>gi|26553544|ref|NP_757478.1| putative membrane integrated oxidoreductase [Mycoplasma penetrans HF-2] >gi|26453550|dbj|BAC43882.1| putative membrane integrated oxidoreductase [Mycoplasma penetrans HF-2] (285 aa)
Score = 1272, Expect = 3.3e-138, Identities = 285/285 (100%), Positives = 285/285 (100%)
  Q:     1 MNLENQEIQTANQINNLDESKNGINHKSFHSHNKWRDEKGRSTSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKTNIVDSYFLS 285
           MNLENQEIQTANQINNLDESKNGINHKSFHSHNKWRDEKGRSTSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKTNIVDSYFLS
  S:     1 MNLENQEIQTANQINNLDESKNGINHKSFHSHNKWRDEKGRSTSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKTNIVDSYFLS 285
>gi|188524106|ref|ZP_03004186.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530863|ref|ZP_03005156.1| hypothetical protein Uurese_01000003_0200001835 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867745|ref|ZP_03079746.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195659784|gb|EDX53164.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660600|gb|EDX53856.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (231 aa)
Score = 183, Expect = 6.2e-12, Identities = 69/230 (30%), Positives = 109/230 (47%)
  Q:    29 FHSHNKWRDEKGRSTSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIK 258
           F  ++K +     STS  I+   ++A++L + I+  Y+ +         NFL  DFSL  L+ L++  K+++     I+  LAN +  G   +VG +   + NL  +S   + K IFI K  S   LN                           L + V++   +I+ N ++NGIL+TPLY   + +T +  F+E  K Y ++P   LL I  YW GI  LY+ FN IK
  S:    12 FKRNHKEKHNIYYSTSKIIKDYTLSAVMLGIGILVAYLSHFIRF-----NFLAFDFSLFTLVYLIYKVKYRFVYLVTILLSLANLM-HGSPSWVGTMILSLNNLFFVSMVIIFKKIFIPK-TSKFHLN---------------------------LCVLVLSSFLTIVFNVIMNGILYTPLYWYTFKITSTLNFLEVQKIYESHPTLFLLNIKSYWLGIIALYTIFNLIK 207
>gi|188039645|ref|ZP_02528994.2| hypothetical protein Uures_03394 [Ureaplasma urealyticum serovar 8] >gi|188568724|ref|ZP_02828786.2| hypothetical protein Uurealyserovar_01225 [Ureaplasma urealyticum serovar 2] >gi|188592538|ref|ZP_02694118.2| hypothetical protein Uureaserovar_01240 [Ureaplasma urealyticum serovar 10] (231 aa)
Score = 180, Expect = 1.2e-11, Identities = 68/229 (29%), Positives = 110/229 (48%)
  Q:    42 STSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLL 270
           STS  I+   ++A++L L I+  Y+ +         NFL  DFSL  L+ L++  K+++     I+  LAN L  G   ++G +   + NL  +S   L K +FI K        +P   +N                    L + V++   + + N ++NGIL+TPLY   + +T +  F+E  K Y  +P   LL I  YW GI  LY++FN IK  ++  +S  +L
  S:    25 STSKIIKDYTLSAVMLGLGILIAYLSHFIRF-----NFLAFDFSLFTLVYLIYKVKYRFVYLVTILLSLANLL-HGSPSWIGTMVLSLNNLFFVSMVILFKKLFIPK--------RPKFYLN--------------------LWVLVLSSFLTTVFNVIMNGILYTPLYWYTFKITPTLNFLEVQKIYEKHPTLFLLNIKSYWLGIIALYTSFNLIKNIIISFISLTIL 219
>gi|170762155|ref|YP_001752205.1| hypothetical protein UPA3_0128 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920495|ref|ZP_02691051.2| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508689|ref|ZP_02689894.2| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701938|ref|ZP_02554434.2| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168827732|gb|ACA32994.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902963|gb|EDT49252.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675611|gb|EDT87516.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700687|gb|EDU18969.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (231 aa)
Score = 177, Expect = 3.0e-11, Identities = 67/229 (29%), Positives = 110/229 (48%)
  Q:    42 STSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLL 270
           STS  I+   ++A++L L I+  Y+ +         NFL  DFSL  L+ L++  K+++     I+  LAN L  G   ++G +   + NL  ++   L K +FI K        +P   +N                    L + V++   + + N ++NGIL+TPLY   + +T +  F+E  K Y  +P   LL I  YW GI  LY++FN IK  ++  +S  +L
  S:    25 STSKIIKDYTLSAVMLGLGILVAYLSHFIRF-----NFLAFDFSLFTLVYLIYKVKYRFVYLVTILLSLANLL-HGSPSWIGTMVLSLNNLFFVTMVILFKKLFIPK--------RPKFYLN--------------------LWVLVLSSFLTTVFNVIMNGILYTPLYWYTFKITPTLNFLEVQKIYEKHPTLFLLNIKSYWLGIIALYTSFNLIKNIIISFISLTIL 219
>gi|31544478|ref|NP_853056.1| hypothetical protein MGA_1122 [Mycoplasma gallisepticum R] >gi|31541323|gb|AAP56624.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (262 aa)
Score = 176, Expect = 3.5e-11, Identities = 77/223 (34%), Positives = 113/223 (50%)
  Q:    50 MVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNA--LLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVL 272
           +   A +LAL I+F Y+ +      F +  L +D S+VFLI +++I      +  AI   L +F+W     ++G+IF  ++N+ T+     + W+                     LN  K + KK+  + + IL I ++ F++S I     NGIL TPLY   +    +  FIE AK YN+  N    LLFI DYWTGIF+LYS FN IKF LV   +  LL  
  S:    54 LSFNAGMLALAIIFAYLSSLVKIPFFSSLSLTIDISIVFLIPVIYISSIYSAVALAISLSLIHFIWNSTN-WIGIIFLTIINIFTILIFAFLNWL---------------------LNKTKLKDKKVKWLVIWILIIPILMFLFSAI-----NGILITPLYWWWFRAVRTINFIEVAKFYNSTTNLRFFLLFINDYWTGIFSLYSLFNLIKFSLVAFFAIPLLTF 251
>gi|13508266|ref|NP_110215.1| putative membrane integrated oxidoreductase [Mycoplasma pneumoniae M129] >gi|6226367|sp|P75251|Y527_MYCPN Uncharacterized protein MG350.1 homolog >gi|1673988|gb|AAB95963.1| putative membrane integrated oxidoreductase [Mycoplasma pneumoniae M129] (225 aa)
Score = 161, Expect = 2.2e-09, Identities = 68/222 (30%), Positives = 107/222 (48%)
  Q:    41 RSTSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANF-LNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANP--NALLLFIPDYWTGIFTLYSAFNAIKFGLV 262
           +   + + ++  +A++LAL ++  +V + F  + FL+   L +D S VFLI   F   + W L   +   L +F+W G   ++G++   + N   +SFT L   IF +                               I+LR L +  +  + + +L   LNG+L TPLY   +    +A F+E AK YN  P  +  L  +P+YW GIF LYS FN IKF LV
  S:    11 KKEQHQLFNLSFSAMMLALALIASFVSH-FISIPFLSALKLTIDISSVFLIACAFFVSYSWALVITVALSLCSFIWDG-NNWIGILTLTIANFAIVSFTRLYFHIFAQ-------------------------------IKLRWLWVFSLATLSNTLLLTTLNGLLITPLYWYWFGYVPTANFVEVAKIYNKTPYFHFFLFGVPNYWGGIFALYSLFNVIKFTLV 202
>gi|171920829|ref|ZP_02695359.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178856|ref|ZP_02554753.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024184|ref|ZP_02569991.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|189009903|ref|ZP_02556829.3| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|171903601|gb|EDT49890.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209492|gb|EDU06535.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018824|gb|EDU56864.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997895|gb|EDU66992.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (193 aa)
Score = 160, Expect = 2.7e-09, Identities = 59/193 (30%), Positives = 93/193 (48%)
  Q:    78 NFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLL 270
           NFL  DFSL  L+ L++  K+++     I+  LAN L  G   ++G +   + NL  +S   L K +FI K        +P   +N                    L + V++   + + N ++NGIL+TPLY   + +T +  F+E  K Y  +P   LL I  YW GI  LY++FN IK  ++  +S  +L
  S:    18 NFLAFDFSLFTLVYLIYKVKYRFVYLVTILLSLANLL-HGSPSWIGTMVLSLNNLFFVSMVILFKKLFIPK--------RPKFYLN--------------------LWVLVLSSFLTTVFNVIMNGILYTPLYWYTFKITPTLNFLEVQKIYEKHPTLFLLNIKSYWLGIIALYTSFNLIKNIIISFISLTIL 181
>gi|13357679|ref|NP_077953.1| hypothetical protein UU122 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|11356778|pir||G82930 conserved hypothetical UU122 [imported] - Ureaplasma urealyticum >gi|6899080|gb|AAF30528.1|AE002113_2 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (193 aa)
Score = 158, Expect = 4.8e-09, Identities = 58/193 (30%), Positives = 93/193 (48%)
  Q:    78 NFLNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLL 270
           NFL  DFSL  L+ L++  K+++     I+  LAN L  G   ++G +   + NL  ++   L K +FI K        +P   +N                    L + V++   + + N ++NGIL+TPLY   + +T +  F+E  K Y  +P   LL I  YW GI  LY++FN IK  ++  +S  +L
  S:    18 NFLAFDFSLFTLVYLIYKVKYRFVYLVTILLSLANLL-HGSPSWIGTMVLSLNNLFFVTMVILFKKLFIPK--------RPKFYLN--------------------LWVLVLSSFLTTVFNVIMNGILYTPLYWYTFKITPTLNFLEVQKIYEKHPTLFLLNIKSYWLGIIALYTSFNLIKNIIISFISLTIL 181
>gi|12045210|ref|NP_073021.1| hypothetical protein MG_521 [Mycoplasma genitalium G37] >gi|6226366|sp|Q9ZB72|Y350A_MYCGE Uncharacterized protein MG350.1 >gi|3844945|gb|AAC71586.1| membrane protein, putative [Mycoplasma genitalium G37] >gi|166079020|gb|ABY79638.1| membrane protein, putative [synthetic Mycoplasma genitalium JCVI-1.0] (224 aa)
Score = 157, Expect = 6.0e-09, Identities = 64/222 (28%), Positives = 104/222 (46%)
  Q:    41 RSTSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANF-LNLDFSLVFLIILVFICKWQWWLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLF--IPDYWTGIFTLYSAFNAIKFGLV 262
           + + + + ++  +A++LAL I+   + + F  + F +   L  D S+VFL+   F     W L   +   L +F W      +GV+   + NL+T+ FT L   +F                        K+RF  I         + + T + + +L   LNGIL TPL+   +   ++  F+  A++YN N +    F  I +YW GIF LYS FN +KFGLV
  S:    11 KKSYHQLFNITFSAMMLALAIITSLI-SEFISIPFFSQLKLTFDISVVFLVACAFFVSLGWSLTITLASALTSFFW-NTNNVIGVLTVTLANLSTILFTRLYFCLF-----------------------SKRRFCWIF--------VFLFTTLSNALLLTTLNGILITPLFWYYFGYVQTPNFLIVAEQYNKNTDFHFFFFGINNYWLGIFCLYSFFNLVKFGLV 202
>gi|47459102|ref|YP_015964.1| hypothetical protein MMOB2670 [Mycoplasma mobile 163K] >gi|47458431|gb|AAT27753.1| conserved hypothetical protein [Mycoplasma mobile 163K] (241 aa)
Score = 122, Expect = 6.4e-05, Identities = 59/243 (24%), Positives = 107/243 (44%)
  Q:    42 STSYSIRSMVITAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQW----WLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKTNIVDSYFL 284
           + S  + ++ ++ I  AL ++F     +FF L  +  FLN++F++VF+IIL  +  +++     +   I+G   N  ++ +G     I  +      L FTF    +   K +  NK                          + ++   +   I++      LNG++FTPL+  L     + +      +   +   L   I  YW GIFTLY+AFN I F LV  L   + +  +K  I++++ L
  S:     8 NNSRIVYNITLSGIFFALVLIF----QSFFSLFSIFGFLNINFTIVFIIILALVSNFKYALILLILRFIIGPAINSGYSEIGILGHFILLVSDVFFILFFTFAYYVLLTWKQIKLNKY-------------------------IILIISSITATIFNAFWMVFLNGLIFTPLFFALLGQNSANFLFYMQPQIWNSLKGLFFNINTYWGGIFTLYTAFNLINFSLVSILFSSITIALFKAKIIENFDL 225
>gi|15829062|ref|NP_326422.1| hypothetical protein MYPU_5910 [Mycoplasma pulmonis UAB CTIP] >gi|14090006|emb|CAC13764.1| unknown; predicted coding region [Mycoplasma pulmonis] (295 aa)
Score = 119, Expect = 1.4e-04, Identities = 64/224 (28%), Positives = 109/224 (48%)
  Q:    53 TAILLALYIVFCYVGNTFFHLTFLANFLNLDFSLVFLIILVFICKWQWWLFAAIVGGL--ANFLWAGVG-GYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKT 276
           +AI  +L ++F +    F     +  FL +D S++F+     I  ++  L   I+  L   +FL        +G   N++ N   L+F  L K+IFI  + + + L K   T+N    +    + ++  IE  IL I V T I+  +    LN  LF  LY +L+ + +S   +E  ++Y+    +   FI +Y+ G ++LY AFN I F +  S+  V L   YK+
  S:    76 SAITFSLVLIFTF----FSKYMKIFGFLEIDISVIFIFATYTISGYRLALLNLILKFLIAPSFLSGYTDISLLGNFINMLTNWMFLNFYILFKFIFI-LFKTKSHLKKIKFTLNKF--YYINYYYELKKIE--ILAILVFTTIFLALFISTLNTFLFNLLYFKLFRVIKSVSLVEIVEKYDG-IKSFFFFINNYFAGSYSLYIAFNLINFSITSSVLVVFLSYIYKS 292
>gi|71893877|ref|YP_279323.1| hypothetical protein MHJ_0526 [Mycoplasma hyopneumoniae J] >gi|71852004|gb|AAZ44612.1| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (231 aa)
Score = 100, Expect = 2.2e-02, Identities = 62/236 (26%), Positives = 102/236 (43%)
  Q:    50 MVITAILLALYIVFCYVGNTFFHLTFLANF-LNLDFSLVFLIILVFICKWQW-------------WLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKTNIVDSYFLS 285
           + +  ILL+L I+F    + +F   F  N  L +D S +F I +  I  +               WL     GG+    +   G ++  + + +   + LSF FL+K IFI                    N KK +   I  +   I  + V TF+ +      LNG+L TP+Y +LY +TES   ++  + ++            YWT I + ++ FN   + L   L+  +        I+  YFLS
  S:    15 LTVAGILLSLSIIFLIFSHNYFSWPFFQNLGLKVDLSTLFFIPIFLISGFGIGIICLLIRFSIGPWLIFNTFGGIDIVYF---GHFILFLASSIYIFSFLSFRFLLKKIFI--------------------NSKKTKTFIILAL---IFAVLVTTFLMT-----YLNGVLITPVYFKLYKLTESISLLKMIEHWSEIREKFGGLKLSYWTFILSAFAPFNLANYSLESFLALPIY-------IIADYFLS 226
>gi|54020569|ref|YP_116051.1| hypothetical protein mhp542 [Mycoplasma hyopneumoniae 232] >gi|53987742|gb|AAV27943.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (231 aa)
Score = 100, Expect = 2.3e-02, Identities = 62/236 (26%), Positives = 102/236 (43%)
  Q:    50 MVITAILLALYIVFCYVGNTFFHLTFLANF-LNLDFSLVFLIILVFICKWQW-------------WLFAAIVGGLANFLWAGVGGYVGVIFNIVLNLTTLSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKTNIVDSYFLS 285
           + +  ILL+L I+F    + +F   F  N  L +D S +F I +  I  +               WL     GG+    +   G ++  + + +   + LSF FL+K IFI                    N KK +   I  +   I  + V TF+ +      LNG+L TP+Y +LY +TES   ++  + ++            YWT I + ++ FN   + L   L+  +        I+  YFLS
  S:    15 LTVAGILLSLSIIFLIFSHNYFSWPFFQNLGLKVDLSTLFFIPIFLISGFGIGIICLLIRFLIGPWLIFNTFGGIDIVYF---GHFILFLASSIYIFSFLSFRFLLKKIFI--------------------NSKKTKTFIILAL---IFAVLVTTFLMT-----YLNGVLITPVYFKLYKLTESISLLKMIEHWSEIREKFGGLKLSYWTFILSAFAPFNLANYSLESFLALPIY-------IIADYFLS 226
>gi|72080856|ref|YP_287914.1| hypothetical protein MHP7448_0525 [Mycoplasma hyopneumoniae 7448] >gi|71913980|gb|AAZ53891.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (231 aa)
Score = 99, Expect = 2.9e-02, Identities = 64/236 (27%), Positives = 104/236 (44%)
  Q:    50 MVITAILLALYIVFCYVGNTFFHLTFLANF-LNLDFSLVFLIILVFICKWQWWLFAAIVGGL--ANFLWAGVGGYVGVIF-NIVLNLTT-------LSFTFLMKWIFIEKYLSSNKLNKPTDTVNDSLNHKKKRFKKIHGIELRILTICVVTFIYSIILNCVLNGILFTPLYMQLYHMTESAWFIETAKEYNANPNALLLFIPDYWTGIFTLYSAFNAIKFGLVLSLSFVLLVLRYKTNIVDSYFLS 285
           + +  ILL+L I+F    + +F   F  N  L +D S +F I +  I  +   +   ++  L     ++   GG   V F + +L L +       LSF FL+K IFI                    N KK +   I  +   I  + V TF+ +      LNG+L TP+Y +LY +TES   ++  + ++            YWT I + ++ FN   + L   L+  +        I+  YFLS
  S:    15 LTVAGILLSLSIIFLIFSHNYFSWPFFQNLGLKVDLSTLFFIPIFLISGFGIGIICLLIRFLIGPRLIFNTFGGIDIVYFGHFILFLASSIYIFSFLSFRFLLKKIFI--------------------NSKKTKTFIILAL---IFAVLVTTFLMT-----YLNGVLITPVYFKLYKLTESISLLKMIEHWSEIREKFGGLKLSYWTFILSAFAPFNLANYSLESFLALPIC-------IIADYFLS 226