L +  F +  +G +       ++  + NI+ + I    F M + G  ++ +IG   + + V  F+   + + +    F          K    +  + + L +  F+  A+ +       +V     N +    GD  V A    + +  +        I   + G+  G +PI++YNY      RVK  +   +++ +VF+     + W   +         FN+N P  + + +           L    ++    F + G+  ++++ +L + ++   P +Y +
  S:    67 MIVAAFSGLVGMGGAPLAAIKMGEKKKEDAEEIMTNSFSALIGLALFLTVFFFIFKEPILWAFGASDAT----------------IGYALDYLGIYLIGTIFVQIALGMNPF-INTQGFAKVGMITVMVGAVINIVLDPILIFGFNMGVKGAALATIIGQCASAIWVLYFLFGKQSILRIRKKF---------LKPKLKILFSIMALGVSPFIMQATES-------LVIISMNNNLLKYGGDLAVGAMTIMSSVMQI--------ILLPLMGLSQGAQPIISYNYGANKVYRVKKAFKLLLVSSMVFT----TIMWSALMILPDVFVKIFNSNNPQLMEITSWSIRIYFAGILLFGAQVACQQTFLALGQAKISLILALLRKIVLLIPFIYVL 414
>gi|160893497|ref|ZP_02074282.1| hypothetical protein CLOL250_01048 [Clostridium sp. L2-50] >gi|156864892|gb|EDO58323.1| hypothetical protein CLOL250_01048 [Clostridium sp. L2-50] (455 aa)
Score = 113, Expect = 1.8e-03, Identities = 64/265 (24%), Positives = 110/265 (41%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIV-----FFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF 463
           +L+ A  Y   +    P +++       +RA+GR        L   + N I + +F  V +M + G  I+ +IG  ++  LV  F+   + V             +++  +  +    + + SLGT      +A+  IV +I+     ++G+L+    A   A   AG+          T +  +    I GI  GL+PI +YNY    YKRVK  Y +    G V +L    + + +F F    + S F   + S        F   LF
  S:   133 VLSYAKTYTGIVAIGFPFLILTTGSGHLIRADGRPKISMICNLTGAVINTILDALFVSVLQMGMTGAAIATVIGQVISAGLVIWFLSHCKTVT------------IRKEHLRISRPIIARVTSLGTAPCSNQLAMM-IVQIIMNKSLKYYGSLSIYGEAIPIA--CAGII---------TKVNQVFLSLIIGISQGLQPITSYNYGAGKYKRVKSAYLFASTCGFVIAL----IAFLLFQFVPRQIISIFGNGSESYFQFSISYFRIFLF 374
>gi|116333206|ref|YP_794733.1| Na+-driven multidrug efflux pump [Lactobacillus brevis ATCC 367] >gi|116098553|gb|ABJ63702.1| Na+-driven multidrug efflux pump [Lactobacillus brevis ATCC 367] (468 aa)
Score = 113, Expect = 1.9e-03, Identities = 41/176 (23%), Positives = 77/176 (43%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL 285
           G++N + I     + +G +++ +     +D +  +  + +S    + ++IVLTVL ++    I++     ++                 I   A  ++  I   I   M  NLL   +RA G S       +I  + N++ EL+F LVF M + G G + +I   V  LL   +I+
  S:    54 GSINFLIIGFAQGLTAGLAIITATRFGARDYKGVRQSFAASIIISILMTIVLTVLSLTFVDPILKLMQTPAS-----------------IFANARIFISTIFAGIFASMAFNLLSNIIRALGDSRTPLIFLVIGTVVNVVLELLFILVFHMGVAGAGWATVISQVVASLLCVVYII 212
>gi|191639530|ref|YP_001988696.1| Damage-inducible protein DinF [Lactobacillus casei] >gi|190713832|emb|CAQ67838.1| Damage-inducible protein DinF [Lactobacillus casei BL23] (451 aa)
Score = 113, Expect = 2.0e-03, Identities = 79/386 (20%), Positives = 154/386 (39%)
  Q:   107 SVIGTVNLIFISIGLF--INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           +V  T +++F+ IG      +G S+L ++A    D ++ +  + +S +  + +S++LTV  +++   ++                         I++ +  ++  I   I   M  NLL   LRA G S    F  +IA + NI+ +  F L F   + G G + +    +  LL   +I                  + ++ + +W+     L + L    + + IA+  ++  ++    LN +    G   V+A  A   I  ++  P       A +G+   +    A N   + Y R++   Y  ++  V  S ++  V   I LF  P V  F   N P+   +    F      + LL++  +  +L Q  G+  +  VA  
  S:    49 AVGATSSIVFLIIGFAQGTTAGLSILTAQAYGAHDYRRVRRSFGTSIWITVGISLILTVAAVTMTRPLLTVMQTPPD-----------------IMDGSIAFVRVIYFGIIASMSFNLLSNMLRALGDSRTPLFFLIIATIINIVLDFWFILGFHSGVAGAGYATVSAQVIAALLCWIYIRMR---------IPLLMIRRRDLRFDWHDIVQHLKVGLPMGFQMSIIAIGAVILQVM----LNTL----GTNAVAAYTAAGRIDQLATLPS------ASFGV--AMATFAAQNLGAKEYGRIRRGVYQTLMVNVGLSAVLGVV---IILFSKPLVNLFLGPNQPAVTALAQTYFHFNASMYWLLAILFTIRNLLQGLGQTLVPTVAGF 391
>gi|160889538|ref|ZP_02070541.1| hypothetical protein BACUNI_01962 [Bacteroides uniformis ATCC 8492] >gi|156861055|gb|EDO54486.1| hypothetical protein BACUNI_01962 [Bacteroides uniformis ATCC 8492] (451 aa)
Score = 113, Expect = 2.0e-03, Identities = 69/295 (23%), Positives = 117/295 (39%)
  Q:   200 LNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFS---LLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           L  A  +M  I    P+   +  L   +RA G        +++  + NII   IF   F   I G   + +I  F+ ++ V S  L    V +    F         +K+   + ++ L + +  FL + +   A ++ +IV     N++    GD  + A    N +          L    + G+  G++PI+ YN+  Q + RVK      II GV  +    LI  +F        P   S    +    I + +      +  FPL+   I   + FQS GK  ++I  SL +
  S:   130 LPYARDFMQVILLGTPVTYTMIGLNNIMRATGYPKKAMLTSMVTVVCNIILAPIFIFQFDWGIRGAATATVISQFIGMVWVVSHFLQKTSVVRLQRGF---------WKMKKRIISSILSIGMSPFLMNVT---ACVIVIIVN----NSLQQYGGDMAIGAYGIINRLLV--------LYVMIVLGLTMGMQPIVGYNFGAQKHDRVKATLRLTIIAGVCITSTGFLICELF--------PHAISAIFTSDEELIDIASRGVRIAVAIFPLVGAQIVIGNFFQSIGKAKISIFLSLTR 395
>gi|150008018|ref|YP_001302761.1| putative transmembrane cation efflux pump [Parabacteroides distasonis ATCC 8503] >gi|149936442|gb|ABR43139.1| putative transmembrane cation efflux pump [Parabacteroides distasonis ATCC 8503] (459 aa)
Score = 113, Expect = 2.0e-03, Identities = 83/392 (21%), Positives = 159/392 (40%)
  Q:   107 SVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQ---LKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFF--NANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           + + +VNLI        ++ + I  G   L    L + D+Q+  +   +SF     +S++++ LI     YI    IA+   +            + +++  A  Y+  +    P++ ++ L  + ++A G   +         L NI  +L+F  V  + I G G++  + + +  L               + P  F   Q   ++  +  W +   +L       + + S  +   ++ I     L       G+ GV+A  A N I  ++ T           GI DG+ PI++YN+      R++ V     + G V + +I    + I  F G  +TSFF         + +         F F +  L+I   S F + G   L++V S+ + L+F
  S:    59 NALASVNLILPCYSLMTALSIVIGVGCQTLIGINLGRSDRQEANNAITTSFLFLGGISVLISGLI-----YIFAGDIARMLGA------------NDVLVTGAVDYIRSLVPFFPLLSLMFLGDYMIKAMGHPLYAMIVMGSTVLINIGLDLLFIPVMGLGIKGAGLATGLAFTLGALF--------------NIPRMFQRGQVVVVQRGRFRWPLVWNALYNGSSEGISELSAGITIFLFNITMMRYL-------GEDGVAAFTAINYILFIATT--------VFLGISDGIIPIISYNFGAGRLDRIEKVLR---LAGRV-NFMIGITLFAILFFFGQQITSFFFKGGEALDALAIANYGITIYCFTFLMSGLNILASSYFTAIGNAKLSVVISMLRSLVF 411
>gi|110004393|emb|CAK98731.1| hypothetical drug/sodium antiporter extrusion transmembrane protein [Spiroplasma citri] (531 aa)
Score = 113, Expect = 2.0e-03, Identities = 97/473 (20%), Positives = 184/473 (38%)
  Q:    31 VPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNY-QKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ-FPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           VP++F+ ++ G+Y  +D+ L+              +  +  L  DQ            N   +     R+ I   T        +  S  + I  G ++ FS A  Q+D    + I  + F   +  SI++   I  I      A        TS++   YN +   L      +Y + +  + P++ +    +  +R+EGR  ++    L + L N    ++F  V  + + G  +  +  + V +  +  FI+   F  K  Y   F +  L  F+I            L  F+ +A++ V + V          ++     +     G+A       S  P   L+  A  G+  G R I+AYNY  K+N +  +V+    ++  + F L++      +F+  G  +   F    P +  +    +  L F  +P  SL+   L+LFQ   + FL    S  + ++   P++
  S:    26 VPTVFLMIVQGLYNIIDKSLVL-------------SFAAPDLIHDQFYIDAYNRLKNINVTEIPLADMRSFINVATQYASQTYNLQWSFSIMIGMGCAMNFSIAYGQRDIPSMRRIAGNGFSLTVLFSIMVAFAIFCIVFPGWNAIFI-----TSQMGKHYNPITESLCW----EYSFPMLAAAPMMFLSYYFMSLIRSEGRMKWVIIMILSSLLINAAAAILFMKVCHLGMSGAMLGTVFSWTVQV--IWGFIIV--FKTKNSYS-KFYWNDL--FQIEGKNIANFTKAGLPNFINNAALVVTSYV--------ATSLVVQLPNQEYHNGVAVLQELYSSIVPWMTLVLSAGVGVTQGARSIIAYNYGAKKNARIWEVLKRVSLLIIIWFCLML-----IVFIIFGKDMMMLF--AFPEKYAIKYRWWIVLNFMTYPFCSLTYIALTLFQGINRSFLATFTSSLRSIVVILPLI 456
>gi|154491846|ref|ZP_02031472.1| hypothetical protein PARMER_01470 [Parabacteroides merdae ATCC 43184] >gi|154088087|gb|EDN87132.1| hypothetical protein PARMER_01470 [Parabacteroides merdae ATCC 43184] (450 aa)
Score = 113, Expect = 2.1e-03, Identities = 70/277 (25%), Positives = 114/277 (41%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +RA G      F  LI  + N+I + IF     M I G  I+ +I      +L+ +  +   FV K D    F     K E  + WN+ T    + +  F   A     ++V VI  +    A+    GD  + A    N I T  G     L+   I GI  G++PI+ +N+  + Y+RV+      IIT  +  ++    F  +     P + +    N P  + V        L  F ++   IS    FQS G  +  +  SL++ ++F  P +
  S:   159 MRASGYPKKAMFTMLIGAITNVILDPIFIFWLDMGIKGAAIATIIS-----MLLCTLFVMNHFVQK-DSIVRFHKGTFKLEKHVVWNILT----IGVSPF---AMQLAGSLVVVIQNY----ALKQHGGDLALGA----NGIITSVGM----LLVMLIIGIAQGMQPIVGFNFGAKKYERVQETLRLVIITATI--IMGVGCFCSVAF---PKLITRAFTNDPDLLDVTANGLRISLLVFVVVGSQISISQFFQSIGIAWKAMFLSLSRQVLFLIPAM 406
>gi|21229232|ref|NP_635154.1| hypothetical protein MM_3130 [Methanosarcina mazei Go1] >gi|20907804|gb|AAM32826.1| hypothetical protein MM_3130 [Methanosarcina mazei Go1] (447 aa)
Score = 113, Expect = 2.1e-03, Identities = 66/269 (24%), Positives = 112/269 (41%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSL-ILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
            +RAEG + +  F  +     NII + IF     M + G  I+ ++      L    F+L Y    K    F        E  +     +  L ++ +G F+ +AS +      +++F    NA++T  GD  ++A   F  I  +        IF  + GI  GL+PI+ YNY  + + RV       ++   +FSL     F  +F F  P +  F  ++ P            ++   P +   + G ++FQ+ GK     V SLA+
  S:   153 LVRAEGNARYAMFGMIFGAGLNIILDPIFIFWLDMGVRGAAIATVLSQ----LAATVFLLRYFLSGKSSVVFK------PELLVPDMTISKELAVIGIGPFIIEASNST-----MMIFVN--NALATYGGDVSIAA---FGIIHRLLML-----IFLPLLGISFGLQPIVGYNYGAKQFSRVAESVKVALMVSTLFSL---PGFLLMFFFPEPIIQIF--SSDPELTAAGAGAMKIVVLILPFIGFQLVGTTVFQALGKPVPAFVLSLAR 392
>gi|160940206|ref|ZP_02087551.1| hypothetical protein CLOBOL_05095 [Clostridium bolteae ATCC BAA-613] >gi|158436786|gb|EDP14553.1| hypothetical protein CLOBOL_05095 [Clostridium bolteae ATCC BAA-613] (334 aa)
Score = 113, Expect = 2.2e-03, Identities = 72/302 (23%), Positives = 128/302 (42%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS---EIHVLTLLFCT--LLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           A  Y+  ++ S P ++I N     +RAEG+S       L+ NL N+I + I  L F  +I G  I+ +IG   NI+    +IL+++    G    S    Q+K+F     V ++ L + +   L    ++V+ I+        +N++    GD  ++       I  ++G            G   G++P+L Y      ++R K V    I+     S  ++AV   I  F    + S F     +         +L CT  L   F +LS      +  Q+ G     ++ +L++  I + P L+
  S:    11 AEIYLTIVSLSGPFVLISNCYSNIIRAEGQSGKAMMGQLLGNLLNVILDPILILGFGWNIAGAAIATVIG---NIVGAGYYILYFK---GGKSSLSI---QVKDFTTRNRVCSSVLAIGIPASLGSLLMSVSQII--------VNSLIAEFGDMALAGMGVAMKITMITG--------MICIGFGQGIQPLLGYCVGAGMWRRFKQVMKCSILC----SFGLSAVMTIICYFFVNQIVSVFLTEASAFNYAARFARILLCTSFLFGMFYVLS------NALQAMGAATEALIINLSRQGIIYIPSLF 282
>gi|189467473|ref|ZP_03016258.1| hypothetical protein BACINT_03862 [Bacteroides intestinalis DSM 17393] >gi|189435737|gb|EDV04722.1| hypothetical protein BACINT_03862 [Bacteroides intestinalis DSM 17393] (452 aa)
Score = 113, Expect = 2.2e-03, Identities = 75/305 (24%), Positives = 125/305 (40%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIIT----GVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-EIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLI------FFFPILY---SMW 507
           A +YM +         +LN  +FFLR +G   F     ++A + NII + +F   F   + G  I+  IG  V  L++  ++   +   +  YP     K ++  + N         L    FL + +IA    V  IVF   L       G A  S    F           + +IF     I    +PI++YN+      RV+  Y   + T    G +F+ +         LF    V+ F + + P+ EI    L      F F   +++I  +  FQS  +     + +L +G +      F  P+L+   S+W
  S:   134 AIEYMLWFVPFSVFTALLNSGMFFLRLDGSPNFAMMCNVVAAILNIILDYLFIFPFGWGMFGAAIASAIGTTVGALIIVIYLSRRKCALRF-YPVKLTRKSMQLTRRNIGYMCR---LGSSAFLCEVAIACMMFVGNIVFIHYLQ----EEGVAAFSIACYF-----------FPIIFMVYNAIAQSAQPIISYNHGLHETARVRRAYLLALKTAVGCGTIFAFITA-------LFSSEIVSMFIDRSYPAYEIASKGLPLYATGFIF--FAINIVSIGYFQSVERARYATIITLLRGFVLLTACFFGLPLLFGNPSIW 424
>gi|148380798|ref|YP_001255339.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 3502] >gi|153933824|ref|YP_001385083.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|153936130|ref|YP_001388552.1| MATE efflux family protein [Clostridium botulinum A str. Hall] >gi|148290282|emb|CAL84403.1| putative drug/sodium antiporter [Clostridium botulinum A str. ATCC 3502] >gi|152929868|gb|ABS35368.1| MATE efflux family protein [Clostridium botulinum A str. ATCC 19397] >gi|152932044|gb|ABS37543.1| MATE efflux family protein [Clostridium botulinum A str. Hall] (456 aa)
Score = 113, Expect = 2.2e-03, Identities = 94/384 (24%), Positives = 154/384 (40%)
  Q:   119 IGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFS---FAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAG-VSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           I + +  G+S + SRA+  +D +    I  +   S L LS+ +TVL       ++    AK  +  S +    N +R   I+   + ++ F   +       N+LI   R EG+         +  + NII + IF       + G  I+ +I   +  L+       Y   NK     +   FAF  + E            ILS+G      S A+  ++Y++        IS   GD   V  G+A           I    F  I+GI  GL+PI+  N+  + Y RVK       I   +F      V W  ++     V S+F  N  + I      F  +   FP+  L +  ++ FQS GK   + + ++ + +I F PI
  S:    67 IAVLVGVGSSSILSRAIGAKDDKVVNEILANLILSVLVLSLTVTVLGCFFSENLLRFSGAKGEILQSGI----NYLR---IVYIGSFFVNFSQSA-------NMLI---RGEGKMKEAMGIMALGAVLNIILDPIFIKTLNFGVEGAAIATVIAQIIQALVT----FMYFKCNKSILSVTKLKFAFDLMPE------------ILSVG-----GSAAMMQLMYLVQQTALYKLISIYGGDDQLVLMGVALR---------ILMFTFIPIWGIGQGLQPIVGMNFGAKKYDRVKDAVKIFSIASTIFI----GVLWGFYMLKPRVVLSWF-INDRTIIENGYEFFRLMFLTFPVSGLIVMSMTFFQSIGKGGKSALITVLKQVILFMPI 402
>gi|16801933|ref|NP_472201.1| hypothetical protein lin2873 [Listeria innocua Clip11262] >gi|16415408|emb|CAC98099.1| lin2873 [Listeria innocua] (450 aa)
Score = 112, Expect = 2.3e-03, Identities = 77/397 (19%), Positives = 168/397 (42%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN-ILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           S+   V +I +++      G + + SR+L   +++    +    F+  ++L ++ ++ I +I T+I    +     + +++ +  +     ++L A  +       +I            +R+EG +       +I+ + N+I   +F + F M + G  ++ +I   V  I L+  F+     ++   + F   F  ++  +I    F + +++S G      SI    + +++  +G   AI+          G+A           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    55 SIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKHADKV----FHQVIWLVLISSIFI-AIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNI------------VRSEGNAKTAMLTMIISAILNMILNPVFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTLSLKGFSFRMDFPLIR--RIMAIGFPSFIMMSAG------SIVTVAVNWMLNIYGGTMAIAVY--------GIA---------NRIASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGL---VEIFPGMLVRIF--SNDPELIAQGTNAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 405
>gi|89896306|ref|YP_519793.1| hypothetical protein DSY3560 [Desulfitobacterium hafniense Y51] >gi|109646925|ref|ZP_01370829.1| MATE efflux family protein [Desulfitobacterium hafniense DCB-2] >gi|89335754|dbj|BAE85349.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109642171|gb|EAT51725.1| MATE efflux family protein [Desulfitobacterium hafniense DCB-2] (442 aa)
Score = 112, Expect = 2.3e-03, Identities = 63/294 (21%), Positives = 132/294 (44%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL-SLSISGLSLFQSTGKMFLNIVASL 492
           I + AN Y++ I   +P +++ N+    LR  G S     A +++++ N++ +++F ++    +IG  +S LI      +L+A F++ Y   +   YP    F+ +++  ++ ++    L LSL T ++ +  +V N++        L  +    G   V+A      +  V   PI NL +        G+  ++A N    N++R K   + G+      ++++ A   P     G ++ S F     S    +   F  ++  F L+  ++I+  S  +  G +    +AS+
  S:   127 IFSIANSYLWIILLGMPFLVVYNVYSTVLRGMGDSKTSFLAIVVSSVINVLLDILFVVILHYGVIGAAVSTLIAQ----VLMAVFMVCY---STKKYPI-MRFR-IEKHCLDGSILRRGLSLSLPTAMQSSVHSVGNLL--------LQNLMNGFGTQTVAAITTAYRVDGVIMLPIINLGY--------GISTVVAQNTGAGNHQRAKRGVFVGMGIIAAVAIILTAAVIPT----GGALVSLFGVTDESA--AIGRTFFNIIAPFYLVFGIAIAIRSFLEGVGDVLFTSIASI 390
>gi|20092007|ref|NP_618082.1| integral membrane protein [Methanosarcina acetivorans C2A] >gi|19917215|gb|AAM06562.1| integral membrane protein [Methanosarcina acetivorans C2A] (478 aa)
Score = 112, Expect = 2.5e-03, Identities = 79/367 (21%), Positives = 145/367 (39%)
  Q:   132 SRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN------TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           SR +  +DK    ++ V +    L L ++ T+   +    I     A  T                   N A  Y   I     ++   N+    LRAEG S     A ++    NI+ + IF   F M I G   + L+  F++ L++ +++ F     + +   SF FK    E  I  ++F  ++  S        S+ + N++ V         +S   G A  S G     + T++  P        + GI   +  +    +  + +++ +  + Y I  G++    + A+F  IF    P + + F          P  +H L ++ C     +P +SL +   S FQ  GK    + A+L + ++F
  S:    96 SRRIGARDKTGADNVAVHTIVMMLLLVLIFTIPFYAFAPQIFSLVGAGRTT------------------NLAVAYARVIFLGSFVVFFTNVANAILRAEGDSKRAMQAMVLGAALNIVLDPIFIYTFNMGIAGAAWATLLSLFISSLMMLNWLFF-----RKNTFVSFEFKGFSFERDIVNDIFKVTIPASTQQLSMSLSMLILNLIIV--------NVSNTDGVAVYSTGWR---VATIAIAP--------LVGIATAVVSVSGAAFGAREFEKAETAHTYAIKLGLLIESGV-AIFTFIF---APQIAAIFTQTEEAAHIAPDLVHFLRVI-CIF---YPSVSLGMLSTSFFQGAGKGMNALTANLLRTIVF 419
>gi|160884415|ref|ZP_02065418.1| hypothetical protein BACOVA_02399 [Bacteroides ovatus ATCC 8483] >gi|156110154|gb|EDO11899.1| hypothetical protein BACOVA_02399 [Bacteroides ovatus ATCC 8483] (454 aa)
Score = 112, Expect = 2.6e-03, Identities = 86/380 (22%), Positives = 153/380 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFF-NANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           + ++    +++G S L S  L Q+D +    I   +   C+  S    +L     ++I    I     ++SE             L  A  +M  I    PI   +  L   +RA G        +++  + NII   IF   F+  + G   + +I   + ++ V S      FV K     S    +   +K+   +  +   + +  FL +  +    IV +I      N++    GD  + A    N + T        L    + G+  G++PI+ YN+  Q   RVK     GII+GVV    I +  + I  F   +V++ F +++   ++ V  +    L+  FP +   I   + FQS GK  ++I  SL +
  S:    64 LVVAFCTLVSAGGSTLASIRLGQKDMKGATEILSHTLMLCITNSFFFGIL-----SFIFLDDILVFFGASSET------------LPYARSFMQVILLGTPITYTMIGLNNVMRATGYPKKAMLTSMVTVVANIILAPIFIFHFEWGMRGAATATVISQLIGMVWVVS-----HFVKKD----STVHFEGNIWKMKRRIVESIFAIGMSPFLMN--VCACAIVIIIN-----NSLQNYGGDMAIGAYGIINRLLT--------LYVMIVLGLTMGMQPIVGYNFGAQKIDRVKQTLRLGIISGVV----ITSSGFIICEFFPHAVSALFTDSDELIDLAVDGIRLAVLM--FPFVGAQIVIGNFFQSIGKAKISIFLSLTR 397
>gi|153938000|ref|YP_001392119.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] >gi|152933896|gb|ABS39394.1| MATE efflux family protein [Clostridium botulinum F str. Langeland] (456 aa)
Score = 112, Expect = 2.6e-03, Identities = 70/277 (25%), Positives = 112/277 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFS---FAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAG-VSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
            +R EG+         +  + NII + IF       + G  I+ +I   +  L+  +F+ F    NK     +   FAF  + E            ILS+G      S A+  ++Y++        IS   GD   V  G+A           I    F  I+GI  GL+PI+  N+  + Y RVK       I   +F      V W  ++     V S+F  N  + I      F  +   FP+  L +  ++ FQS GK   + + ++ + +I F PI
  S:   157 LIRGEGKMKEAMGIMALGAILNIILDPIFIKTLNFGVEGAAIATVIAQIIQALV--TFMYFKR--NKSILSVAKLKFAFDLMPE------------ILSVG-----GSAAMMQLMYLVQQTALYKLISIYGGDDQLVLMGVALR---------ILMFTFIPIWGIGQGLQPIVGMNFGAKKYDRVKDAVKIFSIASTIFI----GVLWGFYMLKPRVVLSWF-INDRTIIENGYEFFRLMFLTFPVSGLIVMSMTFFQSIGKGGKSALITVLKQVILFMPI 402
>gi|170727110|ref|YP_001761136.1| MATE efflux family protein [Shewanella woodyi ATCC 51908] >gi|169812457|gb|ACA87041.1| MATE efflux family protein [Shewanella woodyi ATCC 51908] (503 aa)
Score = 112, Expect = 2.6e-03, Identities = 63/298 (21%), Positives = 124/298 (41%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIA--KSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLA-FNDIQTVSGTPIYNLI---FFAIYGIVDGLRPILAYNYQKQNYKRVK 407
           GT++    SIG+ ++     L SRA+  +  +  K +      +C  +++++++L+ ++ TY +   ++   +T  T+E+               A  Y+Y +  S+P+I +   L   LRA G +     + L     N++F+ IF     M I G  ++ ++     +L +A+  +  +    G + F                         G+F  D S      ++ I     L  I+T  G+A V+  +A F D        +  L+   F  I+ +   + PI+  NY    + RV+
  S:    56 GTISFFTTSIGIGLSIALGALVSRAIGAKQMEAAKRL----LLNCAVVTLLMSLLVSAVVTYFIPELLSLVGATGHTAEL---------------AAGYLYILVPSLPLICLAMALGAALRAVGDAKLSMMSTLGGGGINLVFDPIFIFALGMGIEGAAVASVLAR-AGVLFIAARGVIVKHKLFGQFDF-------------------------GSFKTDLS-----AIFAIAAPAMLTNIATPIGNAVVTRAIADFGDGYVAGWAVLGRLVPVCFGMIFALSGAVGPIVGQNYGAHEFDRVR 309
>gi|69248506|ref|ZP_00604755.1| Multi antimicrobial extrusion protein MatE [Enterococcus faecium DO] >gi|68194400|gb|EAN08906.1| Multi antimicrobial extrusion protein MatE [Enterococcus faecium DO] (456 aa)
Score = 112, Expect = 2.6e-03, Identities = 82/347 (23%), Positives = 140/347 (40%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQL--KEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTL 456
           G++  + I     + +G +++ ++    +D +  K     SF + + +S+V+TV++  +    +   +                     IL+ A  ++  I   I   +  NLL   +RA G S    F  +IA + N++ +LIF + F M + G  I+ +I        V+S +L   ++ K          QL  K+FK     F   L  +L    + + IAV  IV        L A   + G   V+A  A   I   +  P+ +      +GI   +    A NY  + Y R+       ++  V FSLL  A+   +  FG   V  F    +PSE  V  L
  S:    54 GSLTFLIIGFAQGLTAGLAIITAQRYGAKDYRGLKK----SFAASVVISLVVTVILTVLSLLFIRPMLQLMQTPPE-------------ILDQAQTFISIILLGIFASVSFNLLSNVIRALGDSRTPLFFLIIAVIINVVLDLIFIIYFGMGVEGAAIATVIAQ------VSSSVLCLVYIKK-----KMPLLQLRKKDFKFEKEEFAVHLNAALPMAFQSSIIAVGAIV--------LQAALNSLGTDVVAAQAAAGRIDQFANQPMMS------FGI--AMATFTAQNYGAKEYGRILQGVRQTLLMSVGFSLLAGAI---VIFFGHFFVQLFV---SPSETRVFEL 352
>gi|167747336|ref|ZP_02419463.1| hypothetical protein ANACAC_02053 [Anaerostipes caccae DSM 14662] >gi|167653314|gb|EDR97443.1| hypothetical protein ANACAC_02053 [Anaerostipes caccae DSM 14662] (472 aa)
Score = 112, Expect = 2.8e-03, Identities = 100/464 (21%), Positives = 173/464 (37%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLIL--SLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIF------LFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           E + KL L+  VPS    L+  +Y  VDQI +       G+ YL NA                                       T+V   +  I ++    + SG S   +  L Q+ +++ +    ++F   +   IVL V+       I+    A  +                 I+  A  Y   I   +P  +I   L    R +G      +  LI  + N I + I+  +F   + G  I+ +        ++++ ILF  F  +           LKE K++ +V    + L  S G     A I    +   +V++G  +A+    GD  +SA G+       ++   I         GI  G + I  +N+  + Y+R+K ++   +    V S+LI  +   +F      LFGG + ++F N         L  +FC            I   + FQ+TG+
  S:    15 EPVGKLLLQFAVPSTISVLVNSVYNIVDQIFIGQ-----GVGYLGNA--------------------------------------ATTVTFPIITIIMAFATLLGSGGSAYAAIKLGQKKEEEAEKTLNNNFMLSIITGIVLAVIGFIFMEPILRLFGATES-----------------IMPYAKDYASIILIGVPFSVIGPCLSNMARTDGSPRLSMYGILIGAVLNTILDPIYIFIFHWGVKGAAIATITSQ-----IISALILFLYFCKRSQMRL-----HLKELKLDGSVCKNVIALGTSSGITQLVACIMQVTMNNSLVYYGNKSAVG---GDVALSAMGIVMKLAMILASVCI---------GIGIGSQTIFGFNFGAEKYRRIKHLFKNAVAAATV-SVLIGWLLCQLFPGLIVNLFGGGN-SAFVNFAEKCLRIYLFGIFCA--------GFQIVATNYFQATGQ 395
>gi|15645798|ref|NP_207975.1| hypothetical protein HP1184 [Helicobacter pylori 26695] >gi|2314344|gb|AAD08230.1| conserved hypothetical integral membrane protein [Helicobacter pylori 26695] (459 aa)
Score = 112, Expect = 2.8e-03, Identities = 90/426 (21%), Positives = 179/426 (42%)
  Q:   116 FISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFF--AIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFF---NANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGL---IFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIY 541
            I+  L    GA+ +    L Q    + + ++ S FY   F++I   +L M++  +             SE +  +      L L+ + +Y+  I      +++  L   F+  + R      A LI +L NI F  +F  V K+ + G  I+ +IG+ + +L+    ++ + +  KG   F      +K F +      +S+I S  + +  ++   +  V +++F     AI    G+  VS          + G  +YN I F   ++ I  G++PI +++Y  +N +RVK V+ +G+      +  I  VF+  + F    +   +   +   P  +             +  L +++     FQS  +   + + +L+  L   +   PIL   + I  +   Y +  F AF  +A+     EI   ++
  S:    64 LIAYELLFGFGAASIVGYFLGQNKTHRARLVFSSVFY---FVAISAFILSMALLPF-------------SETIARFFGSNDAL-LSMSKRYIEIILMGAVFMVLHPLADVFVVNDKRPILAMVAMLIGSLANIFFNYLFIFVLKVGVQGSAIATVIGHAIGVLV----LMQHFWRKKGQLYF------IKRFSL------SSVISSAKSGVPQSTAEFSASVMILLFN---TAIMHTAGERFVS----------MYGIVMYNAIIFFTTLFAISQGIQPIASFSYGARNLERVKEVFVFGLKA----AFCIGIVFYGAYYFLDEFLIKLYLQPSEQDPLFMQETKRAMNIYYVGYIFLGMTLLCAVFFQSIQRTKSSFIITLSHTLGFIVILLPILSHFYGINGVWVTYPIAQFLAFL-VALGVTYYEIKKGVF 446
>gi|28378120|ref|NP_785012.1| cation efflux protein (putative) [Lactobacillus plantarum WCFS1] >gi|28270955|emb|CAD63859.1| cation efflux protein (putative) [Lactobacillus plantarum WCFS1] (463 aa)
Score = 112, Expect = 2.9e-03, Identities = 70/319 (21%), Positives = 127/319 (39%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           G+V  + I     + +G S+L ++    +D +  +  +  S    L + I+LT+L +    +I+      +                  I+  A  ++  + G +   +  NLL   +RA G S    +  +I+ L NI  EL+F LVFK  I G   + ++   +  L+   +I+          P     +  + FK+ W+     L + L    + + IA+  IV        L A   + G   V+A  A   I  V+  P+ +      +G+   +    A NY    Y+R        IITGV  ++ ++  F
  S:    54 GSVQFLIIGFAQGLTAGLSILTAQHFGARDFKAVRRSFAISIVVSLIVGIILTILSLIFVDHILLLMQTPTD-----------------IIADARTFLQIMLGGMLAPIAFNLLSNIIRALGDSRTPLWFLIISALINIGLELLFILVFKWGIAGASWATILAQTIATLMCVVYIIV-------KVPILHIGR--RHFKLVWSEVKAHLNVGLPMAFQMSIIAIGTIV--------LQAALNSLGTNSVAATTAAQKIDQVATQPLMS------FGVT--MATFAAQNYGAHQYER--------IITGVKQTMWLSGSF 322
>gi|150017931|ref|YP_001310185.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] >gi|149904396|gb|ABR35229.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] (461 aa)
Score = 112, Expect = 2.9e-03, Identities = 104/503 (20%), Positives = 190/503 (37%)
  Q:    25 LTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFW-PIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK------MFLNIVASLAQGLIFFFPILYSMWNI--AILVSDYKVMLFTAFTNI 527
           L +K+ VP++   L+ G+Y FVD I    +I  N +                                              SV     LI   I   I  G++ + SRA+ ++D         S   + +  ++++ +LI+S    ++    A+  +  S             IL+ A +YM  +      I         +RAEGR         I  + NII   I  ++F   + G  ++ L+   +  ++   + +  E  N   + F   F  L E    +++  +++++ +  F++   I                  ST  GD+ +        I   +   +    F  ++G+  GL+P++  NY  + Y RVK      +    V +L     FW PI LF    ++ F      S ++     F  +   FP+L   I  ++ FQS GK      + ++   +L   LI   P+L  +  +  A+ ++D  V + TA   I
  S:    16 LMIKLCVPAVLGMLVIGLYSFVDAIYAGQMIGTNAMG-------------------------------------------AVSVAYPFALINSGISTLIGMGSASVLSRAIGKKD---------SDIINKIMGNLLVLILILSAIVTVIGVVFAREVLLISGASGE--------ILDLAVRYMQIVFIGSFFINFAQSANMIMRAEGRMKKAMIFMAIGAITNIILAPIMIILFNHQVEGAAVATLVSQIIQAVITMVYFI-KESENVRFHGFKIEFDLLPEI---FSIGFSAMLMQIMMFIQQVVI--------------YKMASTYGGDSEI--------ILIGAALRVLAFSFIPLWGMGQGLQPVVGTNYGAKQYDRVKKSINVFVAGATVLAL----CFWIPIQLFPKEILSLFIKDG--SIVYEGINNFRLMYIIFPVLGFWIMSVTAFQSIGKGKNASVLVISRQIALIVPLIIILPMLMGIEGVWAAVPITDGIVFIVTAIMMI 435
>gi|170758662|ref|YP_001788156.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169405651|gb|ACA54062.1| MATE efflux family protein [Clostridium botulinum A3 str. Loch Maree] (456 aa)
Score = 112, Expect = 2.9e-03, Identities = 71/277 (25%), Positives = 111/277 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFS---FAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAG-VSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
            +R EG+         +  + NII + IF       + G  I+ +I   +  L+  +F+ F    NK     S   FAF  + E            ILS+G      S A+  ++Y++        IS   GD   V  G+A           I    F  I+GI  GL+PI+  N+  + Y RVK       I   +F      V W  ++     V S+F  N    I      F  +   FP+  L +  ++ FQS GK   + + ++ + +I F PI
  S:   157 LIRGEGKMKEAMGIMALGAILNIILDPIFIKTLNFGVEGAAIATVIAQIIQALV--TFMYFKR--NKSILSVSKLKFAFDLIPE------------ILSVG-----GSAAMMQLMYLVQQTALYKLISIYGGDDQLVLMGVALR---------ILMFTFIPIWGIGQGLQPIVGMNFGAKKYDRVKDAVKIFSIASTIFI----GVLWSFYMLNPRVVLSWF-INDRIIIENGYEFFRLMFLTFPVSGLIVMSMTFFQSIGKGGKSALITILKQVILFMPI 402
>gi|163814602|ref|ZP_02205991.1| hypothetical protein COPEUT_00753 [Coprococcus eutactus ATCC 27759] >gi|158450237|gb|EDP27232.1| hypothetical protein COPEUT_00753 [Coprococcus eutactus ATCC 27759] (459 aa)
Score = 112, Expect = 2.9e-03, Identities = 66/321 (20%), Positives = 125/321 (38%)
  Q:   107 SVIGTVNLIFI------SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           S +  V L+F       ++G     GA    +R L QQ+K+  +    ++    +   +VL V+    ++ IV   +  +T ++ E+   Y               +Y + G+ P++    +L   LRAEG+ Y      +   + N + + +   V    I   GI+   G  V      S ++ Y  V             L +FK    V      + + +FLR   + VA ++        L+      GD  ++               I+ ++F  + G   G  P+  + Y  + Y+RVK    + + T VVF +++  +
  S:    60 SAVAAVGLMFSVMALIQAVGYTWGMGAGSEIARLLGQQNKRAAEQTLATALAGGVVSGVVLAVIFGIFRSEIVS--LLGATDTSQELAEQYG--------------IYIMMGA-PVMCGAYVLNNALRAEGQPYLALMGIVAGGVTNAVLDYVLIKVLGFGIGAAGIATFAGQAV------SLVIMYACVRARFSMVRLHIGYLWKFKGVVQVIR----IGMPSFLRQGLMCVAAVL--------LSRSCRRYGDTALA--------NITVANKIFAVVFAVLVGYGQGFAPVCGFAYGAKTYRRVKRSLNFTMATSVVFMVMVGGM 343
>gi|86130998|ref|ZP_01049597.1| uncharacterized membrane protein [Cellulophaga sp. MED134] >gi|85818409|gb|EAQ39569.1| uncharacterized membrane protein [Dokdonia donghaensis MED134] (460 aa)
Score = 112, Expect = 2.9e-03, Identities = 80/402 (19%), Positives = 154/402 (38%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFT-TSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY---GIVDGLRPILAYNYQKQNYKRVK------VVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWN 508
           +V+  V     +IGL +  G S + SRAL   D  K   ++ +       +S +L +L +  Q  ++E   A  +                   + A  Y   +   I ++ +  +    +RAEG+  F  +A ++  + NI  + +   V    + G   +    Y V    +  F +F                   E +I       T  I+S  + L   ++A   ++ V+     LN +    GDA          +   S   I  ++ FA++   G+  G  PI +YNY    Y RV+      ++Y  G+   +   ++I   F+  +     +  +   A+    +        T+    P++ + + G   FQ+ GK    ++ SL +   F  P++  + N
  S:    56 TVVIPVTFFIAAIGLAVGIGGSSVLSRALGSGDDDKALRVFGNQITLTFLVSGLLAILGLVFQNTLIEFFGADDSFK-----------------DMALTYYRIVLYGIVMLAMCMMGNNVIRAEGKPKFAMYAMILPAIGNIGMDYLLINVLGYGMEGAAWATFASYAVCFAFIVWFFIFKS-----------------ELRIVPKCLVLTRKIVSEISGLSSVTLARQGVISVLTIL--LNNVLINYGDA----------LDVASYGIISRMLMFALFPVIGVTQGFMPIASYNYGANQYARVRETIKTSILYAGGLALAIFIIIMIVPDFFVSWFISDSNAQAQAIADNKVLMERTPNALRTVFAATPVIVIQLIGAVYFQAIGKAIPALLLSLTKQGFFLIPLILILPN 421
>gi|160879401|ref|YP_001558369.1| MATE efflux family protein [Clostridium phytofermentans ISDg] >gi|160428067|gb|ABX41630.1| MATE efflux family protein [Clostridium phytofermentans ISDg] (445 aa)
Score = 112, Expect = 3.0e-03, Identities = 44/174 (25%), Positives = 73/174 (41%)
  Q:   119 IGLF--INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNK 292
           IGLF  + +G +V+ ++ + Q++++K          S  FLS++L V+ +     I+     K +                L +  A  Y Y +  S P I I N      RA G S      +L  N+ NI+   I    F M + G  IS L+       ++A+ I+ Y   N+
  S:    54 IGLFSALATGGAVVAAQFIGQKNREKANEAANQLVLSVAFLSVILMVISLIGNEAILHLIYGKLS---------------PLTMQNAKTYFYIVAVSFPFIAIYNAGAALFRAMGNSKISMMTSLWMNIINIVGNSILIFGFGMGVAGAAISTLLSR-----MIAAIIVIYRLRNQ 209
>gi|57240532|ref|ZP_00368481.1| MATE efflux family protein, putative [Campylobacter lari RM2100] >gi|57018873|gb|EAL55646.1| MATE efflux family protein, putative [Campylobacter lari RM2100] (444 aa)
Score = 111, Expect = 3.0e-03, Identities = 80/385 (20%), Positives = 150/385 (38%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           +I  ++   I  G+SV  +  L ++  +K ++I    F  C+ L   ++ L+  +  ++ +A  A      +             I N + +YM       P  M+   +  +LR  G++++     ++  L NI  + +F +VF   +    ++  IG F+  +L     +F + V K   P            I   +    L      F  +    +++  Y I+    L  +S      G +A  AF+ I  +S       IF  I  + D ++P L+YNY  +N  R++ ++        + S++   VF  ++ F    V  F   N  +  H+         F F          S F +  K  L++  S+ Q LIF
  S:    61 MISFALADMIAIGSSVQIAINLGKEKVEKARAI----FSFCIVLIFAISCLMGILGFFLAQALSAFMGADEN-------------IQNLSTEYMQIFAIFAPFTMLAFAMDNYLRICGKNFYSMIVNVVTALSNIFLDWLFIVVFDWGLFSAALATCIGMFLGSILGILPFVFKDLVLKFKKPI-----------IKLQILKNILYNGSSEFFSN----ISSSFYTILANAFLLELS------GNTAVAAFSVILYLS-----TFIFMLILAMCDAMQPALSYNYGHKNIARIQAIFKRIFFASWIVSIV---VFLLVYFFNDILVNIFNKDNNQNFAHIAQNALYLFCFSFLFSWFGKICASFFTALDKPLLSLGISITQSLIF 399
>gi|189462866|ref|ZP_03011651.1| hypothetical protein BACCOP_03566 [Bacteroides coprocola DSM 17136] >gi|189430482|gb|EDU99466.1| hypothetical protein BACCOP_03566 [Bacteroides coprocola DSM 17136] (444 aa)
Score = 111, Expect = 3.1e-03, Identities = 84/372 (22%), Positives = 151/372 (40%)
  Q:   132 SRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKG-DYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           SR L  +D +  + +  + F+   F+S  +  L   +  Y+ + C+A  +  T              IL  A +Y+  I    P +    +L   +R +G + +     ++  + NI  + +   VF M + G   + L+        + SF++     ++G +    F    LK   +   VF  S      +  R    +++ I+        LN  + A GDA + AG++         T I   I   + G   G +P+  +NY    Y+RV+  +++ + TGVVF L + +V   IF    P + S+F  + P  I   T      L   PL +  I    + Q+  K    +  S A+  +FF P +
  S:    81 SRKLGAKDYESAEKMASTGFFYA-FMSGAIIALFGHL--YLSQICVALGSTPT--------------ILPYAEEYLGTILLGAPFMASSLVLNNQMRFQGNAVYAMVGIIVGAVLNIGLDPLLIFVFDMGVSGAAWATLLSQ------ICSFLVLLVMDSRGTNIRIRFKNFTLKPAYLKEIVFGGS-----PSLCRQGLASLSTIL--------LNVAAGAYGDAAI-AGMSIV-------TRICMFINSFVIGFGQGFQPVCGFNYGAGIYRRVREGFWFCVKTGVVF-LAVCSVIGYIF---SPEIVSWFR-DDPHVIETGTRALRWQLITLPLGAWVILCNMMLQTIRKPVRAVTLSSARQGLFFIPFI 404
>gi|83590908|ref|YP_430917.1| MATE efflux family protein [Moorella thermoacetica ATCC 39073] >gi|83573822|gb|ABC20374.1| MATE efflux family protein [Moorella thermoacetica ATCC 39073] (454 aa)
Score = 111, Expect = 3.1e-03, Identities = 81/369 (21%), Positives = 147/369 (39%)
  Q:   126 GASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLN-AISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF--WPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           GA+ L S  L +Q K++ + +  ++        +VL  L  SI   +    I +   ++SEV+       H ++L +       + G + + M       F+RAEG         ++  L N +    F     M I G  ++ ++G   + + V S+ L            S    +L+ F+    +  + + +    F  + +  +  ++        LN ++ T  GD G+SA G+  +         I  L+F  I GI  G +P++ +NY  + + RVK      I  G   S+    V   WP+ + G    T    A T      + + FC +     +L   I     FQ+ GK     + SL++
  S:    75 GATALISIRLGEQKKEEAEVVAANATSL-----LVLLPLCFSIIYLLFPEPILRLFGASSEVLPYARDFMHIIMLGS-------VFGGLSMGMN-----NFIRAEGNPVMAMSTQVLGALINGVLNYTFVFQVGMGIKGSALATVLGQLFSTIWVLSYYLTGR---------SLIKLKLRNFRPRLPILLSIVSIGFAPFAMELATCLQQVI--------LNKSVLTYGGDLGLSAVGILMS---------IITLLFMPILGISQGAQPLIGFNYGARRFDRVKATLKKAIFAGSCVSVTGYLVMRIWPVEIAG--IFTKGDIALTRMTADAMLVFFCMIF----MLGFQIVCSQYFQAVGKAVQAAILSLSR 398
>gi|110802304|ref|YP_698540.1| Na+ driven multidrug efflux pump [Clostridium perfringens SM101] >gi|110682805|gb|ABG86175.1| Na+ driven multidrug efflux pump [Clostridium perfringens SM101] (464 aa)
Score = 111, Expect = 3.2e-03, Identities = 49/279 (17%), Positives = 108/279 (38%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           F+  +G +       ++  + NI+ + I    F M I G  ++ +IG   + + V  F+L  + + +    F          K    +  + + L +  F+  A+ +       +V     N +    GD  V A    + +  +        I   + G+  G +PI++YNY      RVK  +   +++ +VF+     + W   +         FN+N P  + + +           L    ++    F + G+  ++++ +L + ++   P +Y
  S:   162 FINTQGFTKVGMITVIVGAVINIVLDPILIFGFNMGIKGAALATIIGQCASAIWVLYFLLGKQSILRIRKKF---------LKPKLKILFSIIDLGVSPFIMQATES-------LVIISMNNNLLKYGGDLAVGAMTIMSSVMQI--------ILLPLMGLSQGAQPIISYNYGANKVYRVKKAFKLLLVSSMVFT----TIMWSALMILPDVFVKIFNSNNPQLMEITSWSIRIYFAGVLLFGAQVACQQTFLALGQAKISLILALLRKIVLLIPFIY 412
>gi|127513703|ref|YP_001094900.1| MATE efflux family protein [Shewanella loihica PV-4] >gi|126638998|gb|ABO24641.1| MATE efflux family protein [Shewanella loihica PV-4] (456 aa)
Score = 111, Expect = 3.2e-03, Identities = 94/465 (20%), Positives = 176/465 (37%)
  Q:    19 TESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILI-GYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINW-----NVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLF-QFPLLSLSISGLSLFQSTGK 483
           T  IPKL  +  +P++   ++ G+Y+ +D + + H +   G+         AG+                            M+ Y       V  I  ++G  I  GA+ L S  L  +D  + + +  ++F  CL     L +L       I+    A+  V TS                 A +Y+  YF  G  P++ I       LR +GR  F+T   +++   N++ + +  +VF   + G  I+ +I   F  +  +  F                 F +     INW     N+   S IL +G  +FL +  +++   ++ + F      I  A          A+  +          L +    GI  G +P+ ++N   + + RV     +  +  V+   L+ A+   +F++  P    +  A   SE+  + +    L F   P   L + G + FQ+  +
  S:    18 TAPIPKLVWRYAIPTILSMVVTGVYVAIDGMFVGHYLGEVGL---------AGM----------------------------MLAY------PVGAILYAVGALIGMGAASLVSINLGLKDVARARHLLGNAFTLCLLAGTGLALLGTRWSQTILIWLGAEGEVLTS-----------------AEQYLFWYFALGVFPVLAI--AFTALLRNDGRPGFVTLVLILSGCLNVLLDWLLIVVFPYGLAGAAIATMICQAFTALACLQHF-----------------FTKRTRLGINWQQMRLNLDHCSNILRVGVPSFLMNLYLSIVLTLHNMAFLWVGGPIHVA----------AYGVVSYAEA-----LFYLIFEGIAFGTQPLFSFNTGAKRFDRV-----FETLRLVIIMTLVTALAGVVFIYWAPEYLVYIFAGDNSELAPVAIEGMRLYFWGLPFEGLILVGAAFFQAINR 394
>gi|170755721|ref|YP_001782447.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] >gi|169120933|gb|ACA44769.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] (456 aa)
Score = 111, Expect = 3.3e-03, Identities = 70/277 (25%), Positives = 112/277 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFS---FAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAG-VSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
            +R EG+         +  + NII + IF       + G  I+ +I   +  L+  +F+ F    NK     +   FAF  + E            ILS+G      S A+  ++Y++        IS   GD   V  G+A           I    F  I+GI  GL+PI+  N+  + Y RVK       I   +F      V W  ++     V S+F  N  + I      F  +   FP+  L +  ++ FQS GK   + + ++ + +I F PI
  S:   157 LIRGEGKMKEAMGIMALGAILNIILDPIFIKTLNFGVEGAAIATVIAQIIQALV--TFMYFKR--NKSILSVAKLKFAFDLMPE------------ILSVG-----GSAAMMQLMYLVQQTALYKLISIYGGDDQLVLMGVALR---------ILMFTFIPIWGIGQGLQPIVGMNFGAKKYDRVKDAVKIFSIASTIFI----GVLWGFYMLEPRVVLSWF-INDRTIIENGYEFFRLMFLTFPVSGLIVMSMTFFQSIGKGGKSALITVLKQVILFMPI 402
>gi|154483193|ref|ZP_02025641.1| hypothetical protein EUBVEN_00894 [Eubacterium ventriosum ATCC 27560] >gi|149736001|gb|EDM51887.1| hypothetical protein EUBVEN_00894 [Eubacterium ventriosum ATCC 27560] (449 aa)
Score = 111, Expect = 3.3e-03, Identities = 43/179 (24%), Positives = 87/179 (48%)
  Q:   107 SVIGTVNLIFISIGLFI--NSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL 285
           +V G   +I + I LF+  + GA+V+    + Q  K+K K     S ++ + ++++  V ++ I T +    +          +N+ ++V     L  A  Y+      +P +M+ N     LR+ G +    +A +++ + NI   L+  +VFK+D+ G  I+ +I   V+  LV  F++
  S:    56 AVGGNTPVISLLINLFVGLSVGANVVIGNYIGQGKKEKVKE----SVHTVMAMAVICGVFLLIIGTVLARPILM--------AINTPDEV-----LPLAMLYLRIYFVGMPFVMVYNFGAAVLRSIGDTKRPLYALIVSGIINICLNLVLVIVFKLDVAGVAIATVIADCVSASLVTYFLM 219
>gi|160931647|ref|ZP_02079041.1| hypothetical protein CLOLEP_00478 [Clostridium leptum DSM 753] >gi|156869292|gb|EDO62664.1| hypothetical protein CLOLEP_00478 [Clostridium leptum DSM 753] (486 aa)
Score = 111, Expect = 3.4e-03, Identities = 85/392 (21%), Positives = 165/392 (42%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSI-QTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISG--LSLFQSTGKMFLNIVASLAQGLIFF 499
           V G V  +  S    I  G + L S  L +  ++K  ++  + F     LS+ LT ++  + +  ++    +K+T+S ++   SY              +  ++TG+I  ++   +  F +  +G +     A  +    NII + +F   + M + G  ++ ++  F +   V SF+    F  +     +F           ++V     +LS+G F   A IAV NI+ +      +NAI    G  G + G       T++ + +  ++   + GI  G + IL++NY  +   RVK+      +  +V++ L+ A  W     GG      F   T   +     L+   ++   LL L I    +  F + GK+  ++  S  + L++F
  S:    87 VCGPVITMVGSAAALIGIGGAPLMSIYLGEGKREKAFAVVANCFLMLCILSVALTAVLFPMKEPMLLFFGASKATISYAD---SY--------------FSIYLTGTIFALLSAGMSQFII-CQGFAKIAMLAVALGAGLNIILDPVFIFAWNMGVPGAAVATVLSQFASCCFVLSFL----FGKRPAIHITFG---------GYSVRIMRRVLSIG-FTPFAIIAVDNIMII-----AMNAILQKYG--GAAQGDMLVTCATIAQSFML-VVTMPLSGISGGTQTILSFNYGARQIGRVKMAQRKIFLLCLVYTGLMTAAAW----LGGKWFVQLF---TNDAVIAEKALWAIRVYTLSLLPLGIQYEIVDGFTAIGKVQYSLPLSFWRKLVYF 434
>gi|169838099|ref|ZP_02871287.1| Na+ driven multidrug efflux pump [candidate division TM7 single-cell isolate TM7a] (300 aa)
Score = 111, Expect = 3.4e-03, Identities = 68/307 (22%), Positives = 125/307 (40%)
  Q:   121 LFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           L    GA+  F+  L ++  ++ KS+  ++    L   I+L +LI      ++ A  A + +    +   Y Q     I +    ++ F  G+ P++          RA+G S++   A +I  + N I + +F   F M + G   + +IG F++ +++  +   ++ V            +LK+FKI         +L     +   S  +  IV        L  I  A    G    +A   I         N+IF AI  G+  G +PI  +NY  + Y RV+ +    +    + SL+  A+
  S:     1 LMTGVGAATNFNLELGRKRPKRAKSVAGTAATMLLLSGIILCILINIFLRPMLTAFGATNQIFDYAI--EYTQ-----ITSLGIPFLLFSIGANPMV----------RADGNSFYSMLAIVIGAITNTILDPLFMFGFDMGMDGAAWATVIGQFISAIMLGLYFFRFKSVKF----------ELKDFKIKIREIWILFMLGTSPLIFQCSALIVQIVT-----NNLLKIYGAKSIYGSEIPIAVAGIVMK-----INVIFIAILLGLTQGAQPIAGFNYGAKKYARVREILKLSLKVAFIISLVAFAI 271
>gi|109647173|ref|ZP_01371077.1| multi antimicrobial extrusion protein MatE [Desulfitobacterium hafniense DCB-2] >gi|109642419|gb|EAT51973.1| multi antimicrobial extrusion protein MatE [Desulfitobacterium hafniense DCB-2] (467 aa)
Score = 111, Expect = 3.7e-03, Identities = 86/397 (21%), Positives = 166/397 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFL-FGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           SV   ++ I ++ G  I  GA  + S AL  +D++  + +      +   LSI++T + M +        IA        ++      R  + +  A  ++Y + G++            +RAEG+              ++IF+ +F +VF+  + G   +  IG  V  L+  S++ F    +KG   F      L+     W+    + +L LG     AS  + +++ ++      NA+S      G +  +AF  +       I+  +   I+G++  L+P++  NY  + Y+RV   Y    +T +V +L     FW + +   GP +         S   +  L F   +   P+LS     ++LF S  K     +  +A+ L+F+ P++
  S:    63 SVAYPLSQISVAFGSLIGVGAGSVLSIALGAKDRKTQEHL----LGNVNLLSIIVTAVYMLLGLAFSTQLIAMMGGRGEALILGDQYFR--ITIYGAFFWVYGLAGNM-----------IIRAEGKMKTAAVMMGFGLAVDVIFKYLFIVVFQWGVEGAAWATNIGMLVYTLV--SWLYF----SKGWATFHSKLASLR-----WDQKIGTSVLRLG-----ASSLIMSVMSLVQAIFVFNALSKY----GTTWDVAFYGVVY----RIFTFLLTPIFGLMRALQPVIGINYGARQYERVISSYKIFAVTALVLTL----PFWFLSIAIPGPILGLMMKDAAFSGADL--LYFRVYMAILPVLSFIFMAMTLFPSVDKGKPAAMIGIARQLVFYVPVM 413
>gi|46907222|ref|YP_013611.1| MATE efflux family protein [Listeria monocytogenes str. 4b F2365] >gi|47093997|ref|ZP_00231730.1| MATE efflux family protein [Listeria monocytogenes str. 4b H7858] >gi|46880489|gb|AAT03788.1| MATE efflux family protein [Listeria monocytogenes str. 4b F2365] >gi|47017623|gb|EAL08423.1| MATE efflux family protein [Listeria monocytogenes str. 4b H7858] (453 aa)
Score = 111, Expect = 3.8e-03, Identities = 112/432 (25%), Positives = 186/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS---EIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      + ++IG     G     SR L +++  K K +     Y  L L I+  +++  +   +     A +T                  L+  N  +  +  S P I+    L   +R+EG S       +IA + N++F+ +  L F  +++G  +S      V +  + S I +  ++ K     S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K +    I  G++  LL + VF   F      V   F+ +       +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   N+ I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTVLMAIGNMFGVGGGTYISRLLGKEEGIKAKQVSAFVLYGSLVLGIICAIILGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRSEGASRVSMNGMIIATVVNLVFDPLLILYFDFNVVGAAVS------VGLASLFSLIYYAWYLEKKSEYLSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRATAISIGLIVLLLSSLVFLFRF-----QVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNVKIASSA 446
>gi|114567335|ref|YP_754489.1| Na+-driven multidrug efflux pump-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338270|gb|ABI69118.1| Na+-driven multidrug efflux pump-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (461 aa)
Score = 111, Expect = 3.8e-03, Identities = 71/311 (22%), Positives = 137/311 (44%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKV-VYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTP-SEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI---LYSMWNI 509
           +L  A  Y +++  S PI+  + +      + G +     A LI N  N+  + I        I G  I+ LIG     LL A +I  Y  + +   P    + + K+  + W       I  LG F     + ++ +V  +     +N +  + G A + A      ++ +   P+Y        G+   L P +A+NY ++N++R++  V  + + TGV+  L I AV     + G P +   F ++   +E+ +  +    L   F  L L++ G +  Q   + + +++ S+A+ L+F +P+     S W +
  S:   133 VLTEAYPYTFWLVLSFPIMAYVMIGEAISMSHGNTLMPMKAMLIGNAINLTLDPILMFYLGWGIAGASIATLIGQ----LLSAVYI--YRQLKQAKLPVPVLYLR-KDMPLYWKK-----ISHLGIF-----VTISQLVSPL-GLSLVNVVLASFGPAAIGAWNIMARLEMMGLLPLY--------GMAGALIPYVAFNYGQENWERIRSGVRIFLLGTGVII-LPIMAV----LILGAPWLVLPFRSDAQVTELAMHAIRIAALAHIFAPLELALFGTA--QGLKRPWYSLLTSVARLLVFRYPLAVFFASFWGV 415
>gi|167453657|ref|ZP_02319880.1| MATE efflux family protein [Listeria monocytogenes FSL J2-064] (453 aa)
Score = 110, Expect = 4.0e-03, Identities = 112/432 (25%), Positives = 186/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS---EIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      + ++IG     G     SR L +++  K K +     Y  L L I+  +++  +   +     A +T                  L+  N  +  +  S P I+    L   +R+EG S       +IA + N++F+ +  L F  +++G  +S      V +  + S I +  ++ K     S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K +    I  G++  LL + VF   F      V   F+ +       +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   N+ I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTVLMAIGNMFGVGGGTYISRLLGKEEGIKAKQVSAFVLYGSLVLGIICAIILGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRSEGASRVSMNGMIIATVVNLVFDPLLILYFDFNVVGAAVS------VGLASLFSLIYYAWYLEKKSEYLSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRATAISIGLIVLLLSSLVFLFRF-----QVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNVKIASSA 446
>gi|150017998|ref|YP_001310252.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] >gi|149904463|gb|ABR35296.1| MATE efflux family protein [Clostridium beijerinckii NCIMB 8052] (451 aa)
Score = 110, Expect = 4.0e-03, Identities = 85/408 (20%), Positives = 165/408 (40%)
  Q:    96 QANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPG-DAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           Q N ++ +   +++  +  I +++   I  G + + SR+L   DK + +    ++  S    S++L +LIM I    +   +      + E +  Y     ++ L  +  +++ I  +             +++EG +     + +I  + NI  + I     +  I G  I+  I   +  +    F+L Y   N           ++K   IN  +   ++ L L TF+   +  +  IV         N++    G D  VSA   +N +        +  I   +YGI   L+PI+ +NY  + + RVK      I+  VV SL    VF  I +     +   F ++    I +   +   ++F  PL+ + +   S FQ  GK    +  S+ +  IF  P++
  S:    45 QPNGSLGIAALTIVFPIQQIILALSQMIGVGIASITSRSLGAGDKLRAEKAVGTALTS----SVLLGILIMVIGLVFIRPML--YIFGSLENILPYAVTFFRITLYCSVFFVFSIVANS-----------IIQSEGHANIAMISMIIGPVINIPLDYILVTRLQYGIKGAAIATDISQIICFI----FLLVYMCFNS-----KILGVKVKNLTINIKLLKEAISLGLSTFMTQLAYGILAIVLN-------NSLKVYGGSDLYVSAIGIYNRV--------FGFITITMYGIRQALQPIIGFNYGAKKFDRVKQSLKLAILASVVISL----VFLVIIISFTNKIAGAFTSDN-GLIALTVPILRVMIFMSPLVGVQVIASSFFQYIGKPKPALFLSIMKPFIFLIPLM 407
>gi|530153|gb|AAA98919.1| unknown [Mycoplasma gallisepticum] (165 aa)
Score = 110, Expect = 4.2e-03, Identities = 43/167 (25%), Positives = 76/167 (45%)
  Q:   408 VVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEKYKDPTVHLDVIIQKLEKFFTKNK 574
           + + Y  I  ++F   +N +F          + + FN      + V  L+    L Q   ++LS++   LFQST ++ +  +ASL QGL  F P+ ++M+N+AI  ++  + ++    N  ++ I   I S  + H Y     K  D    LD  + K +    K K
  S:     8 IAFSYSSIVYLLFGFGLNNIF----------LINLFNIQGADNLVVSNLVLRITLVQSIFIALSMNAQLLFQSTQRIGMAWIASLMQGLFTFAPVFFTMYNLAIDTNNIYLYIWIQPINAILTCIGNWIISIPFAHKYREFVSKRFDIGTMLDKYLNKTKNPKVKAK 164
>gi|120437543|ref|YP_863229.1| multi anti extrusion protein MatE family protein [Gramella forsetii KT0803] >gi|117579693|emb|CAL68162.1| multi antimicrobial extrusion protein MatE family protein [Gramella forsetii KT0803] (446 aa)
Score = 110, Expect = 4.3e-03, Identities = 65/305 (21%), Positives = 118/305 (38%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIF--FAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           I + A  Y   +   +P + +  +    +RAEG+  F   A +I ++ N+I + I      M + G  ++    Y    L    +I+++      +   SF+      F+++  +      L + T  R A ++V  ++   + F                  L   D  TV       L+F  F + G+  G  PI  +NY    Y RV+      I+      LLI   F  I  F  PS+   F     S I         +    P++++ + G + FQ+ GK     + +L++    F P++
  S:   131 IFDPAKIYYIIVLCGVPFLALAMMGNNVIRAEGKPKFAMTAMIIPSVANLILDYILINRLDMGMEGAALASSASY----LFCLGYIVWFFLSKNSELRISFS-----HFRLDLPILKEISSLGVVTLARQAVVSVTYLLMNNILF-----------------DLGGADSVTVYAIIARMLMFALFPVLGVTQGFLPIAGFNYGAGKYPRVRKSINIAILYACGMGLLI---FLGIMFF-APSLVKIFTQEA-SIIEQTPSAMRWVFAAIPIVAVQLIGAAYFQAIGKAVPAFLLTLSRQGFIFIPLI 406
>gi|166032154|ref|ZP_02234983.1| hypothetical protein DORFOR_01857 [Dorea formicigenerans ATCC 27755] >gi|166027877|gb|EDR46634.1| hypothetical protein DORFOR_01857 [Dorea formicigenerans ATCC 27755] (453 aa)
Score = 110, Expect = 4.4e-03, Identities = 54/243 (22%), Positives = 101/243 (41%)
  Q:    43 YIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDK-QKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL 285
           Y+F +Q L+  I+P               L  +Q+L+VL         D+++        V   S++  + ++ I+I   + +G +V+  + L Q++K Q CKS      +S  F+S+V+T  + + + +I+     +                   +++ A+ Y+  +T SIP I + N      RA G S      +L+ N  N+    I    F     G  I  L+  FV   ++   +L
  S:    11 YLFDNQALVSLIVP---------------LIIEQLLTVLV-----GMADSIMVANVGEAAVSGVSLVDQIMVLLINIFAALATGGAVVAGQYLGQKNKEQACKST-TQLMWSMGFISLVITAFVYACKYWILHGVFGQIEAD---------------VMHHADVYLLIVTASIPFIALYNGGAAIFRAMGNSEVSMKVSLLMNAINVSGNAILIYGFHCGTEGVAIPTLVSRFVAAFIIIKLLL 218
>gi|34558416|ref|NP_908231.1| hypothetical protein WS2134 [Wolinella succinogenes DSM 1740] >gi|34484135|emb|CAE11131.1| conserved hypothetical protein [Wolinella succinogenes] (404 aa)
Score = 110, Expect = 4.4e-03, Identities = 68/302 (22%), Positives = 130/302 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTP---SEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFF 500
           +L    +Y+  I  + PI+M+  LL  F+R +   Y    + ++ +L NI+   +F  +F   + G  ++ ++G+ + +L++        ++ +G+  FS        F   +  F   +  +L       S A A IV V++F   L  IS   G A +   +++  +  V+          A+     GL+PI ++N+    Y RV+ V+ +     +V   ++ A+ W    F       FF  + P        + + +   LF    L L+I     FQS G+  ++ V SL+   +F  
  S:    82 LLPYVKEYLGVIVLAAPIMMVQPLLEAFVRNDRAPYLAMSSMVVGSLSNIVLNYLFIFIFSWGLFGAALATVLGHLIGLLILGGHF----YLKRGNIYFS---SLRLRFSYVFRAFANGVAPAL-------SEAAAGIV-VVLFNLKLMEISKEEGVA-IFGAVSYIGVMAVT----------ALVAASQGLQPIASFNHGAGFYDRVRAVFRFSFGITLVLGFVLYALSWSFAPF---LAELFFPLDAPLAKESAEAMRIYYAGYLF----LGLNILSAVFFQSIGRSLVSFVISLSYNFVFIL 353
>gi|157364127|ref|YP_001470894.1| MATE efflux family protein [Thermotoga lettingae TMO] >gi|157314731|gb|ABV33830.1| MATE efflux family protein [Thermotoga lettingae TMO] (462 aa)
Score = 110, Expect = 4.6e-03, Identities = 74/375 (19%), Positives = 157/375 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGG--PSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNI 488
           ++ +S+   I  GAS + +R + Q+DK    +  + S    L LS+++ V+   +  ++V   +     S   +         QL L  A   ++    S  ++M  N+    LR EG +    +A  I ++ NII + +F  VFK+ + G   + ++   ++ +L++ ++ F +         ++   ++++F  + ++    L + +   L   S++VA  V+V+  F        A GD GV+           SG  + N     + GI   +  +    Y +++  ++ + + + +  G    L +      +F   G  P +   F  +        + L+  L+    ++SL + G+     T  MF  I
  S:    63 MVILSLAAGIGVGASSVVARKIGQKDKPGADAAAMIS----LILSLIIGVISTVVSLFVVGPVLRLIGASGETL---------QLCLEYAKVLLF----STTLMMFNNVANGILRGEGDAKRAMYAITIGSVLNIILDPLFIYVFKLGVGGAAYATVLSIAISSVLISYWLFFKK--------STYVSLKIRDFSYDSHILRDILKIGIPASLAQISMSVA--VFVLNVFAI-----RAGGDYGVAV--------FTSGWRVINFGTVPLIGIAMAVTSVTGAAYGERDGNKLDIAHLFAVKFGFFIGLFV------MFAIAGLAPYIALVFTYSDDG-----SALYGDLVVSLRIMSLFLPGVPFGMFTSSMFQGI 388
>gi|153201683|ref|ZP_01943492.1| hypothetical protein LMSG_00521 [Listeria monocytogenes HPB2262] >gi|167014345|ref|ZP_02276878.1| MATE efflux family protein [Listeria monocytogenes FSL J1-194] >gi|167217194|ref|ZP_02286830.1| MATE efflux family protein [Listeria monocytogenes FSL J1-175] >gi|133735991|gb|EBA37689.1| hypothetical protein LMSG_00521 [Listeria monocytogenes HPB2262] (453 aa)
Score = 110, Expect = 4.8e-03, Identities = 112/432 (25%), Positives = 186/432 (43%)
  Q:   102 IVYQTSVIGTVNL------IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVF---TTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV-KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS---EIHVLTLLFCTLLFQFPLLSLSISGL--SLFQSTGKMFLNIVASLAQGLIF---------FFPILYSMWNIA---ILVSDYKVMLFTAFTNIAISSIA 533
           +++ TS++  V L      + ++IG     G     SR L +++  K K +     Y  L L I+  +++  +   +     A +T                  L+  N  +  +  S P I+    L   +R+EG S       +IA + N++F+ +  L F  +++G  +S      V +  + S I +  ++ K     S  FK  K  K I  NVF    + L+LSL               ++IV    LN  S   G+ GV AG             +  L  F   G+  G+ P+LAYNY   N  R  K +    I  G++  LL + VF   F      V   F+ +       +H++  +  + LF         +GL  S FQ+ GK     + S++QG+IF         +F ++  +W++    IL     V LFT   N+ I+S A
  S:    45 LLHDTSMLTAVTLGLPMFTVLMAIGNMFGVGGGTYISRLLGKEEGIKAKQVSAFVLYGSLVLGIICAIILGFLINPVTHFLGADATS----------------FLHTKNYTLALLICS-PFIIANFALEQVVRSEGASRVSMNGMIIATVVNLVFDPLLILYFDFNVVGAAVS------VGLASLFSLIYYAWYLEKKSEYLSIRFKWFKATKEIVQNVFKIGVSELLLSL---------------FLIVTTLVLNHYSMIYGE-GVVAGFGV-------ALRVVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRATAISIGLIVLLLSSLVFLFRF-----QVMHLFSDSQSVITLGVHIMVAMLISSLFS------GFTGLFTSTFQAIGKAIPATIMSVSQGIIFIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFT-IHNVKIASSA 446
>gi|126699615|ref|YP_001088512.1| putative efflux pump [Clostridium difficile 630] >gi|15011959|gb|AAK77649.1| EffD [Clostridium difficile] >gi|115251052|emb|CAJ68883.1| putative efflux pump [Clostridium difficile 630] (440 aa)
Score = 110, Expect = 5.0e-03, Identities = 86/390 (22%), Positives = 161/390 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEI--HVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           I ++IG    +G S LFSR L  ++  + K    ++ +      ++  ++ +    YI+    A S        N++  V+         +Y+ F     P I+    L   +R +G+S       +I+   NII + I     ++ I G  I+ +IG   N   V  +I+    + + D   S      K F++   +     ++ L   L D  + V+++++        N  +   GD  V AG   +         I +LI   +Y    G+ P++A  Y  +N  R+K +      T +  +L+I  +F  +F      V  F N +    I  ++LT+  C+  F      L+     +FQS G+    +V S+ +GL+    I++
  S:    65 ILMAIGNLFGTGGSTLFSRLLGSENTDRTKQCSATTLWLSFLFGLLTAIISIIFSNYIIRLLGADS--------NTFAYVK---------QYLIFYGMGAPFIIANFTLEQLIRGDGKSVESMIGMMISIGANIILDPILMFGLQLGIRGAAIATVIG---NAFAVIYYIV---CIQRADNQLS---ALPKYFRLEKQMLKEIFLVGLSAMLLDILLIVSSLMF--------NYYALKYGDY-VLAGFGISQ----KLVQIVDLIGMGLYM---GVIPLIAVAYGARNELRMKEIIKK---TALYLALVITCLFAILFTCRNFIVHCFSNDSDVIRIGAYILTVQLCSSFFAAGAGLLT----GIFQSKGEGTPAVVMSVMRGLMLIPAIIF 407
>gi|53715088|ref|YP_101080.1| putative transmembrane cation efflux protein [Bacteroides fragilis YCH46] >gi|60683047|ref|YP_213191.1| putative cation transport related membrane protein [Bacteroides fragilis NCTC 9343] >gi|52217953|dbj|BAD50546.1| putative transmembrane cation efflux protein [Bacteroides fragilis YCH46] >gi|60494481|emb|CAH09278.1| putative cation transport related membrane protein [Bacteroides fragilis NCTC 9343] (450 aa)
Score = 109, Expect = 5.3e-03, Identities = 85/387 (21%), Positives = 166/387 (42%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-EIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFF 500
           +I   IGL    GASV+ S  L+Q  K+K  SI ++     L  S +L +++ ++  Y  E  I +   S+  ++         L++   N Y+ F+       ++L+  +F++R +G   +      ++ + NII + +F       ++G   +  +G  V  L+   ++L +   N G Y    + K +   ++        + L    F+ +ASIA    +   VF   L       G++GV+   AF+ +        + +IF     I    +PI++YN+ +QN  RV       + T +   +     F    +F    V  F + +  + +I V  + +  + + F   +L+I G+  +QS  +     V +L +G +F  
  S:    61 MITTGIGLMFGVGASVVASIHLSQ-GKRKVASINITQ---ALAFSALLILVLSALCCYFAEP-IGRLLGSSERLL--------PLVVEYMNWYVPFLV----FYLLLSAGMFYIRLDGSPNYAMMCNAVSAIINIILDYVFIFQLGWGMMGAAFATSLGTMVGGLMTLIYLLRFS-RNVGIYRIKLSRKSM---RLTCRNIGYMIRLGSSAFISEASIASMMFLGNYVFISHL-------GESGVA---AFSIV-----CYFFPIIFMVYNAIAQSAQPIISYNFGQQNPGRVARTIRLALKTALGCGIFF---FAATLVFNHQIVGLFIDKSYQAYDIAVNGIPYFAVGYLF--FALNIVGIGYYQSIERARRATVITLFRGTLFML 407
>gi|32265666|ref|NP_859698.1| hypothetical protein HH0167 [Helicobacter hepaticus ATCC 51449] >gi|32261714|gb|AAP76764.1| conserved hypothetical membrane protein [Helicobacter hepaticus ATCC 51449] (458 aa)
Score = 109, Expect = 5.4e-03, Identities = 67/316 (21%), Positives = 136/316 (43%)
  Q:   116 FISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFG-TLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFA-------IYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPI 431
            I+  L    GA+ + S  L +    + + ++ S FY     S+++ V++          C+ K  ++            ++L+L    +Y+  I  S  I+++  LL  F+  + R      A +I +  NI+   IF  V ++ + G  ++  +G+ + ++     IL   FV K    + F ++           F+ + + +        SI+  ++ +V++ F  TL A             LA ++   VS   IY+++ +        +     G++P+ +YNY     KRV+ +Y +G+       +L+ AVF  I
  S:    68 LIAFELLFGLGAASIASYFLGKGQDNRARLMFSSVFYFATLSSVIIGVILF--------FCVEKVALALGA---------NELVLPYVVEYLQVIFLSAVIMVLHPLLDIFVINDKRPILAMMAMIIGSASNIVLNYIFLFVLELGMFGSALATAMGHGLGMM-----ILLSHFVRKRGRIY-FVWR-----------FSLNAVFASAKNGVPQSISELSVAFVMIMFNHTLKA-------------LAESEEMKVSYLAIYSIVMYVGVVCFTILLSCAQGVQPVASYNYGAGEMKRVRGIYAFGVGFATALGILVYAVFMSI 344
>gi|157961384|ref|YP_001501418.1| MATE efflux family protein [Shewanella pealeana ATCC 700345] >gi|157846384|gb|ABV86883.1| MATE efflux family protein [Shewanella pealeana ATCC 700345] (516 aa)
Score = 109, Expect = 5.4e-03, Identities = 85/395 (21%), Positives = 164/395 (41%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEAC-IAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLA-FNDIQTVSGTPIYNLI---FFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLS--LSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           GT++    SIG+ ++     L SR++  ++ +K K + ++S    L +S+ +     S+  +I E   +  +T  T+E+               A  Y+  +  S+P+I +   L   LRA G +     + L+    N +F+ IF  +F M I G  ++ ++  F    + A  ++                       +  N+        LG F  D  +   + ++ I     L  ++T  G+A V+  +A F D        +  LI   F  I+ +   + PI+  NY    ++RVK      I    V+ L ++ +   +FL     V+ F   +   +   L L FC+ +  F + S  L ++  S F + GK   + + ++ +  +   P +Y
  S:    56 GTISFFTTSIGIGLSIALGALVSRSIGAKESEKAKRLLLNSLVVTLLMSLFVA---FSVYMFIPELLRLVGATGRTAEL---------------AESYLNILVPSLPLICLAMALGSALRAVGDAKLSMVSTLVGGGVNAVFDPIFIFMFAMGIEGAAVASVMARFAVFAVAARGVV-----------------------VKHNL--------LGRFNFDHFVEDLSPIFAIAGPAMLTNVATPIGNAVVTRAIADFGDSYVAGWAVLGRLIPVSFGMIFALSGAIGPIVGQNYGALQFERVKESLTRAIQFCAVYVLAVSLL---LFLTRHQIVSVF---DMKGDAADLILFFCSFIAVFFIFSGVLFVANAS-FNNLGKAKYSTLFNVGKATLGTIPFVY 401
>gi|117921363|ref|YP_870555.1| multi anti extrusion protein MatE [Shewanella sp. ANA-3] >gi|117613695|gb|ABK49149.1| multi antimicrobial extrusion protein MatE [Shewanella sp. ANA-3] (450 aa)
Score = 109, Expect = 5.4e-03, Identities = 103/461 (22%), Positives = 171/461 (37%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK----VVYYYGIIT-GVVFSLLINAVFWPIFLFGG--PSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  ++G  I  G++ L S  L Q    K + +  ++F  CL       ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +TF  ++  + N   + +F +VF   + G  I+ ++   V  LL                     F    + KIN       + L L   L  A + + + +  +     L   +TA     V   L       VS T  +  + F   GI  G +PI ++N     + RVK    + +   ++T G+   L+ +   W ++LF G  PS+       TP  I  +   F  L    P+  L + G S FQ+
  S:    16 EPIAKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGETGL---------AGM----------------------------MLAY------PVGAILYAVGAMIGMGSAALVSINLGQGHVAKARKLLGNAFSLCLLAGAFFALIGGIFSRDILIALGAEGE-----------------ILENANEYLFWYFALCHFPIISM--AFTTLLRNDGRPSMVTFVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMLSQAVTGLLCLQHF----------------FGARTQLKINLE----QMKLKLDNCLNIARVGLPSFLMNLYLSIVLTLHNTA--FLWVGGPLHVAAYGVVSYTEAFFYLIFE--GIALGTQPIYSFNAGAGRFDRVKQARNIAFGMTLLTAGLCLVLIYSRPEWLVYLFAGDNPSL-------TPVAIEGMRWYFWGL----PMEGLILVGASFFQA 388
>gi|86141048|ref|ZP_01059607.1| C-5 cytosine-specific DNA methylase:Multi antimicrobial extrusion(MatE) protein [Flavobacterium sp. MED217] >gi|85832990|gb|EAQ51439.1| C-5 cytosine-specific DNA methylase:Multi antimicrobial extrusion(MatE) protein [Leeuwenhoekiella blandensis MED217] (420 aa)
Score = 109, Expect = 5.5e-03, Identities = 74/397 (18%), Positives = 155/397 (39%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +V+  V+    ++G+ I  G S + SRAL   D  K    + +     L L++ + +L                 V  +E++ ++  +    I   A  Y   +   +P++ +  +    +RAEG+  F   A +I +L N+I + +   +  M + G   +    Y         ++L+Y   +  +         +  F ++W +      L   T  R A +++  ++   + F          G+A V+       +  + G  +     F + G+  G  PI  YNY  +N+ RV+      ++     ++LI   F  I  F    V+ F      + +         +    P++ + + G + +Q+ GK    ++ +L +   FF P++
  S:    25 NVVLPVSFFIAALGMAIGIGGSSIISRALGANDPNKALKTFGNQITITLLLTVSMVIL---------------GLVFVNELIPAFGGMGD--IFEPAKIYYRIVLYGVPVLALCMMGNNVIRAEGKPKFAMIAMIIPSLGNLILDYLLINILDMGMEGAAWATTASYICCFF----YVLWYFLSDNSELKID-----ISHFGLDWPILREMSALGFVTLARQAVVSLTYLLMNNILF-------ELGGEASVT-------VYAIIGRMLM-FALFPVLGVTQGFLPIAGYNYGAENFTRVRESIKLALLYACGVAILI---FIVIMAFPEAIVSVF--TQDEAVLRDTPWAMRWVFAAIPIIGIQLIGSAYYQAIGKATPALLLTLTRQGFFFIPLV 375
>gi|160881576|ref|YP_001560544.1| MATE efflux family protein [Clostridium phytofermentans ISDg] >gi|160430242|gb|ABX43805.1| MATE efflux family protein [Clostridium phytofermentans ISDg] (445 aa)
Score = 109, Expect = 5.5e-03, Identities = 55/247 (22%), Positives = 114/247 (46%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNA 445
           +L+ +  Y+  I    P+ ++ N+L+ F+R +G       A L  +  NI+ + +F    +M I G  ++  +   ++IL+++ F     F  K  +  +         K N ++   S I+S G  + + + S  +  IV+ I+       I    G+ G++   A+  I  +S      L+  +IY GI  G++P+++ NY     + V+ +  Y +I+     L+++ + +       P + S FN+
  S:   123 VLHMSKTYLQVILLFAPMFLLNNVLLCFVRNDGSPQLSMIAMLGGSFSNIVLDYVFMFPLEMGIFGAVLATGLAPVISILILSPFF----FRKKNCFHLT---------KCNLSMTLISGIVSSGIPSLITEVSSGIVMIVFNII-------ILRLQGNVGIA---AYGIIANLS------LVVVSIYTGIAQGIQPLISSNYGSGKRENVQAILRYAMIS----MLVVSGIVYLTIALRAPQIASIFNS 339
>gi|188590149|ref|YP_001921283.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] >gi|188500430|gb|ACD53566.1| mate efflux family protein [Clostridium botulinum E3 str. Alaska E43] (456 aa)
Score = 109, Expect = 5.6e-03, Identities = 74/408 (18%), Positives = 164/408 (40%)
  Q:    97 ANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           AN ++ +    V   + LI  +    I  G + + +  + ++D    + I  +SF +   L I LT+     +  ++ A  A                     +  AN Y+  ++ G+I + + L +  F +  +G +       +I  + NI+ + I    F M + G  ++ ++   V+    A+++L+          F F  K + + +  + V    ++LS+       S  +      +V     N +S   GD  V A    + I  +        I   + G+  G +PI++YNY  +N  RVK  +   +I+ + +++++    W + +         FN++ P  I + +           +    I+    F + G+  ++++ +L + +I   P+++
  S:    51 ANGDIAMAGVGVAFPIILIISAFSALIGMGGAPIAAIKMGEKDNDGAEKILSNSFSTLTILGIALTIGFFIFKEPLLWAFGASEAT-----------------IGFANDYLGIYLVGTIAVQIALGMNPF-INTQGFAKVGMTTVMIGAVINIVLDPILIFGFDMGVKGAALATILSQTVS----AAWVLY----------FLFGKKSILKIRNKYLVPDAKIVLSIMAL--GVSPFIMQATESLVLISQNNQLSLYGGDLAVGAMTIMSSIMQI--------ILLPLMGLSQGAQPIISYNYGAKNVDRVKKTFKLLLISCLSYTVIM----WLLIMVFPQVFVKLFNSD-PKLIEMTSWSMRIFFAGIIIFGAQIACQQTFLALGQAKISLILALLRKVILLIPLIF 412
>gi|163754816|ref|ZP_02161938.1| Na+-driven multidrug efflux pump [Kordia algicida OT-1] >gi|161325757|gb|EDP97084.1| Na+-driven multidrug efflux pump [Kordia algicida OT-1] (247 aa)
Score = 109, Expect = 5.7e-03, Identities = 43/185 (23%), Positives = 77/185 (41%)
  Q:   101 MIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL 285
           M +   +V+  +  +  SIG+ I  G + + SRAL ++D  K +     +F + + +S+ L V  + +     E  +A                    IL  A  Y   +   IP + +       +RAEG+  F   A ++  + NI F+ +F  V+ M + G   +  I YF+  L +  F  
  S:    50 MAIAAITVVIPLTFLIASIGMAIGVGGASIISRALGKEDHDKAQ----RTFGNQIVMSLGLAVFFVIVGLIFKEEALALFGAKGK-------------ILAPAEIYYVIVMYCIPFLALCMTGNPVVRAEGKPKFAMVALILPAIGNIFFDYLFINVWDMGMAGAAWATSISYFICFLFIYWFFF 217
>gi|42525866|ref|NP_970964.1| MATE efflux family protein [Treponema denticola ATCC 35405] >gi|41815916|gb|AAS10845.1| MATE efflux family protein [Treponema denticola ATCC 35405] (455 aa)
Score = 109, Expect = 5.8e-03, Identities = 70/308 (22%), Positives = 123/308 (39%)
  Q:   197 QLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           Q +L    +Y+  I  SIP  +    +   LR  G         L   L N++ + +   +FK   IG G + LIG  +  +++      +E +       SF  K+++  K         L   +  F R A  + A ++        LN  +   G++ ++A        TVS + +  L +  + G   G +PI A NY  + Y RVK  +   ++ G +F   + A    +FLF    +     +     I     +     F  PLLS         Q+ G  F +++ S+++   F+ P+LY
  S:   133 QDVLTFTVQYLRIIIISIPFSLYALTVYNQLRLCGNVRDGMVGLLSGMLSNMVLDPVLMFIFKQGFIGAGYATLIGQIIGCIVLTLLAKRHESI-------SFNLKKVQYSK---ERMYHILAGGMPNFSRQAITSAALVL--------LNVKAAQYGESMIAA-------LTVS-SRVAALAYMIMIGWGQGFQPICAMNYGAKQYSRVKKAFITTVLIGTIF---LTAASIILFLFAEQCIGVM--SKDDEVIFAGIKILRMQCFSLPLLSFFAVSSMFMQNIGHYFSSLLISISRQGFFYLPLLY 409
>gi|168186868|ref|ZP_02621503.1| Na+ driven multidrug efflux pump [Clostridium botulinum C str. Eklund] >gi|169295255|gb|EDS77388.1| Na+ driven multidrug efflux pump [Clostridium botulinum C str. Eklund] (455 aa)
Score = 109, Expect = 5.8e-03, Identities = 79/390 (20%), Positives = 159/390 (40%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           +  +  S GL +  G S   SR L ++  +K + I ++S     F+ I L     S+  ++    I K+ + +SE +  Y           A +Y+  I        +  ++ + + + G +     +  +  + N+I + I  + F M + G  ++  +     +  V +F  F +   + +  F F F++         +    + +   TF+ +AS  + +IV+        N +S + GD  V        I T+  T I   +F  + GI   ++PI A+NY  +NY+++K+V    I   ++F      V W I +     +   F  +    I  +   F  ++  FP + +    +   Q+ GK   + V S+ +  +   P
  S:    60 IQKLITSTGLMMAVGTSTAVSRNLGKKQYEKIRKIILNSLILTGFVLISL-----SLSIFLFREGIIKNLLGSSETLFPY-----------AYQYISIILFGGTFQCLTLVIGYVIMSLGDTKVTLKSMSLGAMVNVILDAILVVHFSMGVKGAALATTLSQI--LAFVYAFSRFMKVKEEINLEFKFIFEK--------TIVKAIISVGFSTFIVEASDGLLSIVFN-------NLLSVSGGDYAVVI------IGTI--TKISMFLFITVMGISSAMQPIAAFNYGSKNYEKLKLV----IKETIIFITATTLVVWGIMMVFPNELIGIFLKDEDLLIRAVK-AFRIVIIIFPCVGIYYVSIYCCQALGKARASFVLSIYRETLVCIP 403
>gi|116512284|ref|YP_809500.1| hypothetical protein LACR_1575 [Lactococcus lactis subsp. cremoris SK11] >gi|116107938|gb|ABJ73078.1| Na+-driven multidrug efflux pump [Lactococcus lactis subsp. cremoris SK11] (459 aa)
Score = 109, Expect = 5.9e-03, Identities = 71/297 (23%), Positives = 125/297 (42%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNL-LIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK 407
           T+ ++F++IG     G     +R L   DK+K K I   SFY  L + +++ ++ +   + I     A +   T      Y +    ++L                 MILN  L   +RAEG S    +   +    +I+ + +F LV  + +IG G+S++I    N+   A ++ F E  NK +    F    LK FKI+         + +    + A + V  ++        LN  S   GD  +++ G+A           I  L  F   G++ G   + AY++  +N +R+K
  S:    61 TITIVFMAIGNLFGVGGGTFITRLLGSGDKEKGKKIAGYSFYMSLTIGLLIGLVSLFFLSPIAHLLGADAATLT------YTKEYAAVLLGGG------------FSMILNYGLEQLVRAEGASKESMYGMFVGVATSIVLDALFILVLNLHVIGAGLSMVIA---NLASTAYYVWFLE--NKSESLKGF----LKHFKISLKDQFEIYKIGIAEVFKSAFMIVTTLL--------LNHFSVEYGDNVLASFGIALR---------ITQLPEFLTMGLILGAILLFAYSFASKNTQRLK 315
>gi|29347787|ref|NP_811290.1| cation efflux pump [Bacteroides thetaiotaomicron VPI-5482] >gi|29339688|gb|AAO77484.1| cation efflux pump [Bacteroides thetaiotaomicron VPI-5482] (457 aa)
Score = 109, Expect = 6.0e-03, Identities = 64/317 (20%), Positives = 127/317 (40%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           V  ++ ++  S    +  G + L + AL Q D+ +   I  + F   +  +++ +V+  +    I+      ++ +T E    Y  +              ++ G+I  + I   L  F+ A+GR     F+ LI  L NII + IF   F M + G  ++ ++    + + V SF+    F  +   P    +  L        +  + L L +  F+  ++ ++   V        LN+     GD  +SA          +  P        + G   G  PI++YN+   + +RVK  +   ++T   F+L++
  S:    59 VTTSLIILISSFSAIVGGGGAPLAAIALGQGDRVRAGKILGNGFVLLILFTLLTSVIAYTFMEPIL--LFTGASENTLEYAVDYLSI--------------YLLGTI-FVEISTGLNSFINAQGRPAIAMFSVLIGALLNIILDPIFIFWFDMGVKGAALATVLSQACSAVWVVSFL----FSRRASLPLEKRYMGLDR-----KIILSILALGVSPFIMASTESLVGFV--------LNSSLKEFGDIYISALTILQSSMQFASVP--------LTGFAQGFVPIISYNFGHGDKQRVKDCFRIVLVTMFSFNLIL 333
>gi|167770164|ref|ZP_02442217.1| hypothetical protein ANACOL_01507 [Anaerotruncus colihominis DSM 17241] >gi|167667486|gb|EDS11616.1| hypothetical protein ANACOL_01507 [Anaerotruncus colihominis DSM 17241] (468 aa)
Score = 109, Expect = 6.3e-03, Identities = 38/168 (22%), Positives = 68/168 (40%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYF 274
           S++ T+N++ + +   + +G +++ S+ L ++D +               LS+VL    +  +  +++A    +                  ++  A  Y      S P+I I N      RA+G S     AALI N+ NI F   F    KM + G  +  LI  F
  S:    71 SLVDTINILLLQVFAALATGGAIVVSQYLGKEDGENANIAAKQLVIVVTLLSLVLMAACLVWKVPLLDALFGSAEPE---------------VMENARTYFAISAVSYPLIAIYNGCAALFRAQGNSKISMVAALIMNIVNISFNAAFIYGLKMGVAGAALGSLIARF 223
>gi|160941618|ref|ZP_02088948.1| hypothetical protein CLOBOL_06517 [Clostridium bolteae ATCC BAA-613] >gi|158435460|gb|EDP13227.1| hypothetical protein CLOBOL_06517 [Clostridium bolteae ATCC BAA-613] (466 aa)
Score = 109, Expect = 6.4e-03, Identities = 80/323 (24%), Positives = 135/323 (41%)
  Q:   229 AEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF-WPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY---SMWNI-AILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKKEK 551
           +EG +       L    FN++ + +F  V K+ + G  I+  I   V+ L+      +  +V  G   FSF F+         N   ++ I+S    L+     +A  +   +    +N  +   GD+ V AG+        + T + +L    ++G + G +PI  YNY   NY+R+    +  I   VV+S L  AVF   + +F GP V S F  N    I +           F L        SLF + GK     V    +  I F PI+    ++W +  IL +     + +A T + +         +++L+  +GKK K
  S:   168 SEGAARTTMCVLLTGAAFNMVLDPVFIYVLKLGVAGAAIATAISQAVSTLI------YLYYVISGRSMFSFRFR---------NCCFSNEIMS--EILKIGIPTLAFQLLTSLSITMINMQAKPYGDS-VIAGMG-------AVTRMISLGSLMVFGFIKGFQPIAGYNYGAGNYERL----HEAIRISVVWSTLFCAVFGLTMAVFSGP-VISRFTKNDMEMIRIGQKALKANGLSFLLFGFYTVYSSLFLALGKAGEGFVLGACRQGICFVPIILVFPALWGLNGILYAQPAADVLSAMTALFM---------AVHLNRDIGKKGK 456
>gi|187935781|ref|YP_001884575.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] >gi|187723934|gb|ACD25155.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] (447 aa)
Score = 109, Expect = 6.5e-03, Identities = 79/399 (19%), Positives = 163/399 (40%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           T++L++ + G    +G++ ++S    + + +  + ++   F S LF+ ++  +L +     I  A    +T +T E+                 +YM  I    P  ++   +  F R +   +    A +     NI+ +++F   F + + G  I+  I   V+  +  S+ L  +           +  +LK      N F   +   + +F+ + S+ V  I +  V    +       G+ GVSA     +I         NLIFF+I+ G    ++P+++ NY    YKR     +     GV F++++  VF    +F    ++S F  +    I V           + ++ +++   + F S  K    +  SL++ LI    +L+ + N+
  S:    59 TISLMY-ATGFLFATGSATIYSIFKGKNEDENARKMYTFGFISALFMGMLYCILGILFVDKI--AYFLGATNNTIEL---------------TKQYMLTILIFAPFFVLDIFMNVFARNDKAPHISMLATIACCSLNIVLDVLFVFGFNLGMFGAAIATAISTVVSFTITFSYSLSKK-----------SGLKLKRCIPKLNDFLRIVTNGVSSFISEMSVGVVTIAFNKVILSQI-------GEIGVSAYGIIANI---------NLIFFSIFMGNAQAMQPLVSINYGANEYKRT----FNFFKLGVTFAMIVGVVFTSASIFFSYQLSSLFVTDQ-EIIKVTASALKIYGLAYLIMGINLLFDAFFYSVEKPKFAVSISLSRALIIVLSMLFILSNV 408
>gi|169334924|ref|ZP_02862117.1| hypothetical protein ANASTE_01330 [Anaerofustis stercorihominis DSM 17244] >gi|169257662|gb|EDS71628.1| hypothetical protein ANASTE_01330 [Anaerofustis stercorihominis DSM 17244] (457 aa)
Score = 108, Expect = 7.6e-03, Identities = 60/302 (19%), Positives = 128/302 (42%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           A  Y+   +  I  I I   L  F+ A+G +     + LI  + N++ + IF  +  M + G  ++ +   F++ L V  F+         +   SF   + + FKI++ ++   L+L L  F+   + +   I++        +++    GD  V +    N I      PI         G   G +P++++NY   N  RVK  + + I+   ++SLL+    W + +F      + F ++T    +    +   +   F L+ + IS    F +     +++  ++ + ++   P+++
  S:   140 ALSYLRVYSLGIVFIQIAIGLNTFIMAQGFAVTGMISILIGAILNMVLDPIFIFMLDMGVKGAALATVTSQFLSALWVLYFL---------NSKKSFIKIKKEYFKIDFKIYLPCLLLGLSPFVMQVTESAIAIIFN-------SSLLKYGGDIAVGSMTILNIILQFYTMPIQ--------GFTQGAQPVISFNYGAGNADRVKRAFLFQIVICTLYSLLL----WCLTMFLPKVFITLFTSDTALITYTQWSIKIYMAVMF-LIGIQISCQQTFVALSNAKVSLFLAVFRKIVLLIPLIF 412
>gi|166032180|ref|ZP_02235009.1| hypothetical protein DORFOR_01883 [Dorea formicigenerans ATCC 27755] >gi|166027903|gb|EDR46660.1| hypothetical protein DORFOR_01883 [Dorea formicigenerans ATCC 27755] (451 aa)
Score = 108, Expect = 7.8e-03, Identities = 92/395 (23%), Positives = 151/395 (38%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRH-QLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI---LYSMWNI 509
           + + +GL   +GA+   SR L + D++    +  ++ YS + +  V+ +        I+    A  T+    +  SY ++     I N  N  M  I  S                EG +     A L+  + NI  + IF     M + G  I+  I    + L+     L Y    K  + FS     +KEF  +  + T  L + +   TF    S+++A I          N  +   GDA V AG+      T  GT         ++G + G +PI  ++Y  + + R++      I+   +F +++      I LF    ++ F   NT   I V         F F +        SLF + GK     V    +  I F PI   L S W I
  S:    65 VVVGLGLMFGNGAASYLSRLLGRGDREAASKVASTALYSSVCIGAVIIIGTAIFLKPILTMLGATDTIMPYAL--SYGRIYVISCIFNVFNVTMNNIVAS----------------EGAAKTTMCALLLGAVLNIGLDPIFIYTLDMGVAGAAIATAISQMASTLVY----LIYALQKKSAFTFS-----IKEFCPSKQIITEILKIGIPTLTFQLLTSLSIAFI----------NREANIYGDA-VIAGMGAVTRITSMGT-------LVVFGFLKGFQPIAGFSYGAKKFDRLREAIKTSILWSTIFCVVVGLT---IALFSTQIISQFTEGNT-EMISVGQKSLMANGFSFFVFGFYTVYSSLFLALGKGTAGFVLGACRQGICFVPIILLLPSFWGI 416
>gi|167762465|ref|ZP_02434592.1| hypothetical protein BACSTE_00820 [Bacteroides stercoris ATCC 43183] >gi|167699571|gb|EDS16150.1| hypothetical protein BACSTE_00820 [Bacteroides stercoris ATCC 43183] (456 aa)
Score = 108, Expect = 8.0e-03, Identities = 45/199 (22%), Positives = 83/199 (41%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           F+ A+GR      + LI  L NII + IF     M + G  ++ ++    + + V SF+    F  +   P    + +L++     ++  + L L +  F+  ++ ++   V        LN+     GD  VSA          +  P        + G   G  P+ +YNY   + +RVK  +   +IT   F+L++
  S:   160 FINAQGRPAVAMCSVLIGALLNIILDPIFIFWLDMGVKGAALATVLSQACSAVWVLSFL----FSRRASLPLERRYMKLEK-----SIVLSMLALGVSPFIMASTESLVGFV--------LNSSLKEFGDIYVSALTVLQTSMQFASVP--------LTGFAQGFVPVASYNYGHGDKQRVKECFRIALITMFSFNLVL 333
>gi|160942790|ref|ZP_02090031.1| hypothetical protein FAEPRAM212_00267 [Faecalibacterium prausnitzii M21/2] >gi|158445955|gb|EDP22958.1| hypothetical protein FAEPRAM212_00267 [Faecalibacterium prausnitzii M21/2] (461 aa)
Score = 108, Expect = 8.5e-03, Identities = 66/305 (21%), Positives = 121/305 (39%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAIS 530
            L A GR+Y    + L+  + NII + IF   +  + + G     +   +     A   L++      D   SF   +     I   ++T  L           SIA+  +  ++ F   +N I  A     V+    +  +Q+         +F  I+G+ +G+ PI++YNY  +   RVK      I   V ++  I    + IF F    V S F A + + + +       +   F L  +SI   S+FQ+ G    +++ S+ + L    P  + +     + + +   L   F +I +S
  S:   166 LLAATGRTYLSMISQLVGAVVNIILDPIFIFGYCGEALSGTTGAAVATVIGQFCGAGMTLYFNTRKNPDIQISFKGFRPSAKAIG-RIYTVGL----------PSIAMQCVGSLMTF--GMNLILMAFSATAVAVFGVYFKLQS--------FVFMPIFGLNNGMVPIISYNYGARRPNRVKKT----IKLAVCYAEGIMLAGFCIFQFAPRQVLSIF-AASDAMLAIGIPAMRIICLHFLLAGVSIVLSSVFQALGNGVFSLIVSVCRQLFVLLPAAWLLAQSGSVNNVWWAFLIAEFVSILMS 444
>gi|196125269|ref|ZP_03117018.1| putative efflux pump [Clostridium difficile ATCC 43255] (440 aa)
Score = 108, Expect = 8.6e-03, Identities = 85/390 (21%), Positives = 161/390 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEI--HVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           I ++IG    +G S LFSR L  ++  + K    ++ +      ++  ++ +    YI+    A S        N++  V+         +Y+ F     P I+    L   +R +G+S       +I+   NII + I     ++ I G  I+ +IG   N   V  +I+    + + D   S      K F++   +     ++ L   L D  + V+++++        N  +   GD  V AG   +         I +LI   +Y    G+ P++A  Y  +N  RVK +      T +  +L+I  +F  +F      V  F N +    I  ++LT+  C+  F      L+     +FQ+ G+    +V S+ +G++    I++
  S:    65 ILMAIGNLFGTGGSTLFSRLLGSENTDRTKQCSATTLWLSFLFGLLTAIISIIFSNYIIRLLGADS--------NTFAYVK---------QYLIFYGMGAPFIIANFTLEQLIRGDGKSVESMIGMMISIGANIILDPILMFGLQLGIRGAAIATVIG---NAFAVIYYIV---CIQRADNQLS---ALPKYFRLEKQMLKEIFLVGLSAMLLDILLIVSSLMF--------NYYALKYGDY-VLAGFGISQ----KLVQIVDLIGMGLYM---GVIPLIATAYGARNELRVKEIIKK---TALYLALVITCLFTILFTCRNFIVHCFSNDSDVIRIGAYILTVQLCSSFFAAGAGLLT----GIFQAKGEGTPAVVMSVMRGIMLIPAIIF 407
>gi|160946363|ref|ZP_02093572.1| hypothetical protein PEPMIC_00323 [Peptostreptococcus micros ATCC 33270] >gi|158447479|gb|EDP24474.1| hypothetical protein PEPMIC_00323 [Peptostreptococcus micros ATCC 33270] (444 aa)
Score = 108, Expect = 8.7e-03, Identities = 83/400 (20%), Positives = 164/400 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           SV+  +  + I+I + +  G S L SR L ++  +       ++  + L L I+  V I+SI  ++ + C+             +   R+ +++ +       + GSI  +    +  +   A G    +  A+ I  L NI+ + I      M + G  I+ +   F+      SF+    FV K     +F+     + KI++N+        +  F     I+V N + + V             DA +  G+          T +   +F A+ G+   ++P+++YNY  +N+ ++K +    + TG VF   ++ + W    +    +   F  +    + + T  F  ++  FP+LS     +  FQS GK   N   S+ +  + + PI+  M
  S:    54 SVVFPLQRLVIAISVCLGIGVSNLISRRLGEKRNKDITK--YTTAVNGLTLLIIFVVTIISI-LFVEDICM-------------FLGARNDILIYSIKYLRIVMCGSI-FLAFTTVFGYMNIAYGNMKVMLIASSIGALINIVVDYILIKNLNMAVEGAAIATISSQFI------SFLFSLVFVKKLQKENNFSLIPRLDSKISFNILAIGFSSFIIEFSDAILISVLNHLLLPV----------GGNDAIILVGVI---------TKVSMFMFVAMIGVSSSIQPLISYNYGAKNFVKIKKI----LKTGFVFVFSLSTLIWIFMNYKVKFIIGLFLKDE-RLLQMATDSFKYVILVFPILSFYYICIYFFQSVGKEKYNFFLSIYRETLLYIPIVIIM 406
>gi|89896512|ref|YP_519999.1| hypothetical protein DSY3766 [Desulfitobacterium hafniense Y51] >gi|89335960|dbj|BAE85555.1| hypothetical protein [Desulfitobacterium hafniense Y51] (467 aa)
Score = 108, Expect = 8.7e-03, Identities = 85/397 (21%), Positives = 165/397 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFL-FGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           SV   ++ I ++ G  I  GA  + S AL  +D++  + +      +   LS+++T + M +        IA        ++      R  + +  A  ++Y + G++            +RAEG+              ++IF+ +F +VF+  + G   +  IG  V  L+  S++ F    +KG   F      L+     W+    + +L LG     AS  + +++ ++      NA+S      G +  +AF  +       I+  +   I+G++  L+P++  NY  + Y RV   Y    +T +V +L     FW + +   GP +         S   +  L F   +   P+LS     ++LF S  K     +  +A+ L+F+ P++
  S:    63 SVAYPLSQISVAFGSLIGVGAGSVLSIALGAKDRKTQEHL----LGNVNLLSLIVTAVYMLLGLAFSTQLIAMMGGRGEALILGDQYFR--ITIYGAFFWVYGLAGNM-----------IIRAEGKMKTAAVMMGFGLAVDVIFKYLFIVVFQWGVEGAAWATNIGMLVYTLV--SWLYF----SKGWATFHSKLASLR-----WDQKIGTSVLRLG-----ASSLIMSVMSLVQAIFVFNALSKY----GTTWDVAFYGVVY----RIFTFLLTPIFGLMRALQPVIGINYGARQYDRVISSYKIFAVTALVLTL----PFWLLSIAIPGPILGLMMKDAAFSGADL--LYFRVYMAILPVLSFIFMAMTLFPSVDKGKPAAMIGIARQLVFYVPVM 413
>gi|167757141|ref|ZP_02429268.1| hypothetical protein CLORAM_02690 [Clostridium ramosum DSM 1402] >gi|167703316|gb|EDS17895.1| hypothetical protein CLORAM_02690 [Clostridium ramosum DSM 1402] (456 aa)
Score = 107, Expect = 1.1e-02, Identities = 41/175 (23%), Positives = 81/175 (46%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFI 284
           G +  + +   L + +G S++ +R+   +D+   K     S    + + I+LT+++M    + +   +        E++N+        I+N A  Y++ IT  + ++   NL    LRA G S       LI+++ N+  +L+F   F M I G  I+ +I   V+ +L   +I
  S:    58 GAIYELLVGFALGVGNGLSIVTARSFGAKDENLLKK----SVAGSIVIGILLTIILMLFSQFCLYPLL--------ELLNTPAN-----IINEAYDYIFMITIFVGVMFAYNLCAGLLRAIGNSVMPLVFLLISSVLNVGLDLLFITQFNMGIQGAAIATVIAQGVSAILCFYYI 215
>gi|167758925|ref|ZP_02431052.1| hypothetical protein CLOSCI_01271 [Clostridium scindens ATCC 35704] >gi|167663332|gb|EDS07462.1| hypothetical protein CLOSCI_01271 [Clostridium scindens ATCC 35704] (473 aa)
Score = 106, Expect = 1.2e-02, Identities = 70/312 (22%), Positives = 125/312 (40%)
  Q:    96 QANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNA-ISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK 407
           Q   +M +    V   + ++  +   F   G + L S  L + D  + + I  +S    +  S+VLT+     +T ++ A  A  T  T +   SY  +              ++ G+I +   + L  F +  +G +     + LI  + NI  + +F  VF M + G  ++ +I   V+   V  F+   + V +          + K  ++  +V      L +  F+  ++ ++ NI        TLN+ +    GD  V              T I  LI   I GI  G++PI++YNY   N  RVK
  S:    48 QGYGDMALTGVGVTFPIIMLIAAFSAFAGMGGAPLASIQLGKHDYDRAELILGNSAGLLVIFSVVLTIGFSIFKTPVLYAFGASET--TIQYAESYIGI--------------YLLGTIFVQFAVGLNTF-ISGQGEARIAMLSVLIGAIINICLDPVFIFVFGMGVKGAALATIISQAVSAAWVIKFLTSKKSVIR---------LKAKNMRLKGDVVKHIGGLGISPFIMQSTESLVNI--------TLNSGLQKYGGDLYVGTMSIM--------TSIMQLIVIPIQGITQGVQPIISYNYGAGNKSRVK 318
>gi|153954859|ref|YP_001395624.1| efflux pump [Clostridium kluyveri DSM 555] >gi|146347717|gb|EDK34253.1| Predicted efflux pump [Clostridium kluyveri DSM 555] (236 aa)
Score = 106, Expect = 1.3e-02, Identities = 61/238 (25%), Positives = 102/238 (42%)
  Q:   246 FNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           F I+   I      M I G  I+ ++   V+ +    F LF            F+ K + E+ +N ++    ++    TF+ + S AV          G LN +  + G  G SA +    ++ VS       I+ AI GI  G++PI+ YN+  + Y+RVK V    I   +V S+    VFW IFLF    +   F     + ++    +F   +   PLL +    +  +Q+ G+
  S:    10 FLILISYILIANMAMGIEGSAIAAVVAQIVSCM----FALFKFIDISKALHIQFSNKSVLEY-LNIDILNQIIVCGFSTFIVEISDAVVA--------GVLNNVIYSTG--GDSAIIIVGVVEKVS-----MFIYSAIIGISSGMQPIVGYNFGAEKYERVKEVLKSSIKIVIVLSI----VFWAIFLFFSYEIIGLFFLKDKALLYQTVSVFRISISMIPLLGIYYVTMYYYQAIGE 223
>gi|159896992|ref|YP_001543239.1| MATE efflux family protein [Herpetosiphon aurantiacus ATCC 23779] >gi|159890031|gb|ABX03111.1| MATE efflux family protein [Herpetosiphon aurantiacus ATCC 23779] (451 aa)
Score = 106, Expect = 1.3e-02, Identities = 45/201 (22%), Positives = 92/201 (45%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           +RA+G + F T   +I     I F  +  +VF + + G  I+ ++G   +       I F+ F  +  Y    ++     FK +W +    L++   + +++ S ++  IV       T N + T  G + +S       +  + G+ +Y+ +     GI+ G++PI+ YN  ++N +RV       +   V + LLI+++
  S:   156 IRADGNTGFSTAIWIIPVSLTIGFWWLLVIVFPLGMTGAAIATVLGQAAS---AGMSIYFFFFRKQRSYNIRLSY-----FKPDWAIMREILLIGSPSLIKNLSASIMAIV-------TNNLLRTLGGTSALS-------VFAIVGS-LYSGLMTPQTGIIQGMQPIVGYNLGQRNLQRVWQTIKLSLRAAVGYGLLISSI 333
>gi|157374961|ref|YP_001473561.1| MATE efflux family protein [Shewanella sediminis HAW-EB3] >gi|157317335|gb|ABV36433.1| MATE efflux family protein [Shewanella sediminis HAW-EB3] (505 aa)
Score = 106, Expect = 1.3e-02, Identities = 65/298 (21%), Positives = 119/298 (39%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLA-FNDIQTVSGTPIYNLI---FFAIYGIVDGLRPILAYNYQKQNYKRVK 407
           GT++    SIG+ ++     L SRA+  +     K + ++S    L +S+ ++    ++ TY +            EV+       H   L A+  Y+Y +  S+PII +   L   LRA G +     + L     N++F+ IF     M I G  ++ ++     +++ A  ++                K+ K F               G F  D+  A    ++ I     L  ++T  G+A V+  +A F D        +  LI   F  I+ +   + PI+  N+    + RV+
  S:    56 GTISFFTTSIGIGLSIALGALVSRAIGAKQLDMAKRLLLNSAVVTLLMSLCVS----AVMTYFI-----------PEVLTLVGATGHTAELAAS--YLYILVPSLPIICLAMALGAALRAVGDAKLSMMSTLAGGGVNLVFDPIFIFALGMGIEGAAVASVLARTAVLVIAARGVI----------------KKHKLF---------------GEFELDSFKADLRPIFAIAGPAMLTNVATPIGNAVVTRAIADFGDGYVAGWAVLGRLIPVSFGMIFALSGAIGPIVGQNFGAHEFSRVR 309
>gi|90962433|ref|YP_536349.1| Na+ driven multidrug efflux pump [Lactobacillus salivarius UCC118] >gi|90821627|gb|ABE00266.1| Na+ driven multidrug efflux pump [Lactobacillus salivarius UCC118] (445 aa)
Score = 106, Expect = 1.4e-02, Identities = 78/342 (22%), Positives = 145/342 (42%)
  Q:   196 HQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLG--TFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSE-----IHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEIT 537
           +Q  +N A  Y   ++   P+ M   + I F+R +G       AAL    F I  + +      + + G  ++ +     ++ +++S                FA +QLK FK   ++ T      LG  +FL + S  V+  V+ +V              +G  A  A+  I  +       ++F AI+ G+  G++PI +  Y K  Y+ VK+    G++  V FS+ I + F  + +F  P +   FNA   ++     +  + + F ++ F    L L +   ++  + G  FL+I+    +G +   P   S+   A       V     FT   ++S+ I +T
  S:   121 NQQTINMATTYFRIVSCGAPLFMANYVTINFVRNDGNPSLTMRAALTQTAFVIFMDWLLIFGLNLKMEGAALATIFSPVTSLTVLSSH-------------RHFAQRQLKLFKTKVHLKTVLKAARLGIPSFLNEMSTGVSIFVFNLVLLKL----------SGNYAIAAYGVIANIG------IVFLAIFNGVALGVQPIASREYGKHLYQNVKIALKIGLV--VTFSIAIISYFL-LLIFKAP-IVDIFNAEHEAQLVAYAVKGIPIYFISIFFSCLNLVLMLFLAAINDARGAFFLSIL----RGYVILLP---SIIIFAYFGGIAGVWASVPFTEFIVASLGIYLT 430
>gi|24373080|ref|NP_717123.1| MATE efflux family protein [Shewanella oneidensis MR-1] >gi|24347260|gb|AAN54567.1|AE015596_7 MATE efflux family protein [Shewanella oneidensis MR-1] (448 aa)
Score = 106, Expect = 1.4e-02, Identities = 101/461 (21%), Positives = 176/461 (38%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK----VVYYYGIITGVVFSLLI-NAVFWPIFLFGG--PSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  +IG  I  G++ L S  L Q +  K + +  ++F  CL       ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +TF  ++  + N   + +F +VF   + G  I+ ++   V  LL     L + F  +     +     L++ K+  +       + L +FL +  +++   ++   F               V   L       VS T  +  + F   GI  G +PI ++N     + RVK    + +   ++T  +  +LI +   W ++LF G  PS+       TP  I  +   F  L    P+  L + G S FQ+
  S:    16 EPIAKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGETGL---------AGM----------------------------MLAY------PVGAILYAIGAMIGMGSAALVSINLGQGNVAKARKLLGNAFSLCLLAGAFFALVGGVFSRDILIALGAEGE-----------------ILENANEYLFWYFALCHFPIISM--AFTTLLRNDGRPSMVTFVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMLSQAVTGLLC----LQHFFGARTQLKIN-----LEQMKLKLDNCINIARVGLPSFLMNLYLSIVLTLHNTAFL-------------WVGGPLHVAAYGVVSYTEAFFYLIFE--GIALGTQPIYSFNAGAGRFDRVKQARNIAFSMTLLTAALGLVLIYSRPEWLVYLFAGDNPSL-------TPVAIEGMRWYFWGL----PMEGLILVGASFFQA 388
>gi|113971082|ref|YP_734875.1| multi anti extrusion protein MatE [Shewanella sp. MR-4] >gi|113885766|gb|ABI39818.1| multi antimicrobial extrusion protein MatE [Shewanella sp. MR-4] (450 aa)
Score = 106, Expect = 1.4e-02, Identities = 103/461 (22%), Positives = 172/461 (37%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK----VVYYYGIITGVVFSLLI-NAVFWPIFLFGG--PSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  ++G  I  G++ L S  L Q +  K + +  ++F  CL       ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +TF  ++  + N   + +F +VF   + G  I+ ++   V  LL                     F    + KIN       + L L   L  A + + + +  +     L   +TA     V   L       VS T  +  + F   GI  G +PI ++N     + RVK    + +   ++T  +  +LI +   W ++LF G  PS+       TP  I  +   F  L    P+  L + G S FQ+
  S:    16 EPISKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGETGL---------AGM----------------------------MLAY------PVGAILYAVGAMIGMGSAALVSINLGQGNVTKARKLLGNAFSLCLLAGAFFALVGGIFSRDILIALGAEGE-----------------ILENANEYLFWYFALCHFPIISM--AFTTLLRNDGRPSMVTFVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMLSQAVTGLLCLQHF----------------FGARTQLKINLE----QMKLKLDNCLNIARVGLPSFLMNLYLSIVLTLHNTA--FLWVGGPLHVAAYGVVSYTEAFFYLIFE--GIALGTQPIYSFNAGAGRFDRVKQARNIAFGMTLLTAALGLVLIYSRPEWLVYLFAGDNPSL-------TPVAIEGMRWYFWGL----PMEGLILVGASFFQA 388
>gi|26248308|ref|NP_754348.1| hypothetical protein c2456 [Escherichia coli CFT073] >gi|91211224|ref|YP_541210.1| hypothetical protein UTI89_C2211 [Escherichia coli UTI89] >gi|110642138|ref|YP_669868.1| drug/sodium antiporter [Escherichia coli 536] >gi|157145139|ref|YP_001452458.1| hypothetical protein CKO_00872 [Citrobacter koseri ATCC BAA-895] >gi|191170104|ref|ZP_03031658.1| mate efflux family protein [Escherichia coli F11] >gi|26108712|gb|AAN80915.1|AE016762_168 Hypothetical protein c2456 [Escherichia coli CFT073] >gi|91072798|gb|ABE07679.1| hypothetical protein UTI89_C2211 [Escherichia coli UTI89] >gi|110343730|gb|ABG69967.1| hypothetical drug/sodium antiporter [Escherichia coli 536] >gi|112292707|emb|CAJ76287.1| putative drug/sodium antiporter [Escherichia coli] >gi|157082344|gb|ABV12022.1| hypothetical protein CKO_00872 [Citrobacter koseri ATCC BAA-895] >gi|190909620|gb|EDV69205.1| mate efflux family protein [Escherichia coli F11] (479 aa)
Score = 106, Expect = 1.4e-02, Identities = 89/402 (22%), Positives = 167/402 (41%)
  Q:   103 VYQTSVIGTVNLIF-ISIGLF-----INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTP-SEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           V  + +I  V L+F + +GLF     I  G   L SRA+  Q   + + I        LF +IV+TVL      Y+    + +S  +T              I+  A ++ Y+   ++  IM++ +++   +  G+   I  A+L+  L NI+ + I   VF   + G  ++    +   + +VA FI     ++ G      A +       +W ++   L + +   L    IAV  ++Y   F   L+          V+A  AF    T++G   Y  I   +  I   L  ++  N+   N  R    Y+  +   + FS+++      I L   P +   F      S+  VL      L    P +++S+     +Q+ GK + +++ +L + +    P++Y
  S:    62 VTNSGIIAGVGLVFPVGMGLFAIANGIQIGMGSLLSRAIGMQRLDRAQRILSVGIIIALFFAIVITVL-----GYVYAQPLLRSLGATKS------------IIGYATEFYYYSLLTVFSIMLIGVMMGLFQGAGKIMVIMKASLLGALVNIMLDPIMIFVFDFGVKGVALA---SFLAQLSMVAYFIYTLMGLHIG-LSIRIALRPF-----SWKIYREFLSVGMAQMLMQLIIAVGIVIYNF-FIVRLD----------VNAMAAF----TLTGRIDY-FIITPMLAIATALLTVVGQNWGHGNVTRTLNAYWAAV--ALAFSIVLVLAVMHIVL--APWMYPLFTRVVAVSDYAVLQTRIMAL--ALPFVAISLLASEYYQAIGKPWYSVLLTLMRHVFISVPVVY 422
>gi|114048316|ref|YP_738866.1| multi anti extrusion protein MatE [Shewanella sp. MR-7] >gi|113889758|gb|ABI43809.1| multi antimicrobial extrusion protein MatE [Shewanella sp. MR-7] (450 aa)
Score = 106, Expect = 1.5e-02, Identities = 103/461 (22%), Positives = 172/461 (37%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK----VVYYYGIITGVVFSLLI-NAVFWPIFLFGG--PSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQS 480
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  ++G  I  G++ L S  L Q +  K + +  ++F  CL       ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +TF  ++  + N   + +F +VF   + G  I+ ++   V  LL                     F    + KIN       + L L   L  A + + + +  +     L   +TA     V   L       VS T  +  + F   GI  G +PI ++N     + RVK    + +   ++T  +  +LI +   W ++LF G  PS+       TP  I  +   F  L    P+  L + G S FQ+
  S:    16 EPISKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGETGL---------AGM----------------------------MLAY------PVGAILYAVGAMIGMGSAALVSINLGQGNVAKARKLLGNAFSLCLLAGAFFALVGGIFSRDILIALGAEGE-----------------ILENANEYLFWYFALCHFPIISM--AFTTLLRNDGRPSMVTFVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMLSQAVTGLLCLQHF----------------FGARTQLKINLE----QMKLKLDNCLNIARVGLPSFLMNLYLSIVLTLHNTA--FLWVGGPLHVAAYGVVSYTEAFFYLIFE--GIALGTQPIYSFNAGAGRFDRVKQARNIAFGMTLLTAALGLVLIYSRPEWLVYLFAGDNPSL-------TPVAIEGMRWYFWGL----PMEGLILVGASFFQA 388
>gi|158319983|ref|YP_001512490.1| MATE efflux family protein [Alkaliphilus oremlandii OhILAs] >gi|158140182|gb|ABW18494.1| MATE efflux family protein [Alkaliphilus oremlandii OhILAs] (448 aa)
Score = 105, Expect = 1.5e-02, Identities = 45/178 (25%), Positives = 81/178 (45%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQ-QDKQKCKS----IWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLV 280
           V   S++ +++++ I+I   + +G +V+  + + Q +D + CKS    I  +SF S + + I+          Y+    I             + Q+  + +   AN YM  +  SIP I + N      R+ G S    F + I N  NI+   IF   FKM++ G  I  L+   V  +++
  S:    49 VSAVSLVDSISILLINIFAALATGGAVVAGQYIGQGRDDEACKSGKQLIMFASFISLMIMGIM----------YLGRGFILNVV---------FGQIDPK-VAAYANTYMLIVFASIPFIAVYNSGAALFRSMGNSKVTMFTSFIMNAINIVGNAIFVYGFKMEVEGVAIPTLVSRIVAAIII 211
>gi|169200473|ref|ZP_02859754.1| multi antimicrobial extrusion protein MatE [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169085345|gb|EDS66065.1| multi antimicrobial extrusion protein MatE [Rhizobium leguminosarum bv. trifolii WSM2304] (454 aa)
Score = 105, Expect = 1.6e-02, Identities = 34/170 (20%), Positives = 74/170 (43%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASF 283
           ++ I++   +++G + + +R L   D++    ++  +    L +++VL +L  ++   I++A    + V+                   A  +M  +    P+   L+L +  LR EG+  F+T   L A+L NI    +F  V    ++G     +   FV +  V ++
  S:    64 MLLIALQSLVSNGMASILARRLGAGDRRGAGRVFAGAHMLALAVTLVLNILYWTLGRQIIDAGAGTAAVA-----------------EGARLFMGAMIAFAPVSFFLSLHLDGLRCEGKIGFMTLVTLTASLLNIFANWLFMAVMHWGVLGSAAGSIAAQFVCLAAVLAY 216
>gi|150009623|ref|YP_001304366.1| cation efflux pump [Parabacteroides distasonis ATCC 8503] >gi|149938047|gb|ABR44744.1| cation efflux pump [Parabacteroides distasonis ATCC 8503] (458 aa)
Score = 105, Expect = 1.6e-02, Identities = 65/317 (20%), Positives = 124/317 (39%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           V  ++ ++  S    + +G S L + AL Q D+++   I  + F     + ++L  +  S+ TY     I   T ++            +  L  A  Y+         + I   L  F+ A+GR      + LI  L NI+ + IF     M I G  ++ ++    + + V SF+    F  +   P      + +  +++  +  +   L +  F+  ++ ++   V        LN+     GD  VSA          +  P        + G   G  PI++YNY   + +RVK  +   +I    F+L++
  S:    59 VTTSIVILISSFSAIVGAGGSPLAAIALGQGDRERAGKIVGNGF-----ILLILFTIFTSLITYTFMEPILLFTGAS------------KYTLGYAVDYLSIYLLGTLFVEISTGLNAFINAQGRPSIAMCSVLIGALLNIVLDPIFIFWLDMGIKGAALATILSQACSAIWVLSFL----FSRRASLPL-----ERRYMRLDRRIVLSMFALGISPFIMASTESLVGFV--------LNSSLKNFGDIYVSALAILQSAMQFASVP--------LTGFAQGFVPIISYNYGHGDKQRVKDCFRIVLIVMFSFNLIL 333
>gi|167770930|ref|ZP_02442983.1| hypothetical protein ANACOL_02283 [Anaerotruncus colihominis DSM 17241] >gi|167666970|gb|EDS11100.1| hypothetical protein ANACOL_02283 [Anaerotruncus colihominis DSM 17241] (452 aa)
Score = 105, Expect = 1.6e-02, Identities = 53/231 (22%), Positives = 102/231 (44%)
  Q:   200 LNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI--NAVFWP 430
           L  A+ Y+  ++ G+I + + L L  F + A+G +        +    NII + I      M + G  ++ +I   V+    A+++L++    +          +++  +I+  V  + L L L  F+  ++ ++  I +         ++ +  GD  VSA +  + +      P+         G   G +PI+ +NY   NY RVK    Y  +  + FSLL+   AVF+P
  S:   130 LPYADSYLSVYLIGTISVQLALGLNQF-ISAQGFAKTAMATVCVGAALNIILDPILIFACDMGVRGAALATVISQTVS----AAWVLWFVCSTRSTLRL-----RVQYLRISPRVMASVLALGLSPFIMQSTESLVQIAFN-------TSMQSYGGDLYVSAIVIMSSVMQFFTMPVM--------GFAQGAQPIIGFNYGAGNYDRVKSAAKYCAVFCLAFSLLLWGVAVFFP 338
>gi|163799674|ref|ZP_02193581.1| MATE efflux family protein [Methanococcus voltae A3] >gi|158973681|gb|EDP41149.1| MATE efflux family protein [Methanococcus voltae A3] (460 aa)
Score = 105, Expect = 1.7e-02, Identities = 60/228 (26%), Positives = 97/228 (42%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDY-PFSFAFKQLK-EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIV 341
            I ++I   +  GAS   SR + Q++K+K  +I   S    L L IV+ V+I  ++T  +     +     S +   Y  +               I GSI I+   N+    LR EG +    +A +  ++ NII + IF  V    I G  ++ +I   +  LL A +I    F++K +Y    F+ + LK  F I   +F      SL       S+   N +  IV
  S:    61 FILMAISNGVGIGASSAISRRIGQKNKEKASTIAEQSVLLSLLLGIVVIVVIPFLKTIFLGLGFEEDV---SNLAYDYGSI--------------MILGSI-ILFFTNMGSSILRGEGNTKKPMYAIIAGSIVNIILDPIFIYVLGWGIKGAALATVISMLITGLLFAYWI----FISKSNYVNMKFSKENLKPNFAIYNEIFKVGFPASLSQISMSLSMFAMNYIIAIV 268
>gi|88603278|ref|YP_503456.1| MATE efflux family protein [Methanospirillum hungatei JF-1] >gi|88188740|gb|ABD41737.1| MATE efflux family protein [Methanospirillum hungatei JF-1] (455 aa)
Score = 105, Expect = 1.9e-02, Identities = 77/376 (20%), Positives = 157/376 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYN---YQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHV---LTLLFCTLLFQFPLLSLSISGLSLFQSTGK----MFLNIV 489
           +I I +   + +GA+ + SR +   D+    +  + +    + +SIV+++++++    ++    A +TV                  + A +Y   +     +I+  N+    LR EG +    +    A++ NI+ + IF       I G       G  V+++L+AS  +++  + K  Y        L E +   +V    L  S   FL        NI+ V+V      A+ TA                       + +I FAI  +V     ++A     +  +++++  V++ + ++ G+V + +I  + W   LF      SF  + +    H+   +     T+   +P +S  I   S+FQ TG+    +FLN++
  S:    65 MILIGLANGLGAGATSVISRRIGAGDRNGAHTTAIQAVLLSIVISIVISLVLITFSRPLMVLFGAGNTV------------------DLAVEYGNIVFAGTILILFTNVGYGILRGEGDTKRTMYVMGAASIINIVLDPIFIYYLNWGIAGAA----WGMIVSLVLIASVQIYWFCIKKDTYITFSKDMNLHETRHIKDVLAIGLPASCEFFLMAILSVFINILLVMVANTDAVAVYTAG----------------------WRVIMFAIIPLVAISTSVVAVTGAAFGGRHFEKFPVIHNFSVLLGIVIATIIAILTW---LFA--DQISFIFSYSAEGAHLAPSIAAFLATMCIFYPFVSPGIMSSSVFQGTGRGLSSLFLNVL 401
>gi|169349778|ref|ZP_02866716.1| hypothetical protein CLOSPI_00516 [Clostridium spiroforme DSM 1552] >gi|169293346|gb|EDS75479.1| hypothetical protein CLOSPI_00516 [Clostridium spiroforme DSM 1552] (452 aa)
Score = 104, Expect = 2.0e-02, Identities = 45/202 (22%), Positives = 83/202 (41%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           F+ A+G +    F   I  + NII + IF   F M + G  ++ +I   ++ + V  F++      K          +LK  K +  V    L L L  F+   + +V ++ +         ++    GD  V +      +   S  P        + G+  G +PI++YN+   N  RVK  +   +   + +S+L+ AV
  S:   160 FINAQGYAKMGMFTVAIGAICNIILDPIFIFQFSMGVKGAALATIISQGISSVWVVYFLISKRSTLK---------IKLKNLKPDRKVIVPCLALGLSPFIMQFTESVISVCFN-------TSLLKYGGDIAVGSMTILTSVMQFSMLP--------LQGLTQGSQPIVSYNFGANNIDRVKKTFRLLLKCALTYSMLLWAV 337
>gi|163815113|ref|ZP_02206494.1| hypothetical protein COPEUT_01269 [Coprococcus eutactus ATCC 27759] >gi|158449522|gb|EDP26517.1| hypothetical protein COPEUT_01269 [Coprococcus eutactus ATCC 27759] (495 aa)
Score = 104, Expect = 2.0e-02, Identities = 31/130 (23%), Positives = 61/130 (46%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           + ++ F  ++G+ +G+ PI++YNY  Q   R+K     G++ G    L    +      F G  +  F   +    + +  +   +  F F   S++ SG  +FQ+ GK   +++ S+A+ L    P+ Y
  S:   323 VQSMAFMPVFGLNNGMIPIISYNYGAQRPDRMKRTMKLGVMVGCSIMLFCLVIMQA---FPGQILKIFDATDDMLSMGIPAVRIMSTAFIFAGFSVTCSG--MFQAVGKGVYSMIVSMARQLFVILPVAY 447
>gi|167747500|ref|ZP_02419627.1| hypothetical protein ANACAC_02221 [Anaerostipes caccae DSM 14662] >gi|167652862|gb|EDR96991.1| hypothetical protein ANACAC_02221 [Anaerostipes caccae DSM 14662] (494 aa)
Score = 104, Expect = 2.0e-02, Identities = 84/422 (19%), Positives = 168/422 (39%)
  Q:   106 TSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIF-FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI---LYSMWNI-AILVSDYKVMLFTAFTNI 527
           TS +G +++ F      + +GL   +GA+   SR L + +K+    +  ++ YS +F+  ++ +  +   T I+    A  ++               L   A    +Y I+    I  I N+ +   + +EG +     A L   + NI+ + IF  V  + + G  I+  I   ++  +   ++              F  K +  FK+    F+  ++  +        I +  +V+ ++   ++  I+      G S   A   +     T + ++    ++G + G +PI+ ++Y  + Y R+    +  I T +++S +   +F         S+ S F A     I           F F L        SLF + GK     +    +  I F P+   L ++W I  IL +     + +AF  I
  S:    76 TSQMGAISVAFPLGQIVVGLGLLFGNGAASYISRLLGRGEKETANKVASTALYSSIFVGAIIIIFSIIFLTPILNMLGATKSI---------------LPYAATYTSIYIISS---IFNIFNVTMNNIVTSEGAAKTTMCALLTGAVLNIVLDPIFIYVLNLGVAGAAIATAISQMISTAVYLCYV--------------FRKKSVFNFKLKDCCFSKKIMSEI------MKIGIPTLVFQLLTSLSIALINKQTKVYGDSVIAAMGVV-----TRVISMGSLMVFGFIKGFQPIIGFSYGAKKYDRL----HEAIKTSILWSTIFCFIFGAAAALFSSSIISGFTAGDIEMIQAGQTALRANGFSFLLFGFYTVYSSLFLALGKAKEGFILGACRQGICFVPVILLLPAVWGINGILYAQPIADVISAFVTI 461
>gi|118444125|ref|YP_878386.1| MATE efflux family protein, putative [Clostridium novyi NT] >gi|118134581|gb|ABK61625.1| MATE efflux family protein, putative [Clostridium novyi NT] (446 aa)
Score = 104, Expect = 2.2e-02, Identities = 96/490 (19%), Positives = 189/490 (38%)
  Q:    12 LNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKG-DYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           ++ +++  + I KL +K  +P++   L+  +Y  VD I +   I   GI  L  AL                                            +  +  S GL +  G S   SR L  +  +  + I ++S      + I L VLI     ++ +  I K+ + +SE +  Y           A +Y+  I        +  ++ + + A G +     A  I    N+I + I  + F M + G  ++     F  IL  +  +  +  V K  +  F F F++         +  T + +   TF+ +AS  + +IV+        N +S + GD  V        I T++   ++  +F  + GI   ++PI A+NY  +NY+++K+V    I   ++F      V W + +    ++   F  +    +  +   F  ++  FP + +    +   Q+ GK   + + S+ +  +   P
  S:     3 IDSTVFSDQKIGKLLIKFAIPTMLSLLVMELYNMVDTIFVGSTIGAVGIGALTIAL-------------------------------------------PIQKLITSTGLMMAVGTSTAVSRNLGGKKYENLRKIILNSLILTSLILISLCVLI-----FLFKDGIIKNLLGSSETLFPY-----------AYQYISIILFGGTFQCLTLVIGYVIMALGDTKVTLKAMSIGATVNVILDAILVVRFSMGVKGAALAT---SFSQILAFSYAVFRFLKVKKEINLEFKFIFER--------KIVKTIISVGFSTFIVEASDGLLSIVFN-------NLLSASGGDDAVVI------IGTITKVSMF--LFITVLGISSAMQPIAAFNYGSKNYEKLKLV----IKETIIFITATTLVVWGLMMIFPSNLIGIFLKDEDLLLRAVR-AFRIVIIIFPCVGIYYVSIYCCQALGKAKASFILSIYRETLICIP 403
>gi|86144940|ref|ZP_01063272.1| Na+ driven multidrug efflux pump [Vibrio sp. MED222] >gi|85837839|gb|EAQ55951.1| Na+ driven multidrug efflux pump [Vibrio sp. MED222] (448 aa)
Score = 104, Expect = 2.2e-02, Identities = 76/384 (19%), Positives = 149/384 (38%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVS--TSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           IF +I + +  G + L S  + + +    ++++  S  S   LS +     +SI  Y ++  IA    S   +E+ + Y  V             +F+  S+  +M       F+R +      T+A  I  + N++ +  F L +   + G      I   V      + IL   FV K          +L    I +N   + L +   TF  + + A+  +++  V             +  ++ GL  N         I     F + GI    +PI+++N+      R++ ++  G+ + +   L    VF  I     P + + +  ++   I +         F  PL+ +++   +LFQ+T K     + SL +G +F
  S:    60 IFTAIAMMVGIGGAALMSIEVGKGNSASGQTLFSQSMLSTALLSTI----SVSIALYFLDDIIALMGASEYMAELTHDYLSVM----------LPFFVLYSLAWVMSC-----FVRNDTNPKLATYAMSIGAVVNLVLDYFFVLKWGWGMKGAAYGTAIAQGV-----IACILLSHFVRKQ------GTLELSLKGIGFNKLPSILKIGTPTFFIEVTAAMTILLFNYVLLHQFGE------NHIIAYGLTAN---------IGVFALFVMVGIAQACQPIISFNHGANQPNRIEAIFRLGLKSAMGSGL----VFMIIVYLCAPQIAALYLGDSSDLIGLSATALTFFFFAVPLMGVNLVIANLFQATAKPKQATLISLGRGFVF 396
>gi|188993945|ref|YP_001928197.1| putative Na driven multidrug efflux pump [Porphyromonas gingivalis ATCC 33277] >gi|188593625|dbj|BAG32600.1| putative Na driven multidrug efflux pump [Porphyromonas gingivalis ATCC 33277] (452 aa)
Score = 104, Expect = 2.2e-02, Identities = 85/401 (21%), Positives = 169/401 (42%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLR--------AEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVL-----TLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           V   SV+  ++L+F+ IGL    G  V  SR L    KQ  K+  V+S      +S++ +V++ ++   +  A +                    L+   AN+ M  +  S   + I++ +I  L         ++G S     A +I ++ N+  + +F   F   + G   + ++   +      +  ++  F+ K +   S A       +I  ++    + +     L+  SI++            L   +   G   V+A      I T+ GT +       ++G V GL+P+  YNY   N++R++      +I    F +L + +   I +F  P ++ F    T  EI  +     T++F T  FQF          +L+ + G+   +++ ++ +  +FF PI+
  S:    50 VAAVSVVFPISLLFLGIGLMFGVGGGVYISRLLGA--KQVVKASQVAS------VSVITSVMLAALIALVCNAFLPDI-----------------LLFMGANEEMISLAESYGRLFIISCVIGTLNVSMSNIIVSQGASKTSASAMIIGSIVNVALDPLFIYTFNWGVEGAAWATILSRII------TTAIYIRFLTKAEVKVSLALFA-PTIRIYADIIKIGISMLFLQLLQTLSISL------------LQKAAVKYGAEAVAAVGIVLKIVTL-GTNV-------VFGFVKGLQPMAGYNYGAGNFQRLREAVCCSLILTTSFCVLWSIL---IVIFTSPIISCFGKDETMQEIARIALRANTIMFFTFGFQFVY-------STLYMAIGRARQSLLLNIGRQGLFFIPII 401
>gi|167757240|ref|ZP_02429367.1| hypothetical protein CLORAM_02790 [Clostridium ramosum DSM 1402] >gi|167703415|gb|EDS17994.1| hypothetical protein CLORAM_02790 [Clostridium ramosum DSM 1402] (442 aa)
Score = 104, Expect = 2.3e-02, Identities = 38/178 (21%), Positives = 73/178 (41%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLV 280
           V   S++  +N++ I+I   + +G +V+ ++ + Q  K K K            LS+++ V++++    ++        V                ++  A  Y  F   S P I + N      RA G S      + + N+ NII   IF  VF+  + G  ++ LI   V  +++
  S:    41 VSAVSLVDAINILLINIFAALGTGGAVVAAQFIGQGSKDKAKYSAKQLILITALLSVIIMVIVIAFNVPLLHMVFGNVEVD---------------VMKNAEIYFLFSAMSYPFIALYNSGAALFRAIGNSKISMINSAVMNVINIILNAIFIFVFRWGVFGAVLATLIARAVACIVI 203
>gi|160936236|ref|ZP_02083609.1| hypothetical protein CLOBOL_01132 [Clostridium bolteae ATCC BAA-613] >gi|158441046|gb|EDP18770.1| hypothetical protein CLOBOL_01132 [Clostridium bolteae ATCC BAA-613] (463 aa)
Score = 104, Expect = 2.4e-02, Identities = 73/306 (23%), Positives = 134/306 (43%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFE--LIF--FLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-EIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSI 532
           L++ G++++         + NII +  LIF  F V KM I G   + + G  V + L     L        +   +F     + F  NW   T S+I  +G      SI + +I  V+ F   +N I     +  V+    +  +Q+         IF  I+G+ +G+ PI+AYNY  ++ KR+    +  I  G+   +++  +   +F    P +   F A+     I V  L   +L F F    + +   S+FQ+ G    +++ S+A+ L+   P+ +       L + +  +     T++ +SSI
  S:   166 LQSTGQTFYCMITQGTGAIINIILDPILIFGLFGVPKMGIQGAAAATVFGQIVAMFLA----LILNHSKNKEVRINF-----RSFTPNWR--TISIIYQVGV----PSIIMQSISSVMTF--GMNKILIGFSETAVAVFGVYFKLQS--------FIFMPIFGLNNGMIPIVAYNYGARSKKRIMETVWLSI--GIAVGIMLIGLM--VFHLMTPQLLMLFQADEEMLAIGVPALRIISLSFLFAGYCIIVG--SVFQALGNGVYSLIISVARQLVCILPLAWFFARTFGLHAVWLSLPLAEITSVVLSSI 445
>gi|153853843|ref|ZP_01995199.1| hypothetical protein DORLON_01190 [Dorea longicatena DSM 13814] >gi|149753593|gb|EDM63524.1| hypothetical protein DORLON_01190 [Dorea longicatena DSM 13814] (457 aa)
Score = 104, Expect = 2.5e-02, Identities = 66/300 (22%), Positives = 124/300 (41%)
  Q:   207 MYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN---TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           M ++ G++P ++ + +  F + A+G S     +  I  + N+I + +F  V    + G  I+ ++       L A+F+LF+    K +    F    L++ +I+        I+SLG      +  +  +   +V     N +S   GD  +S     + ++ +  TP        I+ I +G  PIL+YNY  +   RV+      I    V  L+   V W   +     +   F+++       +  L   F   +F    + L   G ++F+S  K    I  SL + +    P+ Y M
  S:   143 MIYLLGTLPSMIAVGMNPF-INAQGYSVVGMLSVAIGAVANLILDPLFIFVLGFGVRGAAIATILSQ----TLSAAFVLFF-LTGKAELKVRF----LRKNEISECTGYAKNIVSLGM-----AGFIMQLTNSLVTICCNNVLSVTGGDIYISVMTIISSVRQLVETP--------IHAINEGTSPILSYNYGARRPARVR----KSIAVLAVMILIYTGVMWGSIIMIPEVLIRIFSSDKTLMKDAVPALKQYFAAFIF----MDLQYMGQTVFKSLNKKRQAIFFSLLRKVFIVVPLTYLM 414
>gi|169350844|ref|ZP_02867782.1| hypothetical protein CLOSPI_01618 [Clostridium spiroforme DSM 1552] >gi|169292430|gb|EDS74563.1| hypothetical protein CLOSPI_01618 [Clostridium spiroforme DSM 1552] (447 aa)
Score = 103, Expect = 2.7e-02, Identities = 88/388 (22%), Positives = 154/388 (39%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN---TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           I I+       G S L S A  Q    + + I  +SF   +   I+LTV++  ++    E  +     S   +V              AN YM  ++ G+I +++ L  +  F+ ++G +       LI  + NI+ + IF   F++ + G  I+ +I  F++ L    F+   + + K           LK+  +   +     I+SLG  +    +A+ N    IV   TL       GD  ++     N I+ V+  P          GI +  +P+L YNY      RV      GI      +LL+  + W    F        F+ N       ++ L L F    F F +++  + G ++    GK    I  S+ + +I   P+
  S:    65 IIIAFANLFGMGGSPLCSIARGQGKNDEAEEIMGNSFSLLVIFGILLTVIVFVLK----EDLLWLFGASKDTIV-------------YANDYMTIYLFGTIFVLISLG-MNSFINSQGFAKIGMCTVLIGAILNIVLDPIFIFTFELGVKGAAIATVISQFISALWTIYFLTGNKTILK-----------LKKKNMRLKIIHVKRIVSLG--MAGFMMAITNSTVTIVCNATLQKYG---GDLYIAIMTIINSIREVASLP--------GQGISNACQPVLGYNYGAGKSDRV----IQGIKFVTFSALLMMLILWFAITFFPELFIKIFSHNPEIVKDGVNALRLYF----FGFFMMAFQMVGQAVAVGLGKSRQAIFFSVFRKVIIVVPL 406
>gi|160894390|ref|ZP_02075167.1| hypothetical protein CLOL250_01943 [Clostridium sp. L2-50] >gi|156864091|gb|EDO57522.1| hypothetical protein CLOL250_01943 [Clostridium sp. L2-50] (498 aa)
Score = 103, Expect = 2.7e-02, Identities = 62/310 (20%), Positives = 123/310 (39%)
  Q:   200 LNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           +N A  YM  +  G+I + + L +  F + A+G +     + LI  + NII + IF     M + G  ++ +I    + + V SF+       +          ++K   +  +     L L    F+   S ++ ++ +        +++    GD  V A      +   +  P+         G+  G +PI++YNY  +N  RVK  +   +   + +S+L+    W   +       S F  +T         L   L   F L  + IS    F + G    +I+ ++ +  +   P+++ M +I
  S:   178 INYATSYMNIYAIGTIFVQLTLGMNAF-ITAQGFAKEGMLSVLIGAIANIILDPIFIFALHMGVKGAALATIISQGCSCIWVLSFLFGKRTTLR---------IRVKNLGLQASYILPCLALGSAVFIMQGSESIISVCFN-------SSLLKYGGDMAVGAMTILTSVMQFAMLPLQ--------GLGQGAQPIISYNYGAKNASRVKDAFKLLLKVSLTYSVLL----WLCIMCFPQVFASIFTPDTALIAFTKDALRYYLAVMF-LFGIQISCQMTFNALGNAPASIIVAIMRKFVLLIPLIFIMPHI 458
>gi|148976320|ref|ZP_01813044.1| Na+ driven multidrug efflux pump [Vibrionales bacterium SWAT-3] >gi|145964414|gb|EDK29669.1| Na+ driven multidrug efflux pump [Vibrionales bacterium SWAT-3] (448 aa)
Score = 103, Expect = 2.7e-02, Identities = 73/384 (19%), Positives = 152/384 (39%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVS--TSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           IF +I + +  G + L S  + + +    +++    F   + ++ + + + +SI  Y ++  IA    S   +E+ + Y  V  Q          +F+  S+  +M       F+R +      T+A  I  + N++ +  F L +   + G      I   V    +A  +L +    +G    S          I ++   + L +   TF  + + A+  +++  V             +  ++ GL  N         I     F + GI    +PI+++N+      R++ ++  G+ + V   L    VF  I     P + + +  ++   I +         F  PL+ +++   +LFQ+T K     + SLA+G +F
  S:    60 IFTAIAMMVGIGGAALMSIEVGKGNVTSGQTL----FNQSMLITALFSTVTVSIALYWLDEIIALMGASGYMAELTHDYLSVMLQ----------FFVLYSLAWVMSC-----FVRNDTNPKLATYAMSIGAVVNLVLDYFFVLKWGWGMKGAAYGTAIAQGV----IACILLSHFVRKQGTLTLSLK-------GIGFDKLPSILKIGTPTFFIEVTAAMTILLFNYVLLDQFGE------NHIIAYGLTAN---------IGVFALFVMVGIAQACQPIISFNHGANQPNRIEEIFRLGLKSAVGSGL----VFMGIVYLFAPKIAALYLGSSSDLIGLSATALTFFFFGVPLMGINLVIANLFQATAKPKQATLISLARGFVF 396
>gi|160940293|ref|ZP_02087638.1| hypothetical protein CLOBOL_05182 [Clostridium bolteae ATCC BAA-613] >gi|158436873|gb|EDP14640.1| hypothetical protein CLOBOL_05182 [Clostridium bolteae ATCC BAA-613] (454 aa)
Score = 103, Expect = 2.7e-02, Identities = 65/301 (21%), Positives = 121/301 (40%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNI-LLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFF---AIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           A +Y  +I  + P +M   ++   LR +G + F         + NI  + IF     +   G  I+  +  F++  +L+A   L  E ++           ++  F+ +  ++   L   L +  R    ++A IV        LN  +   GDA ++A    N            LI+F   A+ G   G +P+  ++Y  + Y RV+  Y++ +       +++ A     FL  G  V S F  N P  I + TL     +    +         + QS G  F   + ++++  +F  P+L
  S:   139 AVEYARYIFLATPFMMCSFIMNNLLRLQGLAAFAMVGITAGGILNIALDPIFIFGLGLGTSGAAIATGLSQFISFCILLAQCNLRRECIHI----------RIGNFRPSLFLYGKILSGGLPSLTRQGMASIATIV--------LNTTAHPFGDAAIAAMAIVN-----------RLIYFVNSAVIGFGQGFQPVCGFSYGARKYSRVRQAYWFCVKFTTCILVVVCA---GGFLVSG-HVISLFRKNDPEVIAIGTLALRLQIATMWMNGFLTMSNMMSQSIGYGFRATLLAISRQGLFLIPVL 410
>gi|187779562|ref|ZP_02996035.1| hypothetical protein CLOSPO_03158 [Clostridium sporogenes ATCC 15579] >gi|187773187|gb|EDU36989.1| hypothetical protein CLOSPO_03158 [Clostridium sporogenes ATCC 15579] (455 aa)
Score = 103, Expect = 2.8e-02, Identities = 63/311 (20%), Positives = 134/311 (43%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKI-NWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           +I  +    I  G + L +  + + +K   + I  +SF   + LSI+LT++ +  +    E  + K   ST            + I  A +    ++ G++ +++ L +  F +  +G +       +I  L NII + IF  V  + + G  I+ +    ++    A ++LF+ F  K         K  K++ + N  V  + + L +  F+  A+ +       +V     + +    GD  V A    + I  +        +F  + G+  G +PI++YN+  +  +RVK  +   II+ + +++++
  S:    63 MIISAFSALIGMGGAPLAAIKMGENNKSDAEKIMGNSFSMLVILSIILTIVFLIFK----EPILWKFGAST------------RTITFAKDYLTIYLLGTLFVLIALGMNPF-INTQGFAKTGMITVMIGALINIILDPIFIFVLNLGVKGAAIATVTSQCIS----AIWVLFFLFGKKS------TIKIRKKYLVPNKKVIFSIMALGVSPFIMQATES-------LVLISMNSKLQIYGGDLAVGAMTIMSSIMQI--------LFLPLMGLTQGAQPIISYNFGAKKIERVKKTFKLLIISCISYTVIM 332
>gi|18977080|ref|NP_578437.1| hypothetical protein PF0708 [Pyrococcus furiosus DSM 3638] >gi|18892721|gb|AAL80832.1| hypothetical protein [Pyrococcus furiosus DSM 3638] (461 aa)
Score = 103, Expect = 2.8e-02, Identities = 69/335 (20%), Positives = 134/335 (40%)
  Q:   117 ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAIS-TAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEI 451
           I++   +  G S   +R +  +DK+   ++ V S    L L + +T+ ++     +  +  AK                    +  A +Y   +     II+  N+    LR EG +     A ++ +  NI+ + IF       ++G   + L+   V  L    FI ++ FV +  Y        L++F  +  +    L + L + L   S+++A      +FF  LN+++ TA G+ GV+   +   I  +   P        I G+      +    Y ++N ++++  Y Y I    +  L + A    I LF  P V   F  +  +++
  S:    67 IALAAGLGVGTSSAIARRIGARDKEGADNVAVHSLILSLILGVTITITMLPAIDSLFRSMGAKGEA-----------------VELAIEYARVLLAGAFIIVFNNVGNGILRGEGDANRAMLAMVLGSGLNIVLDPIFIYTLGFGVVGAAYATLLSMVVTSL----FIAYWLFVKRDTY----VDITLRDFSPSREILKDILRVGLPSSLSQLSMSIA------MFF--LNSVAITAGGENGVAVFTSAWRITMLGIVP--------ILGMAAATTSVTGAAYGERNVEKLETAYLYAIKIAFMIELAVVAF---IMLF-APQVAYLFTYSESAQV 357
>gi|110801410|ref|YP_695527.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|182625927|ref|ZP_02953692.1| MATE efflux family protein [Clostridium perfringens D str. JGS1721] >gi|110676057|gb|ABG85044.1| MATE efflux family protein [Clostridium perfringens ATCC 13124] >gi|177908840|gb|EDT71338.1| MATE efflux family protein [Clostridium perfringens D str. JGS1721] (447 aa)
Score = 103, Expect = 2.9e-02, Identities = 59/272 (21%), Positives = 123/272 (45%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFK-QLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           +R+EG S    +   I+ + + I +++F L+  M + G  +SI++    NI     +I + E  ++    F   FK  LK+    + +  + LI S                ++IV    LN  S   G+  V++ G+A   +Q            F   GIV G+ P++AYN+  +N  R+K    Y  +   V S+L   +   +++F    + +F  ++  S + + + +   +L       L+   ++++Q++G+     + +++QG ++
  S:   161 VRSEGDSKESMYGMFISVIISTILDVLFILILNMHVYGAALSIILA---NIASSIYYIWYLETKSENLKGFLHFFKLSLKDQTEIYKIGVSELIQS---------------AFLIVTTLLLNNFSIQHGEGVVASFGIALRIVQIPE---------FFTMGIVLGVMPLIAYNFSNKNLSRLKESIKYSTLFIFVISVLFAGI---VYIFRNQVMHAF--SSDTSVLQIGSYILVAMLISTIFNGLTALFMTIYQASGEGIATGIMAISQGCLY 402
>gi|15612175|ref|NP_223827.1| hypothetical protein jhp1110 [Helicobacter pylori J99] >gi|4155699|gb|AAD06682.1| putative [Helicobacter pylori J99] (459 aa)
Score = 103, Expect = 2.9e-02, Identities = 90/426 (21%), Positives = 174/426 (40%)
  Q:   116 FISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFF--AIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFW-----PIFLFGGPSVT-SFFNANTPSEIHVLTL--------LFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIY 541
            I+  L    GA+ +    L Q    + + ++ S FY      + L+  I+S+        IA+   S               +L+ + +Y+  I      +++  L   F+  + R      A LI +L NI F  +F  V ++ + G  I+ +IG+ + +L+    ++ + +  KG   F      +K F ++  + +    +   T    ASI       +I+ F T  AI    G+  VS          + G  +YN I F   ++ I  G++PI +++Y  +N +RV+ V+ +G+       +     ++      I L+  PS   + F   T   +++  +        L C + FQ              Q T   F+  ++     ++   PIL   + +  +   Y +  F AF  +A+     EI   ++
  S:    64 LIAYELLFGFGAASIVGYFLGQNKTHRARLVFSSVFYF-----VALSAFILSMALLPFSENIARFFGSNDA------------LLSMSKRYIEIILMGSVFMVLHPLADVFVVNDKRPVLAMVAMLIGSLANIFFNYLFIFVLEVGVQGSAIATVIGHAIGVLV----LMQHFWRKKGQLYF------IKRFSLSSVISSAKSGVPQSTAEFSASI-------MILLFNT--AIMHTAGERFVS----------MYGIVMYNAIIFFTTLFAISQGIQPIASFSYGARNLERVRAVFVFGLKAAFCIGIFFYGAYYFLDEFLIKLYLQPSEQDALFMQETKRAMNIYYVGYVFLGMTLLCAVFFQS------------IQRTKSSFIITISHTLGFIVILLPILSHFYGVNGIWVTYPIAQFLAFL-VALGVTYYEIKKGVF 446
>gi|189459426|ref|ZP_03008211.1| hypothetical protein BACCOP_00049 [Bacteroides coprocola DSM 17136] >gi|189433883|gb|EDV02868.1| hypothetical protein BACCOP_00049 [Bacteroides coprocola DSM 17136] (450 aa)
Score = 103, Expect = 2.9e-02, Identities = 72/385 (18%), Positives = 153/385 (39%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           V   V ++  S    + +G S L + AL Q ++++   I  + F   L  +I     + S  TY+    I   T ++   +             A +    ++ G++ + + + L  F +  +GR     ++ LI  + NI  + +F   F M + G  ++ ++    + + + SF+   +   + +Y +          K++  +  + L L +  F+  ++ ++   V        LN+     GD  VSA         +   P+         G   G  PI++YNY   N +RVK  +   +I    F+ L+ +     F+   PS+ +    N  + I  +  +    L    +  L  +  ++F + G+  +++  +L
  S:    59 VTSAVIILISSFSAIVGAGGSPLAAIALGQGNRERAGQILGNGFILLLIFTI-----LTSATTYLFMEPILLFTGASENTIGY-----------ATDYLSIYLLGTLFVELSVGLNTF-INTQGRPTIAMYSVLIGAILNIGLDPLFIFTFGMGVKGAALATILSQACSAIWIISFLTSKKASLRLEYRY---------MKLHKGIILSILALGVSPFIMASTESLVGFV--------LNSSLEKFGDIYVSALAIMQSAMLIVSVPLT--------GFAQGFVPIVSYNYGHHNRERVKECFKIVVIIMFSFNFLLIS-----FMILFPSLVASAFTNDETLIETVRQVMPIFLGGMTIFGLQRACQNMFVALGQAKVSVFIAL 396
>gi|168723390|ref|ZP_02755667.1| putative drug/sodium antiporter [Clostridium difficile QCD-76w55] >gi|168731022|ref|ZP_02763299.1| putative drug/sodium antiporter [Clostridium difficile QCD-97b34] >gi|196159836|ref|ZP_03120397.1| putative drug/sodium antiporter [Clostridium difficile CIP 107932] (451 aa)
Score = 103, Expect = 3.1e-02, Identities = 65/280 (23%), Positives = 113/280 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGI-SILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           ++ +G     T   +I+ L NII + +F + F   + G GI ++L   F  I  +  F+     +N     F   FK L++   I +   TT L   +   L + S+        ++++  +N I+T                          L+   I GI  G++P+ ++ Y   N   VK +   GI   ++ S+   AVF     F GP V+ F +       +    +F      F L+ +++     F S  K  ++ V SL +GL+     L SM
  S:   158 IKTDGFPILATVGVIISALTNIILDYLFVIEFGWGVKGAGIATVLSQVFSTIFFLIHFLRKNSTLNFSK--FRIDFKTLRKIVFIGFPDSTTELSCGIVVLLFNLSLTKYIGENALIYYSVINYINT--------------------------LVLMTIMGITQGMQPLTSFYYGAGNIDNVKKLLKMGIKATIIASV---AVFAICMAFSGPIVSLFIHPEETMLFNEGVRVFKIFSISFLLVGINVIISGFFVSVEKPSISTVISLGRGLVIVVLSLISM 408
>gi|150010250|ref|YP_001304993.1| MATE efflux family protein [Parabacteroides distasonis ATCC 8503] >gi|149938674|gb|ABR45371.1| MATE efflux family protein [Parabacteroides distasonis ATCC 8503] (448 aa)
Score = 103, Expect = 3.1e-02, Identities = 66/277 (23%), Positives = 112/277 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTL--NAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           +RA G      F  +I  + N+I + IF     M I G  I+ +I         A+F++ +         F   + +LK   I WN+FT  +           S+ +A  V V++    L  N    A G +G+ + +A              L+   I GI  G++PI+ +N+   ++ RV       II     S LI  V   + L     + S F+ +          L  T+L  F ++   I+    FQS G  +  +  SL++ ++F  P +
  S:   159 MRASGYPKKAMFTMMIGAVLNVILDPIFIFWLDMGIQGAAIATVISMAAG----AAFVMSHFISKDSIVRFHTKYFRLKG-PIIWNIFTIGM--------SPFSMQLAGSVVVVIMNHALKENGGDLAIGASGIISSIAM-------------LLVMLIIGIAQGMQPIVGFNHGAGHHDRVLATLRLSIIV----STLITGVGCIVSLLFPRLIVSVFSTDAELVSITDNGLRLTMLVFF-VVGSQITISQFFQSIGVAWKAMFLSLSRQVLFLIPAI 406
>gi|148839572|sp|Q4L8N9|MEPA_STAHJ Multidrug export protein mepA (452 aa)
Score = 103, Expect = 3.1e-02, Identities = 84/392 (21%), Positives = 154/392 (39%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGL-----SLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           + ++ G     G     SR L  +D  K   +   S YS L L +++ V+ +     I     A                     LN  + Y+     S P +++  +L  F RA G+        L +   NII + I      +D++G  +   I    N +    FI+++   N+     SF  K  K  K    +      + +  FL    + V  +V V +F  T    + A      S G++F  +Q              I G+ +G+ P++AYN+     +    +    +   V+F++ +  V     L  G S+   F  +T  +I VL     T + +  + SL ++G+      + Q+TG+     + ++AQG +   P+L+ +
  S:    64 VLMAFGNLFGVGGGTYISRLLGAKDYIKSHYVSSFSIYSSLVLGLIIAVITLPFTDQIASILCASGET-----------------LNYTSDYLKIEFLSTPFVILFFVLEQFARAIGKPIISMIGMLSSVGINIILDPILIFGLHLDVVGAALGTAIS---NAIAGLFFIIYFSRKNE---TLSFNVKHAKPTKA---MMQEIFKIGIPAFLMVVLMGVTGLV-VNLFLATYGNYAIA------SYGISFRLVQFPE---------LIIMGLSEGVVPLIAYNFVSNKTRMKDTIKVVIVSIAVIFAVCMTVV-----LVAGHSIVQLF--STDPQIVVLA----TFILKVTMTSLLLNGIGFLFTGMLQATGQGRGATIMAIAQGTV-IIPVLFVL 406
>gi|150403667|ref|YP_001330961.1| multi anti extrusion protein MatE [Methanococcus maripaludis C7] >gi|150034697|gb|ABR66810.1| multi antimicrobial extrusion protein MatE [Methanococcus maripaludis C7] (452 aa)
Score = 103, Expect = 3.1e-02, Identities = 106/518 (20%), Positives = 206/518 (39%)
  Q:     7 KKRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFV-NILLVASFILFYEFVNKG-DYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIY--NLIFFAIYGIVDGLRPILAYNYQKQNYKRV-----KVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLF--CTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI--AILVSDYKVMLFTAF 524
           K+R        ++E+I KL L+ ++PS+  +++ GIY  +D I +   +   G+         AG+T                                  +   V +   SIG+ I +GAS + S +L ++D +    I  ++FY  + +S ++T L                 +    V++  N  ++  + N   +Y   I       +    L   LR +G          + ++FNI+ + I  +VF   ++G   + +    + ++L +  F+L    V  G + PFS       EF I   +  T        F+ + +  +  IV+ I F    +++                   +  G  IY  + ++    GI +G++P+++YNY  + + RV     K V+   I+    F  ++N     I +F               EIH   +L    +++     L+     ++ F S G+  + I+ +     I  FPI + +  I  A + S+Y  ++FT +
  S:     2 KRRVMEQVRKLKSENINKLILRYVIPSIAGTVIIGIYSIIDGIFIGRTVGAEGL---------AGVT----------------------------------LAFPVLIAIGSIGIMIGAGASAIISISLGKKDYEMASRILKTAFYYIILISFIITFL---------------GLLFIDPVISGLNLTKN--LENYVLQYSKIIIIGAIAQIFAISLDPILRNDGFPKKSMIILTLMSVFNILLDYILIVVFNFGVMGAATATVFAQALGSVLYLKHFLLGKSNVKIGKNSPFS-------EFSIIKRIAKT----GFSPFIMELAFGILMIVHNIQFIRYGSSLDV-----------------SAYGIVIYITSFLYMVYLGISEGVQPLISYNYGAKKFNRVFEILKKAVFINAILGICSFLTILNFPNLLIKIFNPHDTNLIATTTVGLEIHNFAILILGVSMVLTMYFLATEQPRIAGFLSLGRTIIFILPA-----IIVFPIYFGIKGIWWATVFSEYMGLIFTIY 439
>gi|51244048|ref|YP_063932.1| hypothetical protein DP0196 [Desulfotalea psychrophila LSv54] >gi|50875085|emb|CAG34925.1| hypothetical membrane protein [Desulfotalea psychrophila LSv54] (466 aa)
Score = 103, Expect = 3.1e-02, Identities = 60/304 (19%), Positives = 122/304 (40%)
  Q:   197 QLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFF 500
           +L+L    +Y+      I  +++     FF+R +G+  +  +++L+    NI+ + I  + + M + G  I+   G F++ L  A + LF     +   P            I+W     S+       + + + AV  +V+  +  G         G+AGV+A              +Y L+     G+  G+ P++++NY  +N  ++  +    I   + F+L     F   F FG  ++   F     S +H+       + F F L  ++I   + F S     ++ + S  +  +F  
  S:   126 KLLLPYCVQYLNIFLFGISALVLQMFFEFFMRLDGKPSWALYSSLLGGATNILLDYILIVRYGMGVDGAAIASCAGIFISCLNGAIYFLFKAKTLRFIRPL-----------IDWPFLFRSMFNGFSEMVTEIAAAVQTLVFNYLMLGY-------AGEAGVAAMSIL--------MHLYFLMSSLYIGLGMGVSPLISFNYGCRNPGKISELLTRAIQLTLFFALF---SFAMAFCFGD-NLIQIFAKGQVSVVHIAEGGIKIIAFSFLLNGMNILASAFFTSVNNGKISTLISSLRTFVFIL 399
>gi|160943455|ref|ZP_02090689.1| hypothetical protein FAEPRAM212_00946 [Faecalibacterium prausnitzii M21/2] >gi|158445315|gb|EDP22318.1| hypothetical protein FAEPRAM212_00946 [Faecalibacterium prausnitzii M21/2] (452 aa)
Score = 103, Expect = 3.2e-02, Identities = 80/381 (20%), Positives = 148/381 (38%)
  Q:   103 VYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           V   SV+G V  I  ++   + +G+S + +R     + ++ K      F++  FL +     ++SI   +    +     S +E            I   A +Y+  +    P  ++ N +   +RAEG         L+  L N IF+ +F LV    + G   + ++G   N++  A ++ +   V  G          LK+ ++   +    L   + + L   + + +N   ++V  GT    + A                    T + ++I  AI     G +P+LAY+Y   + KR+K +    I+  VVF +L  A       F G +              + T L   L+   P++ L+    +L QS GK
  S:    54 VAAVSVVGPVFSILAAVATMLGAGSSAIIARCFGAGEIEQGKICSSLCFWTSFFLGV-----LVSIGLLVGRVPLLGMLGSNAE------------IFPYAERYLQVLALGAPCFILSNSMAMLVRAEGAVKEGMIGNLLGTLVNCIFDPLFILVLNFGVSGAAAASVLG---NLVATACYLRY--IVKHGTVLTVDPRPALKKPQMLGELLAIGLPNGISSLLAGFASSFSN--RLLVTHGTAAVAAMAAAG---------------KTTMVISMIAMAI---CMGCQPLLAYSYGAGDSKRLKQLLKDLILLTVVFGVLAGAAS-----FAGRNALIGMFIKEEGAFRLGTQLVVYLVLGSPVIGLTYLVTNLLQSVGK 387
>gi|160885037|ref|ZP_02066040.1| hypothetical protein BACOVA_03034 [Bacteroides ovatus ATCC 8483] >gi|156109387|gb|EDO11132.1| hypothetical protein BACOVA_03034 [Bacteroides ovatus ATCC 8483] (457 aa)
Score = 103, Expect = 3.2e-02, Identities = 64/314 (20%), Positives = 121/314 (38%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFS 421
           V  ++ ++  S    +  G + L + AL Q D+ +   I  + F     + ++L  L  S+  Y     I   T ++   +             A N    ++ G+I  + I   L  F+ A+GR     ++ LI  L NI+ + IF     M + G  ++ ++    + + V +F+    F      P      + +   +N  +  +   L +  F+  ++ ++   V        LN+     GD  VSA          +  P        + G   G  PI++YNY   + +RVK  +   +IT   F+
  S:    59 VTTSLVILISSFSAIVGGGGAPLAAIALGQGDRSRAGKILGNGF-----ILLILFTLFTSLIAYTFMEPILLFTGASENTLEY-----------AVNYLSIYLLGTI-FVEISTGLNSFINAQGRPAIAMYSVLIGALLNIVLDPIFIFWLDMGVKGAALATVLSQACSAVWVLTFL----FSRHASLPL-----EKRYMALNREIILSIFALGVSPFIMASTESLVGFV--------LNSSLKDFGDIYVSALTILQSAMQFASVP--------LTGFAQGFVPIVSYNYGHGDKQRVKDCFRVALITMFSFN 330
>gi|73670656|ref|YP_306671.1| putative transmembrane efflux protein [Methanosarcina barkeri str. Fusaro] >gi|72397818|gb|AAZ72091.1| putative transmembrane efflux protein [Methanosarcina barkeri str. Fusaro] (467 aa)
Score = 102, Expect = 3.4e-02, Identities = 74/310 (23%), Positives = 139/310 (44%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL 423
           L  I++G  I  G S L + AL + ++Q+   +  ++F   LF+ I LT + +      +    A  +V +  + NSY +V                +GSI +I+ + L    +R +G+        + + L N++ + +F +  +M + G  I+ +I + ++ +L+A +  F  +      P S + +     KI    F  S  +   TF+    +  AN  Y+++ +G+  A+S      G+  G  F+         I++LIF    GI  G +PIL +NY  + Y RV       +I+ +V  L+
  S:    61 LAIIAVGQMIGIGTSSLVALALGRNNRQEALKLVHTAFPMLLFVGIGLTTIGLDASGSYLHLLGASGSVFS--MANSYLRV--------------LFSGSILLILSIALEPL-VRNDGKPRLAMTCVVASVLVNMVLDYLFVVRMEMGVTGAAIATVIAFSLSGILLALY-FFSGWAGLRLKPRSLSLEPRIIIKIMRTGFP-SFAMQFSTFI----LLFAN-EYMLLSYGSELAVS----GYGI-IGYVFS---------IFSLIF---EGIAVGTQPILGFNYGARCYSRVAGTLKIAVISCLVAGLI 329
>gi|164688166|ref|ZP_02212194.1| hypothetical protein CLOBAR_01811 [Clostridium bartlettii DSM 16795] >gi|164602579|gb|EDQ96044.1| hypothetical protein CLOBAR_01811 [Clostridium bartlettii DSM 16795] (462 aa)
Score = 102, Expect = 3.4e-02, Identities = 79/407 (19%), Positives = 161/407 (39%)
  Q:    98 NRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV--FWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           N ++ +    +I  + L+  +    +  G S   +  + Q+D    + I  +SF   + + ++LTV+    +  IV A         SE    Y          A +    ++ G++ + + + +  + +  +G +        I    NII + I    F M + G  ++ +    V+    A F+L + F NK        + +LK+      V   +L L +  F+  ++ +       IV     N +     D  VSA    + +  +   P+         G+  G +PIL+YN+  + Y RVK  +    I+   F+++   +   +P F          FN N+P+ + + +           L  + IS    F S G+  +++  +L + +I   P+++
  S:    48 NGDLAMAGIGIITPIVLLVTAFSALVGFGGSPRVAIKMGQKDNDGAEEILGNSFSLVIIIGLILTVIFYIFKEPIVMA------FGASENTAQY----------AIDYLSIYLIGTVFVQVAVGMNPY-INTQGFTTIGMITVAIGAGLNIILDPILIFGFNMGVKGAALATVTSQLVS----AIFVLKFLFGNKTILKIRKKYLKLKK-----EVVLGTLALGIAPFIMQSTES-------IVLISLNNQLLKYGSDIAVSAMTIMSSMMQMIMLPMS--------GLTQGAQPILSYNFGAKRYDRVKKAFKLLFISCFTFTMVAVGLIELFPAFF------VKIFN-NSPALVDITSWSMRIYFAGMCLFGMQISCQQTFLSLGEAKISLFLALLRKMILLVPLIF 408
>gi|187778576|ref|ZP_02995049.1| hypothetical protein CLOSPO_02171 [Clostridium sporogenes ATCC 15579] >gi|187772201|gb|EDU36003.1| hypothetical protein CLOSPO_02171 [Clostridium sporogenes ATCC 15579] (456 aa)
Score = 102, Expect = 3.4e-02, Identities = 35/128 (27%), Positives = 57/128 (44%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           I    F  I+GI  GL+PI+  N+  + Y RVK       I   +F      + W  ++     V S+F  N  + I      F  +   FP+  L +  ++ FQS GK   + + ++ + +I F PI
  S:   280 ILMFTFIPIWGIGQGLQPIVGMNFGAKKYDRVKDAVKIFSIASTIFI----GILWVFYMLKPRVVLSWF-INDKTIIENGYEFFRLMFLTFPVSGLIVMSMTFFQSIGKGGKSALITILKQVILFMPI 402
>gi|169823904|ref|YP_001691515.1| Na+driven multidrug efflux pump [Finegoldia magna ATCC 29328] >gi|167830709|dbj|BAG07625.1| Na+driven multidrug efflux pump [Finegoldia magna ATCC 29328] (436 aa)
Score = 102, Expect = 3.5e-02, Identities = 67/303 (22%), Positives = 133/303 (43%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVF---TTSLILSLGTF--LRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIY-GIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-----EIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           I    N Y+  +T   P   + N+L  F+R +        A +I ++ N+I + +F     M I G   +  +   ++++++A +I+     N G             F +N N+F   +   I+S G F  L +A+ A     + ++  G         G+ GV+   +F+ I  +S      L+  AIY G+  G++P++++ Y K + + V  +  Y ++  ++ S+LI    +    F    + +F+N           +  + + F    F    +  +I   + F ST +   + V S A+G +   P
  S:   123 IFEMTNTYLRVMTLFAPAFFMNNILQCFVRNDRNPRLSMAAMVIGSISNVILDYVFIFPMNMGIFGAIFATGLAPIISMMVIAPYIIAR---NNG-------------FHLNKNIFDFHSIREIVSKGMFALLTEATSASVMFTFNMIILGI-------SGNVGVA---SFSIITVIS------LVVTAIYTGLSQGIQPLISHYYGKNDVENVGKILKYAVVVQIMLSILIYGEIY----FNADILAAFYNKANDVLLQDYAVSGMKIYFVACFF----IGFNIVVSTYFTSTERSIKSQVISFARGFVIIIP 396
>gi|91793726|ref|YP_563377.1| MATE efflux family protein [Shewanella denitrificans OS217] >gi|91715728|gb|ABE55654.1| MATE efflux family protein [Shewanella denitrificans OS217] (509 aa)
Score = 102, Expect = 3.5e-02, Identities = 77/395 (19%), Positives = 163/395 (41%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVS--TSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLR----PILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLS--LSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           GT++    SIG+ ++     L S+A+  +D    K +      +C  +S  ++VL+  +    +   +A    S  T+E+               A  Y+Y +  S+P+I +   L   LRA G +     + L     N + + IF  +F M I G  ++ ++     +++ A  ++                    + K+  ++  T+L   L T            ++ I     +  ++T  G+A V+  +A      V+G  +   +    +G+V  L     PI+  N+  Q++ RV+      I   + + L+++ V   +FL     +++F   +   +   L L +C  +  F + +  L ++  S F + GK   + + ++ +  +   P +Y
  S:    56 GTISFFTTSIGIGLSIALGALVSKAIGAKDVALAKRL----LLNCAIVSFAISVLVALLVGLFIPELLALVGASGHTAEL---------------AQGYLYILIPSLPLICLAMALGGALRAVGDAKLSMMSTLAGGGVNAVLDPIFIFLFAMGIEGAALASVLARLTVLIISAHGVMV-------------------KHKLTSDINLTTLRADLPT------------IFAIALPAMMTNVATPIGNAVVTRAIADYGDSYVAGWAVLGRLIPVTFGMVFALSGAIGPIVGQNFGAQSFDRVRDSLTKAIQFCICYVLVMSLV---LFLIKDFIISAF---DMQGDGAALILFYCQYMAIFFIFAGILFVANAS-FNNLGKAKYSTLFNVGKATLGTIPFVY 401
>gi|126173580|ref|YP_001049729.1| multi anti extrusion protein MatE [Shewanella baltica OS155] >gi|125996785|gb|ABN60860.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS155] (451 aa)
Score = 102, Expect = 3.6e-02, Identities = 57/260 (21%), Positives = 99/260 (38%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILL 279
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  +IG  I  G++ L S  L Q +  K + +  ++F  CL    +  ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +T+  ++  + N   + +F +VF   + G  I+ ++   V  LL
  S:    18 EPIAKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGETGL---------AGM----------------------------MLAY------PVGAILYAIGAMIGMGSAALVSINLGQGNVAKARKLLGNAFSLCLLAGAIFALMGGIFSRDILIALGAQGD-----------------ILENANEYLFWYFALCHFPIISM--TFTTLLRNDGRPSMVTWVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMMSQAVTGLL 217
>gi|149117529|ref|ZP_01844214.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS223] >gi|146862379|gb|EDK48071.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS223] (550 aa)
Score = 102, Expect = 3.9e-02, Identities = 73/380 (19%), Positives = 151/380 (39%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILL-VASFILFYEFVNK------GDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNL-IFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVAS 491
           + ++  ++   I +G + L SR L   +  K   I  + F   L   +++TV+ +     ++      ST++                  AA +Y+  I        +L+L    LRA+G+   +    L++ + NI+F+ +F  V +M + G   + + G  V++ + V  F+    F NK         P  F  +Q+K      N+     IL LG+ +  + + +A ++ ++      +  +  P     +          + G   +N+ I   +  +    + I AYNY      RV     +GI+    +  ++  +F      G P+       +  S I     +        PL  ++   ++++Q T +  L ++ S
  S:   110 LQMMIFALACMIGNGTATLVSRFLGANEFDKASQIANTGFALALCCGVIVTVVSLGQLNNLLAFIGVSSTLAL-----------------AATEYLQPILCFSLFTFLLSLSGDLLRAQGKVVVMLLVILLSAVMNILFDTLFIAVLEMGVSGAAWATVAGQCVSLFIAVVYFVPNNRFANKQALHRQAAQPICFRIEQIK-----LNLTEIKAILGLGSPILLSYLGIACVISLVNHILVSHLANVVPNTPAANEVAYMISAYGLIGR--FNIFIALPLMALTSAAQTISAYNYGAMASSRVLACAKWGIVLTCCYLSVVTIIF-----MGFPTSVYGVFTDNHSLIAACIKISSVTFIALPLAGITGIAIAVYQGTNRPKLALLLS 468
>gi|160885237|ref|ZP_02066240.1| hypothetical protein BACOVA_03236 [Bacteroides ovatus ATCC 8483] >gi|156109587|gb|EDO11332.1| hypothetical protein BACOVA_03236 [Bacteroides ovatus ATCC 8483] (450 aa)
Score = 102, Expect = 4.0e-02, Identities = 81/386 (20%), Positives = 148/386 (38%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKE--FKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           + G  +  GA+ L S  L Q+D    + +  + F   L + I  T++++     I+          + E V    +    ++L     ++Y    ++            LRA G       A +   L N++   +F  VF   I G   + +        L+A     + F  K +        +LK+  F++   +   SL + +  FL +  +A   IV +I        +    GD  + A    N I  V            + G+  G++PI  YN+  + Y RV  V    I    V    +  + + I +F    V+S F ++    I + +  F  ++F +P++   +   + FQS G     I  SL + ++F  P L
  S:    68 AFGSLVGVGAATLISVKLGQKDYDTAQRVLGNVFVLNLIIGISFTLVVLPFLDPIL-----YFFGGSDETVKYAREFMQVILLGNVVTHLYLGLNAV------------LRASGHPQKAMVATITTVLINVLLAPLFIFVFDWGIRGAATATVCAQ-----LIALVWQLHLFCRKDE------LIRLKKGIFRLKRKIVLDSLAIGMSPFLMN--MASCFIVILIN-----QGLKEHGGDLAIGAFGIVNRIVFV--------FIMIVLGLNQGMQPIAGYNFGAKLYPRVTEVLKVTIYCATV----VTTIGFLIGMFIPEIVSSIFTSDA-ELISIASKGFRVVVFFYPIVGFQMVASNFFQSIGMASKAIFLSLTRQMLFLVPCL 407
>gi|153816471|ref|ZP_01969139.1| hypothetical protein RUMTOR_02724 [Ruminococcus torques ATCC 27756] >gi|145846213|gb|EDK23131.1| hypothetical protein RUMTOR_02724 [Ruminococcus torques ATCC 27756] (460 aa)
Score = 102, Expect = 4.0e-02, Identities = 61/294 (20%), Positives = 119/294 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLL-SLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVM 519
           F+ A+G +     + LI  + NII + IF   F M + G  ++ +I   ++ + V SF++  + + K          + +   +   +    L L   TF+  AS +V ++ +         ++ +  GD  VSA            T +       + G+  G +PI++YNY   N  RVK  +   +   + +S     + W   +         F   T +++ V T     +     L+  + ++    F + G+   +IV ++ +  I   P++Y M    +L S  K M
  S:   159 FITAQGFAKTGMLSVLIGAISNIILDPIFIFGFGMGVKGAALATIISQALSCIWVISFLMGRKTMLK---------IRKENLLLRPKIIFPCLALGAATFVMQASESVISVCFNA-------SLQSYGGDMAVSAMAIL--------TSVMQFALLPLQGLGQGAQPIISYNYGAGNAGRVKSAFKLLLKVSLCYS----TILWGAVMLFPEVFAGMF--TTEADLIVFTRPALRIYMAVMLIFGIQMACQMTFNALGRAVESIVVAVMRKFILLLPLIYIM---PLLFSSNKTM 420
>gi|163815282|ref|ZP_02206659.1| hypothetical protein COPEUT_01442 [Coprococcus eutactus ATCC 27759] >gi|158449477|gb|EDP26472.1| hypothetical protein COPEUT_01442 [Coprococcus eutactus ATCC 27759] (492 aa)
Score = 102, Expect = 4.0e-02, Identities = 88/435 (20%), Positives = 174/435 (40%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLR-DASIAVANIVYVIVFFGTLNAISTAPGD--AGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAIEITSSIYLHLYMGKK 549
           +F+++ + ++ G +VL +  + Q  K        +S    +   I + V  M +   I+EA            +++  +V  Q +L      +YF+   +P I++ N     LRA G +    +  +++ + N+I  L F  V K+ + G G++ +I   V+  +V  +IL +E     + P     K ++  K+            LG  LR  A  A+   V+ +        I++   D  AG S GL F               +F I          ++ NY     +R +      ++ G    +L+ AVF  + +  G  +  F+  +     + L  +   +L +    +  ++  +L +  GK  L  V ++   ++F    LY+++         K   F    N+ I S  I  T+ I  ++ + +K
  S:    97 LFVNVFVGLSVGVNVLVAHYIGQNKKDSISKCVHTSVKFAIICGIAMLVAGMFVARPILEA------------IDTPVKVLDQAVLYLR---IYFV--GMPFIILYNFGAAVLRAIGDTRRPLYCLIVSGVLNVILNLFFVCVCKLGVAGVGMATVISNVVSTGIVM-YILMHE-----EGPLRLDMKNIRIDKV-----------CLGKILRIGAPSAIQTAVFSLSNVLIQGGINSFGSDAVAGSSTGLNFE-----------YFAYFVISAYAQAAVTFVSQNYGAGEKQRCRKALRIAMLEG----MLMTAVFSCVMMLAGDFLVRFYTKDPEVIKYALIRMKHVMLLEAMTGTYEMTAAAL-RGLGKSMLPAVITVIGSVVFRIIWLYTVFA--------KYHSFGMLLNVYIVSWIITGTAMIIAYILVSRK 476
>gi|126174387|ref|YP_001050536.1| multi anti extrusion protein MatE [Shewanella baltica OS155] >gi|125997592|gb|ABN61667.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS155] (546 aa)
Score = 102, Expect = 4.1e-02, Identities = 66/324 (20%), Positives = 135/324 (41%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILL-VASFILFYEFVNK------GDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNL-IFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF--WPIFLFG 435
           + ++  ++   I +G + L SR L   +  K   I  + F   L   +++TV+ ++    ++      ST++                  AA +Y+  I        +L+L    LRA+G+   +    L++ + NI+F+ +F  V +M + G   + + G  V++ + V  F+    F NK         P  F  +Q+K      N+     IL LG+ +  + + +A ++ ++      +  +  P     +          + G   +N+ I   +  +    + I AYNY      RV     +GI+    +  ++  +F  +P  +FG
  S:   106 LQMMIFALACMIGNGTATLVSRFLGANEFDKASQIANTGFALALACGVIVTVVSLAQLDNLLAFIGVSSTLAL-----------------AATEYLQPILCFSLFTFLLSLSGDLLRAQGKVVVMLLVILLSAVMNILFDTLFIAVLEMGVSGAAWATVAGQCVSLFIAVVYFVPNNRFANKQALHRQAAQPICFRIEQIK-----LNLTEIKAILGLGSPILLSYLGIACVISLVNHILVSHLANVVPNTPAANEVAYMISAYGLIGR--FNIFIALPLMALTSAAQTISAYNYGAMASSRVLACAKWGIVLTCCYLSVVTIIFMGFPTSVFG 415
>gi|149116790|ref|ZP_01843506.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS223] >gi|146863218|gb|EDK48775.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS223] (451 aa)
Score = 101, Expect = 4.5e-02, Identities = 57/260 (21%), Positives = 99/260 (38%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILL 279
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  +IG  I  G++ L S  L Q +  K + +  ++F  CL    +  ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +T+  ++  + N   + +F +VF   + G  I+ ++   V  LL
  S:    18 EPIAKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGETGL---------AGM----------------------------MLAY------PVGAILYAIGAMIGMGSAALVSINLGQGNVAKARKLLGNAFSLCLLAGAIFALIGGIFSRDILIALGAQGD-----------------ILENANEYLFWYFALCHFPIISM--TFTTLLRNDGRPSMVTWVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMMSQAVTGLL 217
>gi|57167602|ref|ZP_00366742.1| MATE efflux family protein, putative [Campylobacter coli RM2228] >gi|57020724|gb|EAL57388.1| MATE efflux family protein, putative [Campylobacter coli RM2228] (443 aa)
Score = 101, Expect = 4.5e-02, Identities = 67/320 (20%), Positives = 123/320 (38%)
  Q:   215 PIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLK--EFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISSIAI 534
           P  M    L  +LR  G++ +     +I  L NI+ + IF +V    +    ++  +G  +  +              G +PF F   +LK     +N  +F   +      F  + S ++  I   +V              +G  A  AF+ +  +      N I   I  + D ++P L+YNY K+++ R+K +       G + SLL  A+   IF+ G   V  F   N    I    +      F +     ++   S   ++ K   +++ SL+Q L      L  + +I  L   +    F  F  + ++ I +
  S:   143 PFTMCSFALDNYLRICGKTTYSMTMNVIIALSNIVLDYIFIVVLGWGLFSAALATCLGLMLGGIF-------------GIFPFLFQNLELKFSSLYMNMKIFKNIVYNGSSEFFGNISGSLYGIFANLVLLKI----------SGTQAVAAFSIVSYID-----NFIIMLIIAMGDAMQPALSYNYAKKDFSRIKDILKVMFFAGAILSLLSVAM---IFVLGKDLVGLFTQENDQEFIIFAYMALMLFSFNYFFAWFNVLSGSFLTASNKASFSLILSLSQNLFIPLCFLLILSSIMGLKGVWLSPFFAEFCVLVLACIFV 433
>gi|84386803|ref|ZP_00989828.1| Na+ driven multidrug efflux pump [Vibrio splendidus 12B01] >gi|84378331|gb|EAP95189.1| Na+ driven multidrug efflux pump [Vibrio splendidus 12B01] (448 aa)
Score = 101, Expect = 4.6e-02, Identities = 75/384 (19%), Positives = 150/384 (39%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVS--TSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           IF +I + +  G + L S  + + +    ++++  S  S    + VL+ + +SI  Y ++  IA    S   +E+ + Y  V             +F+  S+  +M       F+R +      T+A  I  + N++ +  F L +   + G      I   V      + IL   FV K          +L    I  +   + L +   TF  + + A+  +++  V             +  ++ GL  N         I     F + GI    +PI+++N+      R++ ++  G+ + +   L    VF  I     P + + +  ++   I +         F  PL+ +++   +LFQ+T K     + SL +G +F
  S:    60 IFTAIAMMVGIGGAALMSIEVGKGNSASGQTLFSQSMLS----TAVLSTISVSIALYFLDDMIALMGASGYMAELTHDYLAVM----------LPFFVLYSLAWVMSC-----FVRNDTNPKLATYAMSIGAVVNLVLDYFFVLKWGWGMKGAAYGTAIAQGV-----IACILLSHFVRKQ------GTLELSLKGIGLDKLPSILKIGTPTFFIEVTAAMTILLFNYVLLHQFGE------NHIIAYGLTAN---------IGVFALFVMVGIAQACQPIISFNHGANQPNRIEAIFRLGLKSAIGSGL----VFMVIVYLLAPQIAALYLGDSSDLIALSATALTFFFFAVPLMGINLVIANLFQATAKPKQATLISLGRGFVF 396
>gi|160881444|ref|YP_001560412.1| MATE efflux family protein [Clostridium phytofermentans ISDg] >gi|160430110|gb|ABX43673.1| MATE efflux family protein [Clostridium phytofermentans ISDg] (460 aa)
Score = 101, Expect = 4.8e-02, Identities = 83/411 (20%), Positives = 169/411 (41%)
  Q:   135 LAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAISS-IAIEITSSIYLHLY 545
           L ++D +  + I  +SF+S + +SI+LT +I+     I+           SE    Y        L+  N Y     G+I + + L +  F +  +G +    +   I  + NII + I    F M + G  ++ ++   V+ + V  F++  + V +          + +  +    +    + L L  F+   + AV     +IV F +  ++    GD  V A      I   S  P+         G+  G +PI++YN+   N  R+K  +   + + + +S L+    W I +F  P +     AN+P  I          +    +  + I+    F + G   +++  +L + +    P+++ +    I + D    +F  F    I+  IA+  T+S++++ +
  S:    86 LGKKDPESAEKILGNSFFSLITVSIILTAVILIFGEPIL------MIFGASENTIGYG-------LDYLNIYAL---GTIFVQITLGMNAF-ISTQGFAKTSMYTVAIGAIINIILDPILIFGFDMGVKGAALATILSQAVSCIWVIRFLISDKSVLR---------IKKENVRFTPKIMLPCIALGLSPFIMQFTEAV-----IIVCFNS--SLYKYGGDLAVGAMTILASIMQFSMLPLQ--------GLTQGAQPIISYNFGAGNIDRIKKTFKILVTSCLTYSTLL----WAIAMF-VPKLFIIIFANSPELIDYTVWAVRIYMATSCIFGIQIACQQTFIAIGNAKISMFLALLRKVFLLIPLIFIL---PIFIED---KVFAVFLAEPIADFIAVSTTASMFIYTF 445
>gi|116493308|ref|YP_805043.1| Na+-driven multidrug efflux pump [Pediococcus pentosaceus ATCC 25745] >gi|116103458|gb|ABJ68601.1| Na+-driven multidrug efflux pump [Pediococcus pentosaceus ATCC 25745] (446 aa)
Score = 101, Expect = 4.8e-02, Identities = 69/321 (21%), Positives = 135/321 (42%)
  Q:   107 SVIGTVNLIFISIGLF--INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           SV  T  L F+ IG    + +G S++ ++     D +  K  + +S + C   +++LTV+ +     ++E     +                  I++ A  ++  I G +   M  NL    LRA G S       +IA + N++ ++I  +   M + G GI+ +    ++  L   +I       K   P      ++KE K N  +    + + L    + + IA+ +I+  I    +LN +    G + ++A  A   +  ++  P+ +L      GI   +    A NY  + +KR+       +IT V +S ++ A+
  S:    50 SVGATNGLTFLIIGFAQGMTTGLSIITAQHYGAGDVKAVKQSFATSIWICGVFALMLTVVSVLAARPLLEMMQTPAN-----------------IIDGATTFLTIIFGGVLATMFFNLFSNMLRALGNSRLPLVFLVIACIINVVLDIILIVFLHMGVAGAGIATVTAQLISCFLCWFYI-------KSHVPVLSL--EVKEIKTNMKLVREQIKIGLPMGFQASIIAIGSIILQI----SLNHL----GSSAIAAYTAAGKVDQLATQPMMSL------GIT--MATFTAQNYGAKKFKRILKGIRQTLITSVAYSFIVGAL 330
>gi|168333977|ref|ZP_02692201.1| MATE efflux family protein [Epulopiscium sp. 'N.t. morphotype B'] (461 aa)
Score = 101, Expect = 5.0e-02, Identities = 44/222 (19%), Positives = 93/222 (41%)
  Q:   223 LIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFN 444
           L  F+  +G + F     LI  + NII + IF   F M + G  ++ +I   V+    A++++++    K          + +  KI   V    + L +  F+  ++ ++ NIV+ +       +++   GD  + A    + + +        ++   + GI  G +P+++YN+  + Y RV+      +     F++     FW +      +  S FN
  S:   155 LNMFITTQGFTKFSMLTVLIGAILNIILDPIFIFAFGMGVKGAALATIISQGVS----ATWVIWFLRSKKSKLKI-----RKQNLKIQPKVILPVMALGVSPFIMTSTESILNIVFNV-------SLAKYGGDLAIGAMTIISSLMS--------MLMMPLQGITQGAQPVISYNFGAKKYDRVRSAIKVQVAICATFAI----AFWFLLETFPATFISIFN 348
>gi|187735321|ref|YP_001877433.1| multi antimicrobial extrusion protein MatE [Akkermansia muciniphila ATCC BAA-835] >gi|187425373|gb|ACD04652.1| multi antimicrobial extrusion protein MatE [Akkermansia muciniphila ATCC BAA-835] (459 aa)
Score = 101, Expect = 5.2e-02, Identities = 80/388 (20%), Positives = 153/388 (39%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNV--FTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYG--IVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN-TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP 501
           ++F  IGL    G+SV+ S  L++   +  +            L++   +L ++I   +  A +     +T+  + +   +   +      +Y+ +   S+   M  ++ +F +R +G         +IA +  +I   +F       + G   +  I  F +       I  + F +K           L+ + I W++  F  SL+  +      +S  +       + F   + +    GD GV A           G   Y L F  + G  I    +PI++YN+     KRV       + T VV  ++  A F    LF    V  F N + T + I +    + +L F F +++L + G   +QS   + L  + +L +G +F  P
  S:    62 MLFTGIGLMAGVGSSVVASIQLSKGKLEAAR------------LNVTQALLFVTIAAIVPSALMMAYPSATARFLGASEHLTPMV-----REYLLWFIPSLIFQMWCSVCLFMIRLDGAPKLAMMCNIIAAIITVILGWLFIFPLGWGLTGAAFAATIALFAS--GATGLIYLWIFAHK-----------LRLYPIKWSIRSFRFSLLNIVCQCRIGSSALLTEATLATLMFVGNHTLMKYLGDNGVGA----------FGIACYYLPFVFMVGNAIAQSAQPIISYNFGLGEKKRVADTKRIALFTSVVCGIVTTAAF---ILFPHILVGLFVNPDSTAALIAIEGFPYFSLAFVFFIINLMLIG--YYQSVENVKLANLFALLRGFVFLIP 409
>gi|66880451|ref|ZP_00405432.1| COG0534: Na+-driven multidrug efflux pump [Mycoplasma genitalium G-37] (143 aa)
Score = 101, Expect = 5.3e-02, Identities = 33/140 (23%), Positives = 71/140 (50%)
  Q:     8 KRKFLNESMYETESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIW 147
           +++ L ++++E++ +    L+  VP+ F +L    Y+F+DQI++   +P + +N  ++      L  +   S    +DS  +    I Q  + ++     +I  +N    +I +FI  G  V+FS+A+ + D+ K +  W
  S:     9 EKQLLIKNVFESKQLFLTILRFTVPTFFFALFSAAYVFIDQIMVIKFVPRSELN-PDSIFTDQSLIDEFKNSAFYKSDSFLSSGLNIKQFIKTVLNISQPLIVLLN----AINIFIPLGTGVIFSKAIGRNDQNKIQEAW 143
>gi|152978979|ref|YP_001344608.1| multi anti extrusion protein MatE [Actinobacillus succinogenes 130Z] >gi|150840702|gb|ABR74673.1| multi antimicrobial extrusion protein MatE [Actinobacillus succinogenes 130Z] (493 aa)
Score = 101, Expect = 5.3e-02, Identities = 84/396 (21%), Positives = 163/396 (41%)
  Q:   103 VYQTSVIGTVNLIF------ISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFF---LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           V   + +G VN+I         + L +  G   L S+ L  ++ ++ ++   + F     +S++ + L+   +  +V A  A   +    +                     + +G +P ++ + L  +    ++A G+    T     A + NI+  L F L     + G   +  I +     L  +  LFY  + K    F   F +   FK  +N         L   + + S A+A    V++   T+ A+    G  GVSA  A + IQ +       L+F    GI DGL P++AY++     +R++ ++ +         +LI   F  + L+G   V+ FF +     I + T       + F    +++  +S F + G  F +++ +  +G+IF
  S:    89 VLGATALGGVNIILPLFSVEFVVALIVGVGIQTLVSQGLGNKNAEQVQNAVKTGFIGLAVVSLIASSLLWIFREPLVRAMGADDVLMPHALA--------------------YFSGLVPFMLPMTLAFYLDLLIKAFGKPLLSTLIMSSAVVLNIVLSLTFVLWLDWGVFGASFATSIAFS----LAFAVALFY--LPKPYSLFKGNFSRRLLFKACYN--------GLSEGVSELSSAIA----VLIINRTVMAML---GADGVSAYSAISYIQFIG-----VLVFL---GISDGLIPVMAYHFGAGKTERLQRIFLFTAKVNATLGVLI---FTALQLWGSYFVSLFFQSGDQKVIQLATNSLKIFSWVFLAEGITLLIISYFTALGNAFGSMIIAALRGVIF 441
>gi|87119531|ref|ZP_01075428.1| MATE efflux family protein [Marinomonas sp. MED121] >gi|86165007|gb|EAQ66275.1| MATE efflux family protein [Marinomonas sp. MED121] (444 aa)
Score = 101, Expect = 5.5e-02, Identities = 76/346 (21%), Positives = 144/346 (41%)
  Q:    98 NRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK-----VVYYYGIITGVVFSLLINAVFWPIFLF-GGP---SVTSFF 443
           ++  +V       ++    ISIG+ ++  A+ + SRA+ + D+++ +    +     + LS+++   +M    +++                 Y    + + L+ A  Y+      +P IM+  +    +RA G +    +A LI+ L N + + IF     M + G  I+ LI    +++ +A + L +       + + + ++ LK  KI W  F           L + S  +AN + V     T        GD  V+A      I  V        +F  ++ +   + PIL  NY   N+ R++      V Y      ++  LL    FW + +F  GP   S+ SFF
  S:    45 DQKEVVAAVGFASSIMFFTISIGIAVSVSATAMVSRAVGRGDREQAQRRATNVLVFGVLLSLLIVYFLMPRIPHLL-----------------YFLGANGITLDLATSYLEISILGMPAIMVGMIGSGIMRALGDAKRAMYATLISGLVNAVLDPIFIFALGMGLDGAAIASLIAR-CSMVAIAYYGLVHVHQTLSRFDWLYFWQDLK--KIVWITFPA--------MLTNMSSPLANAI-VTEHMATF-------GDDAVAAYSIIGRIIPV--------VFGGLFALSGAVGPILGQNYGANNFARMQQTLTSAVIYSLSYCLLLCWLLYALQFWLVDVFSAGPETASLISFF 355
>gi|170755229|ref|YP_001779958.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] >gi|169120441|gb|ACA44277.1| MATE efflux family protein [Clostridium botulinum B1 str. Okra] (442 aa)
Score = 100, Expect = 5.8e-02, Identities = 39/168 (23%), Positives = 79/168 (47%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL 285
           SI + +  GAS  FS+    +   + K    +SF+  LF+SI+L+++               + V   E++  +   +  +  +A  +Y+ +I   +    + N+  + LR+ G S    +  +++ + N I +LIF LVF M + G G++  I   ++ L  A + +
  S:    63 SILIGLAMGASAFFSQLYGAKQYDEMKKAISTSFFFILFISILLSII---------------TNVFLYEIIELFQMPKDTVTYSA--EYLRYILTGLIFTGLYNICAYLLRSVGDSKSPLYFLIVSCIVNTILDLIFVLVFNMGVSGVGLATFIAQGLSALWCAFYTV 213
>gi|169338016|ref|ZP_02621135.2| mate efflux family protein [Clostridium botulinum C str. Eklund] >gi|169295609|gb|EDS77742.1| mate efflux family protein [Clostridium botulinum C str. Eklund] (438 aa)
Score = 100, Expect = 5.9e-02, Identities = 72/266 (27%), Positives = 115/266 (43%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFF--------LVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL--INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           +R+EG         L+  L NII + IF         +   + I G  I+ +I   VN +LV     F+ F +K     S +  ++++  +     T+  I S+G  L   SI +AN   V ++   L       G+  V+A              I  +IF  I+GI  G++PIL YNY  + Y RV       I++G+  + +  I   F+P  LF        F  + P+ I +        L   PL+   I   + FQ+ GK  ++I  S 
  S:   134 IRSEGNPKIAMRTMLVGALLNIILDPIFIFDSIFNIKIGLGLGIKGAAIATIISATVNTILV-----FHYFTSKN----SGSILKIRKCNLKLTFKTSKDIFSIG--LSPFSIQLANSAVVALYNMGLLKYG---GNDAVAA--------MSIIASISTIIFMPIFGINQGVQPILGYNYGAKLYPRVIKAIKLAIMSGISIASIGFIAVEFFPHILFKA------FAKDAPNLIVLGCHGIRIDLILLPLVGYQIVTSNYFQAIGKAKISIFLSF 381
>gi|124002704|ref|ZP_01687556.1| mate efflux family protein [Microscilla marina ATCC 23134] >gi|123991932|gb|EAY31319.1| mate efflux family protein [Microscilla marina ATCC 23134] (475 aa)
Score = 100, Expect = 5.9e-02, Identities = 81/397 (20%), Positives = 162/397 (40%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMIL--NLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLL--FCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           S++  + +I  ++   I  G++ + SRA+  QD +  + ++ +     L  S +LTVL      YI  + +        EV           ++   +    F+ GS   +  +  N+LI   RAEG+       A I+ + N++ + +F   F   I G  ++ +    V        +L Y +  KG   F    K++               L      +   + VA ++  ++F      +  +    G    +AF      +   +  L    ++G+V  ++PI+  NY  ++++RVK      +  G+V   L+ A++ P+ LF     T+  +   P     +T +  F   +   P + L     +  QS G   L+ + ++A+ ++FF P +
  S:    61 SLVLPITMIPAALSAMIGVGSASVLSRAIGSQDVETQQKVFSNLLGMSLVFSAILTVL-----GYIYASPLIAFMGGKGEV-----------LVYGTSYLEIFMLGSFFRVFAIATNMLI---RAEGKVNIAMKYAAISMVINMVLDPLFITGFGWGIEGASLATVSSLGVYT------VLNYLYFVKGKNSFPVDLKKVT--------------LDRSILPKVLGVGVAAMMMQLMFLVQQTFVFKSIAYYGNDNDIAFMG----ACYRVLMLAIVPVFGLVQAMQPIVGINYGAKDFQRVKQTVKVFVTGGMV---LLTAIWLPVQLFP----TTILHWLLPDMRFTVTDINNFRVAMIMMPAIPLVFIVGNFLQSIGNGLLSGIITVARQVVFFIPTV 411
>gi|168696247|ref|ZP_02728524.1| putative drug/sodium antiporter [Clostridium difficile QCD-37x79] (451 aa)
Score = 100, Expect = 6.0e-02, Identities = 64/280 (22%), Positives = 113/280 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGI-SILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           ++ +G     T   +I+ L NII + +F + F   + G GI ++L   F  I  +  F+     +N     F   FK L++   I +   TT L   +   L + S+        ++++  +N I+T                          L+   + GI  G++P+ ++ Y   N   VK +   GI   ++ S+   AVF     F GP V+ F +       +    +F      F L+ +++     F S  K  ++ V SL +GL+     L SM
  S:   158 IKTDGFPILATVGVIISALTNIILDYLFVIEFGWGVKGAGIATVLSQVFSTIFFLIHFLRKNSTLNFSK--FRIDFKTLRKIVFIGFPDSTTELSCGIVVLLFNLSLTKYIGENALIYYSVINYINT--------------------------LVLMTMMGITQGMQPLTSFYYGAGNIDNVKKLLKMGIKATIIASV---AVFAICMAFSGPIVSLFIHPEETMLFNEGVRVFKIFSISFLLVGINVIISGFFVSVEKPSISTVISLGRGLVIVVLSLISM 408
>gi|160894389|ref|ZP_02075166.1| hypothetical protein CLOL250_01942 [Clostridium sp. L2-50] >gi|156864090|gb|EDO57521.1| hypothetical protein CLOL250_01942 [Clostridium sp. L2-50] (431 aa)
Score = 100, Expect = 6.0e-02, Identities = 55/258 (21%), Positives = 104/258 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           F+ ++G       + LI  + NII + IF  V  + + G  I+ +I  F + + V  F+     V    +   +         + W      + L + +F+    +A  N +  +V   TL       GD  V      N ++ +   P+         GI +G  P++++NY +  Y++V+    +  I  V ++    A +  + LF  P +  F   ++P  I           F F  ++L  +G S+F + GK
  S:   136 FINSQGFGNTGMISVLIGAVLNIILDPIFIFVLNLGVRGAAIATIISQFCSTVWVLVFLTGKRAVLHLKWSCMW---------LQWKRVLRIIGLGVSSFI----MAFTNSLVQVVCNATLQVYG---GDIYVGVMTVLNSVRDICTLPVM--------GITNGASPVMSFNYGEGAYEKVRKAIRFLTILCVTYTF---AAWGILRLFPEPFIRIF--NHSPELIAKGVPALHIYFFGFCFMALQFTGQSVFLALGK 364
>gi|187933298|ref|YP_001885888.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] >gi|187721451|gb|ACD22672.1| mate efflux family protein [Clostridium botulinum B str. Eklund 17B] (456 aa)
Score = 100, Expect = 6.1e-02, Identities = 66/350 (18%), Positives = 140/350 (40%)
  Q:    97 ANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN 446
           AN ++ +    V   + LI  +    I  G + + +  + ++D    + I  +SF +   L I LT+     +  ++ A  A                     +  AN Y+  ++ G+I + + L +  F +  +G +       +I  + NI+ + I    F M + G  ++ ++   V+    A+++L+          F F  K + + +  + V    ++LS+       S  +      +V     N +S   GD  V A    + I  +        I   + G+  G +PI++YNY  +N  RVK  +   +I+ + +++++    W + +         FN++
  S:    51 ANGDIAMAGVGVAFPIILIISAFSALIGMGGAPIAAIKMGEKDNDGAEKILSNSFSTLTILGIALTIGFFIFKEPLLWAFGASEAT-----------------IGFANDYLGIYLVGTIAVQIALGMNPF-INTQGFAKVGMTTVMIGAVINIVLDPILIFGFNMGVKGAALATILSQTVS----AAWVLY----------FLFGKKSILKIRNKYLVPDAKIVLSIMAL--GVSPFIMQATESLVLISQNNQLSLYGGDLAVGAMTIMSSIMQI--------ILLPLMGLSQGAQPIISYNYGAKNVNRVKKTFKLLLISCLSYTVIM----WLLIMVFPQGFVKLFNSD 355
>gi|117920146|ref|YP_869338.1| MATE efflux family protein [Shewanella sp. ANA-3] >gi|117612478|gb|ABK47932.1| MATE efflux family protein [Shewanella sp. ANA-3] (520 aa)
Score = 100, Expect = 6.1e-02, Identities = 82/395 (20%), Positives = 155/395 (39%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSS----FYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLA-FNDIQTVSGTPIYNLI---FFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLS--LSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           G+++    SIG+ ++     L SR++  +D +  K + ++S        LF+S+V+T  I  + T +       ++  T+E+               A  Y+Y +  S+P I +   L   LRA G +     + L     N + + IF  +F M I G  ++ ++   + + ++A   +  +    G + FS+    LK                               ++ I     L  I+T  G+A V+  +A F D        +  LI   F  I+ +   + PI+  N+    + RV+      +   + F  L   V   +       V S F+    S    L   FC+ +  F   S  L ++  S F + GK   + + ++ +  +   P +Y
  S:    56 GSISFFTTSIGIGLSIALGALVSRSIGAKDVELAKRLLLNSAAVTTLISLFVSVVVTCFIPELVTLV------GASGHTAEL---------------AESYLYILVPSLPFICLAMALGGALRAVGDAKLSMMSTLAGGGVNAVLDPIFIFLFAMGIEGAALASVLAR-IAVFIIAGRGVVVKHQLLGKFNFSYFVADLKP------------------------------IFAIAGPAMLTNIATPIGNAFVTRAIADFGDAYVAGWAVLGRLIPVTFGMIFALSGAIGPIVGQNFGAGRFDRVR----ESLTKAIQFCTLYVVVMSLLLFLLKSQVVSLFDMKGDSA--ALIEFFCSYIAVFFTFSGILFVANAS-FNNLGKAKYSTLFNVGKATLGTVPFVY 401
>gi|168184481|ref|ZP_02619145.1| MATE efflux family protein [Clostridium botulinum Bf] >gi|182672432|gb|EDT84393.1| MATE efflux family protein [Clostridium botulinum Bf] (456 aa)
Score = 100, Expect = 6.2e-02, Identities = 35/128 (27%), Positives = 56/128 (43%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           I    F  I+GI  GL+PI+  N+  + Y RVK       I   +F        W  ++     V S+F  N  + I      F  +   FP+  L +  ++ FQS GK   + + ++ + +I F PI
  S:   280 ILMFTFIPIWGIGQGLQPIVGMNFGAKKYDRVKDAVKIFSIASTIFI----GALWGFYMLKPRVVLSWF-INDKTIIENGYNFFRLMFLTFPVSGLIVMSMTFFQSIGKGGKSALITILKQVILFMPI 402
>gi|168179246|ref|ZP_02613910.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] >gi|182669545|gb|EDT81521.1| MATE efflux family protein [Clostridium botulinum NCTC 2916] (456 aa)
Score = 100, Expect = 6.2e-02, Identities = 35/128 (27%), Positives = 56/128 (43%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPI 502
           I    F  I+GI  GL+PI+  N+  + Y RVK       I   +F        W  ++     V S+F  N  + I      F  +   FP+  L +  ++ FQS GK   + + ++ + +I F PI
  S:   280 ILMFTFIPIWGIGQGLQPIVGMNFGAKKYDRVKDAVKIFSIASTIFI----GALWGFYMLKPRVVLSWF-INDKTIIENGYNFFRLMFLTFPVSGLIVMSMTFFQSIGKGGKSALITILKQVILFMPI 402
>gi|153855818|ref|ZP_01996804.1| hypothetical protein DORLON_02825 [Dorea longicatena DSM 13814] >gi|149751859|gb|EDM61790.1| hypothetical protein DORLON_02825 [Dorea longicatena DSM 13814] (449 aa)
Score = 100, Expect = 6.2e-02, Identities = 66/306 (21%), Positives = 121/306 (39%)
  Q:   122 FINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLN-AISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           F   G + L S  L +++KQ  + I  +S    +  S++LT      +T I+ A  A                    I+ A +    ++ G+I + + L L  + +  +G +     + LI  + NI  + +F  V  + + G  I+ ++   V+   V  F+   + V             LK  ++  +V      L +  F+  ++ ++  I        TLN  +    GD  V +              I  LI   + GI  G++PI++YNY   N +RVK      I+  +  +LL+  V
  S:    72 FAGMGGAPLASIQLGKKNKQGAEQILGNSAGLLILFSVILTAFFSICKTPILYAFGASDAT----------------IVYARDYISIYLIGTIFVQLALGLNAY-ISGQGEAKTAMLSVLIGAVLNICLDPVFIFVLHLGVRGAAIATILSQAVSAAWVVHFLTSEKTV---------MHLSLKNMRLRADVIKMIAGLGISPFIMQSTESLVTI--------TLNTGLQRYGGDLYVGSMSIL--------MSIMQLITIPVQGITQGIQPIISYNYGAGNKERVKDTMKRMILVCLAGTLLLAGV 336
>gi|113969963|ref|YP_733756.1| MATE efflux family protein [Shewanella sp. MR-4] >gi|113884647|gb|ABI38699.1| MATE efflux family protein [Shewanella sp. MR-4] (520 aa)
Score = 100, Expect = 6.4e-02, Identities = 59/245 (24%), Positives = 108/245 (44%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSS----FYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKE-FKINWNVFTTSLILSLGTFLRDASIAVANIVYVI----------VFFGTLNAISTAPG 354
           G+++    SIG+ ++     L SR++  +D +  K + ++S        LF+S+V+T  I  + T +       ++  T+E+               A  Y+Y +  S+P I +   L   LRA G +     + L     N + + IF  +F M I G  ++ ++   + + ++A   +  +    G + FS+    LK  F I      T++   +G      +IA     YV           V FG + A+S A G
  S:    56 GSISFFTTSIGIGLSIALGALVSRSIGAKDVELAKRLLLNSAAVTTLISLFVSVVVTCFIPELVTLV------GASGHTAEL---------------AESYLYILVPSLPFICLAMALGGALRAVGDAKLSMMSTLAGGGVNAVLDPIFIFLFAMGIEGAALASVLAR-IAVFIIAGRGVVVKHQLLGKFNFSYFVADLKPIFAIAGPAMLTNIATPIGNAFVTRAIADFGDAYVAGWAVLGRLVPVTFGMIFALSGAIG 293
>gi|114047198|ref|YP_737748.1| MATE efflux family protein [Shewanella sp. MR-7] >gi|113888640|gb|ABI42691.1| MATE efflux family protein [Shewanella sp. MR-7] (517 aa)
Score = 100, Expect = 6.4e-02, Identities = 59/245 (24%), Positives = 108/245 (44%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSS----FYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKE-FKINWNVFTTSLILSLGTFLRDASIAVANIVYVI----------VFFGTLNAISTAPG 354
           G+++    SIG+ ++     L SR++  +D +  K + ++S        LF+S+V+T  I  + T +       ++  T+E+               A  Y+Y +  S+P I +   L   LRA G +     + L     N + + IF  +F M I G  ++ ++   + + ++A   +  +    G + FS+    LK  F I      T++   +G      +IA     YV           V FG + A+S A G
  S:    56 GSISFFTTSIGIGLSIALGALVSRSIGAKDVELAKRLLLNSAAVTTLISLFVSVVVTCFIPELVTLV------GASGHTAEL---------------AESYLYILVPSLPFICLAMALGGALRAVGDAKLSMMSTLAGGGVNAVLDPIFIFLFAMGIEGAALASVLAR-IAVFIIAGRGVVVKHQLLGKFNFSYFVADLKPIFAIAGPAMLTNIATPIGNAFVTRAIADFGDAYVAGWAVLGRLVPVTFGMIFALSGAIG 293
>gi|160880536|ref|YP_001559504.1| MATE efflux family protein [Clostridium phytofermentans ISDg] >gi|160429202|gb|ABX42765.1| MATE efflux family protein [Clostridium phytofermentans ISDg] (440 aa)
Score = 100, Expect = 6.5e-02, Identities = 69/299 (23%), Positives = 118/299 (39%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNV--FTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYG 413
           +F   GL    G SVL S A    D    K  + +S  S  F+SI L ++IM +    +   +  + V+                   A++Y   +    P+ M   LL  F+R +          +   + NII + IF  +F   + GG I+ +IG  +  L     IL   F  K +        QLK  K  +++  F+  +   L +FL + S  +   ++ I     +       GD G++       + ++     + ++  A  G+    +PILA N+     KRV  V + G
  S:    61 LFFGTGLLFGVGGSVLMSIANGSNDSLLGKQYFTTSVLSVTFISIFL-LIIMQLGFKPILYFLGATDVT----------------FTLASEYGRTLVAGAPVFMFSALLQAFIRNDKDPNLSMIGVITGGVTNIILDYIFIYIFHWGMFGGAIATVIGSSITCL-----ILIVHFFKKTN--------QLKLVKNGFSMKRFSKVVTSGLASFLIEISNGIVTFLFNIQLVKYI-------GDIGIT-------VYSIIANSSFIVMSLA-NGVAQASQPILAINFGAGERKRVDEVKHLG 316
>gi|160892531|ref|ZP_02073321.1| hypothetical protein CLOL250_00060 [Clostridium sp. L2-50] >gi|156865572|gb|EDO59003.1| hypothetical protein CLOL250_00060 [Clostridium sp. L2-50] (512 aa)
Score = 99, Expect = 7.4e-02, Identities = 32/131 (24%), Positives = 63/131 (48%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYS 505
           + ++ F  ++G+ +G+ PI++YNY  +   R+     Y ++  + F LL       + +  G  +  F        I +  L   ++ F F  + +  SG  +FQ+ GK   +++ SLA+ LI   P+ Y+
  S:   337 VQSMAFMPVFGLNNGMIPIVSYNYGAKQPDRMLKAVKYTMMAAICFMLL---CLTAMQVIPGLILKVFDAQEDMMAIGIPALRTMSISFLFAGICIVCSG--MFQALGKGVYSLIVSLARQLIVLLPVAYA 462
>gi|167405514|ref|ZP_02310269.1| hypothetical protein LmonocytFSL_22428 [Listeria monocytogenes FSL J2-003] (179 aa)
Score = 99, Expect = 8.2e-02, Identities = 33/129 (25%), Positives = 60/129 (46%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           I + +   I G+  G++PI+ +NY  + ++RV       +I   V SL+   +   + +F G  V  F  +N P  I   T     +L   P +   I    L+Q+ G+  ++ + SL + +I   P+L
  S:    11 IASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGL---VEIFPGLLVRIF--SNDPELIAQGTTAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQIICLVPLL 134
>gi|90412598|ref|ZP_01220600.1| putative MATE efflux family protein [Photobacterium profundum 3TCK] >gi|90326406|gb|EAS42818.1| putative MATE efflux family protein [Photobacterium profundum 3TCK] (445 aa)
Score = 99, Expect = 9.1e-02, Identities = 86/366 (23%), Positives = 146/366 (39%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGT---FLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV----KVVYYYGIITGVVFSLLINAVF-WPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           ++G  I  GAS L S  L Q D  + + I  ++    +  S +L V+ +     I+    A+                  LIL  A+ Y+  YF+ GS  +I +       LR +G+   +T+  +   +FNI+ + +  +VF   + G  I+ ++      LL                     F      +I W+    S+ L L T    LR  + ++   +Y+ V     N      GDA   A         VS T  +  + F   GI  G++PI +YN     + RV     + +   +   ++  L+I  +  W ++LF G + T       P  I+ +   F  L    P+  L + G + FQS  K
  S:    72 AVGAMIGMGASALVSIKLGQNDTAQARKIVGNALILSILASALLCVIGLLYGRDILLWVGAEG-----------------LILEMASDYLFWYFLMGSFAVISM--AFSSLLRNDGQPKRVTYIMIFGGIFNIVLDWLLIVVFPYALTGAAIATMLSQAATCLLCLQHF----------------FSDKSTLRIGWD----SIYLKLDTVIQILRLGTSSLLMYLYLSVVLVLHNKAFLWVGDAIHVAAYGI-----VSYTEAFFYLIFE--GIALGIQPITSYNTGAGLHARVIQARNIAFGVTLFIALIGLLVIYGLSDWVVYLFAGDNPTL-----KPEAINGMYRYFWGL----PMEGLLLVGATYFQSINK 392
>gi|160935063|ref|ZP_02082449.1| hypothetical protein CLOLEP_03939 [Clostridium leptum DSM 753] >gi|156866516|gb|EDO59888.1| hypothetical protein CLOLEP_03939 [Clostridium leptum DSM 753] (471 aa)
Score = 99, Expect = 9.2e-02, Identities = 29/110 (26%), Positives = 53/110 (48%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK 308
           +L+ A  YM  I   +P +M+ N     LRA G +       LIA   N++  L+F +VF M + G  ++ +I   V+ +++   ++  E V      +    K+L+ +K
  S:   123 VLDQAVLYMRIIFVGMPALMVYNFGAAILRAVGDTKRPLLFLLIAGAINVVLNLVFVIVFHMGVAGVAVATVISQCVSAVMIVVCLMRSETV------YQLCLKELRIYK 226
>gi|89889962|ref|ZP_01201473.1| putative Na+-driven multidrug efflux pump, MatE family [Flavobacteria bacterium BBFL7] >gi|89518235|gb|EAS20891.1| putative Na+-driven multidrug efflux pump, MatE family [Flavobacteria bacterium BBFL7] (450 aa)
Score = 99, Expect = 9.3e-02, Identities = 63/305 (20%), Positives = 119/305 (39%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           I   A  Y   +   +PI+ +  +    +RAEG       A LI ++ N++ + I    F + + G   +  + Y +    +A F +  +         S     +K+    +N+      L   T  R    A+++++Y+I+     N +    G+  VS          V    ++ L  F + GI  G  PI  YNY    + RV+ V +  I    +  + I   F  +F F       F    T  E     L    +    P++S+ + G + +Q+ GK+   ++ +L +      P++
  S:   134 IFEPAKIYYRIVLYGVPILALCMMGNNVIRAEGAPAHAMIAMLIPSVGNLLLDFILINQFNLGMAGAAWATTVSYILCFAYIAWFFISGK---------SELIGNIKDLIPEFNILKEIGGLGFVTLSRQ---AMSSVLYLILN----NVLFELGGEESVSV------FGIVGRMMMFAL--FPVMGITQGFLPIAGYNYGALKWSRVREVIFTSIKYACIMGIFI---FMGLFFFTREIAGVFTKNETVIEQASFALKL--VFIAVPIISIQLIGAAYYQAIGKVIPALLLTLLRMGFILIPLV 409
>gi|160875421|ref|YP_001554737.1| multi anti extrusion protein MatE [Shewanella baltica OS195] >gi|160860943|gb|ABX49477.1| multi antimicrobial extrusion protein MatE [Shewanella baltica OS195] (541 aa)
Score = 99, Expect = 9.4e-02, Identities = 73/380 (19%), Positives = 152/380 (40%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILL-VASFILFYEFVNK------GDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNL-IFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVAS 491
           + ++  ++   I +G + L SR L   +  K   I  + F   L   +++TV+ ++    ++      ST++                  AA +Y+  I        +L+L    LRA+G+   +    L++ + NI+F+ +F  V +M + G   + + G  V++ + V  F+    F NK         P  F  +Q+K      N+     IL LG+ +  + + +A ++ ++      +  +  P     +          + G   +N+ I   +  +    + I AYNY      RV     +GI+    +  ++  +F      G P+       +  S I     +        PL  ++   ++++Q T +  L ++ S
  S:   101 LQMMIFALACMIGNGTATLVSRFLGANEFDKASQIANTGFALALCCGVIVTVVSLAQLDNLLAFIGVSSTLAL-----------------AATEYLQPILCFSLFTFLLSLSGDLLRAQGKVVVMLLVILLSAVMNILFDTLFISVLEMGVSGAAWATVAGQCVSLFIAVVYFVPNNRFANKQALHKQAAQPICFRKEQIK-----LNLTEIKAILGLGSPILLSYLGIACVISLVNHILVSHLANVVPNTPAANEVAYMISAYGLIGR--FNIFIALPLMALTSAAQTISAYNYGAMASSRVLACAKWGIVLTCCYLSVVTIIF-----MGFPTSVFGIFTDNHSLIAACIKISSVTFIALPLAGITGIAIAVYQGTNRPKLALLLS 459
>gi|151572848|gb|EDN38502.1| predicted protein [Francisella tularensis subsp. novicida GA99-3548] (461 aa)
Score = 99, Expect = 9.6e-02, Identities = 51/215 (23%), Positives = 96/215 (44%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFS-FAFKQLKEFKINWNVFTTSLILSLGT 324
           GT++    SIG+ I+    VL SR++ +  K            +C  ++I L  +++++   I   CI          + +  +      L  A +Y+  +  S PI+++       LRA G + F  ++ L+  L N + + IF  +  MD+ G  I+ +    + ILLVA   L +++    ++ F+ F    L   KI +    T++   +GT
  S:    79 GTISFFTTSIGIGISIAMGVLISRSIGEGKKY---------LANCYLVNIYLVAVLVAVPIAI---CIWFYIPDLLIFIGAKGRT-----LELATQYLQILIPSFPILVLGIASSTALRAFGDAKFSMYSTLLGGLVNAVLDPIFIFLLSMDVKGAAIASVFAR-ITILLVAFLTLLFKYRVSLNFDFNGFKKSLLPISKIAFPAILTNITTPIGT 276
>gi|167746319|ref|ZP_02418446.1| hypothetical protein ANACAC_01028 [Anaerostipes caccae DSM 14662] >gi|167654312|gb|EDR98441.1| hypothetical protein ANACAC_01028 [Anaerostipes caccae DSM 14662] (483 aa)
Score = 98, Expect = 9.8e-02, Identities = 67/314 (21%), Positives = 133/314 (42%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM-YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAI--YGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAV 427
           +I  +    I  G S   S  + QQD    + I  ++  + + L++ LT+       Y+ +  +     +T              IL  AN Y+  ++ GSI ++  L L   F+  +G +       LI  L NI+ + IF  +  + + G  ++ +I   V+    A+++L +    K D        + K  ++   V    + L +  F+  ++ ++  I        TLN+     G      G + + + +V+   I  + F ++   G+  G +PI+++NY  +N  RVK  +    +  V ++L I A+
  S:    76 MIISAFASMIGMGGSPRVSIKMGQQDHDGAEKILGNAVTALIALAVPLTLFF-----YLAKEPLLSMFGATDN------------ILPYANDYLGIYLLGSIFVMFSLGL-NSFITCQGFARTSMLTVLIGALLNIVLDPIFIFIMGLGVKGSALATVISQGVS----AAWVLRFLTGKKTDLKI-----RRKNLRLEAKVLLPVIALGIAPFIMQSTESLVQI--------TLNSGMKRYG------GASADSLVSVTTIAISAMQFLSMPALGLAQGAQPIISFNYGSRNMDRVKKAFRLLFVITVAYTLGIWAL 351
>gi|163789360|ref|ZP_02183799.1| Na+ driven multidrug efflux pump (mviN domain) [Carnobacterium sp. AT7] >gi|159875214|gb|EDP69279.1| Na+ driven multidrug efflux pump (mviN domain) [Carnobacterium sp. AT7] (405 aa)
Score = 98, Expect = 9.8e-02, Identities = 92/395 (23%), Positives = 164/395 (41%)
  Q:   100 NMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-EIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           +M +   S+   V L+ ++  L +  G S  FS +L +++ +K K    +     + L+I+  +L M +    +E  +     S++             +L  A  Y+  I        +   L  F RA+G       + +I   FNIIF+ IF +     + G   + + G F+++    ++ L Y    K +   +    +LK   +  ++ TT +      FL   + +V NIV    +V +G   AIS A    G+        I  VSG             ++ GL+PI++YN       RVK      +    +   +I+ + + +F F    V + FN  T   ++ V  +   T    FPL+ + I   S FQ+ GK+ L    +LA+
  S:     6 SMGLAAVSITYPVTLVLLAFALMVGVGGSTRFSISLGKKENEKAKFFLGNG----VTLAIMAGLLFMILGNVFIEPILRILGASSA-------------VLPYATDYLSVILYGAVFQSVAMALNNFSRADGNPRNSMISMMIGAGFNIIFDYIFIVQMGWGMKGAAYATIGGQFLSM----TWQLAYFLGPKANVQLAIQNMKLKAAYVK-DILTTGI----PAFLLQIANSVLNIVINASLVAYGGDIAISVA----GIITSATTIIIMMVSG-------------LIQGLQPIISYNTGADRTDRVK----EALKIASIIGGIISTIGFLVFQFYPEFVITLFNQETAVVDLGVNAIRIWTA--AFPLVGIQIVWASYFQAVGKVRLASFLNLAR 354
>gi|164687493|ref|ZP_02211521.1| hypothetical protein CLOBAR_01134 [Clostridium bartlettii DSM 16795] >gi|164603267|gb|EDQ96732.1| hypothetical protein CLOBAR_01134 [Clostridium bartlettii DSM 16795] (444 aa)
Score = 98, Expect = 1.0e-01, Identities = 47/231 (20%), Positives = 110/231 (47%)
  Q:   107 SVIGTVNLIFISIGLF---INSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIV 337
           + +GT NL+ + +  F   +++G+S++ S+   + D++K       + ++ + LS +  +++M +     E  +        +++N+ + V     +  A  Y+     S+  +MI N+    LRA G S    +    A + NII +L+F +VF M ++G  ++  +   ++ +L+   ++    V K           + + KI+ ++    L++ + T L+   +  +NI+
  S:    50 AAVGTCNLVVVFMIYFFIGLSNGSSIVLSQCFGENDEEKV----FKTVHTTMGLSFISGIVLMIVGLLCAETIL--------KMINTPDDV-----IGYAVTYIRVYFLSMIPMMIYNMGTGILRAMGDSKTPLYYLGAAGILNIILDLVFIIVFNMGVMGAALATTLSQTLSAILILIKLISSNEVYK---------LHISKIKIDKDILKHILVIGVPTGLQSVLVCFSNII 257
>gi|167760718|ref|ZP_02432845.1| hypothetical protein CLOSCI_03103 [Clostridium scindens ATCC 35704] >gi|167661605|gb|EDS05735.1| hypothetical protein CLOSCI_03103 [Clostridium scindens ATCC 35704] (455 aa)
Score = 98, Expect = 1.0e-01, Identities = 66/314 (21%), Positives = 130/314 (41%)
  Q:    43 YIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQD-KQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDA 356
           Y+F ++ L+  IIP               L  +Q+L+VL         D+++  +     V   S++  + ++ I++   + +G +V+  + L Q++ K+ CKS     ++  L  S+V+T+L+ + + +I+     K                   ++  AN Y+  +T SIP + + N      RA G S      ++I N+ N+    I    F     G  I  L+       +VA+ I+     N          ++   +K NW +    L + +   L ++   +  I+   ++  FGT    + A G+A
  S:    14 YLFDNKALLALIIP---------------LVIEQLLAVLV-----GMADSIMIASVGEAAVSGVSLVDQIMVLLINVFAALATGGAVVAGQYLGQKNQKEACKSATQLVWFITL-CSVVITLLVYAGKYFILHGIFGKIEAD---------------VMGHANTYLMIVTASIPFMALYNGGAAIFRAMGNSKVSMQVSIIMNIINVGGNAILIYGFHRGTEGVAIPTLVSR-----MVAAVIIIALLCNPNQL---LHIERTFRYKFNWQMVKKILSIGVPNGLENSMFQLGKILVLSLVSTFGTYAIAANAVGNA 286
>gi|120599642|ref|YP_964216.1| multi anti extrusion protein MatE [Shewanella sp. W3-18-1] >gi|124545091|ref|ZP_01704318.1| multi antimicrobial extrusion protein MatE [Shewanella putrefaciens 200] >gi|120559735|gb|ABM25662.1| multi antimicrobial extrusion protein MatE [Shewanella sp. W3-18-1] >gi|124511278|gb|EAY55343.1| multi antimicrobial extrusion protein MatE [Shewanella putrefaciens 200] (449 aa)
Score = 98, Expect = 1.0e-01, Identities = 58/260 (22%), Positives = 98/260 (37%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILL 279
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  +IG  I  G++ L S  L Q +  K + +  ++F  CL       ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +TF  ++  + N   + +F +VF   + G  I+ ++   V  LL
  S:    16 EPISKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGEAGL---------AGM----------------------------MLAY------PVGAILYAIGAMIGMGSAALVSINLGQGNVVKARKLLGNAFSLCLLAGGFFALMGGLFSRDILIALGAQGD-----------------ILENANQYLFWYFALCHFPIISM--AFTTLLRNDGRPSMVTFVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMLAQAVTGLL 215
>gi|184156160|ref|YP_001844500.1| hypothetical protein LAF_1684 [Lactobacillus fermentum IFO 3956] >gi|183227504|dbj|BAG28020.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956] (439 aa)
Score = 98, Expect = 1.1e-01, Identities = 81/411 (19%), Positives = 173/411 (42%)
  Q:    93 LIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLA-QGLIFFFPIL 503
            + Q   + +V   S    V  + I+IG     G S + SR   ++  Q+ +++   +FY+  F  I+++ L++  +   +   +  ++ +T +  + Y  V        A    + + G  P  +        LR EG +     A++   + NI+   IF     +   G  ++ +    +  LL    +++Y          S     +KE K++W++     I ++G        ++ N++  +    T   +     D+  + G+A      +  + I N+IF    G   G +P++ Y Y  ++ +R +    + ++    F+L++ A    I  F  P + ++F  + P+ +    ++   L+    L   ++   ++FQS GK    ++ SLA QG+IF   I+
  S:    38 FVAQTQNSALVAGVSQGAPVFTLLIAIGDIFGLGGSSVISRLFGEKRDQEGRNVSGYAFYAAFFWGIIVSALMLIFKDQALH--LLGASKATWKYADEYYTV-------MAWGAAFVVFGLAPNNI--------LRTEGLALESMKASMTGTIINIVLNPIFIFTLGLGAAGSALATVTSNVIGDLL----MIYYLRTKSQKLTTS-----IKETKVSWDL--KRQIYAIGI-----PASITNVMATLAMALTNRYLIDYGADSVAAMGIA------LKVSMIINMIFI---GFAFGAQPLIGYVYGAKDRRRFQGALRFDLLVVCGFALVMTA----IMFFLAPIIITWFMKD-PTIVKEGAIMVRWLVISSTLAGFTLVFTTVFQSMGKALPALLLSLARQGIIFTVAIV 402
>gi|146292362|ref|YP_001182786.1| multi anti extrusion protein MatE [Shewanella putrefaciens CN-32] >gi|145564052|gb|ABP74987.1| multi antimicrobial extrusion protein MatE [Shewanella putrefaciens CN-32] (449 aa)
Score = 98, Expect = 1.2e-01, Identities = 58/260 (22%), Positives = 98/260 (37%)
  Q:    20 ESIPKLTLKVLVPSLFVSLLFGIYIFVDQILMQHIIPVNGINYLENALLSAGLTKDQILSVLSPNDSQANYDNLIYQANRNMIVYQTSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM--YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILL 279
           E I KL  +  +P++   L+ G+Y+ +D I + H +   G+         AG+                            M+ Y       V  I  +IG  I  G++ L S  L Q +  K + +  ++F  CL       ++       I+ A  A+                   IL  AN+Y+  YF     PII +       LR +GR   +TF  ++  + N   + +F +VF   + G  I+ ++   V  LL
  S:    16 EPISKLFWRYTIPTIASMLVTGVYVTIDGIFVGHYLGEAGL---------AGM----------------------------MLAY------PVGAILYAIGAMIGMGSAALVSINLGQGNVVKARKLLGNAFSLCLLAGGFFALMGGLFSRDILIALGAQGD-----------------ILENANQYLFWYFALCHFPIISM--AFTTLLRNDGRPSMVTFVLILGGVLNTFLDWLFIVVFPFGLAGAAIATMLAQAVTGLL 215
>gi|18309812|ref|NP_561746.1| hypothetical protein CPE0830 [Clostridium perfringens str. 13] >gi|18144490|dbj|BAB80536.1| conserved hypothetical protein [Clostridium perfringens str. 13] (451 aa)
Score = 98, Expect = 1.2e-01, Identities = 62/285 (21%), Positives = 114/285 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEF-KINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFP---ILYSMWNIAI 511
           +RAEG +        I  + NI  + +F     M I G G++  I   ++   +  +IL    V        F F  LK+   I  + F T + +SL   L + S+      + +  +G +  ++                            I   + G+V G++PI+ ++    N  RV   +   +I     S  I      I L         F  +  + I+  + +  + +  +P L + ++ +  +QSTGK   +++ SL +  IFF P   IL S++N+ I
  S:   157 IRAEGSAKDAMCCMSIGMISNIFLDYLFICKLNMGITGAGLATSISKSLSFSYLTYYILNKSSVKLKLKYLKFDFSILKKIISIGTSAFITQVSISLVALLLNHSLVKYGGNFALSIYGIIYKLTL--------------------------FIQMPLSGLVQGMQPIIGFSTGANNRTRVINTFKLTLI----ISTFIATTLTLIILIKTDMFMKLFTTDI-NLINEGSKVLKSNIIMYPFLGIYLTSIGFYQSTGKGKESLILSLLRQFIFFIPLSIILPSLFNLGI 414
>gi|160940285|ref|ZP_02087630.1| hypothetical protein CLOBOL_05174 [Clostridium bolteae ATCC BAA-613] >gi|158436865|gb|EDP14632.1| hypothetical protein CLOBOL_05174 [Clostridium bolteae ATCC BAA-613] (483 aa)
Score = 98, Expect = 1.2e-01, Identities = 61/317 (19%), Positives = 129/317 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTP----SEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNIAILVSDYKVMLFTAFTNIAIS-SIAIEITSSIYL 542
           F+ A+G +    +  LI  + NII + I   VF M + G  ++ +I   ++    A++++ +   NK        F + K       +   ++ L    F+   + ++ NI +         ++    GD  V A      +   S  P        + G+  G +PI+++NY  +   RV   +   + + + +S     V W + +F        F  +      SE  +   +  +LLF        ++    F + G    ++  +L + +I   P++Y + N+      ++  +F  F    I+ +IA+  T +++L
  S:   187 FINAQGYAKTGMYTVLIGAICNIILDPILMFVFHMGVRGAALATIISQGIS----AAWVVLFLISNKSYLKIRTCFMRPKR-----EILMPAIALGAAPFVMQFTESILNICFN-------TSLLKYGGDVAVGAMTIMGSVMQFSLLP--------LQGLTQGAQPIISFNYGAKKLDRVSRTFRLLLTSCMTYS----TVLWAVAMFVPMVYIRIFTQDAALTAFSEWSIRIYMAASLLF-----GAQLACQQTFIAIGDSKTSLFLALLRKVILLIPLIYVLPNL------FENKVFAVFVAEPIADTIAVCTTVTLFL 469
>gi|167754976|ref|ZP_02427103.1| hypothetical protein CLORAM_00480 [Clostridium ramosum DSM 1402] >gi|167705026|gb|EDS19605.1| hypothetical protein CLORAM_00480 [Clostridium ramosum DSM 1402] (447 aa)
Score = 98, Expect = 1.2e-01, Identities = 38/135 (28%), Positives = 67/135 (49%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPS-VTSFFNANTP-SEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSMWNI 509
           + + I+    G++ G+RP+++YNY  +++ RVK +    II+  V       +F      G P  V S+FNA     EI ++ L   +  F    + + ISG  +F+S GK   ++  SL +  I   P+ Y +  +
  S:   283 LQSFIYMPANGLIQGMRPLISYNYGARHFDRVKKIIKVSIISTAVILCCGTIIF-----MGLPELVLSWFNATEQLLEIGIIGLRVISPCFILSTMGVVISG--VFESLGKGRQSLTISLLRQFIITLPLAYILLKV 412
>gi|167746391|ref|ZP_02418518.1| hypothetical protein ANACAC_01100 [Anaerostipes caccae DSM 14662] >gi|167654384|gb|EDR98513.1| hypothetical protein ANACAC_01100 [Anaerostipes caccae DSM 14662] (471 aa)
Score = 97, Expect = 1.3e-01, Identities = 79/380 (20%), Positives = 143/380 (37%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKE-FKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFL---FGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQ 494
           I I++ L I  G +  F+  + + + +K KS     F       ++L+ L +SI + +    I  +  ST +V               A  Y        P ++  N     +R++G   +     +   + N   + +F   F   I GG  + +IG  V+ ++ A ++  +              K  K+  KI  +     + + + +F    ++    I     + ++G L++  +    A     +  N            ++ FAI GI  G +PIL +NY  Q Y RV+      IIT       + A+F   F+        + S F   + +  H     F   LF   +  L     + F S GK +  I  SL +
  S:    67 ICIALSLLIGIGGASNFNLNMGRGENEKAKS-----FAGTSISLLILSGLALSIFSLLFLKPILIAFGSTKQV------------FPYALTYTRITALGFPFLIATNGFCNLIRSDGSPRYSMVVMVTGAVINTCLDPLFIFGFHWGIAGGAAATVIGQIVSCVMAAVYLTRFR-----------TMKLTKDCLKIKADNLKAIVSIGIASFFNQIAMMAVQIALNNTLAYYGALSSYGSDIPLACAGVIIKVNAF----------VMAFAI-GIAQGCQPILGFNYGAQLYGRVRDTLKKEIIT-------VTAIFSAAFICFQLIPRQIVSIFGEGSAAYFHFAERYFRIYLFMVFINGLQPIVSNFFSSIGKAWKGIFLSLTR 406
>gi|126699021|ref|YP_001087918.1| putative drug/sodium antiporter [Clostridium difficile 630] >gi|196125572|ref|ZP_03117321.1| putative drug/sodium antiporter [Clostridium difficile ATCC 43255] >gi|115250458|emb|CAJ68281.1| putative drug/sodium antiporter [Clostridium difficile 630] (451 aa)
Score = 97, Expect = 1.3e-01, Identities = 64/280 (22%), Positives = 112/280 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISI-LIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           ++ +G     T   +I+ L NII + +F + F   + G GI+  L   F  I  +  F+     +N     F   FK L++   I +   TT L   +   L + S+        ++++  +N I+T                          L+   + GI  G++P+ ++ Y   N   VK +   GI   ++ S+   AVF     F GP V+ F +       +    +F      F L+ +++     F S  K  ++ V SL +GL+     L SM
  S:   158 IKTDGFPILATVGVIISALTNIILDYLFVIEFGWGVKGAGIATGLSQVFSTIFFLIHFLRKNSTLNFSK--FRIDFKTLRKIVFIGFPDSTTELSCGIVVLLFNLSLTKYIGENALIYYSVINYINT--------------------------LVLMTMMGITQGMQPLTSFYYGAGNIDNVKKLLKMGIKATIIASV---AVFAICMAFSGPIVSLFIHPEETMLFNEGVRVFKIFSISFLLVGINVIISGFFVSVEKPSISTVISLGRGLVIVVLSLISM 408
>gi|171741307|ref|ZP_02917114.1| hypothetical protein BIFDEN_00386 [Bifidobacterium dentium ATCC 27678] >gi|171276921|gb|EDT44582.1| hypothetical protein BIFDEN_00386 [Bifidobacterium dentium ATCC 27678] (457 aa)
Score = 97, Expect = 1.3e-01, Identities = 69/371 (18%), Positives = 147/371 (39%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQST 481
           +V  +  ++G F  +GA    SR L + +  +   +    F   L   +V+TV+ ++    +V    A  T+    V                  Y+  +  + P++     L   LR +G +       +  ++ N++ E +F  +  M + G  ++  I   ++ +++A+  + Y  V+     FS     L++ +I   +        L + +R+A+  +A           +N  +   GDA + AG+A      +    I       + G+  G +P+  YNY    ++RV   +++ +    +  L   A+ W       P +   F  +      V+T+    L FQ    +L+++G ++  +T
  S:    72 SVMTVIQAMGFFFGNGAGNSMSRELGKHNDARAARLLSVGFVGALASGLVITVVGLATLHPLVRMLGATPTIEPYAVT-----------------YLIPLLVAAPMMCGSFALNCLLRYQGLASLAMIGLVTGSVLNLVLEPVFIFLLHMGMFGASLATAICQTISFVILAALGMTYGVVH-----FS-----LRQCRITVPLAREIAGGGLPSMIRNAAGTLA--------VTCVNIAANPFGDAAI-AGMAIVMRIMLGANSI-------MIGLGQGFQPVCGYNYGAGLHQRVMKGFWFCVKVATIAMLAFAAIIW----ITAPDLVRVFRDDAA----VVTVGTAALRFQ--CCTLALNGYNMMANT 389
>gi|168333616|ref|ZP_02691876.1| putative transmembrane cation efflux pump [Epulopiscium sp. 'N.t. morphotype B'] (447 aa)
Score = 97, Expect = 1.4e-01, Identities = 32/116 (27%), Positives = 54/116 (46%)
  Q:   383 IYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           ++GI DG+ PI++YNY   N KRV+ +     I   V  ++I  V +    F G  V   F  + P  + + +       F F L   +I     F   GK   +++ + ++G+IF
  S:   287 LFGISDGIGPIVSYNYGSGNMKRVRAIMKTAYIINFVVGMIICVVLF----FFGEDVAQLFIKDDPELVAMASNGGRLYGFAFLLAGFNILSSGYFTFIGKGAQSVIVASSRGIIF 398
>gi|189463937|ref|ZP_03012722.1| hypothetical protein BACINT_00271 [Bacteroides intestinalis DSM 17393] >gi|189438510|gb|EDV07495.1| hypothetical protein BACINT_00271 [Bacteroides intestinalis DSM 17393] (450 aa)
Score = 97, Expect = 1.4e-01, Identities = 85/386 (22%), Positives = 146/386 (37%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPIL 503
           + G  +  GAS L S  L Q+D    + I      + L L+IVL  L  ++ T I    I      + E V    +    ++L     ++Y    ++            LR+ G      +A +   + N I + +F   F   I G  I+ +I   +++L       F  F NK +            F++   +   SL + +  FL +  +A   IV VI        +    GD  + A    N +  +            + G+  G++PI  YN+  Q Y RV  V    II    F+ ++    + + +     V S F ++          L   ++F FP++   +   + FQS G     I  SL + ++F  P L
  S:    68 AFGSLVGVGASTLVSVKLGQKDYDTAQRI----LGNVLVLNIVLG-LAFTVVTMIFLDPILYFFGGSDETVKYAREYMQIILLGNVVTHLYLGLNAV------------LRSSGHPQKAMYATIATVVINTILDPLFIYGFDWGIRGAAIATIIAQVISLLW-----QFKIFSNKDE----LLHFHRGIFRLRRKIVMDSLAIGMSPFLMN--LAACFIVIVIN-----QGLKRYGGDLSIGAFGIVNRLVFI--------FVMIVMGLNQGMQPIAGYNFGAQQYARVSRVLKLTII----FATVVTTSGFLMGMIIPDLVVSIFTSDEELIAISARGLRIVVMF-FPIIGFQMVTSNFFQSIGMASKAIFLSLTRQMLFLLPAL 407
>gi|168714383|ref|ZP_02746660.1| putative drug/sodium antiporter [Clostridium difficile QCD-63q42] (451 aa)
Score = 97, Expect = 1.4e-01, Identities = 64/280 (22%), Positives = 112/280 (40%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISI-LIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFK-INWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           ++ +G     T   +I+ L NII + +F + F   + G GI+  L   F  I  +  F+     +N     F   FK L++   I +   TT L   +   L + S+        ++++  +N I+T                          L+   + GI  G++P+ ++ Y   N   VK +   GI   ++ S+   AVF     F GP V+ F +       +    +F      F L+ +++     F S  K  ++ V SL +GL+     L SM
  S:   158 IKTDGFPILATVGVIISALTNIILDYLFVIEFGWGVKGAGIATGLSQVFSTIFFLIHFLRKNSTLNFSK--FRIDFKTLRKIVFIGFPDSTTELSCGIVVLLFNLSLTKYIGENALIYYSVINYINT--------------------------LVLMTMMGITQGMQPLTSFYYGAGNIDNVKKLLKMGIKATIIASV---AVFVICMAFSGPIVSLFIHPEETMLFNEGVRVFKIFSISFLLVGINVIISGFFVSVEKPSISTVISLGRGLVIVVLSLISM 408
>gi|15674084|ref|NP_268259.1| hypothetical protein L154438 [Lactococcus lactis subsp. lactis Il1403] >gi|12725156|gb|AAK06200.1|AE006438_14 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (400 aa)
Score = 97, Expect = 1.4e-01, Identities = 22/84 (26%), Positives = 45/84 (53%)
  Q:   197 QLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLV 280
           Q +L  +  Y+  + G I ++ ++     FLRA+G +    +A+  A+L N+I  ++F  VF + ++G  +  +I  F+  L +
  S:    89 QQVLELSIIYLSLVGGLIVLLALMTTFGAFLRADGNTKTPMWASFFASLLNLILSIVFIFVFHLGVLGTALGAVIARFIGTLFL 172
>gi|15668891|ref|NP_247694.1| hypothetical protein MJ0709 [Methanocaldococcus jannaschii DSM 2661] >gi|2833550|sp|Q58119|Y709_METJA Uncharacterized transporter MJ0709 >gi|1591425|gb|AAB98703.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM 2661] (450 aa)
Score = 97, Expect = 1.5e-01, Identities = 70/295 (23%), Positives = 123/295 (41%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIH---VLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLI 497
           A KY   +     I  I + L    R EG +  +  A++I  L NII + IF  +  + I G   + L    + I++    + +  F+ K  Y       +L +FK +  +    + + + + L + ++AV+        F  + +I    GD   S GLA           I    F  + G+  G   ++   Y  ++++++K  Y+Y I  GV+  ++I A+   I L        F    T   IH   V  L    L   F    L+ S  ++FQ  GK   +++ S+ + LI
  S:   131 AIKYSSILVLGTVIFTICDALYGIFRGEGNTKIVMIASVIGTLTNIILDPIFIYMLNLGISGASYATL----IAIIISLLILAYELFIKKSCY----VTVKLSKFKPDLKIIADLIRVGIPSALIEITVAVS--------FFIMTSIIMMVGD---SRGLAV----YTGALRITEFGFIPMLGLASGATSVIGATYGARSFEKLKTAYFYTIKIGVLMEIIIVAL---IMLLSPILAYLFTYTKTSMGIHEELVKALRIVPLYLLFTPFILTTS--AMFQGIGKGEKSLIISIFRSLI 400
>gi|167746827|ref|ZP_02418954.1| hypothetical protein ANACAC_01539 [Anaerostipes caccae DSM 14662] >gi|167653787|gb|EDR97916.1| hypothetical protein ANACAC_01539 [Anaerostipes caccae DSM 14662] (443 aa)
Score = 97, Expect = 1.5e-01, Identities = 76/390 (19%), Positives = 148/390 (37%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGP-SVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGL 496
           +V+  +  I  S+GL +  G SV+FS    + D +       S   +  F + V+  + +++  +I+     K  +       S+        L  A  Y+  +   +P  ++  +L  FLR +          L   L N+  + IF   F M I G G++  IG  ++     + +L + F  +    F    + L + K          ++   TF  D ++ +  I++       L          GV+A   +  I T+S       +    Y +    +PI++ N+      R+K    Y +     ++++   VFW + +   P +    F       + +   +       F LL  +I     FQ+  K   + + S+A+GL
  S:    50 AVVAPIWNIIYSLGLLMGIGGSVIFSTLKGRTDLK-------SRDENEYFSASVIGSVFLAVAAWIILIFFGKELLVFFGAKGSF--------LALAETYIIPVKFVLPCFLLTQMLAAFLRNDQAPLLAAIGVLSGGLINVFGDYIFVFAFDMGIFGAGLATAIGSVIS----CAVMLSHFFTKRNTLTFVKPERLLHKLK-------EISVVGFSTFFVDIAMGIMTILFNRQIIKYL----------GVNALSVYGVIVTLS-----TFVQCCAYSVGQASQPIISVNFGAAQGHRIKETLKYAL-----YTVIFLGVFWTLLMLLFPNTFIKIFMTPAGGILKIAPDIMRCYGLSFLLLPFNIFSTYYFQALLKPRASFIVSVARGL 394
>gi|153854135|ref|ZP_01995443.1| hypothetical protein DORLON_01434 [Dorea longicatena DSM 13814] >gi|149753184|gb|EDM63115.1| hypothetical protein DORLON_01434 [Dorea longicatena DSM 13814] (450 aa)
Score = 97, Expect = 1.6e-01, Identities = 31/165 (18%), Positives = 69/165 (41%)
  Q:   107 SVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILI 271
           S++ ++N++ I     + +G +++ S+ + QQ+K+          +    +SIV++VL +  +  ++                         ++ A+  Y ++   S P I   +      RA+  +      ++I+N  NI+   I   +F M + G  IS L+
  S:    53 SLVDSINILVIQAFSALAAGGAIVCSQYIGQQNKKMANESARQVLFIITAISIVVSVLCLGFKKPLLRLIFGSVEAD---------------VMRASETYFFYTAISFPFIAAYDSAASIFRAQENTKGPMLISMISNAMNIVGNAIMIWIFHMGVAGAAISTLV 202
>gi|169349739|ref|ZP_02866677.1| hypothetical protein CLOSPI_00477 [Clostridium spiroforme DSM 1552] >gi|169293814|gb|EDS75947.1| hypothetical protein CLOSPI_00477 [Clostridium spiroforme DSM 1552] (450 aa)
Score = 97, Expect = 1.6e-01, Identities = 76/341 (22%), Positives = 131/341 (38%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFI-LFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEI 451
           T+     SI L ++ G+  +FS    Q+D Q  K   ++SF+    +++VL V I     +I+                 + +   QL+ +   +Y+  I   +  I + N     LR+ G S        I+ + NII ++ F       + G   + +I  +V+ + +A +  + Y  + K D        ++KE       F+T   L                   I+ FG L A+       G +   AF      +   I    +  +    +     +A NY  QN KR+K       I  + FSL+++     +FLF  P +T F NA   S I
  S:    56 TLMTFLTSILLGLSMGSGTVFSIRFGQKDIQGLKEGILASFFLLSVVTVVLNVFIFVGIDWII----------------WFLRTPMQLV-DLMKEYLIIIFSGLVGIFLYNYFASLLRSLGNSLTPLIFLAISAILNIILDIYFVTSLNRGVAGAAEATVISQYVSGIGIAIYTKIKYSDLLKRDQNIRLRLSRIKEI----TSFSTLTCLQQS----------------IMNFGIL-AVQGLVNSFGTTVMAAF-----AAAVKIDAFAYLPVQDFGNAFSIFIAQNYGAQNTKRIKTGIRVATIVSISFSLVVSLC---VFLFAEPLMTFFINAKEVSVI 351
>gi|160940548|ref|ZP_02087892.1| hypothetical protein CLOBOL_05443 [Clostridium bolteae ATCC BAA-613] >gi|158436508|gb|EDP14275.1| hypothetical protein CLOBOL_05443 [Clostridium bolteae ATCC BAA-613] (469 aa)
Score = 97, Expect = 1.6e-01, Identities = 54/258 (20%), Positives = 104/258 (40%)
  Q:   226 FLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNAN---TPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           F+ ++G         L+  + NI+ + +F  VF M + G  ++ ++   ++ L + +F+     + K           L+   +  +      I+ LG  +   ++++ N +  I++   L       GD  V      N ++ V   P+         G+ +  +P+L YNY  + YKRV+      I+   V  +L   V W    +        FN       + I  + + F    F F ++SL  +G S+F   GK
  S:   171 FINSQGFGTVGMMTVLLGAVTNIVLDPVFIFVFHMGVRGAALATILSQMLSALWILAFLTGRRTILK-----------LRPSAMKLDAGRLLRIVGLG--MSGFTMSITNSLVQIMYNSMLQKFG---GDLYVGIMTVINSVREVISMPVN--------GLTNSAQPVLGYNYGAREYKRVQ----KAIVFMSVVCILYTVVAWGFVDWFPAFFIRIFNREGDMVEAGIPAIRMYF----FGFFMMSLQFAGQSVFVGLGK 399
>gi|148643289|ref|YP_001273802.1| Na+-driven multidrug efflux pump [Methanobrevibacter smithii ATCC 35061] >gi|148552306|gb|ABQ87434.1| Na+-driven multidrug efflux pump [Methanobrevibacter smithii ATCC 35061] (463 aa)
Score = 97, Expect = 1.6e-01, Identities = 84/392 (21%), Positives = 162/392 (41%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPL-LSLSISGLSLFQSTGKMFLNIVASLAQG--LIFFFPILYS 505
           +I + +G  I +GA+ L SR +  +DK+   S    S    + +SI   VL ++I   I++       +  SEV+N   +    L +   +  +  I G I             RAEG     T    +  + N+I + IF       + G  ++  I   + +L+     +++ +V K  Y  S++   LK FK N  ++   L + +   L    +A+  I  ++ F  T+ A +TA                  +G  I ++      G+      +   +Y  +NY ++K    Y +  G + SL+   +   I +F G     F  ++  S++  L   F  L+  F L +    +  ++FQ  GK  +++  ++ +   L+  F  L++
  S:    69 MILVGVGNGIGAGANSLISRFIGAKDKKGADSATAHSLILSIIISIGFMVLFIAILDPILK------IMGASEVLNYCKEYGVVLFIWTFSLVIPAIIGGI------------FRAEGDVNRATLPLAVTAIANMILDPIFIYGLNQGLAGAAMATGIAGLIGLLMQ----IYWIYVKKNTY-LSYS---LKNFKNNMKMYADILAVGIPASLEQLIMAILAI--IVNFLLTVVAGTTAVA-------------VYTAGWRIISVGIIPAVGVGTAAVTVAGVSYGARNYDKIKTTVRYAVKLGFIVSLITCIL---IHVFAGQIAYIFSYSSNSSQLAPLITKFLQLMCLFVLFVPFGATAANVFQGLGKGTVSLGLTIMREFILVLLFACLFA 419
>gi|84489624|ref|YP_447856.1| Na+-driven multidrug efflux pump [Methanosphaera stadtmanae DSM 3091] >gi|84372943|gb|ABC57213.1| predicted Na+-driven multidrug efflux pump [Methanosphaera stadtmanae DSM 3091] (454 aa)
Score = 97, Expect = 1.6e-01, Identities = 82/369 (22%), Positives = 147/369 (39%)
  Q:   130 LFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFT-----TSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTL------LFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIF 498
           L +RA+  +DK    +    S +  + LSI L ++++ + + I+    A   VS                ++  N    F+     + +  ++    LRAEG      +A  I  + NII + IF  V  M I+G   + ++   ++ +++  +I    ++ K  Y            +IN  VF      T  I S+       +I ++ ++ +I    T+ A +TA     V A          S   I       ++GI   +  +    Y   +YK++K  + Y II G   S+L++     I +F G    +   A TP    +  L      + C  L   P     I     FQ  GK   + + +L + +IF
  S:    78 LIARAIGHKDKALADNAASHSIFITIILSIALPLILIPLLSPILTLMGAGRCVSMG--------------VDYGNVVFLFMI----VFLFASVASAILRAEGDVNRSMYAMAITAILNIIIDPIFIYVLHMGIVGAAWATVLSSLISCIVMGYWI----WIKKDTY-----------LRINRKVFNYANKVTKDICSVAIPSMAENITMSALIMIINGMLTIVAGTTA---VAVYA----------SAARINQFAMIPLFGIGTAMLTVTGTAYGAHDYKKLKEAHRYSIILGYGVSILLS-----IIMFFGSDYIALLFAYTPESAPLAPLISNALKILCLFLIAMP---AGIMSSMTFQGVGKGLTSFIITLCRSIIF 403
>gi|29347511|ref|NP_811014.1| putative transmembrane cation efflux protein [Bacteroides thetaiotaomicron VPI-5482] >gi|29339411|gb|AAO77208.1| putative transmembrane cation efflux protein [Bacteroides thetaiotaomicron VPI-5482] (451 aa)
Score = 97, Expect = 1.6e-01, Identities = 82/387 (21%), Positives = 156/387 (40%)
  Q:   114 LIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGT--FLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPS-EIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFF 500
           +I   IGL    G SV+ S  L+Q  ++        +     F+ +V++ L       +   C+  S+                 +L    +YM +    +    +L+  +FF+R +G   +      IA +FNIIF+ IF   F   ++G   +  +G  V  L+   ++  +   N   +    + K L        +     ++ LGT  F+ +ASIA    +   VF   L       G+ GV+A               + +IF     I    +PI++YN+      RV+   +  I T ++  +   + F   FL     V+ F + + P+ +I V  + +  + F F   + ++ G+  +QS  +     + +L +G++F  
  S:    61 MIATGIGLMFGVGGSVVASIYLSQGKRKAANINITQALVFSTFIVLVMSALCFCFVGPL--GCLLGSS---------------DRLLPLVIEYMIWYLPFLVFYELLSTGMFFIRLDGSPNYAMMCNAIAAIFNIIFDYIFIFEFGWGMMGAAFATSLGTVVGGLMTVIYLTRFS-RNIHLHRIKLSLKSLM-----LTLRNGGYMIKLGTSAFISEASIACMMFLGNYVFIHHL-------GEDGVAA--------FSIACYFFPIIFMVYNAIAQSAQPIISYNFGAGQPDRVRKALHLAIRTALICGI---SFFIITFLCRQNIVSLFIDRSCPAFDIAVNGIPYFGVGFIF--FAANMIGIGYYQSIRRGQRATIITLLRGVVFML 407
>gi|114562767|ref|YP_750280.1| MATE efflux family protein [Shewanella frigidimarina NCIMB 400] >gi|114334060|gb|ABI71442.1| MATE efflux family protein [Shewanella frigidimarina NCIMB 400] (521 aa)
Score = 96, Expect = 1.7e-01, Identities = 82/394 (20%), Positives = 162/394 (41%)
  Q:   111 TVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIG-GGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLA-FNDIQTVSGTPIYNLI---FFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLS--LSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           T++    SIG+ ++     L S+A+  ++ +  K ++++S    L  S+++  ++++    ++   +  +T  T+E+               A  Y+Y +  S+P I +   L   LRA G +     + L     N I + IF     M I G    S+L    V I+     ++ ++ + +      F+F + K+               LG            +++ I     L  ++T  G+A V+  +A F D        +  LI   F  I+ +   + PI+  N+     +RV++     I   V + L+++     ++L     ++SF      +E   L L FC  +  F + S  L I+  S F + GK   +   ++ +  I   P +Y
  S:    57 TISFFTTSIGIGLSIALGALVSKAVGSKNIKLAKRLFLNSAIVTLITSVLVAAVVIAFIPELL--ALVGATGRTAEL---------------AESYLYILVPSLPFICLAMALGGALRAVGDAKLSMMSTLAGGGVNAILDPIFIFSLSMGIEGAAAASVLARIAVFIISARGVVVKHKLLGR------FSFDEFKQ--------------DLG------------VIFSIAAPAMLTNVATPIGNAVVTRAIADFGDSYVAGWAVLGRLIPVSFGMIFALSGAVGPIVGQNFGANEIERVRLSLTKAIQFCVAYVLMMSL---GLYLLRNVIISSFDMKGDAAE---LILFFCQYIAVFFIFSGILFIANAS-FNNLGKAKYSTFFNVGKATIGTIPFVY 401
>gi|125973961|ref|YP_001037871.1| MATE efflux family protein [Clostridium thermocellum ATCC 27405] >gi|125714186|gb|ABN52678.1| MATE efflux family protein [Clostridium thermocellum ATCC 27405] (470 aa)
Score = 96, Expect = 1.7e-01, Identities = 54/230 (23%), Positives = 91/230 (39%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGT--FLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           +L  A  Y+      +P  +        +RA+G   +     +   + N+  + +F  VF   I G   + +IG  V+ LL A             Y F F   Q+    +    +    I  LGT  F+    + + NIV    +  +G   A+S    D  ++       + +V       L  F+I G+  G +PIL +N   +NY RVK  Y   +   +  S+L   +F
  S:   137 VLPLAMTYLGITAIGLPFQLFTTASSSLIRADGSPTYSMICNVTGAILNVFLDWLFMFVFGWGIQGAATATVIGQIVSFLLCAI------------YYFKFRTFQITRRMLGIKWYYAKRIAKLGTSNFINHTIMMLVNIVLNNSLKIYG---AMSIYGSDIPLAVSGIIAKLNSV-------LSAFSI-GLAQGCQPILGFNMGAKNYSRVKETYKKAVSIAIGISVLAFILF 347
>gi|409866|gb|AAD10610.1| unknown [Mycoplasma genitalium] (109 aa)
Score = 96, Expect = 1.8e-01, Identities = 22/95 (23%), Positives = 49/95 (51%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITG 212
           +I +FI  G  V+FS+A+ + D+ K +  W +   S     ++   L++S     +   + +S+   +   NS+ Q  ++  ++ A++Y+Y + G
  S:     8 AINIFIPLGTGVIFSKAIGRNDQNKIQEAWNTGLISTTVFGLITQFLVLSFAKEWLHYNLDQSSFEQNFQANSFQQFFNKKAIDVASEYVYILIG 102
>gi|196252649|ref|ZP_03151303.1| MATE efflux family protein [Clostridium thermocellum DSM 4150] >gi|196197966|gb|EDX92809.1| MATE efflux family protein [Clostridium thermocellum DSM 4150] (470 aa)
Score = 96, Expect = 1.9e-01, Identities = 54/230 (23%), Positives = 91/230 (39%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGT--FLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVF 428
           +L  A  Y+      +P  +        +RA+G   +     +   + N+  + +F  VF   I G   + +IG  V+ LL A             Y F F   Q+    +    +    I  LGT  F+    + + NIV    +  +G   A+S    D  ++       + +V       L  F+I G+  G +PIL +N   +NY RVK  Y   +   +  S+L   +F
  S:   137 VLPLAMTYLGITAIGLPFQLFTTASSSLIRADGSPTYSMICNVTGAILNVFLDWLFMFVFGWGIQGAATATVIGQVVSFLLCAI------------YYFKFRTFQITRRMLGIKWYYAKRIAKLGTSNFINHTIMMLVNIVLNNSLKIYG---AMSIYGSDIPLAVSGIIAKLNSV-------LSAFSI-GLAQGCQPILGFNMGAKNYSRVKETYKKAVSIAIGISVLAFILF 347
>gi|167747984|ref|ZP_02420111.1| hypothetical protein ANACAC_02721 [Anaerostipes caccae DSM 14662] >gi|167652561|gb|EDR96690.1| hypothetical protein ANACAC_02721 [Anaerostipes caccae DSM 14662] (464 aa)
Score = 96, Expect = 1.9e-01, Identities = 59/318 (18%), Positives = 129/318 (40%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYM----YFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFW 429
           +  + I++ ++I  G +VL +  L Q+++ +  S+  +       + I++T  ++ I               T    +S+       I N A +YM    +    S+  I I  +L          +F     ++  + + I    +F   KM I G  +S + GY ++++L    ++  +   +          ++K F +++ +     ++   +F+ +A  A     ++I F      + +    A   A      +           +   + G+V G  PI++YNY  +N  R++  + YG I G+V + +   +FW
  S:    73 ITTLMIAMSIWIGVGVNVLIADNLGQKNQDRADSVVTNGILLSAAMGIIVTGAVLVI---------------TKPFFSSFTD--DPEIYNLAVRYMRICAFLEVSSMVHICIQKILQGTGNMIAPMWFQIAGVVLNFILDPILIFGYFGFPKMGIEGAAVSTVCGYTLSMILAFMVLILRKQKVR---------LKIKGFHVDFQIIKEIFVIGFPSFIMNALGA-----FMIYFTNIFLVVYSTTAVAFFGAYFKLQQV-----------VIMTLNGLVQGCIPIMSYNYGAKNMPRLRQAFKYGTIIGIVLTGISIVLFW 352
>gi|167750649|ref|ZP_02422776.1| hypothetical protein EUBSIR_01626 [Eubacterium siraeum DSM 15702] >gi|167656328|gb|EDS00458.1| hypothetical protein EUBSIR_01626 [Eubacterium siraeum DSM 15702] (460 aa)
Score = 96, Expect = 2.1e-01, Identities = 21/78 (26%), Positives = 42/78 (53%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVN 276
           +   A  Y++ I   IP+  + N+L  F+R+ G S       +I+++ N+  +L+F LVF M + G G + ++   ++
  S:   129 VFKEAYDYIFVIFLGIPVTFLYNILSGFIRSLGDSKSPVVILIISSILNVGLDLLFILVFDMGVAGAGWATVLAQLIS 206
>gi|160914128|ref|ZP_02076350.1| hypothetical protein EUBDOL_00136 [Eubacterium dolichum DSM 3991] >gi|158433939|gb|EDP12228.1| hypothetical protein EUBDOL_00136 [Eubacterium dolichum DSM 3991] (451 aa)
Score = 96, Expect = 2.1e-01, Identities = 46/174 (26%), Positives = 83/174 (47%)
  Q:   107 SVIGTVNLIFISIGLFI--NSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRS----YFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLV 280
           +V  T +LI + I LFI  + GA+V+  R    +D  + +     S ++ ++ +IV  +L++ I  +  +  +       +             +++ A  YM      +P  MI N     LRA G +    YF+T A ++    N+IF LIF +VF M + G   + LI   ++ +L+
  S:    54 AVGSTSSLINLLINLFIGISVGANVVVGRYYGARDYDEIEE----SVHTAIYTAIVGGILMLIIGVFAAKPMLKLMGTPAN-------------VIDLAVIYMRIYFLGMPAFMIYNFGAAILRAVGDTKRPLYFLTAAGIV----NVIFNLIFVIVFNMGVAGVATATLISEIISAVLI 212
>gi|153811032|ref|ZP_01963700.1| hypothetical protein RUMOBE_01423 [Ruminococcus obeum ATCC 29174] >gi|149832920|gb|EDM88003.1| hypothetical protein RUMOBE_01423 [Ruminococcus obeum ATCC 29174] (456 aa)
Score = 95, Expect = 2.2e-01, Identities = 40/176 (22%), Positives = 76/176 (43%)
  Q:   110 GTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFIL 285
           GT+  +     + + +G +VL ++     D +  +   V +      +  +LT+L M    ++    I  +T S               I   +  Y+  ++G I   M+ NLL   LRA G S    +  +I+ L NII +L+F + F+M   G  ++ +I    + +L   +I+
  S:    60 GTIMFLIYGFVVGMTAGFTVLTAQKFGAGDMEGMRKTVVGAGVLSFVIGTILTILFM---VFMKPLLILMNTPSD--------------IFADSYAYIMIVSGGILAQMLYNLLSSILRALGNSKLPLYFLIISALLNIILDLVFIIRFQMGAKGAAVATVIAQGTSGVLCLLYII 218
>gi|160915679|ref|ZP_02077887.1| hypothetical protein EUBDOL_01687 [Eubacterium dolichum DSM 3991] >gi|158432155|gb|EDP10444.1| hypothetical protein EUBDOL_01687 [Eubacterium dolichum DSM 3991] (474 aa)
Score = 95, Expect = 2.2e-01, Identities = 82/378 (21%), Positives = 157/378 (41%)
  Q:   106 TSVIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFL----RAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSA-GLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL-------INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGK 483
           T+V   +  I +++G  I +GAS   +  L ++ +Q+ +    ++F    F+ ++  ++IM +    +E  +     +      +Y+Q    +IL               +  + NLL   L    R +G       + +   + N I + I+  VF   + G  I+ +        ++ + IL Y F+ K           + + KI   +F + L L   + +   +  +  +V    +V++G L + +   GD  +SA G+       ++   I         GI  G +PIL +N   +  KR+K  Y       V+ S++       I  V   +F    P  ++F  A     I++L +   T  FQ       I+  S FQ+TG+
  S:    58 TTVSFPLQTIILALGTMIGAGASAYAAIKLGEKREQEAEHTLGNAF----FMLVLAGIIIMVVGLVFLEPILYLFGATAKNF--AYSQDYASIIL---------------LGTVFNLLGIGLSNMARTDGSPNIAMLSMIAGAVLNTILDPIYIFVFHWGVKGAAIATITSQ-----IIGAVILVYYFLKKSTMRL-----HISQMKIKKTIFVSILSLGFSSCITQTAATIMQVVMNNSLVYYGDLTSTT---GDVALSAMGIVLKISMIITSICI---------GIGIGAQPILGFNKGARQPKRIKETYKKASSIAVLTSIIGWGVCIAIPGVILSLFGSSDPVFSTF--AQRAMRIYMLGIF--TAGFQ-------ITATSYFQATGQ 395
>gi|163816051|ref|ZP_02207421.1| hypothetical protein COPEUT_02231 [Coprococcus eutactus ATCC 27759] >gi|158448861|gb|EDP25856.1| hypothetical protein COPEUT_02231 [Coprococcus eutactus ATCC 27759] (436 aa)
Score = 95, Expect = 2.3e-01, Identities = 52/233 (22%), Positives = 99/233 (42%)
  Q:   203 ANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRV----KVVYYYGIITGVVFSLLINAVFWPIFLFG 435
           A  YM++I   +P+ +  N +  F+RA+          L+  +FNI+ +++     K  I G  ++ ++G  + +L+ +S  L      K +  F    + L   K   N+ T  +      F     + + NI   I+ +   NA+S        +  + FN + T               G+   ++P+++ NY   N  R+    ++ Y   +I G +FSLL   + +P  L G
  S:   129 AMSYMHYINMFLPVAVFSNFIAIFVRADNDPNRAMAGVLLGGVFNIVMDIVLIFPLKQGIGGAALASVVGMLIQVLVASSHFL----SKKNELRFIMPHRILNSMK---NIVTAGIPSFFNEFANGFIVLLFNI--QILKYCGENALSIY--SVISNCVILFNSLFT---------------GVGQSVQPVISTNYGANNIGRINTIKRMAYTTILIMGALFSLL--GILFPRVLCG 337
>gi|19704801|ref|NP_604363.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19715140|gb|AAL95662.1| Na+ driven multidrug efflux pump [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (440 aa)
Score = 95, Expect = 2.5e-01, Identities = 66/308 (21%), Positives = 123/308 (39%)
  Q:   108 VIGTVNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGII 415
           V+  +N IF SI + I  G+S L +    +    +   I+  S +  LFL I ++ +I+               ++   V+N     + Q +     +Y+  I       M       +++ +G+  +     L+  L N++ + +F ++F   + G  I+  I    +     + +L Y  +N     F      +K  KIN+   +         FL + S  V  ++Y +V    +       G  GVS         TVS   I + I   + G   G++P+++Y   K+NYK +K +    II
  S:    50 VLPLINFIF-SISIMIGVGSSTLMAIKFGENKYDEGNKIFTLSTFLNLFLGIFISAIIL---------------LNIDRVINILGANKSQEVYRYVKEYLTIIVFFSVFYMSGYAFEIYIKIDGKPSYPAICVLVGGLTNLVLDYVFVVIFHYGVTGAAIATGISQVAS----CTMLLLYITLNAKYVKF------IKLNKINFEKISKIFRTGFSEFLTEISSGVLILIYNLVILRKI-------GVLGVSI------FGTVS--YITSFITMTMIGFSQGIQPVISYYLGKKNYKNLKEILKISII 316
>gi|167768184|ref|ZP_02440237.1| hypothetical protein CLOSS21_02740 [Clostridium sp. SS2/1] >gi|167709708|gb|EDS20287.1| hypothetical protein CLOSS21_02740 [Clostridium sp. SS2/1] (455 aa)
Score = 95, Expect = 2.6e-01, Identities = 67/309 (21%), Positives = 130/309 (42%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVY--VIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL 423
           +FI I L    GA VL SR    +D  K K+I  +S  S L LSI L V            C +   +S  +            ILN A  Y+       P + + N+L     + G S       + +++ NI+ +L       + + G  ++ LI   ++ +L  S ++F   + + +  F +  +Q            + L +++ + L+ +++++  ++   V+  FGT          AG SA +   +        +++LIF +I   V    P ++ N   +  +R+K  Y+  ++  + F++L
  S:    64 VFICIALGAGVGAGVLVSRYFGARDYGKMKTIVSTSLISFLVLSIFLGVFGF---------CFSHLMMSVLQTPAD--------ILNEAVLYLRVYFVGFPFLFMYNILSTMFTSIGESKIPLALLIFSSMLNILMDLWMVAGLGLGVFGAALATLIAQGISAVL--SLLIFLCRMRRYESHFDWFDRQ---------ELYSMLQIAVPSVLQQSTVSIGMMIVQAVVNPFGT-------QALAGYSATMRVEN--------VFSLIFVSIGNAVS---PYVSQNLGAKKIERIKKGYHAALVLDICFAIL 328
>gi|160938682|ref|ZP_02086034.1| hypothetical protein CLOBOL_03577 [Clostridium bolteae ATCC BAA-613] >gi|158438381|gb|EDP16140.1| hypothetical protein CLOBOL_03577 [Clostridium bolteae ATCC BAA-613] (463 aa)
Score = 95, Expect = 2.6e-01, Identities = 78/396 (19%), Positives = 165/396 (41%)
  Q:   115 IFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKI----NWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVY--YYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLL-FQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY--SMWNIA 510
           +FI I +   +GASVL S+ L  +   K K+   ++  + LF+SI+L    + +   I+E+    +                  I+  A  Y+      +P + + N+L     A G S    +  + +++ N++ ++I      M + G  I+ ++   V+ L+                 F    K+L+ ++     ++ ++ +S+ L  GT +   SI   +IV + +    + ++    G A ++   A + I+++   P        +    + +    A N      +RVK  Y   YGI+ G  FS +I  +   + L  GP +TSF       E +     + + + + F  + +      + + +G + +  +A+L    I  +   +   +W +A
  S:    76 VFIMIAIGGGNGASVLTSQYLGARQHGKMKTSISTALITFLFVSILLGSAGLYLNGLILESLKTPAN-----------------IMGQAKLYLGIYFLGMPFLFMYNVLAAIFNAMGDSRTPLYLLIFSSILNVVLDIISVTWLGMGVDGVAIATVMAQGVSALI----------------SFGILMKKLRGYEQEDGDSFRLYDSSM-LKAGTRIAVPSILQQSIVSIGMLL--VQSVVNGFGSAALAGYSAGSRIESICVVP--------MIATGNAVATFTAQNIGAGKMERVKEGYRASYGIVAG--FSAIIAVI---VVLLNGPIITSFLGDGMSREAYGAGTGYLSFIAYFFVFIGMKACTDGVLRGSGDVLVFTIANLVNLTIRVYAAFHFAPIWGVA 431
>gi|167756007|ref|ZP_02428134.1| hypothetical protein CLORAM_01527 [Clostridium ramosum DSM 1402] >gi|167703999|gb|EDS18578.1| hypothetical protein CLORAM_01527 [Clostridium ramosum DSM 1402] (441 aa)
Score = 95, Expect = 2.6e-01, Identities = 73/305 (23%), Positives = 129/305 (42%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQ----FPLLSLSISGLSLFQSTGK----MFLNIVASLAQ-GLIFFFPIL 503
           I+  A  Y+  + G + I ++ NLL   LRA G S     A +IA   N+  +L+F  VF + I G  I+ ++      L     +L+ + +        F+ K  + FKI  ++    + L L   L++  I++  ++   V  G         G   V+   A N         +Y L+  A       L    A NY    Y+RV+     G+    + SL+ + +   I +  G ++ + F + + +EI+ +  +    LF      P+L +  +  +  Q  G     MF  IV  L + G+  F P+ 
  S:   126 IIQGAIAYLRVMAGGVTITLMYNLLSCVLRAFGNSKTPLLAMVIAASLNVGLDLLFVCVFHLGIAGAAIATILAQLFASLFCL-LVLYKQSI--------FSLKS-EHFKIQRHLIFELVKLGLPLALQNGIISIGGMIVQFVVNGY--------GVIFVAGFTATNK--------LYGLLETAAISFGYALTTYNAQNYGALEYQRVR----EGVNASALISLVTSLIIALIMIVFGRNILTLFVSGSQNEINAVLEVAYHYLFIMAVCLPILYILHTYRNALQGLGNTVIPMFSGIVELLMRVGIALFLPLF 409
>gi|153813541|ref|ZP_01966209.1| hypothetical protein RUMOBE_03963 [Ruminococcus obeum ATCC 29174] >gi|149830341|gb|EDM85433.1| hypothetical protein RUMOBE_03963 [Ruminococcus obeum ATCC 29174] (456 aa)
Score = 95, Expect = 2.6e-01, Identities = 65/300 (21%), Positives = 128/300 (42%)
  Q:   207 MYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANT---PSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           M ++ G++P ++ + +  F + A+G S     +  I  + N++ + +F  V    + G  I+ ++       L A+F+LF+    K +       + L++ ++         I+SLG+     +  +  +   +V     N +S   GD  +S     + ++ +  TP++         I +G  PIL+YNY     K V+     G I  V+  L+  AV W + +     +   F+++T      +  L   F   +F    + L   G ++F+S  K    I  SL + +    P+ Y M
  S:   142 MIYLIGTLPSMISIGMNPF-INAQGYSTIGMLSVAIGAVANLLLDPLFIFVLGFGVQGAAIATILSQ----TLSAAFVLFF-LTRKSE----LRVRLLRKNEVPQCTGYAKDIVSLGS-----AGFIMQLTNSLVTICCNNVLSVTGGDIYISVMTIVSSVRQLVETPLH--------AINEGASPILSYNYGACRPKHVRKA---GAILSVMV-LVYTAVTWSMIILIPEFLIRIFSSDTVLLKDAVIALKQYFAAFIF----MDLQYIGQTVFKSLNKKKFAIFFSLLRKVFIVVPLTYLM 413
>gi|149201671|ref|ZP_01878645.1| MATE efflux family protein [Roseovarius sp. TM1035] >gi|149144719|gb|EDM32748.1| MATE efflux family protein [Roseovarius sp. TM1035] (465 aa)
Score = 95, Expect = 2.6e-01, Identities = 51/233 (21%), Positives = 90/233 (38%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYN----LIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFC 459
           LRA G S    F +L   + N + + IF     + + G   + +   F  +L+               +P                ++    I  +G FL D    +      I     L  ++T  G A V+  +A      V+G  + N    ++F  +  +   + PI+  N+      RV+  +Y  +I   ++ L+++ +   +FLF G  +  FF A    E   L LLFC
  S:   158 LRAYGDSRRAMFPSLTGAMVNGVLDPIFIFTLGLGLEGAAWATVAARFATMLMAL-------------WP-------------TIRLYNGFAIPRIGCFLYDIREGMQ-----IALPAILATVATPVGTAIVTREMAKYGTDAVAGMAVINRMSPVVFAVVLALSGSIGPIMGQNFGAGRRDRVREAFYDAVIFSAIYVLVVSII---LFLFRG-QIADFFGAK--GEARALILLFC 357
>gi|85859927|ref|YP_462129.1| Na+ driven multidrug efflux pump [Syntrophus aciditrophicus SB] >gi|85723018|gb|ABC77961.1| Na+ driven multidrug efflux pump [Syntrophus aciditrophicus SB] (453 aa)
Score = 95, Expect = 2.6e-01, Identities = 57/232 (24%), Positives = 105/232 (45%)
  Q:   199 ILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVF------KMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTT-------SLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVK------VVYYYGIITGVVFSLLINAVFWP 430
           I+  + +Y+  +   +P + ++ +    LRAEGR + + ++AL+ +  + I +   FL+F      +++I G   + +I      LL A    +Y       Y   + + +  +++I W+++ T       +L +SLG  L +  +      Y  +   TL  +S   G                       L+  A+YGI  GL P++AY+       R+K      V   +GI    +  LLI  VF P
  S:   129 IIPLSRQYLLTLLPGVPFLFLIMMTSNLLRAEGRPHLVMYSALLFSAVSCILDP--FLIFGWGPFPRLEIRGAAAAAVISQIAGALLAA----YYLQQKSSKYKLKWHYLR-PDYRIIWSIYQTGFPSIIINLAVSLGMLLHNHILG----GYSYLAVATLGIVSRVNG-----------------------LVMIALYGIGHGLMPMVAYSEGANLRSRLKETVKIAVKISFGI---ALLCLLIVEVFAP 342
>gi|160944357|ref|ZP_02091585.1| hypothetical protein FAEPRAM212_01867 [Faecalibacterium prausnitzii M21/2] >gi|158444139|gb|EDP21143.1| hypothetical protein FAEPRAM212_01867 [Faecalibacterium prausnitzii M21/2] (227 aa)
Score = 94, Expect = 2.8e-01, Identities = 29/132 (21%), Positives = 63/132 (47%)
  Q:   375 IYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILYSM 506
           +   ++    GIV G+RP+++YNY    +KRV+ +Y    IT ++ + ++ A      +   P +  F   +TP  +    +    +   F + ++S +     +  GK   ++V SL + ++F  P+ + +
  S:    69 LQTFLYLPANGIVQGMRPLISYNYGAGEHKRVRRLYQ---ITLILSAAIMAAGTLGCLVASEPLMRLF--TSTPETVEAGKIALRIICLGFVISAISTTSSGALEGLGKGTQSLVISLCRYIVFIMPLAWVL 195
>gi|163815015|ref|ZP_02206402.1| hypothetical protein COPEUT_01171 [Coprococcus eutactus ATCC 27759] >gi|158449698|gb|EDP26693.1| hypothetical protein COPEUT_01171 [Coprococcus eutactus ATCC 27759] (446 aa)
Score = 94, Expect = 2.9e-01, Identities = 62/307 (20%), Positives = 128/307 (41%)
  Q:   118 SIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLI 424
           +  +F+ +G + L S AL + D+ K + I  +     + L I+ TV++M++   + +  +     S +   +             A+ Y+         +MI   L  F+ A+G++     + LI  + NII + IF     + I G  I+ +I   ++    A++++ +   +K     S      +  +    +  +   L +  F+   + ++  IV+        + +     D  V    +F  +Q+     I  +IF  + G   G++PI++YNY K N  RVK      I   ++ S ++
  S:    61 AFSVFVGAGGAPLASIALGKGDRDKAQRILSNG----VTLLIIFTVIVMAVIYTLKKPLLYFFGASDATYPH-------------ADDYLSIYLIGTIFVMITTGLNTFITAQGQAKTAMASVLIGAICNIILDPIFIFALNLGIKGAAIATVISQAIS----AAWVIRFLTSDKASLRIS-----AQMMRPQGKLILSIAALGVSPFIMQVTESLITIVFT-------HGLQKYGDDLYVG---SFTILQS-----IMQIIFIPMSGFSQGVQPIISYNYGKGNVARVKKTCTILITMSIIVSFVL 326
>gi|118443585|ref|YP_878733.1| MATE efflux family protein [Clostridium novyi NT] >gi|118134041|gb|ABK61085.1| MATE efflux family protein [Clostridium novyi NT] (438 aa)
Score = 94, Expect = 2.9e-01, Identities = 72/266 (27%), Positives = 111/266 (41%)
  Q:   227 LRAEGRSYFITFAALIANLFNIIFELIFF--------LVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLL--INAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASL 492
           +R+EG         L+  L NII + IF         +   + I G  I+ +I    N  LV     F+ F +K     S +  ++++  +     T   I S+G  L   SI +AN   V ++   L       G+  V+A              I  +IF  I+GI  G++PIL YNY  + Y RV       II G+  + +  I   F+P  LF        F  + P+ I +        L   PL+   I   + FQ+ GK  ++I  S 
  S:   134 IRSEGNPKIAMRTMLVGALLNIILDPIFIFDSIFNIKIGLGLGIKGAAIATIISATANTALV-----FHYFTSKN----SGSVLKIRKRNLKLTFKTCKDIFSIG--LSPFSIQIANSAVVALYNMGLLKYG---GNDAVAA--------MSIIASISTIIFMPIFGINQGVQPILGYNYGAKLYSRVIKAIKLAIICGISIASVGFIAVEFFPHVLFKA------FAKDAPNLIILGCRGIRIDLILLPLVGYQIVTSNYFQAIGKAKISIFLSF 381
>gi|154502793|ref|ZP_02039853.1| hypothetical protein RUMGNA_00607 [Ruminococcus gnavus ATCC 29149] >gi|153796676|gb|EDN79096.1| hypothetical protein RUMGNA_00607 [Ruminococcus gnavus ATCC 29149] (463 aa)
Score = 94, Expect = 3.0e-01, Identities = 71/393 (18%), Positives = 157/393 (39%)
  Q:   112 VNLIFISIGLFINSGASVLFSRALAQQDKQKCKSIWVSSFYSCLFLSIVLTVLIMSIQTYIVEACIAKSTVSTSEVVNSYNQVRHQLILNAANKYMYFITGSIPIIMILNLLIFFLRAEGRSYFITFAALIANLFNIIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFFAIYGIVDGLRPILAYNYQKQNYKRVKVVYYYGIITGVVFSLLINAVFWPIFLFGGPSVTSFFNANTPSEIHVLTLLFCTLLFQFPLLSLSISGLSLFQSTGKMFLNIVASLAQGLIFFFPILY 504
           V +I  +    +  G +   S  + ++D +  + I  + F + +  ++VLT L++  +  ++   +  ++ +T     SY  +              +  G+I + + L L  F + A+G S       +I  + NI+ + IF   F M + G  ++ ++   ++ +    F+   + V +          + + FKI   +    + L    F+  ++ ++     V+ F  +L       GD  V A    + +   +  P+         G+  G +PI++YN+   N +RV+  + + +I+ VV++    A  W +  F  P V      N P             +    L+   I+    F + G   ++   ++ + +I   P++Y
  S:    65 VIMIVSAFAALMGMGGAPRASILMGKKDNEGAEKILGNCFSALVITAVVLTALVLVFKRPLL--MMFGASENTIGYAESYLNI--------------YAVGTIFVQLTLGLNAF-IAAQGFSKISMMTVVIGAVTNIVLDPIFIFGFDMGVQGAALATVLSQAISAVWAIRFLSGKDTVLR---------LKKENFKIKKEIMLPCIGLGAAPFIMQSTESI----LVLCFNSSLLKYG---GDLAVGAMTILSSVMQFAMLPLQ--------GLTQGGQPIISYNFGANNAERVRKGFRFLLISAVVYA----AGIWAVSEF-APGVFVTIFTNDPQLAEFAKWAMRIYMAAVVLMGAQIACQQTFIAFGNSKISAFLAMFRKIIVLIPLIY 411
>gi|123444413|ref|XP_001310977.1| MatE family protein [Trichomonas vaginalis G3] >gi|121892769|gb|EAX98047.1| MatE family protein [Trichomonas vaginalis G3] (525 aa)
Score = 94, Expect = 3.1e-01, Identities = 57/201 (28%), Positives = 93/201 (46%)
  Q:   205 KYMYFITGSIPIIMILNLLIFF------LRAEGRSYFITFAALIANLFN-IIFELIFFLVFKMDIIGGGISILIGYFVNILLVASFILFYEFVNKGDYPFSFAFKQLKEFKINWNVFTTSLILSLGTFLRDASIAVANIVYVIVFFGTLNAISTAPGDAGVSAGLAFNDIQTVSGTPIYNLIFF-------AIYGIVDGLRPILAYNYQKQNYKR 405
           KYM+      P++M      FF      L+ EGRS       +++ L N +I + +F L FK  + G   + +I   V  LLV  F LF+     G +       QL + K N N    SL + L   + + S+++  I+           +    G A  +   +FND+  ++G   YN++F        A+ G   G  P  +Y+Y  +N+KR
  S:   164 KYMF------PLLMCTVFTCFFVTSGGFLQGEGRSLLFGVIQVVSLLVNMVILDPLFLLAFKWGLAGAAWARIITEAVPGLLV--FTLFF----MGKFGVKPKVSQLFK-KFNKNTLP-SLKVGLSQLVSNLSVSIPGII-----------VRKLIGSAAHNGIHSFNDV--MAG---YNVVFRYAQITNNAMIGFTMGYLPAASYSYAAKNFKR 348