>gi|26554369|ref|NP_758303.1| DNA polymerase III subunit alpha [Mycoplasma penetrans HF-2] >gi|26454379|dbj|BAC44707.1| DNA polymerase III subunit alpha [Mycoplasma penetrans HF-2] (1458 aa)
Score = 7200, Expect = 0.0e+00, Identities = 1458/1458 (100%), Positives = 1458/1458 (100%)
  Q:     1 MADKNSIYNFLSKLNLVSLENWKNHFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           MADKNSIYNFLSKLNLVSLENWKNHFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF
  S:     1 MADKNSIYNFLSKLNLVSLENWKNHFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
>gi|196247598|ref|ZP_03146300.1| DNA polymerase III, alpha subunit [Geobacillus sp. G11MC16] >gi|196212382|gb|EDY07139.1| DNA polymerase III, alpha subunit [Geobacillus sp. G11MC16] (1434 aa)
Score = 2679, Expect = 0.0e+00, Identities = 578/1447 (39%), Positives = 886/1447 (61%)
  Q:    10 FLSKLNLVSLENWKNHFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLV---DDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLND----YGFSKHHLSYIL---DEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS-----FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
            L +L + S E W  +F       +  +K+  S +       VLP D+   F D L        +V   +        + D+  Y        +EQ Q+G S   +LL       G + P++  N +F+      +   +K+    F K + D    +GF   HL   +   +++    ++  + + +E+    +T++ +     +  S        Y  R      V  L  +  E +   ++G +F  +    K+G  +    +TDY++SIVIK     K +  ++S +K+G+WVK + S+Q D +   D+  +  +++ ++  +   R D A    KR EL  HT M+  + + ++ +L + + + G+ +VAITD    Q+FP+ Y+ AKK+  +K +YG++ NI+D  +PI  N    ++SD TYV+FD+ETTGLS  Y+ IIE  A+K   G  ++    F NP   +S     +T I++E VKDA  ++E L +  D++GDS L AHN   FD+ FLN  L +  +  + NP+IDTL+++R +   +  H L  + +K+ I+   TQ HRA  DAE   ++  R+L+  + + I   +E+NS   ++     +R   +T+  +NE  ++NL+KL+S S    F   P++      +  +  +V +   +GE+F+  +    + +E+I +  YDF+ +  P  +   I  +  K    I+D I+ I+ +  K +  VVAT + +YLN  D++Y ++ ++++   G  N L ++      LP  YFRTTDE+ D FSFL       +IVV N+  IASLI   +KPIK+ L++P IEGA D+++++ Y+++  I+GD +   V+ R+++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK+  F  + +V SGFDLP+ NCP+C +K K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T A+KTAYG+VK Y  +   +  R AEI R+A  C  VKRTTGQHPGGI+VVP   ++YDFTP  YPADD + +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D DVM +F+ST+ L +    I  +   G+ GIPEFGT FV++ML  TKP+ FS+L++ISGLSHGT+VW  NA+ LI+    T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ +  +++P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++PL +YASYF++R + FD+ +++ G + I  +I EI  K            KE  L+ + E+ALE+  RG+ F NIDL +S AT+F+++G  LIPPF+AI GLG +VA +IV+AREE  F SKED ++R KV+ T ++ +E  G   SL + +Q+SLF
  S:    13 LLEQLKMTSDE-WMPYFREAAIRKVVIDKEEKSWHFHFQLANVLPVDVYKSFTDRLAAAFRHIAAVRHTIYVEAPHVTETDVQAYWPLC----LEQLQEGVSPLVDLL-------GRQTPVVKGNKLFVTARHEAEALAVKR---RFAKKIADVYASFGFPLLHLEVGIQPAEQEMERFLAQKQQEDEERALAVLTDLAKEEEKAEAASPSGPLVIGYPIRDEEP--VRPLETIVEEERRVVVQGYVFDAEVTELKSGRTLLTMKITDYTNSIVIKMFSRDKEDAALMSSVKKGMWVKVRGSVQNDTFVR-DLVIIANDLNEVAANE---RRDTAPEGEKRVELHLHTPMSQMDAVTSVAKLIEQAKKWGHPAVAITDHAVVQSFPEAYSAAKKHG-MKVLYGMEANIVDDGVPIAYNEAHRRLSDETYVVFDVETTGLSAVYNTIIELAAVKVKDGEIIDRFMSFANPHHPLSVTTMELTGITDEMVKDAPDVEEVLRRFIDWVGDSTLAAHNA-SFDIGFLNAGLAKMGLGKVINPVIDTLELARFLYPDLKNHRLNTLCKKFDIEL--TQHHRAIYDAEATGHLLMRLLKEAEERGILYHDELNSRTHSEASYRLSRPFHVTLLAQNETGLKNLFKLVSLSHVQYFHRVPRIPRSVLVKHRDGLLVGSGCDKGELFDNLIQKAPEEVEEIAR-FYDFLEVHPPAVYKPLIEMDYVKDEEMIKDIIRSIVALGEKLDIPVVATGNVHYLNPEDKIYRKILIHSQ---GGANPLNRHE-----LPDVYFRTTDEMLDCFSFLGAEK-AKEIVVDNTQKIASLI-GEVKPIKDDLYTPRIEGADDEIREMSYRRAKDIYGDPLPKIVEERLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFNDGSVGSGFDLPDKNCPQCGTKYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAYGFVKGYASD-HNLELRGAEIDRLAAGCTGVKRTTGQHPGGIIVVPDYMEIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPDVMGIFSSTEPLGVTPEQI--MCNVGTIGIPEFGTRFVRQMLEETKPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRDDIMVYLIYRGLEPSLAFKIMESVRKGKGLTPEFEEEMRKHDVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGIQATA------KEKSLLTVLEVALEMCERGFTFKNIDLYRSQATEFVIDGHSLIPPFNAIPGLGTNVAQNIVRAREEGEFLSKEDLQQRGKVSKTLLEYLESRGCLDSLPDHNQLSLF 1434
>gi|138894778|ref|YP_001125231.1| DNA polymerase III PolC [Geobacillus thermodenitrificans NG80-2] >gi|134266291|gb|ABO66486.1| DNA polymerase III alpha subunit [Geobacillus thermodenitrificans NG80-2] (1442 aa)
Score = 2673, Expect = 0.0e+00, Identities = 577/1447 (39%), Positives = 885/1447 (61%)
  Q:    10 FLSKLNLVSLENWKNHFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLV---DDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLND----YGFSKHHLSYIL---DEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS-----FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
            L +L + S E W  +F       +  +K+  S +       VLP D+   F D L        +V   +        + D+  Y        +EQ Q+G S   +LL         + P++  N +F+      +   +K+    F K + D    +GF   HL   +   +++    ++  + + +E+    +T++ +     +  S        Y  R      V  L  +  E +   ++G +F  +    K+G  +    +TDY++SIVIK     K +  ++S +K+G+WVK + S+Q D +   D+  +  +++ ++  +   R D A    KR EL  HT M+  + + ++ +L + + + G+ +VAITD    Q+FP+ Y+ AKK+  +K +YG++ NI+D  +PI  N    ++SD TYV+FD+ETTGLS  Y+ IIE  A+K   G  ++    F NP   +S     +T I++E VKDA  ++E L +  D++GDS L AHN   FD+ FLN  L +  +  + NP+IDTL+++R +   +  H L  + +K+ I+   TQ HRA  DAE   ++  R+L+  + + I   +E+NS   ++     +R   +T+  +NE  ++NL+KL+S S    F   P++      +  +  +V +   +GE+F+  +    + +E+I +  YDF+ +  P  +   I  +  K    I+D I+ I+ +  K +  VVAT + +YLN  D++Y ++ ++++   G  N L ++      LP  YFRTTDE+ D FSFL       +IVV N+  IASLI   +KPIK+ L++P IEGA D+++++ Y+++  I+GD +   V+ R+++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK+  F  + +V SGFDLP+ NCP+C +K K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T A+KTAYG+VK Y  +   +  R AEI R+A  C  VKRTTGQHPGGI+VVP   ++YDFTP  YPADD + +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D DVM +F+ST+ L +    I  +   G+ GIPEFGT FV++ML  TKP+ FS+L++ISGLSHGT+VW  NA+ LI+    T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ +  +++P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++PL +YASYF++R + FD+ +++ G + I  +I EI  K            KE  L+ + E+ALE+  RG+ F NIDL +S AT+F+++G  LIPPF+AI GLG +VA +IV+AREE  F SKED ++R KV+ T ++ +E  G   SL + +Q+SLF
  S:    21 LLEQLKMTSDE-WMPYFREAAIRKVVIDKEEKSWHFHFQLANVLPVDVYKSFTDRLAAAFRHIAAVRHTIYVEAPHVTETDVQAYWPLC----LEQLQEGVSPLVDLL-------SRQTPVVKGNKLFVTARHEAEALAVKR---RFAKKIADVYASFGFPLLHLEVGIQPAEQEMERFLAQKQQEDEERALAVLTDLAKEEEKAEAASPSGPLVIGYPIRDEEP--VRPLETIVEEERRVVVQGYVFDAEVTELKSGRTLLTMKITDYTNSIVIKMFSRDKEDAALMSSVKKGMWVKVRGSVQNDTFVR-DLVIIANDLNEVAANE---RRDTAPEGEKRVELHLHTPMSQMDAVTSVAKLIEQAKKWGHPAVAITDHAVVQSFPEAYSAAKKHG-MKVLYGMEANIVDDGVPIAYNEAHRRLSDETYVVFDVETTGLSAVYNTIIELAAVKVKDGEIIDRFMSFANPHHPLSVTTMELTGITDEMVKDAPDVEEVLRRFIDWVGDSTLAAHNA-SFDIGFLNAGLAKMGLGKVINPVIDTLELARFLYPDLKNHRLNTLCKKFDIEL--TQHHRAIYDAEATGHLLMRLLKEAEERGILYHDELNSRTHSEASYRLSRPFHVTLLAQNETGLKNLFKLVSLSHVQYFHRVPRIPRSVLVKHRDGLLVGSGCDKGELFDNLIQKAPEEVEEIAR-FYDFLEVHPPAVYKPLIEMDYVKDEEMIKDIIRSIVALGEKLDIPVVATGNVHYLNPEDKIYRKILIHSQ---GGANPLNRHE-----LPDVYFRTTDEMLDCFSFLGAEK-AKEIVVDNTQKIASLI-GEVKPIKDDLYTPRIEGADDEIREMSYRRAKDIYGDPLPKIVEERLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFNDGSVGSGFDLPDKNCPQCGTKYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAYGFVKGYASD-HNLELRGAEIDRLAAGCTGVKRTTGQHPGGIIVVPDYMEIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPDVMGIFSSTEPLGVTPEQI--MCNVGTIGIPEFGTRFVRQMLEETKPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRDDIMVYLIYRGLEPSLAFKIMESVRKGKGLTPEFEEEMRKHDVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGIQATA------KEKSLLTVLEVALEMCERGFTFKNIDLYRSQATEFVIDGHSLIPPFNAIPGLGTNVAQNIVRAREEGEFLSKEDLQQRGKVSKTLLEYLESRGCLDSLPDHNQLSLF 1442
>gi|56419793|ref|YP_147111.1| DNA polymerase III PolC [Geobacillus kaustophilus HTA426] >gi|56379635|dbj|BAD75543.1| DNA-directed DNA polymerase III alpha chain [Geobacillus kaustophilus HTA426] (1444 aa)
Score = 2651, Expect = 0.0e+00, Identities = 531/1235 (42%), Positives = 806/1235 (65%)
  Q:   222 VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           V +L  +  E +   ++G +F  +    K+G  +    +TDY++SI++K     K + +++S +K+G+WVK + S+Q D +   D+  +  +++ I+  +   R D A    KR EL  HT M+  + + ++ +L + + + G+ ++A+TD    Q+FP+ Y+ AKK+  +K IYG++ NI+D  +PI  N    ++S+ TYV+FD+ETTGLS  Y+ IIE  A+K   G  ++    F NP   +S     +T I++E VKDA K  E L +  D+ GD+ L+AHN   FD+ FLN  L       I NP+IDTL+++R +   +  H L  + +K+ I+   TQ HRA  DAE   ++  R+L+  + + I   +E+NS   ++      R   +T+  +NE  ++NL+KL+S S    F   P++      +  +  +V +   +GE+F+  +    + +EDI +  YDF+ +  P+ +   I  +  K    I++ I+ I+ +  K +  VVAT + +YLN  D++Y ++ ++++   G  N L ++      LP  YFRTT+E+ D FSFL  P    +IVV N+  IASLI  ++KPIK+ L++P IEGA ++++++ Y+++  I+GD +   V+ R+++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK+  F  + +V SGFDLP+ NCP+C +K K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T A+KTAYG+VK+Y  +   +  R AEI R+A  C  VKRTTGQHPGGI+VVP   ++YDFTP  YPADD + +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D DVM +F+ST+ L +    I  +   G+ GIPEFGT FV++ML  T+P+ FS+L++ISGLSHGT+VW  NA+ LI+    T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E++  +  +++P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++PL +YASYF++R + FD+ +++ G + I  +I EI  K            KE  L+ + E+ALE+  RG+ F NIDL +S AT+F+++G+ LIPPF+AI GLG +VA +IV+AREE  F SKED ++R K++ T ++ +E  G   SL + +Q+SLF
  S:   233 VRRLETIVEEERRVVVQGYVFDAEVSELKSGRTLLTMKITDYTNSILVKMFSRDKEDAELMSGVKKGMWVKVRGSVQNDTFVR-DLVIIANDLNEIAANE---RQDTAPEGEKRVELHLHTPMSQMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHG-MKVIYGLEANIVDDGVPIAYNETHRRLSEETYVVFDVETTGLSAVYNTIIELAAVKVKDGEIIDRFMSFANPGHPLSVTTMELTGITDEMVKDAPKPDEVLARFVDWAGDATLVAHNA-SFDIGFLNTGLARMGRGKIANPVIDTLELARFLYPDLKNHRLNTLCKKFDIEL--TQHHRAIYDAEATGHLLMRLLKEAEERGILFHDELNSRTHSEASYRLARPFHVTLLAQNETGLKNLFKLVSLSHIQYFHRVPRIPRSVLVKHRDGLLVGSGCDKGELFDNLIQKAPEEVEDIAR-FYDFLEVHPPDVYKPLIEMDYVKDEEMIKNIIRSIVALGEKLDIPVVATGNVHYLNPEDKIYRKILIHSQ---GGANPLNRHE-----LPDVYFRTTNEMLDCFSFLG-PEKAKEIVVDNTQKIASLI-GDVKPIKDELYTPRIEGADEEIREMSYRRAKEIYGDPLPKLVEERLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFNDGSVGSGFDLPDKNCPRCGTKYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAYGFVKAYASD-HNLELRGAEIDRLAAGCTGVKRTTGQHPGGIIVVPDYMEIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPDVMGIFSSTEPLGVTPEQI--MCNVGTIGIPEFGTRFVRQMLEETRPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRDDIMVYLIYRGLEPSLAFKIMESVRKGKGLTPEFEAEMRKHDVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGIQATA------KEKSLLTVLEVALEMCERGFSFKNIDLYRSQATEFVIDGNSLIPPFNAIPGLGTNVAQAIVRAREEGEFLSKEDLQQRGKLSKTLLEYLESRGCLDSLPDHNQLSLF 1444
>gi|110004377|emb|CAK98715.1| probable dna polymerase III alpha subunit protein [Spiroplasma citri] (1453 aa)
Score = 2650, Expect = 0.0e+00, Identities = 582/1328 (43%), Positives = 838/1328 (63%)
  Q:   128 ISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKN---KIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVT--KLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVES--IQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIW----KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMN-ARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVK--NKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV-----EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISL 1455
           +++N + +      ++K + ++  +++K L  YGFS   L+ ++D +  +I+  ++    K QE  +     + + +N   +       + ++  G+ +  +L D+  ++   TI G+I   ++ +  T   IY   VTDYSD+I  K     +   D + ELK   WV     I+ D Y N  +   I++IS +   ++  R DNA  KR EL  HT M+  +G+ ++  LFK      + ++A TD  N Q +P+ YN  KKY  +K IYGV+ +++D  +  V N +   +  A YVIFD+ETTGLS  YD+IIEFGA+    G+  E   I     P  K+S     +T I++E + D     E++ +I ++  D++LIAHN  +FDL F+   L++     I N +IDTLQ+SR +   +  + LG IAR Y + Y+E  AHR D DA  L +I+    ++M+ N     I+  N+I  N+ +  + ++ R   + +  KN+  +  L+KLI+++ T  F   PK+      +  ++ ++ +S   G++FE A +     L + IK  YD+I +  P  + H +         +   IK I+  A + NK VVAT D +YLN  D+++  VY+NAK +GG+ + L+ Y +  T  P  + RTT E+ +EF FLND  L+ +IVVTN N I+  I+  ++ IK+ L++P IEG+   LK+L YQ +Y I+G+ +   V +R++RE++++I +G+A+IYW +H LV +S+ DGY+VGSRGSVGSS  A + +ITEVNPL+PHY+C+ C Y  F  + +V  G+DL    CPKC+  LKG+GH+IPFETF+GF+ DK+PDIDLNFS  YQ  AHDF K MFGE  V+RAGTIST AEKTAYGYVK YFE    ++  R AE+ RIAK CE VKRTTGQHPGGIVV+P+  +V  FTP N+PADD   +W TTH  F ++HD++LK DILGH +PT L+ML + T V+  TIP  D  V+ LF S D L IK   IN   KTG+ GIPEFGT FV++MLL TKP  F+DL++ISGLSHGT+VW  NA+ LI  + ++IS+VI CRDDIMV LI KG+    AFKIMEDVRKGKGL  E+++++ DNN+  WYI+SCNKI Y+FPKAHATAYV+MAW++AW+KI YP+ +YA++FS R  VFDIK+IL G   I   + +I+ ++ N    A  K   KE DLIP+YE+ALE+  RG K +NIDLK S   +F V         ++PPFSAIDGLG +V  SI+ AR EK F S  D +KRT +T  H++  EELGI   L+ DDQI+ 
  S:   114 LTDNILKITVHSESEQKLVGEHCNYYQKKLRCYGFSDLQLALVIDLRENNILEINEQELIKYQETAQKTEQLISKPTNGANSVLREPNSYHRAKIGEASYERLIDIDQDVPNVTIYGKILSKERQLISTKKFIYVITVTDYSDTIGAKFFTRTEQPDDFIEELKTNEWVSLFGDIRYDTYANEQMF-FIKKISRLDH-EDLYREDNAPEKRIELHLHTKMSIMDGVTDLAMLFKTLQHWNHKAIAFTDHLNVQAYPEIYNLNKKYPDIKVIYGVEADVLDDKVSYVKNPHHHNLRTAKYVIFDLETTGLSSGYDEIIEFGAV-IMDGISGERQIINHLFKPSVKLSSFTTELTGITDELLADKPTFIESIDQILEYFKDAILIAHNA-EFDLGFIQSWLKKAGRSEINNTVIDTLQLSRILEPHLKNYRLGTIARCYSVIYNEEVAHRGDYDAIVLTDIYEHQLRKMINNY---GIEFDNDI-ENIHDPAVYKKLRPKHMAILAKNQAGLLELFKLITSAHTKYFYSSPKLLRSVIEQHRSNLLIGSSCVNGDVFEVARNKNLSELRETIK-FYDYIEVQPPSVYKHLVQMGDLSEERLLTVIKDIVFTAKELNKLVVATGDVHYLNPEDKIFREVYINAKGIGGRPHPLYDYKKRVTDNPDQFLRTTMEMMNEFKFLNDDELIYEIVVTNPNLISDQIE-KVEIIKDKLYTPKIEGSDQLLKELCYQNAYKIYGNPLPKIVASRLERELNAIIKHGFAVIYWIAHKLVDKSLQDGYLVGSRGSVGSSFVATMSNITEVNPLQPHYLCSYCSYSEFIVDGSVKCGYDLSARTCPKCQKPLKGEGHDIPFETFLGFEADKVPDIDLNFSGEYQPIAHDFTKEMFGERSVYRAGTISTVAEKTAYGYVKGYFESKNILHLKRRAELERIAKGCEGVKRTTGQHPGGIVVIPNEYEVEAFTPVNFPADDIKSNWLTTHFDFHAIHDNVLKLDILGHVDPTALRMLQDLTGVDPKTIPTNDEAVLSLFRSLDVLNIKPEDING-EKTGAIGIPEFGTFFVRKMLLDTKPTSFADLVQISGLSHGTDVWIGNAQELIRNQNISISEVIGCRDDIMVNLIYKGLPAQSAFKIMEDVRKGKGLTAEHEQLMRDNNVEQWYIDSCNKIKYMFPKAHATAYVLMAWRVAWYKINYPVEYYATFFSTRTDVFDIKTILKGAETIKQVLRDIQTRLDNKDFNAPNKPTQKEKDLIPVYEIALEMYARGIKMSNIDLKTSRNKNFTVITTENNEKIILPPFSAIDGLGGAVGDSIINARYEKPFLSVADLQKRTNITKAHLESFEELGILKDLSLDDQIAF 1451
>gi|171324508|ref|ZP_02913022.1| DNA polymerase III, alpha subunit [Geobacillus sp. WCH70] >gi|171089550|gb|EDT35878.1| DNA polymerase III, alpha subunit [Geobacillus sp. WCH70] (1435 aa)
Score = 2641, Expect = 0.0e+00, Identities = 553/1357 (40%), Positives = 864/1357 (63%)
  Q:   100 IEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKK-YLEHFRKFLNDYGFSKHHLSYILDEKTIDI---ISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++ Q+G S    LL+        + P +  N +++    + +   +K+ + +   +    +GF    L   + +   D    I+  + +  E+    +TE+ + + ++   ++        Y  R+    ++  L  +  E +   ++G +F  +    K+G  +    +TDY++SI++K     K +  +++++K+G+WVK + S+Q D +   D+  +  +I+ I K KE  R D A    KR EL  HT M+  + + ++ +L + + + G+ ++A+TD    Q+FP+ Y+ AKKY  +K +YGV+ NI+D  +PI  N     +S+ TYV+FD+ETTGLS  Y+ IIE  A+K   G  ++    F NP   +S     +T I+++ +KDA  ++E L +  D++GDS+L+AHN   FD+ FLN    +  +  + NP+IDTL+++R +  ++  H L  + +K+ I+   TQ HRA  DAE    +  R+L++ + + I   +E+N   + +   +R+R   +T+  +N+  ++NL+KL+S S    F   P++      +     +V +   +GE+F+  +    + +E+I K  YDF+ +  PE +   I  +  K    I++ I++I+ +  K N  VVAT + +YLN  D++Y ++ ++++   G  N L +Y      LP  YFRTTDE+   FSFL +     +IVV N+  IA LI   +KPIK+ L++P IEGA ++++++ Y+++  I+GD +   V+ R+++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK+  F  + +V SGFDLP+ NCPKC +K K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T A+KTAYG+VK Y  +   +  R+AEI R+A  C  VKRTTGQHPGGI+VVP   D+YDFTP  YPADD + +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+ST+SL +    I  +   G+ GIPEFGT FV++ML  TKP+ FS+L++ISGLSHGT+VW  NA+ LI+    T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ +  +++P WYIESC KI Y+FPKAHA AYV+MA +IA+FK+++PL +YASYF++R + FD+ +++ G + I  +I EI  K  N         KE  L+ + E+ALE+  RG+ F NIDL +S AT+F+++G+ LIPPF+AI GLG +VA +IV+AREE  F SKED ++R K++ T ++ +E  G   SL + +Q+SLF
  S:   101 LQELQEGVSPLLSLLHE-------QVPTVKGNKLYVTARNDAEAMAVKRRFAKKIAEVYQSFGFPLLQLEIEVKQSEKDFEQFIAQKQQEDAERALAALTEMTKETKSETAGNAPAGPLIIGYPIREE--EEIRTLDSIVEEERRVVVQGYVFDAEINELKSGRTLLTLKITDYTNSILVKMFSRDKEDAALMADVKKGMWVKVRGSVQNDTFVR-DLVLIANDINEI-KAKE--RQDTAPEGEKRVELHLHTPMSQMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKYD-MKVLYGVEANIVDDGVPIAYNEAHRLLSEDTYVVFDVETTGLSAVYNTIIELAAVKVKDGEIIDRFTSFANPHHPLSITTIELTGITDDMLKDAPDVEEVLRQFYDWMGDSILVAHNA-SFDIGFLNVGFTKLGLGKVTNPVIDTLELARFLYPELKNHRLNTLCKKFDIEL--TQHHRAIYDAEATGYLLMRLLKDAQERGILYHDELNERSKEEVSYQRSRPFHVTLLAQNDIGLKNLFKLVSLSHVKYFYRVPRIPRSVLQQHREGILVGSGCDKGEVFDNMIQKAPEEVEEIAK-FYDFLEVHPPEVYKPLIEMDYVKDENMIKEIIRKIVMLGEKLNIPVVATGNVHYLNPEDKIYRKILIHSQ---GGANPLNRYE-----LPDVYFRTTDEMLKCFSFLGEEK-AKEIVVMNTQKIADLI-GEVKPIKDKLYTPRIEGAEEEIREMSYRRAKEIYGDPLPEIVEQRLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFNDGSVGSGFDLPDKNCPKCGTKYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAYGFVKGYASDLN-LQLRSAEIDRLAAGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSSTESLGVTPEQI--MCNVGTLGIPEFGTRFVRQMLEETKPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRDDIMVYLIYRGLEPSLAFKIMESVRKGKGLTPEFEEEMRKHDVPEWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGLNATA------KEKSLLTVLEVALEMCERGFSFKNIDLYRSQATEFVIDGNSLIPPFNAIPGLGTNVALNIVRAREEGEFLSKEDLQQRGKLSKTLIEYLESRGCLDSLPDHNQLSLF 1435
>gi|154686075|ref|YP_001421236.1| DNA polymerase III PolC [Bacillus amyloliquefaciens FZB42] >gi|154351926|gb|ABS74005.1| PolC [Bacillus amyloliquefaciens FZB42] (1437 aa)
Score = 2630, Expect = 0.0e+00, Identities = 573/1447 (39%), Positives = 891/1447 (61%)
  Q:    10 FLSKLNLVSLENWKNHFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFV--------------DSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIK-KYLEHFRKFLNDYGFSKHHLS---YILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS----FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEEN-KMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
            L +LN+   + +  +FE      +T +K   + + +  F  +LP  I   F+               S+ ++D +V   LV +Y T   E++                +GTS     L      +  +KP +  N + +    + +   +K KY    +     +GF +  L    ++ D++          + QE+    + E+++       D +        ++     ++  L  +  E +  T++G +F  +    K+G  +  + +TDY++SI++K    +K +  ++  LK+G+WVKA+ SIQ D +    +  L+   + +++ K   R D A    KR EL  H+ M+  + +  I +L + + + G+ ++A+TD    Q+FPD Y+ AKK+  +K IYG++ NI+D  +PI  N     + + TYV+FD+ETTGLS  YD IIE  A+K   G  ++  + F NP   +S     +T I+++ V+DA  + + +   K++IGD VL+AHN   FD+ FLN   +   K +  KNP+IDTL+++R +  +   H L  + +K+ I+   TQ HRA  DAE    +  +ML++   +DI   +++N N+      +R+R    T+   NE  ++NL+KL+S S    F   P++     N++    ++ ++   GE+FE  M  + + +EDI    YD++ +  PE + H +  E+ +    +++ I  I K+  K NK VVAT + +YLN+ D++Y ++ ++++   G  N L ++      LPK +FRTTDE+ + FSFL       +IVV N+  +AS+ID  IKPIK+ L++P I+GA ++++++ YQ++ SI+G+ +   V+ARI++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A L +ITEVNPL PHY+C +C+Y  F  + +V SGFDLP+ +CP C + LK DGH+IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   ++ R AEI R+ + C  VKRTTGQHPGGI+VVP   D+YDF+P  +PAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F  T+SL +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      +S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L +YA+YF++R   FDI +++ G + I   +++I  K   A+PK K        +L+ + ELALE+  RGY F  +DL +S A++F+++G+ LIPPF++I GLG + A +IVKAR+E  F SKED +KR KV+ T ++ ++  G   SL + +Q+SLF
  S:    14 LLQQLNMTD-DTFMTYFEDGEIDKLTIHKAEKAWHFQFRFKALLPYQIYDSFMMRLTQSFAHIARVTSSVQVIDPTVTEELVQDYWTRCIEEL----------------EGTSPPMVAL------LNQQKPKLKGNKLIVKTKTDTEASALKNKYSALIQHSYRQFGFPELQLDTEIFVSDQEVQKFREQKLAEDQERAMQALIEMEKKEKEGDEDQAPSGPLVIGYQIKENEEIRTLDSIMDEERRITVQGFVFDAETRELKSGRTLCIFKITDYTNSILVKMFAREKEDAALMKTLKKGMWVKARGSIQNDTF----VRDLVMIANDVNEIKAKTREDTAPEGEKRVELHLHSPMSQMDAVTGIGKLVEQAKKWGHEAIALTDHAVVQSFPDAYSAAKKHG-IKMIYGMEANIVDDGVPIAYNPAHRLLEEDTYVVFDVETTGLSAVYDTIIELAAVKIRGGEIIDKFEAFANPHHPLSATTIELTGITDDMVRDAPDVVDVVRDFKEWIGDDVLVAHNA-SFDMGFLNVAYKRLLKTEKAKNPVIDTLELARFLYPEFKNHRLNTLCKKFDIEL--TQHHRAVFDAEATGYLLLKMLKDAAEKDIFYHDQLNENMGQSNAYQRSRPYHATLLAVNETGLKNLFKLVSISHIQYFYRVPRIPRSQLNKYREGLLIGSACDRGEVFEGMMQKSPEEVEDI-ASFYDYLEVQPPEVYRHLLQLELVRDEKALKEIIANITKLGEKLNKPVVATGNVHYLNDEDKIYRKILISSQ---GGANPLNRHE-----LPKVHFRTTDEMLEAFSFLGAEK-AKEIVVDNTQKVASMID-EIKPIKDDLYTPKIDGADEEIREMSYQRARSIYGEELPEIVEARIEKELKSIIGHGFAVIYLISHKLVKRSLDDGYLVGSRGSVGSSLVATLTEITEVNPLAPHYVCPSCRYSEFFNDGSVGSGFDLPDKSCPSCGTPLKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPHAHNYTKVLFGEDNVYRAGTIGTVAEKTAYGYVKGYAGD-HNLHMRGAEIDRLVQGCTGVKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATGSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTESLGVTEEQIG--CKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNNTCELSEVIGCRDDIMVYLIYQGLEPSLAFKIMEFVRKGKGLTPEWEEEMKKNNVPNWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHALLYYAAYFTVRADDFDIDTMIKGSTAIRAVMDDISSKGLDASPKEK--------NLLTVLELALEMCERGYSFQKVDLYRSSASEFIIDGNSLIPPFNSIPGLGTNAALNIVKARKEGEFLSKEDLQKRGKVSKTILEYLDRHGCLESLPDQNQLSLF 1437
>gi|16078721|ref|NP_389540.1| DNA polymerase III PolC [Bacillus subtilis subsp. subtilis str. 168] >gi|118793|sp|P13267|DPO3_BACSU DNA polymerase III polC-type (PolIII) >gi|40060|emb|CAA36362.1| unnamed protein product [Bacillus subtilis] >gi|2634030|emb|CAB13531.1| DNA polymerase III (alpha subunit) [Bacillus subtilis subsp. subtilis str. 168] (1437 aa)
Score = 2623, Expect = 0.0e+00, Identities = 548/1333 (41%), Positives = 851/1333 (63%)
  Q:   124 KKPIISENAIFLHYLENDQEKCIK-KYLEHFRKFLNDYGFSKHHL--SYILDEKTIDIISDHK-NKIQEKIKNEITEVKRSSNAKKTDSS----FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEEN-KMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +KP +  N + +    + +   +K KY    +     +GF    L     + E+ +    + K  + QE+    + E+++       D +        ++     ++  L  +  E +  T++G +F ++    K+G  +  + +TDY++SI+IK    +K +  ++  LK+G+WVKA+ SIQ D +    +  L+   + +++ K   R D+A    KR EL  H+ M+  + +  I +L + + + G+ ++A+TD    Q+FPD Y+ AKK+  +K IYG++ N++D  +PI  NA    + + TYV+FD+ETTGLS  YD IIE  A+K   G  ++  + F NP   +S  I  +T I+++ ++DA  + + +   +++IGD +L+AHN   FD+ FLN   ++  +++  KNP+IDTL++ R +  +   H L  + +K+ I+   TQ HRA  D E    +  +ML++   + I+  +E+N N+      +R+R    T+   N   ++NL+KL+S S    F   P++      ++    ++ ++   GE+FE  M  + + +EDI    YD++ +  PE + H +  E+ +    +++ I  I K+  K NK VVAT + +YLN+ D++Y ++ ++++   G  N L ++      LPK +FRTTDE+ + FSFL +     +IVVTN+  +ASL+D +IKPIK+ L++P IEGA ++++++ YQ++ SI+G+ +   V+ARI++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A L +ITEVNPL PHY+C  C++  F  + +V SGFDLP+  CP C + LK DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  ++  ++ R AEI R+ + C  VKRTTGQHPGGI+VVP   D+YDF+P  +PAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F  T+SL +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      +S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L +YA+YF++R   FDI +++ G + I   + +I  K   A+PK K        +L+ + ELALE+  RGY F  +DL +S AT+F+++G+ LIPPF++I GLG + A +IVKAREE  F SKED +KR KV+ T ++ ++  G   SL + +Q+SLF
  S:   119 QKPKLKGNKLIVKTKTDTEAAALKNKYSSMIQAEYRQFGFPDLQLDAEIFVSEQEVQKFREQKLAEDQERAMQALIEMEKKDKESDEDQAPSGPLVIGYQIKDNEEIRTLDSIMDEERRITVQGYVFDVETRELKSGRTLCIFKITDYTNSILIKMFAREKEDAALMKSLKKGMWVKARGSIQNDTF----VRDLVMIANDVNEIKAKTREDSAPEGEKRVELHLHSPMSQMDAVTGIGKLVEQAKKWGHEAIALTDHAVVQSFPDAYSAAKKHG-IKMIYGMEANLVDDGVPIAYNAAHRLLEEETYVVFDVETTGLSAVYDTIIELAAVKVKGGEIIDKFEAFANPHRPLSATIIELTGITDDMLQDAPDVVDVIRDFREWIGDDILVAHNA-SFDMGFLNVAYKKLLEVEKAKNPVIDTLELGRFLYPEFKNHRLNTLCKKFDIEL--TQHHRAIYDTEATAYLLLKMLKDAAEKGIQYHDELNENMGQSNAYQRSRPYHATLLAVNSTGLKNLFKLVSLSHIHYFYRVPRIPRSQLEKYREGLLIGSACDRGEVFEGMMQKSPEEVEDI-ASFYDYLEVQPPEVYRHLLELELVRDEKALKEIIANITKLGEKLNKPVVATGNVHYLNDEDKIYRKILISSQ---GGANPLNRHE-----LPKVHFRTTDEMLEAFSFLGEEK-AKEIVVTNTQKVASLVD-DIKPIKDDLYTPKIEGADEEIREMSYQRARSIYGEELPEIVEARIEKELKSIIGHGFAVIYLISHKLVKRSLDDGYLVGSRGSVGSSLVATLTEITEVNPLPPHYVCPECQHSEFFNDGSVGSGFDLPDKTCPHCGTPLKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPQAHNYTKVLFGEDNVYRAGTIGTVAEKTAYGYVKGYAGDNN-LHMRGAEIDRLVQGCTGVKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATGSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTESLGVTEEQIG--CKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNNICELSEVIGCRDDIMVYLIYQGLEPSLAFKIMEFVRKGKGLTPEWEEEMKNNNVPDWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHALLYYAAYFTVRADDFDIDTMIKGSTAIRAVMEDINAKGLDASPKEK--------NLLTVLELALEMCERGYSFQKVDLYRSSATEFIIDGNSLIPPFNSIPGLGTNAALNIVKAREEGEFLSKEDLQKRGKVSKTILEYLDRHGCLESLPDQNQLSLF 1437
>gi|194015013|ref|ZP_03053630.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus pumilus ATCC 7061] >gi|194014039|gb|EDW23604.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus pumilus ATCC 7061] (1437 aa)
Score = 2616, Expect = 0.0e+00, Identities = 531/1236 (42%), Positives = 809/1236 (65%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEEN-KMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++  L  +  E +  T++G +F  +    K+G  +  + +TDY++SI+IK    +K +  ++  LK+G+WVKA+ SIQ D +    +  L+   + +++ K  ++ D A    KR EL  H+ M+  + +  I +L + + + G+ ++A+TD    Q+FPD Y  +KK+  +K +YGV+ N++D  +PI  N     + DATYV+FD+ETTGLS  YD IIE  A+K   G  ++  + F NP   +S     +T I+++ VKDA  + + +   K++IG  +L+AHN   FD+ FLN   +   K D   NP+IDTL++ R +  +   H L  + +K+ I+   TQ HRA  DAE    +  +ML++   +DI   +++N N+      +R+R     +  +NE  ++NL+KL+S S    F   P++      ++    I+ ++  +GE+FE  M  +   +EDI    YD++ +  PE + H +  E+ +    +++ I  I+K+  K NK VVAT + +YL++ D++Y ++ ++++   G  N L ++      LPK +FRTTDE+ + FSFL +     +IVVTN+  ++ ++++ IKPIK+ L++P IEGA ++++++ YQ + SI+GD +   V+ RI++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A L +ITEVNPL PHY+C +CK+  F  + +V SGFDLP+ +CP+C +  K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGEE V+RAGTI T AEKTAYGYVK Y  +   ++ R AEI R+ + C  VKRTTGQHPGGI+VVP   D+YDF+P  +PAD    DW TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F  T+ L +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI  K   +S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L +YA+YF++R   FDI+++  G + I   +++I  K   A+PK K        +L+ + ELALE+  RGY F  +DL +S AT+F+++GD LIPPF++I GLG +VA +IV+AR++  F SKED +KR KV+ T ++ ++  G   +L + +Q+SLF
  S:   224 EIRTLDSIMDEERRITVQGYVFDAETRELKSGRTLCIFKITDYTNSILIKMFAREKEDAQLMKSLKKGMWVKARGSIQNDTF----VRDLVMIANDVNEMKPQLKEDTAPEGEKRVELHLHSPMSQMDAVTGIGKLVEQAKKWGHEAIALTDHAVVQSFPDAYAASKKHD-IKMMYGVEINLVDDGVPIAYNPEHRLLEDATYVVFDVETTGLSAVYDTIIELAAVKIKGGEIIDRFEAFANPHHPLSATTIELTGITDDMVKDAPDVVDVVRDFKEWIGQDILVAHNA-SFDMGFLNTAYKRLLKTDKASNPVIDTLELGRFLYPEFKNHRLNTLCKKFDIEL--TQHHRAIYDAEATGYLMLKMLKDAAEKDIAYHDQLNENMGQSNAYQRSRPYHAILIAQNETGLKNLFKLVSLSHIHYFYRVPRIPRSQLEKYREGLIIGSACDKGEVFEGMMQKSPDEVEDIAA-FYDYLEVHPPEVYQHLLQLELVRDERALKEIITNIVKLGEKLNKPVVATGNVHYLHQEDKIYRKILISSQ---GGANPLNRHE-----LPKVHFRTTDEMLEAFSFLGEEK-AKEIVVTNTKKVSEMVES-IKPIKDDLYTPKIEGADEEVREMSYQMARSIYGDDLPKIVEDRIEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSLVATLTEITEVNPLAPHYVCPSCKHSEFFNDGSVGSGFDLPDKDCPECGTPYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPIAHNYTKELFGEEYVYRAGTIGTVAEKTAYGYVKGYAGD-HNLHMRGAEIDRLVQGCTGVKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATGSDWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTEPLGVTEEQIG--CKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNKTCELSEVIGCRDDIMVYLIYQGLEPSLAFKIMESVRKGKGLPPEWEEEMKNNNVPNWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHALLYYAAYFTVRADDFDIETMTKGSNAIRAVMDDINSKGLDASPKEK--------NLLTVLELALEMCERGYHFKKVDLYRSSATEFIIDGDGLIPPFNSIPGLGTNVALNIVRARQDGEFLSKEDLQKRGKVSKTILEYLDRQGCLEALPDQNQLSLF 1437
>gi|143342|gb|AAA22666.1| polymerase III (1437 aa)
Score = 2615, Expect = 0.0e+00, Identities = 535/1236 (43%), Positives = 813/1236 (65%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEEN-KMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++  L  +  E +  T++G +F ++    K+G  +  + +TDY++SI+IK    +K +  ++  LK+G+WVKA+ SIQ D +    +  L+   + +++ K   R D+A    KR EL  H+ M+  + +  I +L + + + G+ ++A+TD    Q+FPD Y+ AKK+  +K IYG++ N++D  +PI  NA    + + TYV+FD+ETTGLS  YD IIE  A+K   G  ++  + F NP   +S  I  +T I+++ ++DA  + + +   +  IGD +L+AHN   FD+ FLN   ++  +++  KNP+IDTL++ R +  +   H L  + +K+ I+   TQ HRA  D E    +  +ML++   + I+  +E+N N+      +R+R    T+   N   ++NL+KL+S S    F   P++      ++    ++ ++   GE+FE  M  + + +EDI    YD++ +  PE + H +  E+ +    +++ I  I K+  K NK VVAT + +YLN+ D++Y ++ ++++   G  N L ++      LPK +FRTTDE+ + FSFL +     +IVVTN+  +ASL+D +IKPIK+ L++P IEGA +++++  YQ++ SI+G+ +   V+ARI++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A L +ITEVNPL PHY+C  C++  F  + +V SGFDLP+  CP C + LK DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y E++  ++ R AEI R+ + C  VKRTTGQHPGGI+VVP   D+YDF+P  +PAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F  T+SL +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      +S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L +YA+YF++R   FDI +++ G + I   + +I  K   A+PK K        +L+ + ELALE+  RGY F  +DL +S AT+F+++G+ LIPPF++I GLG + A +IVKAREE  F SKEDF+KR KV+ T ++ ++  G   SL + +Q+SLF
  S:   224 EIRTLDSIMDEERRITVQGYVFDVETRELKSGRTLCIFKITDYTNSILIKMFAREKEDAALMKSLKKGMWVKARGSIQNDTF----VRDLVMIANDVNEIKAKTREDSAPEGEKRVELHLHSPMSQMDAVTGIGKLVEQAKKWGHEAIALTDHAVVQSFPDAYSAAKKHG-IKMIYGMEANLVDDGVPIAYNAAHRLLEEETYVVFDVETTGLSAVYDTIIELAAVKVKGGEIIDKFEAFANPHRPLSATIIELTGITDDMLQDAPDVVDVIRDFRVRIGDDILVAHNA-SFDMGFLNVAYKKLLEVEKAKNPVIDTLELGRFLYPEFKNHRLNTLCKKFDIEL--TQHHRAIYDTEATAYLLLKMLKDAAEKGIQYHDELNENMGQSNAYQRSRPYHATLLAVNSTGLKNLFKLVSLSHIHYFYRVPRIPRSQLEKYREGLLIGSACDRGEVFEGMMQKSPEEVEDI-ASFYDYLEVQPPEVYRHLLELELVRDEKALKEIIANITKLGEKLNKPVVATGNVHYLNDEDKIYRKILISSQ---GGANPLNRHE-----LPKVHFRTTDEMLEAFSFLGEEK-AKEIVVTNTQKVASLVD-DIKPIKDDLYTPKIEGADEEIRESSYQRARSIYGEELPEIVEARIEKELKSIIGHGFAVIYLISHKLVKRSLDDGYLVGSRGSVGSSLVATLTEITEVNPLPPHYVCPECQHSEFFNDGSVGSGFDLPDKTCPHCGTPLKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPQAHNYTKVLFGEDNVYRAGTIGTVAEKTAYGYVKGYAEDNN-LHMRGAEIDRLVQGCTGVKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATGSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTESLGVTEEQIG--CKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQDLIHNNICELSEVIGCRDDIMVYLIYQGLEPSLAFKIMEFVRKGKGLTPEWEEEMKNNNVPDWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHALLYYAAYFTVRADDFDIDTMIKGSTAIRAVMEDINAKGLDASPKEK--------NLLTVLELALEMCERGYSFQKVDLYRSSATEFIIDGNSLIPPFNSIPGLGTNAALNIVKAREEGEFLSKEDFEKRGKVSKTILEYLDRHGCLESLPDQNQLSLF 1437
>gi|152976184|ref|YP_001375701.1| DNA polymerase III PolC [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024936|gb|ABS22706.1| DNA polymerase III, alpha subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (1433 aa)
Score = 2614, Expect = 0.0e+00, Identities = 534/1236 (43%), Positives = 802/1236 (64%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++T L ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  VL  LK+G+W+KA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + + ++ +L   + + G+ ++AITD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     + D TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K + ++GD  L+AHN   FD+ FLN   ++  +D  KNP+IDTL+++R +   +  H L  + +K  +D + TQ HRA  D E    +  +ML+    +  +  +++N ++      +R R S +T+   ++  ++NLYKLIS S  + F   P++      +     +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H +  E+ +  G ++  I  ++K+    +K VVAT + +YLN  D +Y ++ ++++   G  N L +++     LP  YFRTTDE+ D FSFL +     +IVVTN+  IASLI   + P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+ NCP C    K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAE+ R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+S +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++PL FYA+YF++R   FD+  +  G + I  KI EI +K   A+PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+K++ T ++ ++  G    L + +Q+SLF
  S:   221 EITPLREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPVLQSLKKGMWIKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTSVSQLIAQAGKWGHEAIAITDHAVAQSFPEAYSAGKK-AGIKVIYGVEANLVNDGVPIAYNEEHRLLEDETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVGEVFKKFQAWMGDHTLVAHNA-SFDMGFLNVGFKKCGLDKPKNPVIDTLELARFLFPDMKNHRLNTLCKK--LDIELTQHHRAIYDTEATGYLLAKMLKEVIEKGFEYHDQLNDSMGQGDSYKRGRPSHVTLLATSDEGLKNLYKLISYSHVNYFYRVPRIPRSLLKKHREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVELELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLNPEDAIYRKILISSQ---GGANPLNRHS-----LPPVYFRTTDEMLDCFSFLGEEK-AKEIVVTNTQKIASLI-GEVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLIDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKNCPNCNVPYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYASD-HNLTIRNAEVDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSVGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSSPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEEMRNNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFPLLFYAAYFTVRADDFDVDVMAKGSASIRAKIEEIAQKGLDASPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDTLIPPFNAVSGLGTNAAISIVEARKNGDFLSKEDLQQRSKLSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|157692337|ref|YP_001486799.1| DNA polymerase III PolC [Bacillus pumilus SAFR-032] >gi|157681095|gb|ABV62239.1| DNA-directed DNA polymerase III alpha subunit [Bacillus pumilus SAFR-032] (1437 aa)
Score = 2612, Expect = 0.0e+00, Identities = 529/1236 (42%), Positives = 807/1236 (65%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEEN-KMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++  L  +  E +  T++G +F  +    K+G  +  + +TDY++SI+IK    +K +  ++  LK+G+WVKA+ SIQ D +    +  L+   + +++ K  ++ D A    KR EL  H+ M+  + +  I  L + + + G+ ++A+TD    Q+FPD Y  ++K+  +K +YGV+ N++D  +PI  N     + DATYV+FD+ETTGLS  YD IIE  A+K   G  ++  + F NP   +S     +T I+++ V+DA  + + +   K++IG  +L+AHN   FD+ FLN   +   K D   NP+IDTL++ R +  +   H L  + +K+ I+   TQ HRA  DAE    +  +ML++   +DI   +++N N+      +R+R     +  +NE  ++NL+KL+S S    F   P++      ++    I+ ++  +GE+FE  M  +   +EDI    YD++ +  PE + H +  E+ +    +++ I  I+K+  K NK VVAT + +YL+  D++Y ++ ++++   G  N L ++      LPK +FRTTDE+ + FSFL +     +IVVTN+  ++ ++++ IKPIK+ L++P IEGA ++++++ YQ + SI+GD +   V+ RI++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A L +ITEVNPL PHY+C +CK+  F  + +V SGFDLP+ +CP+C +  K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGEE V+RAGTI T AEKTAYGYVK Y  +   ++ R AEI R+ + C  VKRTTGQHPGGI+VVP   D+YDF+P  +PAD    DW TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F  T+ L +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI  K   +S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L +YA+YF++R   FDI+++  G + I   +++I  K   A+PK K        +L+ + ELALE+  RGY F  +DL +S AT+F+++GD LIPPF++I GLG +VA +IV+AR++  F SKED +KR KV+ T ++ ++  G   +L + +Q+SLF
  S:   224 EIRTLDSIMDEERRITVQGYVFDAETRELKSGRTLCIFKITDYTNSILIKMFAREKEDAQLMKSLKKGMWVKARGSIQNDTF----VRDLVMIANDVNEMKPQLKEDTAPEGEKRVELHLHSPMSQMDAVTGIGRLVEQAKKWGHEAIALTDHAVVQSFPDAYAASRKHD-IKMMYGVEINLVDDGVPIAYNPEHRLLEDATYVVFDVETTGLSAVYDTIIELAAVKIKGGEIIDRFEAFANPHHPLSATTIELTGITDDMVRDAPDVVDVVRDFKEWIGQDILVAHNA-SFDMGFLNTAYKRLLKTDKASNPVIDTLELGRFLYPEFKNHRLNTLCKKFDIEL--TQHHRAIYDAEATGYLMLKMLKDAAEKDIAYHDQLNENMGQSNAYQRSRPYHAILIAQNETGLKNLFKLVSLSHIHYFYRVPRIPRSQLEKYREGLIIGSACDKGEVFEGMMQKSPDEVEDIAA-FYDYLEVHPPEVYQHLLQLELVRDERALKEIITNIVKLGEKLNKPVVATGNVHYLHPEDKIYRKILISSQ---GGANPLNRHE-----LPKVHFRTTDEMLEAFSFLGEEK-AKEIVVTNTKKVSEMVES-IKPIKDDLYTPKIEGADEEIREMSYQMARSIYGDDLPKIVEDRIEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSLVATLTEITEVNPLAPHYVCPSCKHSEFFNDGSVGSGFDLPDKDCPECGTPYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPIAHNYTKELFGEEYVYRAGTIGTVAEKTAYGYVKGYAGD-HNLHMRGAEIDRLVQGCTGVKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATGSDWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTEPLGVTEEQIG--CKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNKTCELSEVIGCRDDIMVYLIYQGLEPSLAFKIMESVRKGKGLPPEWEEEMKNNNVPNWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHALLYYAAYFTVRADDFDIETMTKGSNAIRAVMDDINSKGLDASPKEK--------NLLTVLELALEMCERGYHFKKVDLYRSSATEFIIDGDGLIPPFNSIPGLGTNVALNIVRARQDGEFLSKEDLQKRGKVSKTILEYLDRQGCLEALPDQNQLSLF 1437
>gi|196036920|ref|ZP_03104304.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus cereus W] >gi|195990475|gb|EDX54459.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus cereus W] (1433 aa)
Score = 2602, Expect = 0.0e+00, Identities = 537/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     ++D TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEEHRLLADETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTKNPVIDTLELARFLFPEMKNHRLNTLCKK--MDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGGTLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGEFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|166986130|ref|ZP_02257385.1| DNA polymerase III PolC [Bacillus cereus AH187] (1433 aa)
Score = 2602, Expect = 0.0e+00, Identities = 538/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++AITD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YLN  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAITDHAVAQSFPEAYSAGKK-AGIKVIYGVEANLVNDGVPIAYNEAHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTKNPVIDTLELARFLFPEMKNHRLNTLCKK--MDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLNPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGEFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|166994471|ref|ZP_02260931.1| DNA polymerase III PolC [Bacillus cereus AH820] (1378 aa)
Score = 2601, Expect = 0.0e+00, Identities = 537/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     ++D TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:    99 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEEHRLLADETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTKNPVIDTLELARFLFPEMKNHRLNTLCKK--MDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGEFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1378
>gi|30263821|ref|NP_846198.1| DNA polymerase III PolC [Bacillus anthracis str. Ames] >gi|47529245|ref|YP_020594.1| DNA polymerase III PolC [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186668|ref|YP_029920.1| DNA polymerase III PolC [Bacillus anthracis str. Sterne] >gi|52141670|ref|YP_085159.1| DNA polymerase III PolC [Bacillus cereus E33L] >gi|65321145|ref|ZP_00394104.1| COG2176: DNA polymerase III, alpha subunit (gram-positive type) [Bacillus anthracis str. A2012] >gi|165872624|ref|ZP_02217255.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0488] >gi|170687849|ref|ZP_02879063.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0465] >gi|170706900|ref|ZP_02897358.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0389] >gi|190568456|ref|ZP_03021363.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis Tsiankovskii-I] >gi|196042171|ref|ZP_03109454.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus cereus NVH0597-99] >gi|30258465|gb|AAP27684.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. Ames] >gi|47504393|gb|AAT33069.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180595|gb|AAT55971.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. Sterne] >gi|51975139|gb|AAU16689.1| DNA polymerase III, alpha subunit [Bacillus cereus E33L] >gi|164711656|gb|EDR17202.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0488] >gi|170128318|gb|EDS97187.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0389] >gi|170668165|gb|EDT18914.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0465] >gi|190560460|gb|EDV14438.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis Tsiankovskii-I] >gi|196027023|gb|EDX65647.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus cereus NVH0597-99] (1433 aa)
Score = 2600, Expect = 0.0e+00, Identities = 537/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     ++D TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEEHRLLADETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTKNPVIDTLELARFLFPEMKNHRLNTLCKK--MDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGEFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|167639871|ref|ZP_02398140.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0193] >gi|177652036|ref|ZP_02934582.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0174] >gi|167512272|gb|EDR87649.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0193] >gi|172082405|gb|EDT67470.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0174] (1433 aa)
Score = 2600, Expect = 0.0e+00, Identities = 537/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     ++D TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEEHRLLADETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTKNPVIDTLELARFLFPEMKNHRLNTLCKK--MDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCLKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGEFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|167635812|ref|ZP_02394121.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0442] >gi|167528769|gb|EDR91527.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus anthracis str. A0442] (1433 aa)
Score = 2600, Expect = 0.0e+00, Identities = 537/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     ++D TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEEHRLLADETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINIGFKKAGLEKTKNPVIDTLELARFLFPEMKNHRLNTLCKK--MDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGEFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|49478392|ref|YP_037879.1| DNA polymerase III PolC [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49329948|gb|AAT60594.1| DNA polymerase III, alpha subunit [Bacillus thuringiensis serovar konkukian str. 97-27] (1433 aa)
Score = 2596, Expect = 0.0e+00, Identities = 536/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEEHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTKNPVIDTLELARFLFPEMKNHRLNTLCKK--MDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGEFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|89098599|ref|ZP_01171481.1| DNA polymerase III subunit alpha [Bacillus sp. NRRL B-14911] >gi|89086561|gb|EAR65680.1| DNA polymerase III subunit alpha [Bacillus sp. NRRL B-14911] (1440 aa)
Score = 2592, Expect = 0.0e+00, Identities = 532/1276 (41%), Positives = 813/1276 (63%)
  Q:   181 DHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           D +   Q  I  +  E +  S + +     +         D  +L ++  E +   +EG IF  +    ++G  +  + VTDY+ SI++K     K +  +   +++G+WVK + SIQ D +    +  L+   + I++ K  +R D A    KR EL  HT M+  + + ++  L   + + G+ ++AITD    Q+FP+ +   KK + +K +YGV+ N+ID  +PI  N+    +++ TY++FD+ETTGLS  YD IIE  A+K H G  ++  + F NP   +S     +T I+++DV++A +++E L + K++  + +L+AHN   FD+ FLN   +   +    NP+IDTL+++R +  ++  H L  +A+K+  D + TQ HRA  DAE    +  +ML+    + I+  N++N N+      +R R S  T+  + E  ++NL+KL+S S  + F   P+V      ++    +V +    GE+FEA M    +  ED+    YD++ +     + H I  E+ +    +E+ I  I+K+  K +  V AT + +YLN  D++Y ++ +N++   G  N L ++      LP  +FRTT+E+ D FSFL       +IVV N+N +A +ID+ IKPIK+ L++P I+GA ++++ + Y  +  I+GD +   V+AR+++E+ S+I +G+A+IY  SH LVK+S++DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C  CK+  F  + +V SGFDLP+ NCP C    + DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T A+KTAYGYVK+Y ++   +  R AEI R+A  C  VKRTTGQHPGGI+VVP   D++DF+P  +PADD+T +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+ T+SL +    I  + KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI     T+S+VI CRDDIMVYLI +G+ P  AFKIME VRKGKGL+++ ++ +  N +P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L +YA+YF++R + FD+++++ G   I  KI EI  K   A+PK K        +L+ + ELALE+  RGYKF+ +DL +S ATDF+++GD LIPPF+AI GLG + A +IVKAR E  F SKED ++R +++ T ++ ++  G   SL + +Q+SLF
  S:   188 DQERGRQAMIDMQKKEAEGDSGSGELQGPLSIGLTIKDDADFRRLEEIVDEERRVAVEGFIFAAETKELRSGRTLLTFKVTDYTSSIMVKMFSRDKEDAALFQHVQKGMWVKVRGSIQNDTF----VRDLVMIGNDINEIKPVLRKDTAPEDEKRVELHLHTPMSQMDAVSSVSALVSQAKKWGHKAIAITDHAVAQSFPEAFGAGKK-NDIKILYGVEINLIDDGVPIAYNSAPIPLAEGTYIVFDVETTGLSAVYDTIIELAAVKIHDGEIIDRFESFANPHHPLSATTIDLTGITDDDVRNAPEVEEVLRRFKEWSQNDILVAHNA-SFDMGFLNTGYKRYGLGKAANPVIDTLELARFLLPEMKNHRLNTLAKKF--DVELTQHHRAIYDAEATGYLLIKMLKEVMQKGIEYHNQLNDNMGKGNAYQRARPSHCTLLAQTEAGLKNLFKLVSISHMNYFYRVPRVPRSLLEKYREGILVGSGCDRGEVFEAMMQKGPEEAEDL-ASFYDYLEVHPKAVYAHLIELELVRDEKALEEIISNIVKLGEKLDIPVAATGNVHYLNPVDKIYRKILINSQ---GGANPLNRHQ-----LPDVHFRTTNEMLDAFSFLGKEK-AKEIVVENTNKVADMIDS-IKPIKDDLYTPKIDGADEEMRNMSYDMARRIYGDELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLNDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPACKHSEFFNDGSVGSGFDLPDKNCPTCDIPYRKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAYGYVKAY-QQDNNLQIRGAEIDRLASGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQFPADDRTSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGTESLGVTQDQI--MCKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNSICTLSEVIGCRDDIMVYLIYQGLEPAFAFKIMESVRKGKGLSDDMEEEMRKNEVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHALLYYAAYFTVRAEDFDVEAMVRGSQAIRAKIEEINAKGLDASPKEK--------NLLTVMELALEMNERGYKFSKVDLYRSDATDFIIDGDSLIPPFNAIPGLGTNAALNIVKARGEGEFLSKEDLQQRGRISKTILEYLDNHGCLESLPDQNQLSLF 1440
>gi|52080261|ref|YP_079052.1| DNA polymerase III PolC [Bacillus licheniformis ATCC 14580] >gi|52785638|ref|YP_091467.1| DNA polymerase III PolC [Bacillus licheniformis ATCC 14580] >gi|52003472|gb|AAU23414.1| DNA polymerase III (alpha subunit) [Bacillus licheniformis ATCC 14580] >gi|52348140|gb|AAU40774.1| PolC [Bacillus licheniformis DSM 13] (1438 aa)
Score = 2589, Expect = 0.0e+00, Identities = 543/1333 (40%), Positives = 849/1333 (63%)
  Q:   124 KKPIISENAIFLHYLENDQEKCIKK-YLEHFRKFLNDYGFSKHHLS---YILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEEN-KMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +KP ++ N I L    + +   +KK Y    +     +GF +  L    ++ D++          + QE+    + E+++     + D +        Y+ + S   ++  L  +  E +  T++G +F  +    K+G  +  + +TDY++SI++K    +K +  ++  LK+G+WVKA+ SIQ D +    +  L+   + +++ K   R D A    KR EL  H+ M+  + + +I +L + + + G+ ++A+TD    Q+FPD +  +KK+  +K IYG++ N++D  +PI  N     + + TYV+FD+ETTGLS  YD IIE  A+K   G  +E  + F NP   +S  I  +T I+++ +KDA +++E +   K+++GD  L+AHN   FD+ F+N   +     + ++NP+IDTL++ R +  +   H L  + +K+ I+   TQ HRA  D E    +  +ML++   ++I   +++N N+      +R+R    T+   NE  ++NL+KL+S S    F   P++      ++    ++ ++  +GE+FE  M  + + +EDI    YD++ +  PE + H +  E+ +    +++ I  I K+  K N  VVAT + +YLN  D++Y ++ V+++   G  N L ++      LP  +FR+TDE+ + FSFL +     +IVV N+  I+  I+  IKPIK+ L++P IEGA D+++++ Y+K+ SI+G+ +   V+ RI++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A L +ITEVNPL PHY+C +C++  F  + +V SGFDLP+ +CPKC +  + DGH+IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  ++  ++ R AEI R+ + C  VKRTTGQHPGGI+VVP   D+YDF+P  +PAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F  T+SL +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      +S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++PL +YA+YF++R   FDI++++ G + I   +++I  K   A+PK K+        L+ + ELALE+  RG+ F  +DL +S A++F+++G+ LIPPF++I GLG + A +IVKAREE  F SKED +KR KV+ T M+ +E  G   SL + +Q+SLF
  S:   120 QKPKLTGNKILLKTKTDTEASALKKKYSSLIQSSYRTFGFPELQLDTEIFVSDQEIQKFREQKMAEDQERALQALIEMEKQDKEAQDDEAPAGPLQIGYQIKDS--EEIRTLDSIMDEERRITVQGYVFDAETRELKSGRTLCIFKITDYTNSILVKMFAREKEDAVLMKSLKKGMWVKARGSIQNDTF----VRDLVMIANDVNEIKAKTREDTAPEDEKRVELHLHSPMSQMDAVSSIGKLVEQAKKWGHPAIALTDHAVVQSFPDAFAASKKHG-VKMIYGLEANLVDDGVPIAYNPVHRLLEEETYVVFDVETTGLSAVYDTIIELAAVKVKGGEIIERFERFANPHRPLSATIIELTGITDDMLKDAPEVEEVIRDFKEWVGDHTLVAHNA-SFDIGFINVAYKRLLNSEKVQNPVIDTLELGRFLYPEFKNHRLNTLCKKFDIEL--TQHHRAIYDTEATGYLLVKMLKDAAEKNILYHDQLNENMGQSNAYQRSRPYHATLLAVNETGLKNLFKLVSLSHIHYFYRVPRIPRSQLEKYREGLLIGSACDKGEVFEGMMQKSPEEVEDI-ASFYDYLEVMPPEVYRHLLQLELVRDEKALKEIIANITKLGEKLNIPVVATGNVHYLNPEDKIYRKILVSSQ---GGANPLNRHE-----LPNVHFRSTDEMLEAFSFLGEEK-AKEIVVKNTRMISERIE-EIKPIKDDLYTPKIEGADDEIRRMSYEKARSIYGEDLPEIVEKRIEKELKSIIGHGFAVIYLISHKLVKRSLDDGYLVGSRGSVGSSLVATLTEITEVNPLPPHYVCPDCRHSEFFNDGSVGSGFDLPDKDCPKCGAAYRKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPHAHNYTKVLFGEDNVYRAGTIGTVAEKTAYGYVKGYANDNN-LHMRGAEIDRLVQGCTGVKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATDSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTESLGVTEEQIG--CKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNNICELSEVIGCRDDIMVYLIYQGLEPSLAFKIMEFVRKGKGLTPEWEEEMKNNNVPDWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLLYYAAYFTVRADDFDIETMIKGSTAIRAVMDDINSKGLDASPKEKS--------LLTVLELALEMCERGFSFQKVDLYRSSASEFIIDGNSLIPPFNSIPGLGTNAALNIVKAREEGEFLSKEDLQKRGKVSKTIMEYLERHGCLESLPDQNQLSLF 1438
>gi|47569095|ref|ZP_00239784.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus cereus G9241] >gi|47554257|gb|EAL12619.1| DNA polymerase III, alpha subunit, Gram-positive type [Bacillus cereus G9241] (1433 aa)
Score = 2589, Expect = 0.0e+00, Identities = 535/1297 (41%), Positives = 828/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS       T  +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  +  L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++   NP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL + V   +IVVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S ATDF+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVHEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSRLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEAHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTNNPVIDTLELARFLFPEMKNHRLNTMCKK--LDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDV-AKEIVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKSNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATDFIIDGDSLIPPFNAVPGLGTNAALSIVEARKNGDFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|30021907|ref|NP_833538.1| DNA polymerase III PolC [Bacillus cereus ATCC 14579] >gi|81433857|sp|Q819Y5|DPO3_BACCR DNA polymerase III polC-type (PolIII) >gi|29897463|gb|AAP10739.1| DNA polymerase III alpha subunit [Bacillus cereus ATCC 14579] (1435 aa)
Score = 2584, Expect = 0.0e+00, Identities = 532/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYK------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS  Y+      +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++   NP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL +     ++VVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S AT+F+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   156 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVYEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEAHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTNNPVIDTLELARFLFPEMKNHRLNTMCKK--LDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDK-AKEVVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPACNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKNNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATEFIIDGDTLIPPFNAVPGLGTNAALSIVEARKNGDFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1435
>gi|168138552|ref|ZP_02581781.1| DNA polymerase III PolC [Bacillus cereus B4264] (1433 aa)
Score = 2583, Expect = 0.0e+00, Identities = 532/1297 (41%), Positives = 830/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYK------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + + T ++    +   QE  +  I  ++  +  +  +SS  Y+      +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  + +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++   NP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL +     ++VVTN+  IASLI  ++ P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  +I+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S AT+F+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNTEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVYEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEAHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTNNPVIDTLELARFLFPEMKNHRLNTMCKK--LDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDK-AKEVVVTNTQKIASLI-GDVHPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPACNIPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQYPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEDMKNNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRARIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATEFIIDGDTLIPPFNAVPGLGTNAALSIVEARKNGDFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|163941555|ref|YP_001646439.1| DNA polymerase III PolC [Bacillus weihenstephanensis KBAB4] >gi|163863752|gb|ABY44811.1| DNA polymerase III, alpha subunit [Bacillus weihenstephanensis KBAB4] (1433 aa)
Score = 2575, Expect = 0.0e+00, Identities = 525/1236 (42%), Positives = 807/1236 (65%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++T L ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + + ++ +L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K +YGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++  KNP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTT+E+ D FSFL +     +IVVTN++ IASLI  +++P+K+ L++P IEGA D+ + + Y  + SI+GD +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+  CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  +PAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  +SL +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE+++ + +NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  KI+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S AT+F+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   221 EITPLREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGTWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAKEGEKRVELHLHTPMSQMDAVTSVSKLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVLYGVEANLVNDGVPIAYNEAHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGIEKTKNPVIDTLELARFLFPEMKNHRLNTMCKK--LDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHMTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAIYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTNEMLDCFSFLGEDK-AKEIVVTNTHKIASLI-GDVRPVKDDLYTPKIEGADDETRDMSYIMARSIYGDELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKECPTCNVPYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKLLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQFPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPESLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEEEMRNNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRVKIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATEFIIDGDTLIPPFNAVPGLGTNAAFSIVEARKNGDFLSKEDLQQRSKVSKTIIEYLDGQGCLGDLPDQNQLSLF 1433
>gi|168142538|ref|ZP_02585767.1| DNA polymerase III PolC [Bacillus cereus G9842] (1433 aa)
Score = 2573, Expect = 0.0e+00, Identities = 529/1297 (40%), Positives = 828/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYK------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + +   ++    +   QE  +  I  ++  +  +  +SS  Y+      +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  +  L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++   NP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL +     ++VVTN+  +ASLI  +++P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+ +CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  +PAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  ++L +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE++  +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  KI+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S AT+F+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   154 FGFPRFQLDTHIQQNAEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVYEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSRLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEAHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTNNPVIDTLELARFLFPEMKNHRLNTMCKK--LDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHLTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDK-AKEVVVTNTQKVASLI-GDVRPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKDCPTCNVAYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQFPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPETLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEDDMKGNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRVKIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATEFIIDGDTLIPPFNAVPGLGTNAALSIVEARKNGDFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1433
>gi|75760862|ref|ZP_00740876.1| DNA polymerase III alpha subunit [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491646|gb|EAO54848.1| DNA polymerase III alpha subunit [Bacillus thuringiensis serovar israelensis ATCC 35646] (1435 aa)
Score = 2568, Expect = 0.0e+00, Identities = 528/1297 (40%), Positives = 827/1297 (63%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYK------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +GF +  L   + +   ++    +   QE  +  I  ++  +  +  +SS  Y+      +      ++T + ++  E +  T++G +F ++    ++G  +    +TDY+DSI+IK     K +  +L  LK+G+WVKA+ S+Q D +   D+  +  +I+ I+ P    R D A    KR EL  HT M+  + +  +  L   + + G+ ++A+TD    Q+FP+ Y+  KK + +K IYGV+ N+++  +PI  N     +++ TYV+FD+ETTGLS  YD +IE  A+K   G  ++  + F NP + +S  I  +T I+++ + DA ++ E   K ++++GD  L+AHN   FD+ F+N   ++  ++   NP+IDTL+++R +  ++  H L  + +K  +D + TQ HRA  D E    +  +ML++   +  +  +++N ++      +R R S +T+   ++  ++NLYKL+S S  + F   P+V      ++    +V  +  +GE+FEA M    + +E+I +  YD+I +  PE   H + RE+ +  G ++  I  ++K+    +K VVAT + +YL+  D +Y ++ V+++   G  N L +++     LP  +FRTTDE+ + FSFL +     ++VVTN+  +ASLI  +++P+K+ L++P IEGA D+ + + Y+ + SI+G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VG RGSVGSS  A +++ITEVNPL PHY+C  CK   +FN + +V SGFDLP+ +CP C      DGH+IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   +  RNAEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  +PAD    +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  ++L +    IN   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI     T+S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKG+ EE++  +  NN+P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L FYA+YF++R   FD++++  G + I  KI+EI +K   A PK K+        L+ + E+ LE+  RGY F  +DL +S AT+F+++GD LIPPF+A+ GLG + A SIV+AR+   F SKED ++R+KV+ T ++ ++  G    L + +Q+SLF
  S:   156 FGFPRFQLDTHIQQNAEEMQKFREQTQQEDRERVIQAMEEMAKKQAEESSVVYEGPITLGYLIKPDEEITPMREIQDEERRKTVQGYVFHVETKELRSGRTLLTLKITDYTDSIMIKMFSRDKEDIPMLQSLKKGMWVKARGSVQNDTFVR-DLVMIANDINEITGPS---RKDKAPEGEKRVELHLHTPMSQMDAVTPVSRLVAQAGKWGHEAIAVTDHAVAQSFPEAYSAGKK-AGVKVIYGVEANLVNDGVPIAYNEAHRLLAEETYVVFDVETTGLSAVYDTVIELAAVKVKGGEIIDRFESFANPHQPLSATIIELTGITDDMLTDAPEVDEVFKKFEEWMGDHTLVAHNA-SFDMGFINVGFKKAGLEKTNNPVIDTLELARFLFPEMKNHRLNTMCKK--LDIELTQHHRAIYDTEATGYLLVKMLKDVIEKGFEYHDQLNDSMGQGDAYKRGRPSHLTLLATSDVGLKNLYKLVSYSHLNYFYRVPRVPRSLLKKYREGILVGTACDKGEVFEAMMQKAPEEVEEIAQ-FYDYIEVMPPEVLRHLVERELVRDEGQLKTIISNLVKLGETLDKPVVATGNVHYLDPEDAMYRKILVSSQ---GGANPLNRHS-----LPPVHFRTTDEMLECFSFLGEDK-AKEVVVTNTQKVASLI-GDVRPVKDDLYTPKIEGADDETRDMSYKMARSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGXRGSVGSSFVATMMEITEVNPLPPHYVCPKCKQSEFFN-DGSVGSGFDLPDKDCPTCNVAYVKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLTIRNAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQFPADSIGAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPETLGVTEEQIN--CKTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNANELIYNGTCTLSEVIGCRDDIMVYLIYQGLDPSLAFKIMESVRKGKGVPEEWEDDMKGNNVPGWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHFALLFYAAYFTVRADDFDVEAMAKGSASIRVKIDEIAQKGLDAAPKEKS--------LLTVLEMTLEMCERGYSFQKVDLYRSHATEFIIDGDTLIPPFNAVPGLGTNAALSIVEARKNGDFLSKEDLQQRSKVSKTIIEYLDSQGCLGDLPDQNQLSLF 1435
>gi|15614981|ref|NP_243284.1| DNA polymerase III PolC [Bacillus halodurans C-125] >gi|13959348|sp|Q9KA72|DPO3_BACHD DNA polymerase III polC-type (PolIII) >gi|10175038|dbj|BAB06137.1| DNA polymerase III (alpha subunit) [Bacillus halodurans C-125] (1433 aa)
Score = 2559, Expect = 0.0e+00, Identities = 537/1310 (40%), Positives = 822/1310 (62%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEKTI---DIISDHKNKIQEKIKNEITEVKR---SSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIIS--KPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNL-QNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNT-VLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +K  E  ++ +  +GF    L   + E        +   K +   K+   I E K+       K  +   T  +   +  +   L  +  E +  T++G IF  +    ++G  +  + +TDY+DSI++K     K +  +L  +K+G+WVK +  +Q D +   D+  +  +++ +S  + K+    D    KR EL  HT M+  +G+ +       +S+ G+ ++AITD    Q FP+ Y  ++K+  +K IYGV+ N++D  +PI  N     + D+ +V+FD+ETTGLS  Y+KIIE  A+K   G  ++  + F +P E +++ I  +T I+++ +K   ++++ L +   FIGD+VL+AHN   FD+ FLN   ++  +   KNP+IDTL++ R +   +  H L  + +K+ I+      HRA  DAE   ++  RM+++   +DI   +++N N+ + +F   R R S   +  + +  ++NLYKL+S +    F   P++      +     +V +   +GE+FE  M  T Q +E+I K  YD+I +     + H I +E+ K R  +++ +  I+K+  +  K VVAT + +YL E D +Y ++ + ++  GG        N LN   LP+ +FRTT E+ + F+FL +     +IVVTN+N+IA  I+  I PI + L++P IEGA ++++Q+ Y ++  I+GD +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NC + +F  + +V SG+DLP+ NCPKC +    DG +IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE  V+RAGTI T AEKTAYGYVK Y +    ++ R AEI R+   C  VKRTTGQHPGGI+VVP   D++DF P  +PADD+  +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+  D L +    I  + KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW +NA  LI      + DVI CRDDIMVYLI KG+ P +AFKIME VRKGKGL  E+ + +  +++P WYI SC KI Y+FPKAHA AYV+MA +IA+FK++YP+ +YASYF++R   FD+ +++ G + I  KI EI  K   A+PK K+        L+ + ELALE++ RG+ F  +DL +S AT+FLVEG+ LIPPF+A+ G+G + A +IVKAR+E+ F SKED ++R+K+T T ++ ++  G    L E +Q+SLF
  S:   144 RKLTEPLQQAVQSFGFPAVQLDAEVKESKQAFEKFVEQRKQEDHSKVVEAILEKKKLEQQVEKKMKEEKLTIGY--PIKDEPVPLETIVEEERRITVQGYIFAAETKELRSGRTLLTFKITDYTDSILVKMFSRDKEDIPLLQAVKKGMWVKVRGGVQNDTFVR-DLVMIANDVNEVSGKETKDEAPDDE---KRVELHLHTAMSQMDGISSAGAYVTQASKWGHKAIAITDHGVVQAFPEAYGASQKHG-IKVIYGVEANLVDDGVPIAYNEAHIPLLDSEFVVFDVETTGLSAVYNKIIELAAVKVKNGEIIDRFERFADPHEPLTNTIIELTGITDDMLKGQPEVEQVLNEFHAFIGDAVLVAHNA-SFDMGFLNTGFQKMGLGEAKNPVIDTLELGRFLYPTLKNHRLNTLCKKFDIEL--VSHHRAIYDAEATGHLLWRMVKDATERDILYHDQLNDNMGEGNF--HRQRPSHCILLAQTQEGLKNLYKLVSMAHVEYFYRTPRIPRSQLQKHREGILVGSGCDKGEVFEGMMQKTPQEVEEIAK-FYDYIEVQPLANYEHLIEKELVKSREALQEIVANIVKLGEQLGKPVVATGNAHYLKEEDYIYRKILIASQ--GGA-------NPLNKQTLPQVHFRTTSEMLEAFAFLGEEK-AKEIVVTNTNHIADQIE-EIHPIPDKLYTPKIEGADEEIRQMSYNRARKIYGDPLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCHHSHFFNDGSVGSGYDLPDENCPKCGTPYVKDGQDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKELFGESYVYRAGTIGTVAEKTAYGYVKGY-QSDHDLHFRGAEIDRLVTGCTGVKRTTGQHPGGIIVVPDYMDIHDFCPIQFPADDRGAEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPDVLGVTEEQI--LCKTGTLGIPEFGTRFVRQMLEETKPSTFSELVQISGLSHGTDVWLNNANELIYNGTCELKDVIGCRDDIMVYLIYKGLEPSLAFKIMEFVRKGKGLQPEWIEEMKKHDVPDWYIGSCLKIKYMFPKAHAAAYVLMAVRIAYFKVHYPILYYASYFTVRADDFDLDTMVKGSAAIRAKIEEINGKGLDASPKEKS--------LLTVLELALEMVERGFSFQKVDLYRSEATEFLVEGNTLIPPFNALTGVGTNAAINIVKARDEREFLSKEDLQQRSKITKTVLENLDAHGCLEGLPESNQLSLF 1433
>gi|169827163|ref|YP_001697321.1| DNA polymerase III polC-type [Lysinibacillus sphaericus C3-41] >gi|168991651|gb|ACA39191.1| DNA polymerase III polC-type [Lysinibacillus sphaericus C3-41] (1468 aa)
Score = 2558, Expect = 0.0e+00, Identities = 528/1309 (40%), Positives = 827/1309 (63%)
  Q:   148 KYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNE-------ITEVKRSSNAKKTDSSFT------YKFRKSVTGD-VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           KY +        +GF K  + ++L E+T ++I+  +  +++K   E       + + ++    KK + +        ++    +  D + ++  +  E +   +EG +F  +  V K+G  + +  +TDY+DSI++K       + +++  LK+G+WVK + S+Q D +    I  LI   + I++ K+  R D A    KR EL  HT M+  + +  +  L   +++ G+ +VAITD    Q+FP+ Y   KK+  +K IYG++ N++D  +PI        ++DATYV+FD+ETTGLS  YD IIE  A+K   G  ++  + F NP   +S     +T I+++ V+ A ++++ + +   FIGD +++AHN   FD+ FL    ++  ++   +P+IDTL+++R +   +  H L  + +K+ I+   TQ HRA  D E    +  ++L++     IK  ++ N ++      ++ R    T+   +   ++NL+K++S S T  F   P+V      ++    +V +  + GE+FE  M+ + +  E + K  YD+I +     +   I R + +  W +ED I++++K+  K +K VVAT + +YL+ +D ++ ++ V ++  GG        N LN + LP+ +FRTTDE+  EF FL  P L  ++VVTN+  +A  I  ++KPIK+ L++P IEG+ D++  L Y+ ++ I+G+ +   VKARI++E+ S++ +G+ +IY  S  LVK+S+ DGY+VGSRGSVGSS+ A  ++ITEVNPL PHY+C NCK+  F  + +V SGFDLP  +C +C +  K DG +IPFETF+GFKGDK+PDIDLNFS  YQ KAH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   ++ R AE+ R+ + C  VKRT+GQHPGGI+VVP   D++DFTP  +PAD +  +W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D  VM +F+S +SL +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      + +VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL+EE++  +  N +P WYIESC KI Y+FPKAHA AYV+MA +IAWFK+++P+ +YA+YF++R   FD+ +++ G   I  +I+EI  K  +  T      KE +L+ + ELALE+  RG  F  +DL +S A++F++EG+ LIPPF AI GLG +VA +IV ARE+  F SKED ++R +V+ T ++ M++LG    + + +Q+SLF
  S:   169 KYADKLADSYCQFGFPKMVIDFVLQEQTEEMIAAQEAFMEQKRMEEAALSQQAMQDFQKREQEKKDNPAIANLGDRPFQLGMHIKDDEIMEIKRIVEEERRVIVEGFVFDTEIKVLKSGRSLLQIKITDYTDSIIVKMFSRDNDDAELMQHLKKGMWVKVRGSVQTDTF----IRDLIVMANDINEIKKETRQDLAPEGEKRVELHLHTPMSQMDAVTPVDRLVAQAAKWGHPAVAITDHAVVQSFPEAYAAGKKHG-IKVIYGLEANLVDDGVPIAYAPEHRLLADATYVVFDVETTGLSTAYDTIIELAAVKIKDGHVIDKYESFANPHHPLSATTIELTGITDDMVRHAPEVEQVIKEFHAFIGDGIVVAHNA-SFDIGFLYTGYKKFGLEGTTHPVIDTLELARLLYPTMKNHRLNTLCKKFNIEL--TQHHRAIYDTEATGYLLLQLLKDADELVIKYHDDFNKHIGGGDAYKKGRPMHCTILAVDNAGLKNLFKIVSHSHTKTFYRVPRVTRAVLEQYREGLLVGSGCSNGELFETMMNKSPEEAEQVAK-FYDYIEVQPKAVYAPLIERNVVRDEWTLEDIIRKLVKLGKKLDKPVVATGNVHYLDPTDAMFRQILVGSQ--GGA-------NILNRSKLPEVHFRTTDEMLKEFDFLG-PDLAKEVVVTNAQKVADSI-GDVKPIKDDLYTPKIEGSDDEVTNLTYEMAHHIYGEELPEIVKARIEKELKSILGHGFGVIYLISAKLVKKSLADGYLVGSRGSVGSSLVATFMEITEVNPLPPHYVCPNCKHSEFFDDGSVSSGFDLPNKDCSECGTPYKKDGQDIPFETFLGFKGDKVPDIDLNFSGEYQPKAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLHFRGAEVDRLVQGCTGVKRTSGQHPGGIIVVPDYMDIFDFTPVQFPADAQDAEWRTTHFDFHSIHDNILKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPVVMQIFSSPESLGVTEKQIG--CKTGTLGIPEFGTRFVRQMLEDTKPSTFSELVQISGLSHGTDVWLGNAQELIHNGTCVLKEVIGCRDDIMVYLIYQGLEPSLAFKIMESVRKGKGLSEEFEAEMLANKVPGWYIESCKKIKYMFPKAHAAAYVLMAVRIAWFKVHFPILYYAAYFTVRADDFDLIAMVQGSQMIRARIDEINLKGLDAST------KEKNLLTVMELALEMCERGMSFQKVDLYRSQASEFVIEGNTLIPPFDAIPGLGTNVAKTIVAAREDGEFLSKEDLQQRGRVSKTLIEYMDQLGCLEGMPDANQLSLF 1468
>gi|16800425|ref|NP_470693.1| DNA polymerase III PolC [Listeria innocua Clip11262] >gi|21263558|sp|Q92C34|DPO3_LISIN DNA polymerase III polC-type (PolIII) >gi|16413830|emb|CAC96588.1| polC [Listeria innocua] (1444 aa)
Score = 2551, Expect = 0.0e+00, Identities = 543/1333 (40%), Positives = 831/1333 (62%)
  Q:   124 KKPIISENAIFLHYLENDQEKCIKKYLEHFR-KFLNDYG---FSKHHLS-YILDEKTIDIISDHKNKIQEKIKNEITEV-----KR-------SSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +KP   E       + ND E+   +  + F+ K + +YG   F +  +  ++LD+   D         QE+ + +  E      KR       S+NA      F   ++     ++ +L D++ E +  T++G IF  +    ++G  + ++ +TDY+ S++IK       +  +   LK+G+WVK + S+Q D +   D+  + ++I+ I+  K   R D A  KR EL  H+ M+  +   ++  LFK +++ G+ ++AITD    Q+FP+ Y   +KY  LK I+G++ N+ID  +PI  N     + DATY +FD+ETTGLS  YD IIE   +K   G  ++  + FI+P   +S     +T I+++ VK +  I   L + +++ GD +L+AHN   FD+ F+N   E+  ++  KN ++DTL+++R +      H L  + +K+ I  +  Q HRA  DAE    + WK + + +++ DI+  + +N  +      +R R    T+Y + +  ++NL+KLI+ S  + F   P++      +     I+  + ++GE+FEA M    Q  E +  + YDFI +     +   I RE+ +    +E+ +K I+++  K  K VVAT + +Y +  D++Y ++ ++++  GG        N LN   LP  +FR+TDE+  EF+FL +     +IVVTNSN +   +D ++KPIK+ L++P I+GA D+++ + Y  ++ ++G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+ +CP C +  + +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGE+ VFRAGTI T AEKTA+GYV++Y E    M  R AE+ R+   C  VKRTTGQHPGGI+V+P   DVYDFTP  +PAD    +W TTH  F S+HD++LK DILGHD+PT ++ML + + ++  TIP  D DVM LF ST+SL +K   I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+ K   + DVI CRDDIMV+LI +G+   +AFKIME VRKGKGL EE ++ +  N +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK+++PL+FYA+YF++R   FD+ S++NG+  +   + E+ +K     T      KE +L+ + E+A E+L RG+ F  +DL KS A +F+++GD LIPPF+AI  LG +VA  IV ARE   F SKED ++R KV+ T ++ M++ G    L + +Q+SLF
  S:   121 QKPTFKEPHFIEVAVHNDMEEATIQ--QRFQAKIIENYGKAGFPRLAMKMHMLDQSETDEYKAFAQAKQEEDQKKAAEAVQVMQKRQAEGQNGSANAAPLTGPFQIGYKIKDDEEIKRLGDVYDEERRITVQGLIFATEIRELRSGRSLLQFKITDYTSSMIIKMFSRDNEDAAMFQNLKKGMWVKVRGSVQNDTFVR-DLIMMAQDINEIAGVK---RLDTAEEKRAELHLHSPMSQMDATSSVDSLFKQAADWGHKAIAITDHSVAQSFPEAYGAGQKYG-LKVIFGIEANLIDDGVPIAYNDQHIALEDATYCVFDVETTGLSAVYDTIIELAGVKMKNGEIIDKFEAFIDPGHPLSATTINLTGITDDMVKGSDPIDVVLKQFREWSGDDILVAHNA-SFDMGFINTAYEKVGLEKAKNAVVDTLELARFLYPHFKNHRLNTLTKKFNIILE--QHHRAVFDAEATAYLAWKLIKDAKEMHDIEFHDSLNDYMGEGDAYKRARPFHATIYAQTDVGLKNLFKLITMSNINYFYRVPRIPRSQLKKMREGLIIGTACSQGELFEAMMQKGMQAAEKV-AEFYDFIEVQPKPVYAPLIERELVRDEKALEEILKNIVRVGEKTGKPVVATGNVHYKDPVDKIYRKILIHSQ--GGA-------NPLNRAELPDVHFRSTDEMLKEFAFLGEEK-AKEIVVTNSNLVVDWMD-DLKPIKDELYTPKIDGAEDEVRNMSYGMAHQLYGEKLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYLCPNCKDSEFFDDGSVGSGFDLPDKDCPHCGTPYQKEGQDIPFETFLGFKGDKVPDIDLNFSGDYQPVAHAYTKEIFGEDYVFRAGTIGTVAEKTAFGYVRNY-ERDMNMTIRGAEVDRLVAGCTGVKRTTGQHPGGIIVIPDYMDVYDFTPVQFPADATDSEWKTTHFDFHSIHDNVLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPDVMKLFGSTESLGVKPADIDS--KTGTLGIPEFGTRFVRQMLEQTKPTTFSELVQISGLSHGTDVWLGNAEELIKNKTCELPDVIGCRDDIMVFLIYQGLESSLAFKIMESVRKGKGLTEEMEEAMIANKVPLWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYFYATYFTVRADDFDLTSMVNGKEAVKATMKEVNDKGMEAST------KEKNLLTVLEIANEMLARGFHFQKVDLYKSSADEFIIDGDSLIPPFNAIPSLGTNVAKQIVAARENGEFLSKEDLQQRGKVSKTIIQYMDDQGCLEGLPDQNQLSLF 1444
>gi|116872751|ref|YP_849532.1| DNA polymerase III PolC [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466238|sp|A0AIC1|DPO3_LISW6 DNA polymerase III polC-type (PolIII) >gi|116741629|emb|CAK20753.1| polC [Listeria welshimeri serovar 6b str. SLCC5334] (1444 aa)
Score = 2550, Expect = 0.0e+00, Identities = 544/1333 (40%), Positives = 829/1333 (62%)
  Q:   124 KKPIISENAIFLHYLENDQEKCIKKYLEHFR-KFLNDYG---FSKHHLS-YILDEKTIDIISDHKNKIQEKIKNEITEV-----KRSSNAKKTDSS-------FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +KP   E       + ND E+   +  + F+ K + +YG   F +  +  ++LD+   D         QE+ + +  E      KR +  +  +SS       F   ++     ++ +L D++ E +  T++G IF  +    ++G  + ++ +TDY+ S++IK       +  +   LK+G+WVK + S+Q D +   D+  + ++I+ I+  K   R D A  KR EL  H+ M+  +   ++  LFK +++ G+ ++AITD    Q+FP+ Y   +KY  LK I+G++ N+ID  +PI  N     + DATY +FD+ETTGLS  YD IIE   +K   G  ++  + FI+P   +S     +T I+++ VK +  I   L + K++ GD +L+AHN   FD+ F+N   E+  ++   N ++DTL+++R +      H L  + +K+ I  +  Q HRA  DAE    + WK + + +++ DI   + +N  +      +R R    T+Y + +  ++NL+KLI+ S  + F   P++      +     IV  + ++GE+FEA M    Q  E ++ + YDFI I     +   I RE+ +    +E+ +K I+++  K  K VVAT + +Y +  D++Y ++ ++++  GG        N LN   LP  +FR+TDE+  EF+FL +     ++VVTNSN +   ++  +KPIK+ L++P I+GA D+++ + Y  ++ ++G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+  CP C +  + +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGE+ VFRAGTI T AEKTA+GYV++Y E    M  R AEI R+   C  VKRTTGQHPGGI+V+P   DVYDFTP  +PAD    +W TTH  F S+HD++LK DILGHD+PT ++ML + + ++  TIP  D DVM LF ST+SL +K   I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+ K   + DVI CRDDIMV+LI +G+   +AFKIME VRKGKGL EE ++ +  N +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK++YPL+FYA+YF++R   FD+ S++NG+  +   + E+ +K     T      KE +L+ + E+A E+L RG+ F  +DL KS A +F+++GD LIPPF+AI  LG +VA  IV ARE   F SKED ++R KV+ T ++ M++ G    L + +Q+SLF
  S:   121 QKPTFKEPHFIEVAVHNDMEEATIQ--QRFQAKIIENYGKAGFPRLAMKMHMLDQSESDEYKAFAQAKQEEDQKKAAEAVQVMQKRQAEGQNGNSSAAPLSGPFQIGYKIKDDEEIKRLGDVYDEERRITVQGLIFATEIRELRSGRSLLQFKITDYTSSMIIKMFSRDNEDAAMFQNLKKGMWVKVRGSVQNDTFVR-DLIMMAQDINEIAGVK---RLDTAEEKRAELHLHSPMSQMDATSSVDSLFKQAADWGHKAIAITDHSVAQSFPEAYGAGQKYG-LKVIFGIEANLIDDGVPIAYNDQHIGLQDATYCVFDVETTGLSAVYDTIIELAGVKMKNGEIIDKFEAFIDPGHPLSATTINLTGITDDMVKGSDPIDVVLKRFKEWSGDDILVAHNA-SFDMGFINTAYEKVGLEKADNAVVDTLELARFLYPHFKNHRLNTLTKKFNIILE--QHHRAVFDAEATAYLAWKLIKDAKEMHDINFHDSLNDYMGEGDAYKRARPFHATIYAQTDVGLKNLFKLITMSNINYFYRVPRIPRSQLKKLREGLIVGTACSQGELFEAMMQKGMQAAEKVV-EFYDFIEIQPKPVYAPLIERELVRDEKALEEILKNIVRVGEKAGKPVVATGNVHYKDPVDKIYRKILIHSQ--GGA-------NPLNRAELPDVHFRSTDEMLKEFAFLGEEK-AKEVVVTNSNLVVDWME-ELKPIKDELYTPKIDGAEDEVRNMSYDMAHQLYGENLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYLCPNCKDSEFFDDGSVGSGFDLPDKECPHCGTAYQKEGQDIPFETFLGFKGDKVPDIDLNFSGDYQPVAHAYTKEIFGEDYVFRAGTIGTVAEKTAFGYVRNY-ERDMNMTIRGAEIDRLVAGCTGVKRTTGQHPGGIIVIPDYMDVYDFTPVQFPADATDSEWKTTHFDFHSIHDNVLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPDVMKLFGSTESLGVKPADIDS--KTGTLGIPEFGTRFVRQMLEQTKPTTFSELVQISGLSHGTDVWLGNAEELIKNKTCELPDVIGCRDDIMVFLIYQGLESSLAFKIMESVRKGKGLTEEMEEAMMANKVPLWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHYPLYFYATYFTVRADDFDLTSMVNGKEAVKATMKEVNDKGMEAST------KEKNLLTVLEIANEMLARGFHFQKVDLYKSSADEFIIDGDSLIPPFNAIPSLGTNVAKQIVAARENGEFLSKEDLQQRGKVSKTIIQYMDDQGCLEGLPDQNQLSLF 1444
>gi|13507773|ref|NP_109722.1| DNA polymerase III PolC [Mycoplasma pneumoniae M129] >gi|2494192|sp|P75080|DPO3_MYCPN DNA polymerase III polC-type (PolIII) >gi|1673778|gb|AAB95768.1| DNA polymerase III (dnaE) alpha chain [Mycoplasma pneumoniae M129] (1443 aa)
Score = 2547, Expect = 0.0e+00, Identities = 534/1258 (42%), Positives = 789/1258 (62%)
  Q:   199 RSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYE----IYKYFVTDYS--DSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDF---LRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDAN-IKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKC--KSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNA-EITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNE-DDQISLF 1456
           +S    K D  F  +   +    + K++    E+K   + G+IF++       GY         +VTD+    S+++K  +    +   +  +K G WVKA + ++ D  +   + G+I+EIS I  P  + R D    KR ELV HT M+AF+G+ +++E  +F+ E  + ++A+TDK N   +P  Y  AKKY  LKAIYG++ N+ID +I IV N + TK+ DAT+VIFDIETTGL   YD +IEF  IK     +VE +Q F+  +  +   +  ITKI+   ++D ++ +  L K++ ++   V++AHNG+ FDLPFL  + E+  +  + NPLIDTL +S A+N     H+L  I  K K D+D+ + HRAD D + L  ++    E  +L  I  L +++  L       L +R   +   +Y K++     LY+L+S +LT N    P V      +F  SF+++++  +G+IF+AA++   + LE  IK + DF+ I  P  +     RE  K+  I +AIK ++  A + NK V   SD Y+++  +  Y++  V AK LGG+ +R F Y E    +P  + RTT E+ +E SFL +  L  ++VV N+N +A  + A+ + P++  L  P IEG+++ L    + ++ +I+GD +   ++ RI  E+ ++IDNG+ +IYW SHLLVKQSV DGY VG RGS+GSS+ A L+ I+E+NPL PHY+C +C+YF   + VD G+DL   +CPKC  K+  KGDGHNIPF TFMGF GDKIPDIDLNFS+ YQ KAH +++ +FGE+  FRAGTI+T AEKTAYGY ++YFE  K+     A EI R  +K   +KRTTGQHPGGI++ P+ K VY+FTP  YPADD + DW TTH  +++L +++LK DILG D+PT+LK L + T+VN   IP FD  + ++F S + LK+K   +++   TG+ GIPEFGT FV+++L  TKP+ F DLIR+SGLSHG NVW DNA+ +++++ L++ DVI+CRDDIM+YLI KG+    AF+IME VRKG  LN +  +++  N +   +I SC KISYLFPKAHA AYV+MAW+IAWFK+Y+PL +YA   S ++K  D+    +G S +  K+ E+       +    +K KE +L+  YE+ LE++ RG K   I L  S AT F+     LI PF  I G+G++VA SI++AR EK FSS +DFKKRTK+T  H++   ++ +     E D+Q  LF
  S:   191 KSMKVSKYDKQFETEVFSTEFVPIHKINQQMDEIK---LMGQIFELKDF---PGYNNLRNTLNIYVTDFQLGGSLILKWFYK---DPKTIEGIKIGTWVKATVKVERDA-KTQLLQGIIKEISPIETPAYYRRPDQDKQKRVELVFHTKMSAFDGINSVQEYAQFAKERDWKTIAVTDKDNIHIYPTLYEVAKKYG-LKAIYGLECNLIDDHIKIVSNPDKTKLKDATFVIFDIETTGLHGRYDSVIEFAGIKVKHNREVERMQFFLKIDGPLPAAVTEITKITQAQLEDGMEQQAGLEKLRAWLDGCVMVAHNGLSFDLPFLQTQFEKYNIAPLTNPLIDTLALSWALNPGFASHTLSNICAKLKFDFDDERLHRADYDTQALKKVFDYFKEQVELMGITNLEQLDQELNQQCHFELLKRTFTNTGIIYIKSQSGFAKLYELLSIALTDNNATRPLVLTSTLQKFAKSFVITDNPVQGDIFKAALTKPLKELEAAIK-RVDFVLIAPPGAYAGYTIREGLKKEAIPNAIKLVVDTAQRLNKLVAVASDAYFIHPWENEYYKAIVCAKGLGGRWHRHFNYKEREQRVPNVFVRTTGEMLNEMSFLGEQ-LAYELVVENTNKLAKQLTADDLVPVQTKLQPPVIEGSNENLAAKTWSQAKAIYGDPLPKLIEQRIQEELKAIIDNGFGIIYWISHLLVKQSVQDGYFVGPRGSIGSSLVANLIGISEINPLVPHYLCESCQYFEVNEEVDDGYDLMVRDCPKCGAKAAFKGDGHNIPFATFMGFAGDKIPDIDLNFSSEYQAKAHAYVRELFGEQYTFRAGTIATVAEKTAYGYARNYFEIIKQTELATAPEIERFKQKLVGIKRTTGQHPGGIMIFPNHKSVYEFTPCGYPADDTSSDWKTTHFEYDALGNTILKLDILGQDDPTMLKHLGDLTHVNPQNIPRFDKKLTEMFWSVNPLKLKPHYLDE--PTGAIGIPEFGTKFVRKILEQTKPKGFGDLIRVSGLSHGKNVWADNAQKILKDQNLSLKDVIACRDDIMLYLIHKGMQAKDAFEIMEKVRKGIALNAKEVQLMQSNGVEQHWINSCLKISYLFPKAHAAAYVLMAWRIAWFKLYHPLSYYACLLSFKLKEHDVSGFKSGVSFVKQKLEELNTLYRIKR----IKPKEAELLTSYEVYLEMMARGIKLEQISLTHSHATRFVEHNGMLIAPFITIPGMGEAVANSIIEARNEKPFSSLDDFKKRTKITKKHIEAFTQMQLLDEFREQDNQKKLF 1443
>gi|153202161|ref|ZP_01943790.1| DNA polymerase III, alpha subunit, Gram-positive type [Listeria monocytogenes HPB2262] >gi|133735444|gb|EBA37142.1| DNA polymerase III, alpha subunit, Gram-positive type [Listeria monocytogenes HPB2262] (1444 aa)
Score = 2547, Expect = 0.0e+00, Identities = 520/1236 (42%), Positives = 788/1236 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +V +L D++ E +  T++G IF  +    ++G  + ++ +TDY+ S++IK       +  +   LK+G+WVK + S+Q D +   D+  + ++++ I+  K   R D A  KR EL  H+ M+  +   ++  LFK +++ G+ ++AITD    Q+FP+ Y   +KY  LK I+G++ N+ID  +PI  N     + DATY +FD+ETTGLS  YD IIE   +K   G  ++  + FI+P   +S     +T I+++ VK +  I   L + K++ GD +L+AHN   FD+ F+N   E+  ++  +N ++DTL+++R +      H L  + +K+ I  +  Q HRA  DAE    + WK + + +++ +I   + +N  +      +R R    T+Y +    ++NL+KLI+ S  + F   P++      +     I+  + ++GE+FEA M    Q  E +  + YDFI +     +   I RE+ +    +E+ +K I+++  K  K VVAT + +Y +  D++Y ++ ++++  GG        N LN   LP  +FRTTDE+  EF+FL +     +IVVTN+N +   ++ ++KPIK+ L++P I+GA D+++ + Y  ++ ++G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+ +CP C +  + +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGE+ VFRAGTI T AEKTA+GYV++Y E    M  R AEI R+   C  VKRTTGQHPGGI+V+P   DVYDFTP  +PAD    +W TTH  F S+HD++LK DILGHD+PT ++ML + + ++  TIP  D DVM LF ST+SL +K+  I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+ K   + DVI CRDDIMV+LI +G+   +AFKIME VRKGKGL EE ++ +  N +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK++YPL+FYA+YF++R   FD+ S++NG+  +   + E+ +K     T      KE +L+ + E+A E+L RG+ F  +DL KS A +F+++GD LIPPF+AI  LG +VA  IV ARE   F SKED ++R KV+ T ++ M++ G    L + +Q+SLF
  S:   233 EVKRLGDIYDEERRITVQGLIFATEIRELRSGRSLLQFKITDYTSSMIIKMFSRDNEDAAMFQNLKKGMWVKVRGSVQNDTFVR-DLIMMAQDVNEIAGVK---RLDTAEEKRAELHLHSPMSQMDATSSVDSLFKQAADWGHKAIAITDHSVAQSFPEAYGAGQKYG-LKVIFGIEANLIDDGVPIAYNDQHIALEDATYCVFDVETTGLSAVYDTIIELAGVKMKNGEIIDKFEAFIDPGHPLSATTINLTGITDDMVKGSDPIDVVLKRFKEWSGDDILVAHNA-SFDMGFINTAYEKVGLEKAENAVVDTLELARFLYPHFKNHRLNTLTKKFNIILE--QHHRAVFDAEATAYLAWKLIKDAKEMHNIDFHDSLNDYMGEGDAYKRARPFHATIYAQTAVGLKNLFKLITMSNINYFYRVPRIPRSQLKKLREGLIIGTACSQGELFEAMMQKGMQAAEKV-AEFYDFIEVQPKPVYAPLIERELVRDEKALEEILKNIVRVGEKTGKPVVATGNVHYKDPVDKIYRKILIHSQ--GGA-------NPLNRAELPDVHFRTTDEMLKEFAFLGEEK-AKEIVVTNANLVVDWME-DLKPIKDELYTPKIDGAEDEVRNMSYAMAHQLYGEKLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYLCPNCKDSEFFDDGSVGSGFDLPDKDCPHCGTPYQKEGQDIPFETFLGFKGDKVPDIDLNFSGDYQPVAHAYTKEIFGEDYVFRAGTIGTVAEKTAFGYVRNY-ERDMNMTIRGAEIDRLVAGCTGVKRTTGQHPGGIIVIPDYMDVYDFTPVQFPADATDSEWKTTHFDFHSIHDNVLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPDVMKLFGSTESLGVKSADIDS--KTGTLGIPEFGTRFVRQMLEQTKPTTFSELVQISGLSHGTDVWLGNAEELIKNKTCELPDVIGCRDDIMVFLIYQGLESSLAFKIMESVRKGKGLTEEMEEAMMANKVPLWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHYPLYFYATYFTVRADDFDLTSMVNGKEAVKATMKEVNDKGMEAST------KEKNLLTVLEIANEMLARGFHFQKVDLYKSSADEFIIDGDSLIPPFNAIPSLGTNVAKQIVAARENGEFLSKEDLQQRGKVSKTIIQYMDDQGCLEGLPDQNQLSLF 1444
>gi|126654115|ref|ZP_01725933.1| DNA polymerase III PolC [Bacillus sp. B14905] >gi|126589395|gb|EAZ83545.1| DNA polymerase III PolC [Bacillus sp. B14905] (1443 aa)
Score = 2546, Expect = 0.0e+00, Identities = 524/1309 (40%), Positives = 827/1309 (63%)
  Q:   148 KYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNE-------ITEVKRSSNAKKTDSSFT------YKFRKSVTGD-VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           KY +   +    +GF K  + ++L E+T ++I+  +  +++K   E       + + ++    KK + +        ++    +  D + ++  +  E +   +EG +F  +  V K+G  + +  +TDY+DSI++K       + +++  LK+G+WVK + S+Q D +    I  LI   + I++ K+  R D A    KR EL  HT M+  + +  +  L   +++ G+ +VAITD    Q+FP+ Y   KK+  +K IYG++ N++D  +PI        + +ATYV+FD+ETTGLS  YD IIE  A+K   G  ++  + F NP   +S     +T I+++ V+ A ++++ + +   FIGD +++AHN   FD+ FL    ++  ++   +P+IDTL+++R +   +  H L  + +K+ I+   TQ HRA  D E    +  ++L++     IK  ++ N ++      ++ R    T+   +   ++NL+K++S + T  F   P+V      ++    +V +  + GE+FE  M+ + +  E + K  YD+I +     +   I R + +  W +ED I++++K+  K +K VVAT + +YL+ +D ++ ++ V ++  GG        N LN + LP+ +FRTTDE+  EF FL  P L  ++VVTN+  +A  I  ++KPIK+ L++P IEG+ D++  L Y+ ++ I+G+ +   VKARI++E+ S++ +G+ +IY  S  LVK+S+ DGY+VGSRGSVGSS+ A  ++ITEVNPL PHY+C NCK+  F  + +V SGFDLP  +C +C +  K DG +IPFETF+GFKGDK+PDIDLNFS  YQ KAH++ K +FGE+ V+RAGTI T AEKTAYGYVK Y  +   ++ R AE+ R+ + C  VKRT+GQHPGGI+VVP   D++DF+P  +PAD +  +W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D  VM +F+S ++L +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      + +VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL+EE++  +  N +P WYIESC KI Y+FPKAHA AYV+MA +IAWFK+++P+ +YA+YF++R   FD+ +++ G   I  +I+EI  K  +  T      KE +L+ + ELALE+  RG  F  +DL +S A++F++EG+ LIPPF AI GLG +VA +IV ARE+  F SKED ++R +V+ T ++ M++LG    + + +Q+SLF
  S:   144 KYSDKLAESYCQFGFPKMAIDFVLQEQTEEMIAAQEAFMEQKRMEEAALSQQAMQDFQKREQEKKDNPAIANLGDRPFQLGMLIKDDEIMEIKRIVEEERRVIVEGFVFDAEIKVLKSGRSLLQIKITDYTDSIIVKMFSRDNDDAELMQHLKKGMWVKVRGSVQTDTF----IRDLIVMANDINEIKKETRQDLAPEGEKRVELHLHTPMSQMDAVTPVDRLVAQAAKWGHPAVAITDHAVVQSFPEAYAAGKKHG-IKVIYGLEANLVDDGVPIAYAPEHRLLEEATYVVFDVETTGLSTAYDTIIELAAVKIKDGQVIDKYESFANPHHPLSATTIELTGITDDMVRHAPEVEQVIKEFHAFIGDGIVVAHNA-SFDIGFLYTGYKKFGLEGTTHPVIDTLELARLLYPTMKNHRLNTLCKKFNIEL--TQHHRAIYDTEATGYLLLQLLKDADELVIKYHDDFNKHIGGGDAYKKGRPMHCTILAVDNAGLKNLFKIVSHAHTKTFYRVPRVTRAVLEQYREGLLVGSGCSNGELFETMMNKSPEEAEQVAK-FYDYIEVQPKAVYAPLIERNVVRDEWTLEDIIRKLVKLGKKLDKPVVATGNVHYLDPTDAMFRQILVGSQ--GGA-------NILNRSKLPEVHFRTTDEMLKEFDFLG-PDLAKEVVVTNAQKVADSI-GDVKPIKDDLYTPKIEGSDDEVTNLTYEMAHHIYGEELPEIVKARIEKELKSILGHGFGVIYLISAKLVKKSLADGYLVGSRGSVGSSLVATFMEITEVNPLPPHYVCPNCKHSEFFDDGSVSSGFDLPNKDCSECGTPYKKDGQDIPFETFLGFKGDKVPDIDLNFSGEYQPKAHNYTKVLFGEDYVYRAGTIGTVAEKTAYGYVKGYAND-HNLHFRGAEVDRLVQGCTGVKRTSGQHPGGIIVVPDYMDIFDFSPVQFPADAQDAEWRTTHFDFHSIHDNILKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPVVMQIFSSPETLGVTEKQIG--CKTGTLGIPEFGTRFVRQMLEDTKPSTFSELVQISGLSHGTDVWLGNAQELIHNGTCVLKEVIGCRDDIMVYLIYQGLEPSLAFKIMESVRKGKGLSEEFEAEMLANKVPGWYIESCKKIKYMFPKAHAAAYVLMAVRIAWFKVHFPILYYAAYFTVRADDFDLIAMVQGSQMIRARIDEINLKGLDAST------KEKNLLTVMELALEMCERGMSFQKVDLYRSQASEFVIEGNTLIPPFDAIPGLGTNVAKTIVAAREDGEFLSKEDLQQRGRVSKTLIEYMDQLGCLEGMPDANQLSLF 1443
>gi|153174400|ref|ZP_01929928.1| hypothetical protein LMIG_01431 [Listeria monocytogenes FSL N3-165] >gi|153179391|ref|ZP_01932610.1| hypothetical protein LMMG_00283 [Listeria monocytogenes F6900] >gi|153196098|ref|ZP_01940506.1| DNA polymerase III, alpha subunit, Gram-positive type [Listeria monocytogenes 10403S] >gi|127634380|gb|EBA23766.1| DNA polymerase III, alpha subunit, Gram-positive type [Listeria monocytogenes 10403S] >gi|133730348|gb|EBA32046.1| hypothetical protein LMIG_01431 [Listeria monocytogenes FSL N3-165] >gi|133732876|gb|EBA34574.1| hypothetical protein LMMG_00283 [Listeria monocytogenes F6900] (1444 aa)
Score = 2544, Expect = 0.0e+00, Identities = 520/1236 (42%), Positives = 787/1236 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +V +L D++ E +  T++G IF  +    ++G  + ++ +TDY+ S++IK       +  +   LK+G+WVK + S+Q D +   D+  + ++++ I+  K   R D A  KR EL  H+ M+  +   ++  LFK +++ G+ ++AITD    Q+FP+ Y   +KY  LK I+G++ N+ID  +PI  N     + DATY +FD+ETTGLS  YD IIE   +K   G  ++  + FI+P   +S     +T I+++ VK +  I   L + K++ GD +L+AHN   FD+ F+N   E+  ++  +N ++DTL+++R +      H L  + +K+ I  +  Q HRA  DAE    + WK + + +++ +I   + +N  +      +R R    T+Y +    ++NL+KLI+ S  + F   P++      +     I+  + ++GE+FEA M    Q  E +  + YDFI +     +   I RE+ +    +E+ +K I+++  K  K VVAT + +Y +  D++Y ++ ++++  GG        N LN   LP  +FRTTDE+  EF+FL +     +IVVTN+N +   ++ N+KPIK+ L++P I+GA D+++ + Y  ++ ++G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+ +CP C +  + +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGE+ VFRAGTI T AEKTA+GYV++Y E    M  R AEI R+   C  VKRTTGQHPGGI+V+P   DVYDFTP  +PAD    +W TTH  F S+HD++LK DILGHD+PT ++ML + + ++  TIP  D DVM LF ST+SL +K   I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+ K   + DVI CRDDIMV+LI +G+   +AFKIME VRKGKGL +E ++ +  N +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK++YPL+FYA+YF++R   FD+ S++NG+  +   + E+ +K     T      KE +L+ + E+A E+L RG+ F  +DL KS A +F+++GD LIPPF+AI  LG +VA  IV ARE   F SKED ++R KV+ T ++ M++ G    L + +Q+SLF
  S:   233 EVKRLGDIYDEERRITVQGLIFATEIRELRSGRSLLQFKITDYTSSMIIKMFSRDNEDAAMFQNLKKGMWVKVRGSVQNDTFVR-DLIMMAQDVNEIAGVK---RLDTAEEKRAELHLHSPMSQMDATSSVDSLFKQAADWGHKAIAITDHSVAQSFPEAYGAGQKYG-LKVIFGIEANLIDDGVPIAYNDQHIALEDATYCVFDVETTGLSAVYDTIIELAGVKMKNGEIIDKFEAFIDPGHPLSATTINLTGITDDMVKGSDPIDVVLKRFKEWSGDDILVAHNA-SFDMGFINTAYEKVGLEKAENAVVDTLELARFLYPHFKNHRLNTLTKKFNIILE--QHHRAVFDAEATAYLAWKLIKDAKEMHNIDFHDSLNDYMGEGDAYKRARPFHATIYAQTAVGLKNLFKLITMSNINYFYRVPRIPRSQLKKLREGLIIGTACSQGELFEAMMQKGMQAAEKV-AEFYDFIEVQPKPVYAPLIERELVRDEKALEEILKNIVRVGEKTGKPVVATGNVHYKDPVDKIYRKILIHSQ--GGA-------NPLNRAELPDVHFRTTDEMLKEFAFLGEEK-AKEIVVTNANLVVDWME-NLKPIKDELYTPKIDGAEDEVRNMSYAMAHQLYGEKLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYLCPNCKDSEFFDDGSVGSGFDLPDKDCPHCGTAYQKEGQDIPFETFLGFKGDKVPDIDLNFSGDYQPVAHAYTKEIFGEDYVFRAGTIGTVAEKTAFGYVRNY-ERDMNMTIRGAEIDRLVAGCTGVKRTTGQHPGGIIVIPDYMDVYDFTPVQFPADATDSEWKTTHFDFHSIHDNVLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPDVMKLFGSTESLGVKPADIDS--KTGTLGIPEFGTRFVRQMLEQTKPTTFSELVQISGLSHGTDVWLGNAEELIKNKTCELPDVIGCRDDIMVFLIYQGLESSLAFKIMESVRKGKGLTDEMEEAMMANKVPLWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHYPLYFYATYFTVRADDFDLTSMVNGKEAVKATMKEVNDKGMEAST------KEKNLLTVLEIANEMLARGFHFQKVDLYKSSADEFIIDGDSLIPPFNAIPSLGTNVAKQIVAARENGEFLSKEDLQQRGKVSKTIIQYMDDQGCLEGLPDQNQLSLF 1444
>gi|46907546|ref|YP_013935.1| DNA polymerase III PolC [Listeria monocytogenes str. 4b F2365] >gi|47093944|ref|ZP_00231681.1| DNA polymerase III, alpha chain, Gram-positive type [Listeria monocytogenes str. 4b H7858] >gi|153166695|ref|ZP_01927218.1| DNA polymerase III, alpha subunit, Gram-positive type [Listeria monocytogenes FSL N1-017] >gi|67460321|sp|Q720A2|DPO3_LISMF DNA polymerase III polC-type (PolIII) >gi|46880814|gb|AAT04112.1| DNA polymerase III, alpha chain, Gram-positive type [Listeria monocytogenes str. 4b F2365] >gi|47017682|gb|EAL08478.1| DNA polymerase III, alpha chain, Gram-positive type [Listeria monocytogenes str. 4b H7858] >gi|133727455|gb|EBA29153.1| DNA polymerase III, alpha subunit, Gram-positive type [Listeria monocytogenes FSL N1-017] (1444 aa)
Score = 2544, Expect = 0.0e+00, Identities = 520/1236 (42%), Positives = 787/1236 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +V +L D++ E +  T++G IF  +    ++G  + ++ +TDY+ S++IK       +  +   LK+G+WVK + S+Q D +   D+  + ++++ I+  K   R D A  KR EL  H+ M+  +   ++  LFK +++ G+ ++AITD    Q+FP+ Y   +KY  LK I+G++ N+ID  +PI  N     + DATY +FD+ETTGLS  YD IIE   +K   G  ++  + FI+P   +S     +T I+++ VK +  I   L + K++ GD +L+AHN   FD+ F+N   E+  ++  +N ++DTL+++R +      H L  + +K+ I  +  Q HRA  DAE    + WK + + +++ +I   + +N  +      +R R    T+Y +    ++NL+KLI+ S  + F   P++      +     I+  + ++GE+FEA M    Q  E +  + YDFI +     +   I RE+ +    +E+ +K I+++  K  K VVAT + +Y +  D++Y ++ ++++  GG        N LN   LP  +FRTTDE+  EF+FL +     +IVVTN+N +   ++ ++KPIK+ L++P I+GA D+++ + Y  ++ ++G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+ +CP C +  + +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGE+ VFRAGTI T AEKTA+GYV++Y E    M  R AEI R+   C  VKRTTGQHPGGI+V+P   DVYDFTP  +PAD    +W TTH  F S+HD++LK DILGHD+PT ++ML + + ++  TIP  D DVM LF ST+SL +K   I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+ K   + DVI CRDDIMV+LI +G+   +AFKIME VRKGKGL EE ++ +  N +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK++YPL+FYA+YF++R   FD+ S++NG+  +   + E+ +K     T      KE +L+ + E+A E+L RG+ F  +DL KS A +F+++GD LIPPF+AI  LG +VA  IV ARE   F SKED ++R KV+ T ++ M++ G    L + +Q+SLF
  S:   233 EVKRLGDIYDEERRITVQGLIFATEIRELRSGRSLLQFKITDYTSSMIIKMFSRDNEDAAMFQNLKKGMWVKVRGSVQNDTFVR-DLIMMAQDVNEIAGVK---RLDTAEEKRAELHLHSPMSQMDATSSVDSLFKQAADWGHKAIAITDHSVAQSFPEAYGAGQKYG-LKVIFGIEANLIDDGVPIAYNDQHIALEDATYCVFDVETTGLSAVYDTIIELAGVKMKNGEIIDKFEAFIDPGHPLSATTINLTGITDDMVKGSDPIDVVLKRFKEWSGDDILVAHNA-SFDMGFINTAYEKVGLEKAENAVVDTLELARFLYPHFKNHRLNTLTKKFNIILE--QHHRAVFDAEATAYLAWKLIKDAKEMHNIDFHDSLNDYMGEGDAYKRARPFHATIYAQTAVGLKNLFKLITMSNINYFYRVPRIPRSQLKKLREGLIIGTACSQGELFEAMMQKGMQAAEKV-AEFYDFIEVQPKPVYAPLIERELVRDEKALEEILKNIVRVGEKTGKPVVATGNVHYKDPVDKIYRKILIHSQ--GGA-------NPLNRAELPDVHFRTTDEMLKEFAFLGEEK-AKEIVVTNANLVVDWME-DLKPIKDELYTPKIDGAEDEVRNMSYAMAHQLYGEKLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYLCPNCKDSEFFDDGSVGSGFDLPDKDCPHCGTPYQKEGQDIPFETFLGFKGDKVPDIDLNFSGDYQPVAHAYTKEIFGEDYVFRAGTIGTVAEKTAFGYVRNY-ERDMNMTIRGAEIDRLVAGCTGVKRTTGQHPGGIIVIPDYMDVYDFTPVQFPADATDSEWKTTHFDFHSIHDNVLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPDVMKLFGSTESLGVKPADIDS--KTGTLGIPEFGTRFVRQMLEQTKPTTFSELVQISGLSHGTDVWLGNAEELIKNKTCELPDVIGCRDDIMVFLIYQGLESSLAFKIMESVRKGKGLTEEMEEAMMANKVPLWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHYPLYFYATYFTVRADDFDLTSMVNGKEAVKATMKEVNDKGMEAST------KEKNLLTVLEIANEMLARGFHFQKVDLYKSSADEFIIDGDSLIPPFNAIPSLGTNVAKQIVAARENGEFLSKEDLQQRGKVSKTIIQYMDDQGCLEGLPDQNQLSLF 1444
>gi|16803360|ref|NP_464845.1| DNA polymerase III PolC [Listeria monocytogenes EGD-e] >gi|21263551|sp|Q8Y7G1|DPO3_LISMO DNA polymerase III polC-type (PolIII) >gi|16410736|emb|CAC99398.1| polC [Listeria monocytogenes] (1444 aa)
Score = 2540, Expect = 0.0e+00, Identities = 519/1236 (41%), Positives = 787/1236 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +V +L D++ E +  T++G IF  +    ++G  + ++ +TDY+ S++IK       +  +   LK+G+WVK + S+Q D +   D+  + ++++ I+  K   R D A  KR EL  H+ M+  +   ++  LFK +++ G+ ++AITD    Q+FP+ Y   +KY  LK I+G++ N+ID  +PI  N     + DATY +FD+ETTGLS  YD IIE   +K   G  ++  + FI+P   +S     +T I+++ VK +  I   L + K++ GD +L+AHN   FD+ F+N   E+  ++  +N ++DTL+++R +      H L  + +K+ I  +  Q HRA  DAE    + WK + + +++ +I   + +N  +      +R R    T+Y +    ++NL+KLI+ S  + F   P++      +     I+  + ++GE+FEA M    Q  E +  + YDFI +     +   I RE+ +    +E+ +K I+++  K  K VVAT + +Y +  D++Y ++ ++++  GG        N LN   LP  +FRTTDE+  EF+FL +     +IVVTN+N +   ++ N+KPIK+ L++P I+GA D+++ + Y  ++ ++G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+ +CP C +  + +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGE+ VFRAGTI T AEKTA+GYV++Y E    M  R AEI R+   C  VKRTTGQHPGGI+V+P   DVYDFTP  +PAD    +W TTH  F S+HD++LK DILGHD+PT ++ML + + ++  TIP  D DVM LF ST+SL +K   I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+ K   + DVI CRDDIMV+LI +G+   +AFKIME VRKGKGL +E ++ +  N +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK++YPL+FYA+YF++R   FD+ S++NG+  +   + E+ +K     T      KE +L+ + E+A E+L RG+ F  +DL KS A +F+++G+ LIPPF+AI  LG +VA  IV ARE   F SKED ++R KV+ T ++ M++ G    L + +Q+SLF
  S:   233 EVKRLGDIYDEERRITVQGLIFATEIRELRSGRSLLQFKITDYTSSMIIKMFSRDNEDAAMFQNLKKGMWVKVRGSVQNDTFVR-DLIMMAQDVNEIAGVK---RLDTAEEKRAELHLHSPMSQMDATSSVDSLFKQAADWGHKAIAITDHSVAQSFPEAYGAGQKYG-LKVIFGIEANLIDDGVPIAYNDQHIALEDATYCVFDVETTGLSAVYDTIIELAGVKMKNGEIIDKFEAFIDPGHPLSATTINLTGITDDMVKGSDPIDVVLKRFKEWSGDDILVAHNA-SFDMGFINTAYEKVGLEKAENAVVDTLELARFLYPHFKNHRLNTLTKKFNIILE--QHHRAVFDAEATAYLAWKLIKDAKEMHNIDFHDSLNDYMGEGDAYKRARPFHATIYAQTAVGLKNLFKLITMSNINYFYRVPRIPRSQLKKLREGLIIGTACSQGELFEAMMQKGMQAAEKV-AEFYDFIEVQPKPVYAPLIERELVRDEKALEEILKNIVRVGEKTGKPVVATGNVHYKDPVDKIYRKILIHSQ--GGA-------NPLNRAELPDVHFRTTDEMLKEFAFLGEEK-AKEIVVTNANLVVDWME-NLKPIKDELYTPKIDGAEDEVRNMSYAMAHQLYGEKLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYLCPNCKDSEFFDDGSVGSGFDLPDKDCPHCGTAYQKEGQDIPFETFLGFKGDKVPDIDLNFSGDYQPVAHAYTKEIFGEDYVFRAGTIGTVAEKTAFGYVRNY-ERDMNMTIRGAEIDRLVAGCTGVKRTTGQHPGGIIVIPDYMDVYDFTPVQFPADATDSEWKTTHFDFHSIHDNVLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPDVMKLFGSTESLGVKPADIDS--KTGTLGIPEFGTRFVRQMLEQTKPTTFSELVQISGLSHGTDVWLGNAEELIKNKTCELPDVIGCRDDIMVFLIYQGLESSLAFKIMESVRKGKGLTDEMEEAMMANKVPLWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHYPLYFYATYFTVRADDFDLTSMVNGKEAVKATMKEVNDKGMEAST------KEKNLLTVLEIANEMLARGFHFQKVDLYKSSADEFIIDGESLIPPFNAIPSLGTNVAKQIVAARENGEFLSKEDLQQRGKVSKTIIQYMDDQGCLEGLPDQNQLSLF 1444
>gi|169350436|ref|ZP_02867374.1| hypothetical protein CLOSPI_01204 [Clostridium spiroforme DSM 1552] >gi|169292756|gb|EDS74889.1| hypothetical protein CLOSPI_01204 [Clostridium spiroforme DSM 1552] (1439 aa)
Score = 2532, Expect = 0.0e+00, Identities = 566/1418 (39%), Positives = 878/1418 (61%)
  Q:    39 QNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQ--EKIKNEITEVKRSSNAKKTDSSFTYKFRK---SVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE----GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLG--GKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFE-ESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL----NEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD---YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++DS    +SF K++P +     + + +     + + + +  D + QE+++ Y+ Y +        +   +K  +   L  +     PII   A   + ++ +Q   +K  +E      N  G  K +  + LDE+  D   D K +++  E ++ +++ ++++      +++F  K+RK   +V   + +++D   +     I+G +FK D +VTK+   I   +VTDY+DSI++K       N   L ELK      VWVK +  ++ D Y +  +  +  E+ II  P    R D + IKR EL  H+ M+A +G+  I++  K  +  G+ ++A+TD  N Q+FP+    A   + +K IYGV+FN+++  + IV N  D  I  ATYV FD+ETTGLS  +D I EFGA+K   G  ++ +Q FINP + IS +I ++T I+NE VK+   I + L +I +F GD +L+AHN   FD+ FLN  L  + M  IKNP+ID+L ++RAI + +  + LG + R Y+++YD+  AHRAD DA+ L +++  M+      +  +L ++   L +D + +      +     N+  ++N++KL+S + T  F G  ++  E    +    +  +S    ++FEAA++ + + LE+ +K  YD+I I   E + H I R ++  +  +  +++RI+  A K NK +VAT D ++L+  D ++  V+++   +G   K + L          P  Y RTTDE+ + + +L+      + VVTN+N IA +++  IKPI + L +P I+GA + LK+L Y+ ++  +G+ + + V+ R+++E+S++I +G+ +IY+ SHLLVK+S DDGY+VGSRGSVGSS  A +  ITEVNPL PHY+C NC Y  F  E  +  G+DL +  CPKC + +KG+GHNIPFETF+GF  DK+PDIDLNFS  YQ  AH F K +FGE+ VFRAGTIST AEKTAYGY K Y E   K  + R+AE+ RIA  C  VKRTTGQHPGGI+V+P   DV+DFTP+ YPADD +  W TTH  F ++HD++LKFDILGH +PT+++ L + T V+  TIP  D  VM LF S+ +L      I    K+G+ G+PEFGTNFV+ ML  T+P+ FSDL+ ISGLSHGT+V+  NA+ LI+    T+S+VI CRDDIMVYLI+KG+    AF IME VRKGK        +Y++++  +N+P WYIESC KI Y+FPKAHA AYV+ A ++AW+K+YYP  +YA YFS R   ++I++++ G+  I  +    +E++A  K +    NKE  L  ++E+ALE++ RGY F  I L+ S A+ F+++ +    LIPPFSA+D LG++VA +++ AR +  F SKED  KRTK+  +H+K + ++G+ + + E +Q+SLF
  S:    33 KDDSYTFYLSFQKLIPFNEYQLLIQNKDNFPFPIKYVIDYENDDFTQEELIPYIGYLL--------EVLKQKYPVCLTLTTDNFKVGPIIKIGAC--NTIQLEQLTQLKSEIE---SLFNQTGI-KRNFDFYLDEEN-DTFKDIKEEMETYEPVEIDMSLLQKTEKPSMKENTFQNKYRKKSNAVDMKIEEITDQTLD-NNICIKGYVFKTDIIVTKSNKHIQSLWVTDYTDSIIVKRFENNSNNS--LEELKSIGKGNVWVKVRGEVRYDSYAHETVM-IAREVEIIKGPAP--RKDTSEIKRVELHTHSKMSAMDGIGTIEQYIKTVASWGHKAIAVTDHGNVQSFPE-AQSASLQAGIKMIYGVEFNMVEPVLNIVYNPIDVSIEHATYVAFDLETTGLSVIHDGITEFGAVKIKNGEVIDRMQKFINPGKTISSRISSLTNITNEMVKNEPTIDKVLPEIMEFFGDCILVAHNA-SFDVGFLNENLRRSNMSEIKNPIIDSLALARAILKPMKSYRLGNVCRSYRVNYDDEVAHRADYDAKVLGDVFNLMIHQIMQSEKYSLLDV-CKLTSDDVYKIVYPYHMCALALNKTGLKNMFKLVSEANTKYFHGESRIPKERLEYYREGLLFGSSCYNSDVFEAALNLSDERLENAMK-FYDYIEIQPLEDYFHLIERGKLQDKDELIKSLQRIVTCAKKLNKIIVATGDVHFLDVKDRIFRDVFISNPTIGIGHKAHPLCDRRNPKAKNPCQYLRTTDEMLECYPYLSKEETF-EYVVTNTNKIADMVE-EIKPIHDKLFTPKIDGADENLKKLCYETAHKTYGNPLPSIVEKRLEKELSNIIKHGFGVIYYISHLLVKKSNDDGYLVGSRGSVGSSFVATMSGITEVNPLPPHYVCPNCTYSEFLEEGTIADGYDLEDKPCPKCGTIMKGEGHNIPFETFLGFNADKVPDIDLNFSGEYQANAHAFTKEIFGEDHVFRAGTISTVAEKTAYGYAKGYAELMGKDQSIRSAELERIAAGCGGVKRTTGQHPGGIIVIPRDMDVFDFTPYQYPADDLSATWKTTHFDFHAIHDNVLKFDILGHVDPTVIRALQDLTGVDPKTIPTNDKKVMSLFTSSKALGCDLEFIG--CKSGALGLPEFGTNFVRGMLDQTQPKSFSDLVIISGLSHGTDVYLGNAESLIKSGTCTLSEVIGCRDDIMVYLIEKGLPNKDAFDIMECVRKGKSTAVFPKMQYEELMKKHNVPQWYIESCKKIKYMFPKAHAVAYVLSAIRVAWWKVYYPREYYAVYFSTRCDFYEIETLIQGKDAIMAR----REEIAQLKAQRSASNKEEGLWDVFEIALEMIERGYHFNPISLQYSQASKFILDPNDEFGLIPPFSAVDALGEAVAKTVIDARNQAPFLSKEDVIKRTKLNNSHIKTLTKMGVFNGMQERNQLSLF 1439
>gi|187605330|ref|ZP_02991528.1| DNA polymerase III, alpha subunit [Exiguobacterium sp. AT1b] >gi|187482576|gb|EDU20582.1| DNA polymerase III, alpha subunit [Exiguobacterium sp. AT1b] (1430 aa)
Score = 2519, Expect = 0.0e+00, Identities = 551/1422 (38%), Positives = 855/1422 (60%)
  Q:    37 NKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYL-EHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKN-EITEVKRSSNAKKTDSSFTYKFRKS--VTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQID--MYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLE-NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGE-IRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNT--VLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           NK+  +     SF KVLP D+   F+  L     +    +   + T       +Y+ Y+         +  SE  ++   ++   G   P   +N + +      +   + K L +  +   + YGF+K        E      +  +  +QE I+  ++    + + A +T+     + R    +  ++  +  +  E +   I G +F  ++   K+G +++ + +TDY+DS+++K       +  +LS +K+G+W++    ++ D  M E   +   ++E+ +     E  R +    KR EL  HT M+  + + N+  L   +++ G+ ++AITD    Q FP+ Y   KK + +K +YGV+ N+++  +P+  +A D  + DATYV+FD+ETTGLS  Y+KIIE   +K   G  ++  + F +P+  +S     +T I+++ V+     +    +  D+ GDS+L+AHN   FD+ FL   L     +    P+IDTL+++R +   +  H L  +A+++ I+   TQ HRA  DAE    +  ++L+  +++ ++ T   +N+ + +D  + R   +  T+Y KN+   +R+LY+LIS S         ++      +     ++ ++   GEIF+AA++ +   LE ++   YDFI I  P  + H I +EI      + + IKRII++A K    V AT + +YL+ SD  Y  + +  +  GG        N +NT   LP  +FRTT E+ +EF FL D  L  +IV+TN N IA  I++ I+ I + L++P IEGA D+++ + Y  + SI+GD +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A + +ITEVNPL PHY+C NC++ +F  + +V SG+DLP+  CP+C +  K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGEE V+RAGTI T A+KTAYGYVK Y  E+ K+  RNAE+ R+      VKRTTGQHPGGI+VVP   D+ D +P  YPADD + +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D  VM +F+S + L +    I    KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI      + DVI CRDDIMVYLI  G+ P  AFKIME VRKGKGL EE +  + +N++P WYI SC KI Y+FPKAHATAYV+MA +IA+FK+++P+ +YA+YF++R   FD+ +++ G   +   +++I+EK  +    A  K+K L    + ELALE+L RG KF NIDL +S AT+FL+E + LIPPF+A+DGLG + A +IV+AREE  F SKED +KR K++ T ++ ++ +     L +++Q+S F+F
  S:    34 NKKRRTWTFYFSFPKVLPYDVHQLFMSRLESRYATFADEVYARFSTTAGGSEQDYIDYW--------PRIVSELSQVSGAMRSYFGSVSPRFEQNKLMIPVRSAPEASYVDKELCQEVQALYSAYGFTKKPCQAQFSEDAEANQALREQVVQEDIEQAKMALAAQFAKATETNDEPITEIRMGALIKDEIVPIKTIIEEERRVAIRGLVFSAERKELKSGKKLFTFKMTDYTDSLIVKVFARDDDDDRMLSAVKKGMWIQTAGRVEDDSFMRELCMMASQLQEVKV-----EPPRDEWEGEKRVELHAHTQMSQMDAVTNVSALVARAAKWGHRAIAITDHAGVQAFPEAYYAGKK-NDIKVLYGVEANVVNDGVPVAYHATDVALEDATYVVFDVETTGLSAVYNKIIELAGVKIKDGEIIDRFEAFADPKHALSATTIELTGITDDMVQGQPDPEVITKRFVDWCGDSILVAHNA-SFDMGFLEATLRSGGHEPDDYPVIDTLELARTLMPTLKNHRLNTLAKRFDIEL--TQHHRAIYDAEATAYLLMKLLDLAKQMFEMTTHRSLNAKVGSDVSKIRPFHA--TIYAKNKKPGLRHLYELISLSHIDYLYRMARMPRSELVKRREGLLIGSACDNGEIFDAALNKSDDELEKMMS-FYDFIEIHPPALYHHLIDKEIVANELELREIIKRIIRVAEKAELPVCATGNVHYLDRSDRSYREILIRTQ--GGA-------NFINTRKELPHAHFRTTKEMMEEFKFLGDD-LAREIVITNPNAIADQIES-IQIIPDDLYTPKIEGADDEVRNMSYDMARSIYGDELPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSLVATMTEITEVNPLPPHYVCPNCQHSHFFNDGSVGSGYDLPDKECPECGTWYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPHAHAYTKVLFGEEYVYRAGTIGTIADKTAYGYVKGYATENDKI-YRNAEVDRLVSGVTGVKRTTGQHPGGIIVVPDYMDIADISPIQYPADDNSSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPTVMKIFSSPEVLGVTPEQIES--KTGTLGIPEFGTKFVRQMLEETKPSTFSELVQISGLSHGTDVWLGNANELIYNGTCELKDVIGCRDDIMVYLIYAGLEPSFAFKIMESVRKGKGLTEEMESEMRENDVPEWYISSCKKIKYMFPKAHATAYVLMAVRIAYFKVHHPILYYATYFTVRAGDFDLSAMIKGPQAVRKAMSDIREKGFD----ATAKDKGLH--TVLELALEMLERGMKFQNIDLYRSSATEFLIEDNTLIPPFNAVDGLGTNAAKAIVEAREEGQFLSKEDLRKRAKLSKTVIETLDTMKCLEGLPDENQLSFFDF 1428
>gi|56963998|ref|YP_175729.1| DNA polymerase III PolC [Bacillus clausii KSM-K16] >gi|56910241|dbj|BAD64768.1| DNA polymerase III alpha subunit PolC [Bacillus clausii KSM-K16] (1430 aa)
Score = 2512, Expect = 0.0e+00, Identities = 521/1276 (40%), Positives = 804/1276 (63%)
  Q:   181 DHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNL-QNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           D    ++  ++ +  E + +   K+ + S  Y  +     + T L  +  E +  TI+G +F  D    ++G  +  + +TDY+DSI++K     K +  V+  +K+G+W+K +  IQ D +    +  L+   +  ++    +R D A  KR EL  H+ M+  +G+V++    + +++ G+ ++AITD    Q FP+ Y  AKK+  +K IYG++ N++D  +PI  N++   + +  YV+FD+ETTGLS  Y+ IIE  A+K   G  +++ + F +P+E +S  I  +T I+++ V+ A +  E L + ++F G++ L+AHN   FD+ FLN   ++     + NP+IDTL++ R +  ++  H L  + +K+ I+      HRA  D +   YLL  WK M+++   ++I   +E+N+++ Q +F R+R      T+   ++  ++NLY+L+S S    +   P++     N+     ++ ++  +GE+FE  M  +   +E I    YDF+ I     + H I RE+ K +  +++ +  I+ +  +    VVAT + +YLNE D +Y ++ + ++   G  N L K       LP  +FRTT E+ +EFSFL        +VVT SN IA+ +  ++ PI + L++P IEGA D+++ + Y+++  I+GD +   V+AR+ +E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C +CK+ +F  + +V SG+DLP++ CPKC S    DG +IPFETF+GFKGDK+PDIDLNFS  YQ +AH + K +FGE+ V+RAGTI T A+KTAYGYVK Y +    +  R AEI R+   C  VKRTTGQHPGGI+VVP   D++DF+P  YPADDK  +W TTH  F S+HD+LLK DILGHD+PT ++ML + + ++  TIP  D +VM +F S D L +    I  + KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI      + DVI CRDDIMVYLI KG+   +AFKIME VRKGKGL  E+ + +  +++P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++P+ +YA+YF++R   F++  ++ G S I  K+ EI  K   A+PK KA        ++ + EL+LE+  RG+ F  +DL KS AT+F+V+GD L+PPF+A++G+G + A +IVKARE   F SKED ++R ++T T ++ + E G    L E +Q+SLF
  S:   185 DRSKVVEAMLEKQRVEEEMAKQVKQANLSMGYPIKD----EPTPLEAIVDEERRITIQGYVFATDIRELRSGRTLLTFKMTDYTDSILVKMFSRDKEDVPVMQAVKKGMWLKVRGGIQNDTF----VRDLVMIANDFNQVTPIVREDTAEQKRVELHTHSTMSQMDGVVSVGRYIEQAAKWGHPAIAITDHGVVQAFPEAYGAAKKHD-IKVIYGMEANVVDDGVPIAYNSDHRHLLEEEYVVFDVETTGLSAVYNTIIELAAVKIKNGEIIDTYESFADPKEPLSATIIELTGITDDMVQGAPEPAEVLKQFREFAGNATLVAHNA-SFDIGFLNVGYKKLGFSEVTNPVIDTLELGRFLYPELKNHRLNTLCKKFDIEL--VSHHRAIYDTQATAYLL--WK-MVKDAAEKEIVYHDELNNHMGQGNFHRQRPFHC--TLLVTSQTGLKNLYQLVSMSHVDYYFRTPRIPRSQLNKHREGLLIGSACDKGEVFEGMMQKSADEVEKI-AGFYDFLEIQPLGNYGHLIERELVKDKTALQEIVGNIVALGERLGLPVVATGNVHYLNEEDAIYRKILIASQ---GGANPLNKQK-----LPDVHFRTTTEMLEEFSFLGAE-QAEKVVVTASNDIAAQV-GDVHPIPDDLYAPKIEGADDEIRNMSYERAKMIYGDPLPEIVEARLQKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPSCKHSHFFDDGSVASGYDLPDAECPKCGSMYIKDGQDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHAYTKELFGEDYVYRAGTIGTVADKTAYGYVKGY-QNDHDLLMRGAEIDRLVAGCTGVKRTTGQHPGGIIVVPDYMDIHDFSPIQYPADDKNAEWKTTHFDFHSIHDNLLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPEVMKIFASPDVLGVTEEQI--LCKTGTLGIPEFGTRFVRQMLEETKPSTFSELLQISGLSHGTDVWLGNANELIYNGTCELKDVIGCRDDIMVYLIYKGLESSLAFKIMEFVRKGKGLQPEWVEEMKKHDVPDWYIDSCTKIKYMFPKAHAAAYVLMAVRIAYFKVHHPILYYATYFTVRADDFELDIMIKGASSIRAKMEEINAKGLDASPKEKA--------VLTVLELSLEMCERGFGFHKVDLYKSSATEFIVDGDKLLPPFNALNGVGTNAALNIVKARENGHFLSKEDLQQRARLTKTVVENLSEHGCLEGLPESNQLSLF 1430
>gi|57651834|ref|YP_186140.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus COL] >gi|87161645|ref|YP_493854.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus USA300] >gi|88194974|ref|YP_499774.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161509430|ref|YP_001575089.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123486180|sp|Q2FHH4|DPO3_STAA3 DNA polymerase III polC-type (PolIII) >gi|56749834|sp|P68852|DPO3_STAAW DNA polymerase III polC-type (PolIII) >gi|110808208|sp|Q2G1Z8|DPO3_STAA8 DNA polymerase III polC-type (PolIII) >gi|12082347|dbj|BAB20885.1| PolC [Staphylococcus aureus] >gi|57286020|gb|AAW38114.1| DNA polymerase III, alpha subunit, Gram-positive type [Staphylococcus aureus subsp. aureus COL] >gi|87127619|gb|ABD22133.1| DNA polymerase III, alpha subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202532|gb|ABD30342.1| DNA polymerase III, alpha subunit, Gram-positive type [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|160368239|gb|ABX29210.1| DNA-directed DNA polymerase III alpha subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (1436 aa)
Score = 2508, Expect = 0.0e+00, Identities = 531/1227 (43%), Positives = 792/1227 (64%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    I  L+  +S I + K+  + D A  KR E   HT M+  +G+ NI    K +++ G+ ++A+TD    Q FPD +  A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +   NEIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   F   P++     +E+    +V  +  EGE+F A M   Q  +E I K  YDFI I  P  +   I RE+ +    + +  +R+I   +     V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ +EF FL +    ++IVV N+N +A  I+  + PIK+ L++P +EGA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   +FN + +V SGFDLP+  C  C + L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  YPADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F++ +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AFKIME VRKGKGL EE  + + +N +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RGY+   I L+KS A +F++EGD LIPPF ++ GLG++VA  IV+AR++  F SKED  K+  ++   ++ ++ELG   +L +  Q+S+F+
  S:   235 EFKVA-IEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLK-MFTRK-NKDDLEHFKALSVGKWVRAQGRIEEDTF----IRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKHG-IKMIYGMEGMLVDDGVPIAYKPQDVVLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKLSNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQSQVEKIAK-YYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLNEFHFLGEEK-AHEIVVKNTNELADRIE-RVVPIKDELYTPRMEGANEEIRELSYANARKLYGEDLPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFN-DGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPGLGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFD 1435
>gi|15924254|ref|NP_371788.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus Mu50] >gi|15926847|ref|NP_374380.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus N315] >gi|148267754|ref|YP_001246697.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus JH9] >gi|150393813|ref|YP_001316488.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus JH1] >gi|156979585|ref|YP_001441844.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus Mu3] >gi|166217451|sp|A7X1P4|DPO3_STAA1 DNA polymerase III polC-type (PolIII) >gi|54036992|sp|P63982|DPO3_STAAN DNA polymerase III polC-type (PolIII) >gi|54040953|sp|P63981|DPO3_STAAM DNA polymerase III polC-type (PolIII) >gi|13701064|dbj|BAB42359.1| DNA polymerase III, alpha chain PolC-type [Staphylococcus aureus subsp. aureus N315] >gi|14247034|dbj|BAB57426.1| DNA polymerase III alpha chain PolC-type [Staphylococcus aureus subsp. aureus Mu50] >gi|147740823|gb|ABQ49121.1| DNA polymerase III catalytic subunit, PolC type [Staphylococcus aureus subsp. aureus JH9] >gi|149946265|gb|ABR52201.1| DNA polymerase III, alpha subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156721720|dbj|BAF78137.1| DNA polymerase III alpha chain PolC-type [Staphylococcus aureus subsp. aureus Mu3] (1438 aa)
Score = 2508, Expect = 0.0e+00, Identities = 531/1227 (43%), Positives = 792/1227 (64%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    I  L+  +S I + K+  + D A  KR E   HT M+  +G+ NI    K +++ G+ ++A+TD    Q FPD +  A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +   NEIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   F   P++     +E+    +V  +  EGE+F A M   Q  +E I K  YDFI I  P  +   I RE+ +    + +  +R+I   +     V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ +EF FL +    ++IVV N+N +A  I+  + PIK+ L++P +EGA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   +FN + +V SGFDLP+  C  C + L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  YPADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F++ +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AFKIME VRKGKGL EE  + + +N +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RGY+   I L+KS A +F++EGD LIPPF ++ GLG++VA  IV+AR++  F SKED  K+  ++   ++ ++ELG   +L +  Q+S+F+
  S:   237 EFKVA-IEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLK-MFTRK-NKDDLEHFKALSVGKWVRAQGRIEEDTF----IRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKHG-IKMIYGMEGMLVDDGVPIAYKPQDVVLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKLSNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQSQVEKIAK-YYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLNEFHFLGEEK-AHEIVVKNTNELADRIE-RVVPIKDELYTPRMEGANEEIRELSYTNARKLYGEDLPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFN-DGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPGLGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFD 1437
>gi|21282876|ref|NP_645964.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus MW2] >gi|49486103|ref|YP_043324.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus MSSA476] >gi|151221386|ref|YP_001332208.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus str. Newman] >gi|168727927|ref|ZP_02760204.1| DNA polymerase III alpha chain PolC-type [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|172049022|sp|A6QGG4|DPO3_STAAE DNA polymerase III polC-type (PolIII) >gi|56748669|sp|Q6G9U9|DPO3_STAAS DNA polymerase III polC-type (PolIII) >gi|73919251|sp|Q5HGG7|DPO3_STAAC DNA polymerase III polC-type (PolIII) >gi|21204315|dbj|BAB95012.1| DNA polymerase III alpha chain PolC-type [Staphylococcus aureus subsp. aureus MW2] >gi|49244546|emb|CAG42975.1| DNA polymerase III PolC-type [Staphylococcus aureus subsp. aureus MSSA476] >gi|150374186|dbj|BAF67446.1| DNA polymerase III alpha chain PolC-type [Staphylococcus aureus subsp. aureus str. Newman] (1438 aa)
Score = 2508, Expect = 0.0e+00, Identities = 531/1227 (43%), Positives = 792/1227 (64%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    I  L+  +S I + K+  + D A  KR E   HT M+  +G+ NI    K +++ G+ ++A+TD    Q FPD +  A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +   NEIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   F   P++     +E+    +V  +  EGE+F A M   Q  +E I K  YDFI I  P  +   I RE+ +    + +  +R+I   +     V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ +EF FL +    ++IVV N+N +A  I+  + PIK+ L++P +EGA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   +FN + +V SGFDLP+  C  C + L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  YPADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F++ +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AFKIME VRKGKGL EE  + + +N +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RGY+   I L+KS A +F++EGD LIPPF ++ GLG++VA  IV+AR++  F SKED  K+  ++   ++ ++ELG   +L +  Q+S+F+
  S:   237 EFKVA-IEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLK-MFTRK-NKDDLEHFKALSVGKWVRAQGRIEEDTF----IRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKHG-IKMIYGMEGMLVDDGVPIAYKPQDVVLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKLSNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQSQVEKIAK-YYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLNEFHFLGEEK-AHEIVVKNTNELADRIE-RVVPIKDELYTPRMEGANEEIRELSYANARKLYGEDLPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFN-DGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPGLGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFD 1437
>gi|163762557|ref|ZP_02169622.1| Hpt sensor signal transduction histidine kinase [Bacillus selenitireducens MLS10] >gi|160357296|gb|EDP83944.1| Hpt sensor signal transduction histidine kinase [Bacillus selenitireducens MLS10] (1433 aa)
Score = 2505, Expect = 0.0e+00, Identities = 533/1318 (40%), Positives = 817/1318 (61%)
  Q:   139 ENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEV-----KRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E ++E   ++ +E  +     +GF        + E   ++    + ++QE  + E+ E      K+   AK             +  D   L ++  E K  T +G +F  +    K+G  +  + +TDY+DSI +K     K +  V   +K+G+W+K +  +Q D + + D   +  ++  + KP E  R D A    KR EL  H+ M+  + + N+    + + + G+ ++AITD    Q FP+ Y+  KK + +K IYGV+ N++D  +PI  + +D  + + TYV+FD+ETTGLS  Y+ IIE  A+K   G  ++  + F NP E +S  I  +T I+++ V DA +I + L   K + G+ +L+AHN   FD+ FL+   ++  MD   NP+IDTL++ R +      + L  + +K+ I+      HRA  DAE   ++  +M+ +   + I T + +N     D  + + R +  T+Y KN   ++NLYKL+S +    F   P++      E     ++ ++  +GE+F+  M    + +E      YDF+ +  P  + H I +EI +    ++  IK +IK+    NK VVAT + +YLNE D VY ++ + ++  GG        N LN + LPK +FRTT+E+ D FSFL++     +IVVTNS  IA  ID  IKPI + L++PHIEGA ++++Q+ Y ++ SI+GD +   V+ R+++E++S+I NG+++IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C +C+Y  F  + +V SGFDLP+ +C KC +  + DGH+IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K++FGE+ V+RAGTI+T A+KTAYGYVK Y E    M  + AEI R+   C  VKR+TGQHPGGI+VVP   D+YDF+P  +PADD   +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++   IP  D +V  LF+ T+SL +K   I  + KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHG++VW +NA  LI      + DVI CRDDIMVYLI +G+   +AFKIME VRKGKGL+ E+ + +  N +P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++P+ FYA+YF++R   F++ +++ G + I  +I EI  K   A PK K+        ++ + ELALE+  RG+ F  +DL +S A++F VE + L+PPF A+ G+G + A SIV+AR++  F SKE+ ++R+K+T T ++ +++ G    + + +Q+SLF
  S:   136 ETEKEMMERRIMEPLQTLSEIFGFQGVLWGVAVHESKEEMQRFREERVQED-QLEVVEAMKEKRKQEDLAKDMQEKHAITHGTRIKDDPRPLKEIVEEEKRFTAQGLVFDAETRELKSGRTLLTFKITDYTDSISVKMFSNDKEDLPVFEAIKKGIWLKVRGPVQYDTF-SRDFAMMARDLEQV-KPVE--RQDTAPEGEKRVELHMHSTMSQMDAVTNVGRYVEQAKKWGHHAIAITDHAGAQAFPEAYSAGKK-NGIKIIYGVEANLVDDGVPIAYHPSDRDLMEDTYVVFDVETTGLSAVYNTIIELAAVKVQGGEIIDRFESFANPHEPLSPTIIDLTGITDDMVADAPEIHDVLKDFKAWCGNDILVAHNA-AFDMAFLDAGYQKAGMDKAANPVIDTLEMGRMLYPTFKNYRLNTLCKKFNIEL--VSHHRAIYDAEATGHLLWKMVRDAVEKGITTHSALNDQSSPDDYK-KQRPNHCTIYAKNAEGLKNLYKLVSKAHIDYFFRVPRLPKSVLVEHREGLLIGSACDQGEVFDGLMQKAPEEVESTAA-FYDFLEVMPPSNYQHLIEKEIIRDELELKSVIKNLIKLGETVNKPVVATGNVHYLNEEDHVYRKILIASQ--GGA-------NPLNRITLPKVHFRTTNEMLDCFSFLSEEKR-QEIVVTNSRKIADEID-EIKPIPDDLYTPHIEGADEEMRQMCYDRAKSIYGDPLPELVEKRLEKELTSIISNGFSVIYLISQKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPSCQYSYFFNDGSVGSGFDLPDKDCEKCGTPYEKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPVAHNYTKDLFGEDYVYRAGTITTVADKTAYGYVKGY-EGDMGMQLKGAEIDRLVSGCTGVKRSTGQHPGGIIVVPDHLDIYDFSPIQFPADDDGSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGMDPKDIPVDDPEVFKLFSGTESLGVKEEDI--MCKTGTFGIPEFGTRFVRQMLEETKPSTFSELVQISGLSHGSDVWLNNAADLIAAGTCELKDVIGCRDDIMVYLIYQGLEHSLAFKIMEFVRKGKGLDPEWIEEMKKNGVPDWYIQSCLKIKYMFPKAHAAAYVLMAIRIAYFKVHHPMMFYAAYFTVRADDFELDTMIRGSATIRKRIEEIYSKGLDATPKEKS--------VLTVLELALEMTMRGFSFKKVDLYRSKASEFQVEENALLPPFDALTGVGTNAALSIVEARKDGEFLSKENLRERSKITKTVLENLDDHGCLDGMPDTNQLSLF 1433
>gi|82750865|ref|YP_416606.1| DNA polymerase III PolC [Staphylococcus aureus RF122] >gi|123549060|sp|Q2YXK4|DPO3_STAAB DNA polymerase III polC-type (PolIII) >gi|82656396|emb|CAI80815.1| DNA polymerase III [Staphylococcus aureus RF122] (1438 aa)
Score = 2504, Expect = 0.0e+00, Identities = 530/1227 (43%), Positives = 790/1227 (64%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    I  L+  +S I + K+  + D A  KR E   HT M+  +G+ NI    K +++ G+ ++A+TD    Q FPD +  A+K+  +K IYG++  ++D   PI     D  + DATYV+FD+ETTGLS  Y+KIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +   NEIN  L N    +R R S +T+  +N+  ++NL+K++S SL   F   P++     +E+    +V  +  EGE+F A M   Q  +E I K  YDFI I  P  +   I RE+ +    + +  +R+I   +     V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ +EF FL +    ++IVV N+N +A  I+  + PIK+ L++P +EGA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   +FN + +V SGFDLP+  C  C + L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  YPADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F++ +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AFKIME VRKGKGL EE  + + +N +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RGY+   I L+KS A +F++EGD LIPPF ++ GLG++VA  IV+AR++  F SKED  K+  ++   ++ ++ELG   +L +  Q+S+F+
  S:   237 EFKVA-IEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLK-MFTRK-NKDDLEHFKALSVGKWVRAQGRIEEDTF----IRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKHG-IKMIYGMEGMLVDDGAPIAYKPQDVVLKDATYVVFDVETTGLSNQYNKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKLSNQDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQSQVEKIAK-YYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLNEFHFLGEEK-AHEIVVKNTNELADRIE-RVVPIKDELYTPRMEGANEEIRELSYANARKLYGEDLPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFN-DGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPGLGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFD 1437
>gi|49483427|ref|YP_040651.1| DNA polymerase III PolC [Staphylococcus aureus subsp. aureus MRSA252] >gi|56748683|sp|Q6GHH1|DPO3_STAAR DNA polymerase III polC-type (PolIII) >gi|49241556|emb|CAG40242.1| DNA polymerase III PolC-type [Staphylococcus aureus subsp. aureus MRSA252] (1438 aa)
Score = 2503, Expect = 0.0e+00, Identities = 528/1237 (42%), Positives = 794/1237 (64%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++  +  +  E     IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    I  L+  +S I + K+  + D A  KR E   HT M+  +G+ NI    K +++ G+ ++A+TD    Q FPD +  A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +   NEIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   F   P++     +E+    +V  +  EGE+F A M   Q  +E I K  YDFI I  P  +   I RE+ +    + +  +R+I   +     V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ +EF FL +    ++IVV N+N +A  I+  + PIK+ L++P +EGA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   +FN + +V SGFDLP+  C  C + L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  YPADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F++ +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AFKIME VRKGKGL EE  + + +N +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RGY+   I L+KS A +F++EG+ LIPPF ++ GLG++VA  IV+AR++  F SKED  K+  ++   ++ ++ELG   +L +  Q+S+F+
  S:   226 NIKPIESIIEEEYKVAIEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLK-MFTRK-NKDDLEHFKALSVGKWVRAQGRIEEDTF----IRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKHG-IKMIYGMEGMLVDDGVPIAYKPQDVVLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKLSNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQSQVEKIAK-YYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLNEFHFLGEEK-AHEIVVKNTNELADRIE-RVVPIKDELYTPRMEGANEEIRELSYANARKLYGEDLPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFN-DGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGETLIPPFISVPGLGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFD 1437
>gi|27467858|ref|NP_764495.1| DNA polymerase III PolC [Staphylococcus epidermidis ATCC 12228] >gi|32469713|sp|Q8CPG6|DPO3_STAES DNA polymerase III polC-type (PolIII) >gi|27315403|gb|AAO04537.1|AE016747_34 DNA polymerase III, alpha chain PolC-type [Staphylococcus epidermidis ATCC 12228] (1442 aa)
Score = 2498, Expect = 0.0e+00, Identities = 523/1227 (42%), Positives = 790/1227 (64%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI-KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    +  L+  +S I + K+  + D A  KR E   HT+M+  +G+ NI    + +++ G+ ++A+TD    Q FPD +N A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +    EIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   +   P++     NE+    ++  +  EGE+F A M   Q  +E I K  YDFI +  P  +   + RE+ +       I KR+I      N  V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ D+F FL +     +IVVTN+N +A+ I+  + PIK+ L +P ++GA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+++IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC++CK   F  + +V SGFDLP+  CP C ++L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+G+VK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  +PADD++  W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D + M +F+  +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI +    +S VI CRDDIMVYL+  G+ P +AFK ME VRKG+GL +E  + + +NN+P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YA+YF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RG++   I L+KS A DF++EGD LIPPF ++ GLG++VA  IV+AREE  F SKED  K+  ++   +  ++ELG    L +  Q+S+F+
  S:   241 EFKVA-IEGVIFDINLKELKSGRHIVELKVTDYTDSLVLK-MFTRK-NKDDLDHFKALSVGKWVRAQGRIEEDTF----VRDLVMMMSDIEEIKKTPKQDKAEDKRVEFHLHTSMSQMDGIPNISAYVEQAAKWGHQALAVTDHNVVQAFPDAHNAAEKHG-IKMIYGMEGMLVDDGVPIAYKPTDRNLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLTDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVNNHLEINKKLTNEDAYKRARPSHVTLIVQNQEGLKNLFKIVSASLVKYYYRTPRIPRSLLNEYREGILIGTACDEGELFTAVMQKDQSEVEKIAK-FYDFIEVQPPALYQDLMDRELIRDNETLTQIYKRLIDAGKSANIPVIATGNAHYLYEHDAIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLDDFHFLGEEK-AYEIVVTNTNELANKIE-KVVPIKDKLFTPRMDGANEEIRELSYSNAKKLYGEDLPQIVIDRLEKELDSIIGNGFSVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICSHCKTSEFFDDGSVGSGFDLPDKKCPTCGNELIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGFVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQFPADDQSAAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKETMQIFSGPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIRQGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKTMEFVRKGRGLTDEMVEAMKENNVPDWYLDSCRKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYAAYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGFRLQPISLEKSQAFDFIIEGDTLIPPFISVPGLGENVAQRIVEAREEGPFLSKEDLNKKAGLSQKVIDYLDELGSLPDLPDKAQLSIFD 1441
>gi|73919252|sp|Q5HPS7|DPO3_STAEQ DNA polymerase III polC-type (PolIII) (1438 aa)
Score = 2497, Expect = 0.0e+00, Identities = 523/1227 (42%), Positives = 790/1227 (64%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI-KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    +  L+  +S I + K+  + D A  KR E   HT+M+  +G+ NI    + +++ G+ ++A+TD    Q FPD +N A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +    EIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   +   P++     NE+    ++  +  EGE+F A M   Q  +E I K  YDFI +  P  +   + RE+ +       I KR+I      N  V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ D+F FL +     +IVVTN+N +A+ I+  + PIK+ L +P ++GA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+++IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC++CK   F  + +V SGFDLP+  CP C ++L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+G+VK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  +PADD++  W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D + M +F+  +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI +    +S VI CRDDIMVYL+  G+ P +AFK ME VRKG+GL +E  + + +NN+P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YA+YF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RG++   I L+KS A DF++EGD LIPPF ++ GLG++VA  IV+AREE  F SKED  K+  ++   +  ++ELG    L +  Q+S+F+
  S:   237 EFKVA-IEGVIFDINLKELKSGRHIVELKVTDYTDSLVLK-MFTRK-NKDDLDHFKALSVGKWVRAQGRIEEDTF----VRDLVMMMSDIEEIKKTPKQDKAEDKRVEFHLHTSMSQMDGIPNISAYVEQAAKWGHQALAVTDHNVVQAFPDAHNAAEKHG-IKMIYGMEGMLVDDGVPIAYKPTDRNLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLTDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVNNHLEINKKLTNEDAYKRARPSHVTLIVQNQEGLKNLFKIVSASLVKYYYRTPRIPRSLLNEYREGILIGTACDEGELFTAVMQKDQSEVEKIAK-FYDFIEVQPPALYQDLMDRELIRDNETLTQIYKRLIDAGKSANIPVIATGNAHYLYEHDAIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLDDFHFLGEEK-AYEIVVTNTNELANKIE-KVVPIKDKLFTPRMDGANEEIRELSYSNAKKLYGEDLPQIVIDRLEKELDSIIGNGFSVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICSHCKTSEFFDDGSVGSGFDLPDKKCPTCGNELIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGFVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQFPADDQSAAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKETMQIFSGPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIRQGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKTMEFVRKGRGLTDEMVEAMKENNVPDWYLDSCRKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYAAYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGFRLQPISLEKSQAFDFIIEGDTLIPPFISVPGLGENVAQRIVEAREEGPFLSKEDLNKKAGLSQKVIDYLDELGSLPDLPDKAQLSIFD 1437
>gi|57866746|ref|YP_188413.1| DNA polymerase III PolC [Staphylococcus epidermidis RP62A] >gi|57637404|gb|AAW54192.1| DNA polymerase III, alpha subunit, Gram-positive type [Staphylococcus epidermidis RP62A] (1436 aa)
Score = 2497, Expect = 0.0e+00, Identities = 523/1227 (42%), Positives = 790/1227 (64%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI-KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    +  L+  +S I + K+  + D A  KR E   HT+M+  +G+ NI    + +++ G+ ++A+TD    Q FPD +N A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +    EIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   +   P++     NE+    ++  +  EGE+F A M   Q  +E I K  YDFI +  P  +   + RE+ +       I KR+I      N  V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ D+F FL +     +IVVTN+N +A+ I+  + PIK+ L +P ++GA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+++IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC++CK   F  + +V SGFDLP+  CP C ++L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+G+VK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  +PADD++  W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D + M +F+  +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI +    +S VI CRDDIMVYL+  G+ P +AFK ME VRKG+GL +E  + + +NN+P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YA+YF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RG++   I L+KS A DF++EGD LIPPF ++ GLG++VA  IV+AREE  F SKED  K+  ++   +  ++ELG    L +  Q+S+F+
  S:   235 EFKVA-IEGVIFDINLKELKSGRHIVELKVTDYTDSLVLK-MFTRK-NKDDLDHFKALSVGKWVRAQGRIEEDTF----VRDLVMMMSDIEEIKKTPKQDKAEDKRVEFHLHTSMSQMDGIPNISAYVEQAAKWGHQALAVTDHNVVQAFPDAHNAAEKHG-IKMIYGMEGMLVDDGVPIAYKPTDRNLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLTDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVNNHLEINKKLTNEDAYKRARPSHVTLIVQNQEGLKNLFKIVSASLVKYYYRTPRIPRSLLNEYREGILIGTACDEGELFTAVMQKDQSEVEKIAK-FYDFIEVQPPALYQDLMDRELIRDNETLTQIYKRLIDAGKSANIPVIATGNAHYLYEHDAIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLDDFHFLGEEK-AYEIVVTNTNELANKIE-KVVPIKDKLFTPRMDGANEEIRELSYSNAKKLYGEDLPQIVIDRLEKELDSIIGNGFSVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICSHCKTSEFFDDGSVGSGFDLPDKKCPTCGNELIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGFVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQFPADDQSAAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKETMQIFSGPESLGVTEDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIRQGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKTMEFVRKGRGLTDEMVEAMKENNVPDWYLDSCRKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYAAYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGFRLQPISLEKSQAFDFIIEGDTLIPPFISVPGLGENVAQRIVEAREEGPFLSKEDLNKKAGLSQKVIDYLDELGSLPDLPDKAQLSIFD 1435
>gi|160915589|ref|ZP_02077800.1| hypothetical protein EUBDOL_01599 [Eubacterium dolichum DSM 3991] >gi|158432709|gb|EDP10998.1| hypothetical protein EUBDOL_01599 [Eubacterium dolichum DSM 3991] (1447 aa)
Score = 2496, Expect = 0.0e+00, Identities = 518/1232 (42%), Positives = 792/1232 (64%)
  Q:   225 LSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEA-----KKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQK-LQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTS----------LTSNFDGGPKVYWENFNEF--NNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNT---VLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE-SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD---YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + D+  E     I+G+IF+ +    +   +I   ++ D  D+IV+K      I K+VL E++ G +V A   ++ D +  +    L+    +I K  E  R D+A  KR EL  HT ++  +G+  I+E  + ++E G +++A TD    Q FP   ++      K+ +  K IYG++ N++D  + IV N  +  + + TY +FD+ETTGLS  +D IIEFG         ++S+Q+FI P   I   I  +T IS E V++A    E   +I DFIGDS+L+AHN   FD  FLN +L       + NP+IDTL ++R++ ++  G+ LG IAR Y I YDE  AHRAD DAE L N +  ML + K +Q++  L +    +QN     + R   +T+  KN   ++ L++L++ S           T N    P++  E   +   N + ++ +S   GE+F+ A +  ++ L  +++  YD+I +     + H + R+ I     +++ ++ I++ A K  K+++A+ D +Y + ++++   +Y++++ +GG R+ L+ YN+        P  +  TT E+  EF++L +       VVTN+N IA +I+  +KP+K+ L+ P IEG+  KL  + Y+ ++  +G  + + V+ R+ RE+ S+I +G+ ++Y+ SHLLVK+S++DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C  C Y  F  + +V  GFDLP+  CP C   ++GDGH+IPFETF+GF+GDK+PDIDLNFS  YQ  AH + K +FGE+ V+RAGTI T A +TA+GYVK Y EE   +   RNA++ R+AK CE VKRTTGQHPGGI+V+P   DV+DFTP  YPA++   DW TTH  F  +HD++LKFDILGH +PT ++ML   + V+  TIP  D + M +F+  D+LKI         KTG++G+PEFGT FV+ +L +T+P  F +L++ISGLSHGT+VW  NAK LI++   T+  VI CRDDIMVYL+ KG+ P +AF IME VRKGKGL +E+   +  + +  WYIESC KI Y+FPKAHATAYV+MA +IAWFK++ P ++Y  +FSIR   +DI++++ GE  I  ++N+I E++ N +TK  V  K+ D+    ELALE++ RGY F NIDL +S +++F+V+ D   YLIPPF++IDGLG++VA ++V+AR+   F SKED ++RT ++ T +K +E +G+   L +++Q+SLF
  S:   202 IHDITEECHDIRIKGKIFETEIRTLRNEKDIQMLWIADEQDAIVMKRFERGAITKEVLREIQTGDYVVAYGKVEYDNFTRD----LVFMPDVIEKVAEVKRIDDAEEKRVELHVHTKLSEMDGVCGIEEYIETANEWGMNAIACTDHLVVQAFPKAQHKVAAINKKRETPFKMIYGIEMNMVDPYLQIVRNVKEIGLEEGTYCVFDLETTGLSSRFDHIIEFGGQIVKDRTCIKSLQLFIKPPVPIPAHIVELTGISEEHVRNAKSFAECADQILDFIGDSILVAHNA-DFDYNFLNSELVRIGRKPLDNPVIDTLDLARSMQDR-KGYRLGQIARSYGIRYDEDVAHRADYDAEVLANTYMNMLNDLKHIQNLAALQD----MQNARSFTKVRAKHVTILVKNAAGLKELFELVTLSHTKYLSYSDKSTGNIVAEPRILREEIEKRRRNGNLLIGSSCLNGEVFDIAQTRGEEELLKVMQ-FYDYIELQPLGNYRHLVERDSIESMDRLKEILRSIVEAAKKCGKRIIASGDVHYAHPNEKMIRDIYISSQAIGGIRHPLYIYNQEKRRKFKSPDQHLLTTKEMLKEFAWLGEKEAYT-YVVTNTNAIADMIEV-VKPVKDRLYPPDIEGSDQKLIDICYENAHKKYGPNLPDIVEERLKRELDSIIGHGFYVVYYISHLLVKKSLNDGYLVGSRGSVGSSFVATMAEITEVNPLAPHYVCPKCHYVKFFTDGSVADGFDLPDIQCPNCGETIRGDGHDIPFETFLGFEGDKVPDIDLNFSGDYQPTAHAYTKEVFGEDHVYRAGTIGTVATQTAFGYVKGYQEEMGIEGGMRNAQVLRLAKGCEGVKRTTGQHPGGIIVIPLDLDVHDFTPVQYPANNPNADWKTTHFEFHDIHDNVLKFDILGHVDPTAMRMLQRISGVDPVTIPMNDPETMSIFSKVDALKIDTS--KACDKTGAAGLPEFGTKFVRGILELTEPTTFDELLKISGLSHGTDVWLGNAKDLIDQNICTLKSVIGCRDDIMVYLLHKGLEPKLAFTIMESVRKGKGLRDEWIPEMKKHGVEDWYIESCKKIKYMFPKAHATAYVMMAIRIAWFKVHLPQYYYCMFFSIRCDAYDIQTMIQGEQAIRRRMNDIDERLRNNETKRDVSKKDKDIYNTLELALEMVLRGYFFRNIDLNRSASSEFIVDPDNDHYLIPPFTSIDGLGENVADTVVEARKHGAFLSKEDLQRRTSLSGTLIKTLESMGVLEGLQDENQMSLF 1446
>gi|42560899|ref|NP_975350.1| DNA polymerase III alpha chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492396|emb|CAE76992.1| DNA polymerase III alpha chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] (1482 aa)
Score = 2489, Expect = 0.0e+00, Identities = 596/1414 (42%), Positives = 875/1414 (61%)
  Q:    45 IKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILD--EKTIDIISDHK--NKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSI-----------------VIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEA----KKYS---KLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYH-KGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRML-ENQKLQDIKTLNEINS----NLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEF--NNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNA--RNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVE-----GDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           + +     LP D+L    D L    ++  FN     D  NQ+   + LI ++   I+  +   + +     +  YN      +I+   +FL   +  + + I   L++    LN +GF    LSY+++  E ++D +   +  NK  +K + E   +K        ++S+  K           L D+  + +   I+G +   +  ++KTG +I+   +TD+  SI                     L  K+I +   ++++   W+  K    + +Y+   I   I++   I K +  +R D+A IKR EL  HT M+  +G+ +  +  +  S   + ++A TD  N Q FPD Y       KK S   K+KAIYG++ N+++ ++  V N  + K+ DA  V FD+ETTGLSP  D+IIEFGAI+Y+ K  + + I + I P+ K+      +T I+ + ++D   I++A  +I + I D++L+AHN   FD  FL+   E+     ++N +IDTL ISR I   +  H LG +A++  I YD + AHR D DA+ L +I++RML E +K   I T ++ N     N  ++    +N+G    +  KN+  ++ LYKL++ S T+NF   PK++ ++  +   NN+ +   S    EIFE A ++T + L+  I   YD+I +     + + +  +      +++ I  II IA + NK VVA+SD +Y N   +    VY+NAK LGG R+ LF +N      P  + RTT E+  EF +LND  L+N+IV+TNSN IA +ID+N+ PIK+ L +P I   ++KLK   YQ +  ++G+ +   V+ R+++E+ S+  +G+A++YW SHLLVKQS+DDGY+VGSRGSVGSS  A +  ITEVNPL+ HY C NCKY  FN +     G+DLPE NCP C  KL GDGH+IPFETF+GF GDK+PDIDLNFS  YQ +AH+F K MFGE  VFRAGTIST AEKTA+GYVK+YFEE+K+  +  R  EI R+AK  + VKRTTGQHPGGI+++P+  ++ DFTP NYPADD    W TTH  F S+HD+LLK DILGHD+PT LKML + TN++  TIP  D +V  LF+S  +L + +  IN  + TG+ GIPEFGT FV+ ML  T+P+ F+DL++ISGLSHGT+VW  NA+ LI++K   IS VI CRDDIMVYLI+ G+   +AF IME VRKGKGL +E+  V+   N+P WYI+SC KI Y+FPKAHATAYV+MA++IAW+KIYYP  +YA+Y + R  VFD+K++L G   +  K+   ++++ N +    +  KE DL  +YE+ LE+  RG KF+NID +KS AT F V+        +IPPF+ ID LG++VA SI+ AR  K  +S  D K RT+ T T +KI EE  I  SL+ D+Q++ F+F
  S:    44 LHVEIKDFLPIDVLKKIEDKLK---NNQYFNFKLIIDVKNQQFNKDLLIQYLEF-IKMHKSLFNNRASWKLLDIYNF----ELINNQLVFLVNSQTIKNE-ISLELDYCLAKLNQFGFKD--LSYLINVNEISLDTLDTKQQINKTYDKPEYEQQIIKPIEKKPSVNNSYKNKRPSLDKPSYNSLLDVEDDAQNIVIQGMVINKEFKLSKTGRKIFYIDITDFQSSIRCMYFAKSDALCEFDDLTEDELKSKEIEQIKENKIQINDWISVKGKTSLSVYDQEQIF-YIDDFKKIKK-QVGLRIDDAKIKRVELHAHTKMSVMDGVSDPIDYLELISSWNHKAIAFTDHTNVQAFPDIYKALNSVNKKRSDQDKIKAIYGLEMNMLNNDLWYVKNPKNQKLKDARMVFFDLETTGLSPELDEIIEFGAIEYNLKTGERKKIDILIKPKTKLKAFTQKLTNITEKMLEDKPSIEQAFKQINEIIKDAILVAHNA-NFDFTFLSYWSEKLGYSKLENTIIDTLTISRIIYPDLKSHRLGSLAKRVNISYDPSIAHRGDYDADILADIYERMLDETRKKIKIITDSDWNKIDPINYADNLNYYKNKGFHTNILVKNQAGLKELYKLVTKSHTTNFYSSPKIFKDDLIQIKQNNNLLFGASCVNSEIFELARTSTLENLKQAIS-FYDYIEVQPISVYKNLLQNDSLDLDQLKEIITNIINIAKQENKLVVASSDCHYTNPELKQIREVYINAKGLGGIRHPLFDFNNRVKDYPDQHLRTTKEMLKEFEWLNDDDLINEIVITNSNKIADMIDSNVIPIKDGLFTPKIANVNEKLKDKCYQTAKQMYGEMLPEIVEKRLEKELGSITKHGFAIVYWISHLLVKQSLDDGYLVGSRGSVGSSFVATMAQITEVNPLKAHYRCLNCKYSDFNTDPAYKCGYDLPEKNCPNCNQKLIGDGHDIPFETFLGFNGDKVPDIDLNFSGEYQNQAHNFTKKMFGENNVFRAGTISTVAEKTAFGYVKTYFEETKRDASLPRKTEINRLAKLAQGVKRTTGQHPGGIIILPNEYEIEDFTPVNYPADDLNSTWKTTHFDFHSIHDNLLKMDILGHDDPTALKMLRDLTNIDPITIPTDDKNVYSLFSSLQALNLTSDKINDEI-TGAIGIPEFGTGFVRNMLKETQPKTFADLVQISGLSHGTDVWLGNARDLIKDKKADISTVIGCRDDIMVYLINMGLESSLAFMIMESVRKGKGLKKEWIDVMKQYNVPDWYIDSCLKIKYMFPKAHATAYVLMAYRIAWYKIYYPTEYYATYLTTRADVFDLKTVLGGYDAVLLKLKSQQQRVKNGEK---LSKKEEDLEVVYEVLLEMFARGIKFSNIDFEKSEATKFKVDILQDNSKIIIPPFNVIDSLGEAVALSIINARNTKPITSVNDLKNRTQTTQTQIKIFEEFNILDSLSVDEQLA-FDF 1482
>gi|188159598|ref|ZP_02512644.2| DNA polymerase III alpha chain [Mycoplasma mycoides subsp. mycoides LC str. GM12] (1482 aa)
Score = 2487, Expect = 0.0e+00, Identities = 599/1414 (42%), Positives = 874/1414 (61%)
  Q:    45 IKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILD--EKTIDIISDHK--NKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSI-----------------VIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEA----KKYS---KLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYH-KGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRML-ENQKLQDIKTLNEINS----NLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEF--NNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNA--RNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVE-----GDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           + I     LP D+L    D L    ++  FN     D  NQE   + LI ++   I+  +   + +     +  YN      +I+   +FL   +  + + I   L++    LN +GF    LSY+++  E ++D +   +  NK  +K + E   +K       T++S+  K           L D+  + +   I+G +   +  ++KTG +I+   +TD+  SI                     L  K+I +   ++++   W+  K    + +Y+   I   I++   I K  + +R D+A IKR EL  HT M+  +G+ +  +  +  S   + ++A TD  N Q FPD Y       KK S   K+KAIYG++ N+++ ++  V N  +  + DA  V FD+ETTGLSP  D+IIEFGAI+Y+ K  + + I + I P+ K+      +T I+ + ++D   I++A  +I + I D++L+AHN   FD  FL+   E+     ++N +IDTL ISR I   +  H LG +A++  I YD + AHR D DA+ L +I++RML E +K   I T ++ N     N  ++    +N+G    +  KN+  ++ LYKL++ S T+NF   PK++ ++  +   NN+ +   S    EIFE A ++T + L+  I   YD+I I     + + +  +      ++  I  II IA + NK +VA+SD +Y N   +    VY+NAK LGG R+ LF +N      P  + RTT E+ +EF +LND  L+N+IV+TNSN IA +ID+N+ PIK+ L +P I   ++KLK   YQ +  ++G+ +   V+ R+++E+ S+  +G+A++YW SHLLVKQS+DDGY+VGSRGSVGSS  A +  ITEVNPL+ HY C NCKY  FN +     G+DLPE NCP C  KL GDGH+IPFETF+GF GDK+PDIDLNFS  YQ +AH+F K MFGE  VFRAGTIST AEKTA+GYVK+YFEE+KK  +  R  EI R+AK  + VKRTTGQHPGGI+++P+  ++ DFTP NYPADD    W TTH  F S+HD+LLK DILGHD+PT LKML + TN++  TIP  D +V  LF+S  +L + +  IN  + TG+ GIPEFGT FV+ ML  T+P+ F+DL++ISGLSHGT+VW  NA+ LI++K   IS VI CRDDIMVYLI+ G+   +AF IME VRKGKGL +E+  V+   N+P WYI+SC KI Y+FPKAHATAYV+MA++IAW+KIYYP  +YA+Y + R  VFD+K+ L G   +  K+   ++++ N +    +  KE DL  +YE+ LE+  RG KF+NID +KS AT F V+        +IPPF+ ID LG++VA SI+ AR  K  +S  D K RT+ T T +KI EE  I  SL+ D+Q++ F+F
  S:    44 LHIEIKDFLPIDVLKKIEDKLK---NNQYFNFKLIIDVKNQEFNKDLLIQYLEF-IKMHKSLFNNRSSWKLLDIYNF----ELINNQLVFLVNSQTIKNE-ISLELDYCLAKLNQFGFKD--LSYLINVNEISLDTLDTKQQINKTYDKPEYEQQIIKPIEKKPSTNNSYKNKRPSLDKPSYNSLLDVEDDAQNIVIQGMVINKEFKLSKTGRKIFYIDITDFQSSIRCMYFAKSDALCEFDDLTEDELKSKEIQQIKENKIQINDWISVKGKTSLSIYDQEQIF-YIDDFKKIKKQVD-LRIDDAKIKRVELHAHTKMSVMDGVSDPIDYLELISSWNHKAIAFTDHTNVQAFPDIYKALNSINKKRSDQDKIKAIYGLEMNMLNNDLWYVKNPKNQNLKDARMVFFDLETTGLSPELDEIIEFGAIEYNLKTGERKKIDILIKPKAKLKAFTQKLTNITEKMLEDKPSIEQAFKQINEIIKDAILVAHNA-NFDFTFLSYWSEKLGYGKLENTIIDTLTISRIIYPDLKSHRLGSLAKRVNISYDPSIAHRGDYDADILADIYERMLDETRKKIKIITDSDWNKIDPINYADNLNYYKNKGFHTNILVKNQAGLKELYKLVTKSHTTNFYAFPKIFKDDLIQIKQNNNLLFGASCVNSEIFELARTSTLENLKQAIS-FYDYIEIQPISVYKNLLQNDSLDLEQLKQIITNIINIAKQENKLIVASSDCHYTNPELKQIREVYINAKGLGGIRHPLFDFNNRVKDYPDQHLRTTKEMLNEFEWLNDDDLINEIVITNSNKIADMIDSNVIPIKDGLFTPKIANVNEKLKDKCYQTAKQMYGEMLPEIVEKRLEKELGSITKHGFAIVYWISHLLVKQSLDDGYLVGSRGSVGSSFVATMAQITEVNPLKAHYRCLNCKYSDFNTDPTYKCGYDLPEKNCPDCNQKLIGDGHDIPFETFLGFDGDKVPDIDLNFSGEYQNQAHNFTKKMFGENNVFRAGTISTVAEKTAFGYVKTYFEETKKDVSLPRKTEINRLAKLAQGVKRTTGQHPGGIIILPNEYEIEDFTPVNYPADDLNSTWKTTHFDFHSIHDNLLKMDILGHDDPTALKMLRDLTNIDPITIPTDDKNVYSLFSSLQALNLTSDKINDEI-TGAIGIPEFGTGFVRNMLKETQPKTFADLVQISGLSHGTDVWLGNARDLIKDKKADISTVIGCRDDIMVYLINMGLESSLAFMIMESVRKGKGLKKEWIDVMKQYNVPDWYIDSCLKIKYMFPKAHATAYVLMAYRIAWYKIYYPTEYYATYLTTRADVFDLKTALGGYDAVLLKLKSQQQRVKNGEK---LSKKEEDLEVVYEVLLEMFARGIKFSNIDFEKSEATKFKVDILQDNSKIIIPPFNVIDSLGEAVALSIINARNTKPITSVNDLKNRTQTTQTQIKIFEEFNILDSLSVDEQLA-FDF 1482
>gi|73662813|ref|YP_301594.1| DNA polymerase III PolC [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123642441|sp|Q49X49|DPO3_STAS1 DNA polymerase III polC-type (PolIII) >gi|72495328|dbj|BAE18649.1| DNA polymerase III alpha chain PolC-type [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (1438 aa)
Score = 2485, Expect = 0.0e+00, Identities = 523/1270 (41%), Positives = 805/1270 (63%)
  Q:   188 EKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           EK++    E  +  +  ++D S     +     +V ++  +  E   A +EG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L+  K    G WV+A+  I+ D +    +  L+  +S I + K+  + D A  KR E   HT+M+  +G+ NI +    +++ G+ ++A+TD    Q FPD ++ A+K + +K IYG++  ++D  +PI     D  +  ATYV+FD+ETTGLS  YDKIIE  A+K   G  ++  + F NP E++S+ I  +T IS++ + DA +I+E L + K ++GD++ +AHN   FD+ F++   E   +    N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    ++ +ML+  +   +    +IN++L N+   +R R + +T+  +N+  ++NL+K++S SL   +   P++     +E+    +V ++  EGE+F A M   Q  +E I K  YDFI +  P  +   I RE+ +    + +   R+I+  +  N  V+AT + +YLNE D +  ++ + A+  G   NR        + LPK +FRTTDE+ DE  FL +     ++VV N+N +A  I+  + PIK+ L +P +EGA+++++++ Y  + +++GD +   V  R+++E+ S+I NG+++IY  S  LVK+S++DGY+VGSRGSVGSS  A + +ITEVNPL PHYIC  CK   F  + +V SGFDLP+  C  C   L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FGE++VFRAGTI T AEKTA+G+VK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  +PADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D + M +F+S + L + +  I  + KTG+ G+PEFGT FV++ML  TKP  FS+L+RISGLSHGT+VW  NA+ LI      ++ VI CRDDIMVYL+  G+ P +AFK ME VRKGKGL ++  + + DN +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK++YPL++YASYF++R   FD+ S++  +  I N +N++  +  +      +  KE D + + E+  E+  RGY+   I L+KS A +F++EGD LIPPF A+ GLG++VA  IV+AR+E  F SKED  K+  ++   ++ ++ELG   +L +  Q+S+F+
  S:   193 EKLEKMKAEKAKQQDNNESDVSKCQIGKPIQVENVRQIDSIIEEEFKAAVEGVIFDINLKELKSGRHIVELKVTDYTDSLVLK-MFTRK-NKDDLAHFKALSVGKWVRAQGRIEEDTF----VRDLVMMMSDIEEIKKATKQDKAEDKRVEFHLHTSMSQMDGIPNISDYVDQAAKWGHKAIAVTDHNVVQAFPDAHSAAEK-NGIKMIYGMEGMLVDDGVPIAYKPKDCDLKTATYVVFDVETTGLSNQYDKIIELAAVKVKDGEIIDKFERFSNPHERLSETIKNLTHISDDMLVDAPEIEEVLTEFKSWVGDAIFVAHNA-SFDMGFIDTGYEHVGIGASTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYMFIKMLKQLEALGVHNHQDINTSLSNEDAYKRARPNHVTLIVQNQDGLKNLFKIVSASLVQYYYRTPRIPRSLLDEYREGILVGSACDEGEVFTAVMQKDQSQVERIAK-YYDFIEVQPPALYQDLIDRELVRDNETLHEIYNRLIRAGDVNNIPVIATGNAHYLNEHDAIARKILIAAQP-GNPLNR--------STLPKAHFRTTDEMLDELHFLGEEK-AYELVVQNTNDLADKIE-RVVPIKDELFTPRMEGANEEIREMSYDNAKALYGDDLPQIVIDRLEKELESIIGNGFSVIYLISQRLVKKSLNDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPECKQSEFFDDGSVGSGFDLPDKKCESCGCDLIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPEAHNYTKELFGEDKVFRAGTIGTVAEKTAFGFVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPVQFPADDQGSSWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKETMGIFSSPEPLGVTSDEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVRISGLSHGTDVWLGNAQDLIRSGKCDLASVICCRDDIMVYLMYNGLEPSLAFKTMEFVRKGKGLTDDMVEAMVDNEVPDWYLDSCRKIKYMFPKAHAAAYVLMAVRIAYFKVHYPLYYYASYFTVRASDFDLISMIKDKESIRNTVNDMYSRYMD------LAKKEKDTLTVLEIMNEMAQRGYRMQPISLEKSKAFEFIIEGDTLIPPFIAVPGLGENVAQRIVEARDEGPFLSKEDLNKKAGLSQKVIEYLDELGSLPNLPDKAQLSIFD 1437
>gi|23099048|ref|NP_692514.1| DNA-directed DNA polymerase III alpha chain [Oceanobacillus iheyensis HTE831] >gi|32469727|sp|Q8EQU6|DPO3_OCEIH DNA polymerase III polC-type (PolIII) >gi|22777276|dbj|BAC13549.1| DNA-directed DNA polymerase III alpha chain [Oceanobacillus iheyensis HTE831] (1428 aa)
Score = 2482, Expect = 0.0e+00, Identities = 531/1333 (39%), Positives = 827/1333 (62%)
  Q:   124 KKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILD---EKTIDIISDHKNKI----QEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNAL--IKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEI--KEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + P +S N I L      +   +KK LE   KF +D+  S   L Y L+   +   + + + ++K     Q+ +   + E ++    K             +  +   +  +  E +  T++G +F  +    ++G  +     TDY+DSI IK       +    + +K+G+WVKA+ SIQ DMY  N++  + ++I  I   +   R D+A    KR EL  HT M+  + +V+ + L + +++ G+ ++AITD    Q FPD +N  KK+  +K +YGV+ N++D  +PI  N  D  + + T+V+FD+ETTGLS  YD IIE  A+K   G  V+  + F NP   +S     +T I+++ V DA ++ + L     ++G+ +L+AHN   FD+ FLN   +    +   NP++DTL+++R +  ++  H L  + +   +D + TQ HRA  DAE   YLL  WK +++    ++I    E+N+++  +   +R+R    T+  + E  ++NLYKL+S +    F   P++      +     +V  +  +GE+FE  M  +++  E +  D YD+I +  PE + H I +++ +    I D +++++ + +K  K VVAT + +YL+E D+ Y ++ + ++      N L ++      LP   FRTT E+ + F FL +    N+IVV N+  +   I+  I P+K+ L +P+IEGA  +++ L Y K+  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHY+C +C +  F  + +V SGFDLP+ +CP C   L  DG +IPFETF+GFKGDK+PDIDLNFS  YQ +AH++ K +FG + V+RAGTI T AEKTAYGYVK Y  +++ +  +NAE+ R+ + C  VKRTTGQHPGGI+VVP  K++YDFTP  +PADD+  +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++   IP  D +VM +F+ T+SL +    IN   KTG+ G+PEFGT FV++ML  TKP+ F++L+ ISGLSHGT+VW  NA+ LI +    + DVI CRDDIMVYL+ KG+ P +AF IME VRKGKGL +E+   +  + +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK+++P+ FYA+YF++R   F++ +++ G   I  +I EI  K   A+PK K        +L+ + E++LE+  RG+ F  +DL +S ATDF+VEGD L+PPF+A+DGLG + A +IVKAREE  F SKED ++R+K++ T ++ ++  G    + + +Q+SLF
  S:   116 QAPEVSNNKIMLTARNEAEASALKKRLE--AKF-HDFCLSIGSLPYTLEVEVKTNTEAMQEFRDKKALEDQQLVMKTVQEKEKRDKDKSVPDQQPLAIGYKIQDEPITMDQIIDEERRITVQGYVFDAEVRELRSGRSLLIIKATDYTDSIQIKMFSKGDEDAAKFASVKKGMWVKARGSIQTDMY-TNELAMMAKDIHEIHVSQ---RMDDASEDKKRVELHTHTTMSQMDAVVSPEALVEQAAKWGHKAIAITDHAGVQGFPDAHNAGKKHG-VKVLYGVEANLVDDGVPIAYNEADRNLYEDTFVVFDVETTGLSAVYDTIIELAAVKIKGGEIVDRFESFANPHHALSQTTIDLTGITDDMVNDAPEVADVLKDFHTWMGNDILVAHNA-SFDMGFLNQGFQRIDYEKASNPVVDTLELARFLLPELRNHRLNTLCKH--LDIELTQHHRAIYDAEATGYLL--WK-LVQRLVEKEISNHLELNNHMGENNAYQRSRPYHCTLIAQTEEGLKNLYKLVSRAHIDFFYRVPRLPRSVLQKHREGILVGTACDKGEVFETMMQKSEEEAEQV-ADFYDYIEVQPPENYTHLIEKDLVQNESQILDILRKLVNLGDKMKKTVVATGNVHYLHEHDKQYRQILIGSQA----GNPLSRHK-----LPDTPFRTTTEMINCFHFLGEKK-ANEIVVDNTQKLTDSIE-EISPVKDGLFTPNIEGAEQEMRDLCYNKAKEVYGEPVPQIVVDRLEKELESIIGNGFAVIYLISQKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLVPHYVCKHCHHHEFFTDGSVASGFDLPDKDCPGCGKGLTKDGQDIPFETFLGFKGDKVPDIDLNFSGDYQPRAHNYTKELFGIDNVYRAGTIGTVAEKTAYGYVKGYASDNQFV-YKNAEVDRLVQGCTGVKRTTGQHPGGIIVVPSDKEIYDFTPIQFPADDRNSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGMDPKNIPTDDEEVMKIFSGTESLGVTPEQIN--CKTGTLGVPEFGTKFVRQMLEDTKPKTFAELLIISGLSHGTDVWLGNAQELINDGICQLPDVIGCRDDIMVYLMHKGLDPSMAFTIMEFVRKGKGLKDEWIDEMKKHAVPDWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHPILFYAAYFTVRADDFELDTMIKGSDAIRKRIEEITVKGNDASPKEK--------NLLTVLEISLEMCERGFSFKKVDLYQSSATDFIVEGDSLLPPFNAVDGLGTNAALNIVKAREEGEFLSKEDLRERSKISKTVLEYLDNHGCLEGMEDKNQLSLF 1428
>gi|12044881|ref|NP_072691.1| DNA polymerase III PolC [Mycoplasma genitalium G37] >gi|1352298|sp|P47277|DPO3_MYCGE DNA polymerase III polC-type (PolIII) >gi|3844641|gb|AAC71247.1| DNA polymerase III, alpha subunit, Gram-positive type [Mycoplasma genitalium G37] >gi|166078825|gb|ABY79443.1| DNA polymerase III, alpha subunit, Gram-positive type [synthetic Mycoplasma genitalium JCVI-1.0] (1451 aa)
Score = 2474, Expect = 0.0e+00, Identities = 539/1267 (42%), Positives = 800/1267 (63%)
  Q:   191 KNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYS--DSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDIT-GLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNL----QNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDAN-IKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKC--KSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMN-ARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           KNE     ++    + D  F  K   +    + K++    ++K   I G+IF++    + TG +    +VTD+    S+++K  +    ++  +  +  G W+KA I ++ D   N  I  G++ EI+ +  P  + R D +  KR ELV HT MTAF+G+ +I+E  +F+ E G+ ++ +TDK N   +P FY  AKKY  LKAIYG++FN+ D +I IV N ++TK+SDAT+VIFDIETTGL   YD +IEF A K     +++  Q F+  ++ I   I  ITKI++E ++  +  ++ L KI++++ D V++AHNGI FDLPFL  + E+  +  + NPLIDTL +S A+N     H+L  I  K K+++D+ + HRA+ D E L  ++    +  K   I TL EI+ NL    Q D ++     + I VY KN+   +NLY+++S +LT +    P V   +  +F  SF+++ +  +G+IF+AA++     LE  I +K DF+ I  P  +L    RE  K+  I DAIK +IK A K  K V   SD Y+++  +  Y++  V AK LGGK +R F   E    +P+ +  TTDE+    SFL + +    +VV N+N I  L+D N + P K  L+ P ++ ++ KL    ++++   +G  +   +K RI++E++++I NG+ +++W SHLLV+QSV DGY VG RGS+GSS+ A L+ I+E+NPL  HY+C  C YF    +VD G+DL   +CPKC  K+  KGDGHNIPF TFMGF GDKIPDIDLNFS+ YQ KAHD+++ +FG    FRAGTI+T AEKTAYGY ++YFE  K+++ A  AEI R  +K   +KRTTGQHPGGI++ P    VY+FTP  +PADD   +W TTH  +++L D++LK DILG D+PT+LK L + T +N   IP+FD +++ +F+S   L +K  +++++  TG+ GIPEFGT FV+++L  TKP+ F+DLIR+SGLSHG NVW DNA+ LI+   LT+ DVI+CRDDIM+YLI+KG+    AF+IME VRKG  +N +   ++ +  +  ++I +C KI+YLFPKAHA AYV+MAW+IAWFK+Y+PL +YA   S ++K  DI     G   I N+++E+ +     K    +K KE +L+  YE+ LE++ R  K   I ++ S A  F+     LI PF  I G+G++VA+SIV+AR EK F+S  DFKKRTK+T  H++ ME+L +       D   LFN
  S:   192 KNESKLKVKAVTVSQYDKQFETKVFATEFIPIHKINQQIDDVK---IIGQIFELKTHESLTGKKTLNIYVTDFQLGGSLILKWSY---TDEKKIEGITIGNWIKAHIQVERD--PNTQILYGIVREINPVEIPNNYKRLDLSKQKRVELVFHTKMTAFDGINDIEEYAQFAKERGWKAITVTDKDNIHIYPKFYEVAKKYD-LKAIYGLEFNLTDDHIKIVHNPDNTKLSDATFVIFDIETTGLHGRYDDVIEFSARKIKNNSEIDHQQFFLKIDKPIPKTITEITKITDEMLEGGIDQQQGLEKIRNYLDDCVMVAHNGINFDLPFLQTQFEKYNIKPLTNPLIDTLCLSWALNPLFSSHTLSNICSKLKLEFDDERLHRAEYDTEALKKVFFYFKKQLKEMGINTLTEIDQNLNKKCQIDLMKRVFTNTAI-VYVKNQRGFQNLYEMLSIALTDHNANRPLVLASSLAKFRKSFLLTENPVQGDIFKAALTKPINELEKAI-EKVDFVLISQPNAYLGYTLREGLKKELINDAIKLVIKTATKLKKLVAVASDAYFIHPWENEYYKAIVCAKGLGGKWHRHFNNKEKEQTVPEVFLHTTDEMLKRMSFLGEDIAYK-LVVENTNKIVKLLDLNELVPTKNKLYPPVMQDSNQKLIDKTWKQAEKRYGKNLPKLIKERIEKELNAIISNGFGIVFWISHLLVEQSVKDGYFVGPRGSIGSSLIANLIGISEINPLAAHYLCEQCHYFEVSDSVDDGYDLMIRDCPKCHEKASFKGDGHNIPFATFMGFSGDKIPDIDLNFSSEYQAKAHDYVRKLFGVNNTFRAGTIATVAEKTAYGYARNYFEIIKRVDLATTAEIERFKQKLIGIKRTTGQHPGGIMIFPSDHSVYEFTPCGFPADDVESEWKTTHFEYDALGDAILKLDILGQDDPTMLKHLADLTKINPQNIPHFDKNLISMFSSNKPLNLKPGIVDEV--TGAVGIPEFGTKFVRKILEQTKPKDFADLIRVSGLSHGKNVWADNAQKLIKSNRLTLRDVIACRDDIMLYLINKGMQAKDAFEIMEKVRKGIKVNAKEVSLMQNCGVEQYWINACLKINYLFPKAHAAAYVLMAWRIAWFKLYHPLSYYACLLSFKLKEHDINGFEKGYEFIKNRLDELNKLYRIKK----IKPKEAELLTSYEVYLEMMARNIKLQQISIQNSNARMFVEHNGVLIAPFITIPGMGEAVASSIVEARNEKPFASLNDFKKRTKITKKHVETMEQLQLFDEFEHQDDHKLFN 1451
>gi|183508608|ref|ZP_02958116.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182676065|gb|EDT87970.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 14 str. ATCC 33697] (1442 aa)
Score = 2468, Expect = 0.0e+00, Identities = 565/1340 (42%), Positives = 851/1340 (63%)
  Q:   117 LKYNMGIKKPI--ISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK---TIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALF--GKKINKDVLSELKEGVWVKAKISIQID-MYENNDI-TGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNA--RNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++YN  +   I  I++  I+ H++ N  E  I   L+ +    +++     +LS +L+EK    ++ I  H  + Q+ ++ +I++ +   N +KT+  F Y ++      +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I      G+   K  L ELK    ++A+I I +D M ++  +  G I++I  +            +  R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q +P+    +KK   LK IYG++   ++  IP+VLN  D  + +ATYVIFDIETTGL P +D+IIEFGA+      Q+ E IQ F+ P ++I++ +  +T IS E V +A+  K AL+KIK+   D +L+AHNGI FD+ F+N +L +  ++ +KNP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K M +N    D  I  LNEIN+ LQ   LR R+ G+ I +Y KN+  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S   + ++ +I+ +YDFIT+ S     H ++ +      ++ A K++I +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE+   +P   +       DE ++L D  L+N I+  N  +I S  D +I+P+K+ L++P +EG   K    +Y  +  I+G+ +   V+ RI +E++S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C NCK   F  N D GFDL   +C +C++ +  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T A+ +A   VK YFE     N   R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM  F+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  +P WYIES NKI Y+FPKAHATAYV+ AWK AW+KIYYPL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  E + +IPPF AI GLG++VA SI++AR +K+FS+ ED K RTK++ T +K +  LG+   L+E +Q++LF
  S:   106 IEYNSNLNSLILKINDKLIYDHFIANKLE--ILNILKVWSLPYSNFEIHFENLSSLLNEKHEQAVNEIISHHIQQQKHLEQQISQQQNFYNNQKTN--FNY-YKNPSNKTITKLVDINPLMNNAKIQAYVFLKKIDVLKSGAIAYKLNVIDDSETLTIMTYLPSGEHPLKKFLDELKIDQLIEAEIDIVLDNMSKSGQVPIGKIKKIYCVEDKYA----KKQITPRLELNFHTKMSSLDAIISTQELIDFAVKNQLKTIGITDRNVVQAYPEIAKFSKK-QDLKIIYGLETEELEDQIPLVLNVRDQNLDNATYVIFDIETTGLFPNFDEIIEFGAVIMQNNKQIGEKIQFFVKPIQQINENVTNLTNISQEMVNNAIDEKTALLKIKEIFDDHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEIAHRADYDAIVLTDVFKVM-KNNLFNDFGITNLNEINTKLQTTMLRNRSFGNWINLYIKNQANVKDMYELVSISHTDMYYTRPTITTGFLANKKDKLIISNSIHESDLINALYSKNDEEIKRLIQ-RYDFITLPSLGSQKHLVYAKKITIENVQKAFKKLIYLALELNKIIIYSSSPYYFFKDDKKFYDVYVNTKGLEGKAHRF--ANEV--YVPDLEYIDQKNAIDELAYLEDEKLINLIINENPVHINSWFDDSIQPLKKGLYAPKMEGVDQKTIDYVYHTAKKIYGENLPTIVEQRIKKELNSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLTPHYLCPNCKKCEFITNADDGFDLAPKSCEQCQTPMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAQTSAENTVKKYFENRFSENKIIRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDERDVPMYDPLVMKSFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQIILKELKVPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYYPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKENNAIIPPFIAIQGLGETVANSIIEARNQKVFSTIEDLKNRTKISRTDLKNLRALGVLDHLSETEQLTLF 1442
>gi|188518224|ref|ZP_03003759.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188998138|gb|EDU67235.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (1442 aa)
Score = 2467, Expect = 0.0e+00, Identities = 551/1284 (42%), Positives = 824/1284 (64%)
  Q:   173 EKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E+ ++ I +H  + +++++ +I +     N +K  S+F Y ++ +    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T IS E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ +KNP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   165 EQAVNEIINHHIQQKKQLEQQINQQLDYQNNQK--SNFNY-YKNTSNKTITKLIDINPLMNNAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKIDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEEQIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAQKMTLENVQKAFKKLVSLALESNKPIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|70726651|ref|YP_253565.1| DNA polymerase III PolC [Staphylococcus haemolyticus JCSC1435] >gi|123660050|sp|Q4L5W6|DPO3_STAHJ DNA polymerase III polC-type (PolIII) >gi|68447375|dbj|BAE04959.1| DNA polymerase III alpha chain PolC-type [Staphylococcus haemolyticus JCSC1435] (1438 aa)
Score = 2463, Expect = 0.0e+00, Identities = 555/1377 (40%), Positives = 855/1377 (62%)
  Q:    81 DTYNQ-EDILNYLIYFVNHN-IEQKQKGTSEKKELLY---VLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKT-IDIISDHKNKIQEKIK------NEITEVKRSSNAKKTDSSFTY----KFRKSVTGDVTK-LSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           DT NQ E  + Y  + + H  +  K KG  ++K L+    VLK        +++ N I  ++ +   + C    ++ FRK     GF    + +  D+ +  D ++  +  IQE+ +       E  E  ++  AK+ D++ +     +  K +  D  K +  +  E     IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    +  L+  ++ I + K+  + D A  KR E   HT+M+  +G+ NI      +++ G+ ++A+TD    Q FPD +  A+K + +K IYG++  ++D  +PI     D  + +ATYV+FD+ETTGLS  YD+IIE  A+K   G  ++  + F NP EK+S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +    +IN  L N+   +R R + +T+  + +  ++NL+K++S SL   +   P++     NE+    +V  +  EGE+F A M   Q  +E I K  YDFI +  P+ +   I RE+ +    + +  +RI+K        V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ DEF FL +    ++IVV N+N +A  I+  I PIK+ L +P ++GA++++++L Y  +  ++G+ +   V  R+++E++S+I NG+++IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   F  + +V SGFDLP+  C  C ++L  +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K C  VKRTTGQHPGGI+VVP   D+YDFTP  YPADD++  W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D + M +F+S +SL +    I  + KTG+ G+PEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      +S VI CRDDIMVYL+  G+ P +AFK ME VRKGKGL EE    + +NN+P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  +  I N + ++  +  +      +  KE D++ + E+  E+  RG++   I L+KS A DF++EGD LIPPF ++ GLG++VA  IV+ARE+  F SKED  K+  ++   ++ +++LG   +L +  Q+S+F+
  S:    84 DTSNQDEHAIKYFGHCIEHTALSPKVKGQLKQKRLIMSGNVLK--------VMTSNDIERNHFD---KVCNGSLVKAFRKC----GFDIDKVVFETDDSSSYDDLASLEAHIQEEDEKSAREATEKIEKIKAEKAKQQDNNESNVDKCQIGKPIQIDNIKPIESIIEEEFKVAIEGVIFDINLKELKSGRHIVELKVTDYTDSLVLK-MFTRK-NKDDLDHFKALSVGKWVRAQGRIEEDTF----VRDLVMMMTDIEEIKKTPKQDKAEEKRVEFHLHTSMSQMDGIPNISAYVNQAAKWGHKAIAVTDHNVVQAFPDAHGAAEK-NGIKMIYGMEGMLVDDGVPIAYKPTDRDLKEATYVVFDVETTGLSNQYDQIIELAAVKVKDGEIIDKFERFSNPHEKLSETIINLTHITDDMLTDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTESTAYIFIKMVQQMKELGVTNHKDINQKLSNEDAYKRARPTHVTLIVQTQEGLKNLFKIVSASLVKYYYRTPRIPRSLLNEYREGILVGTACDEGELFTAVMQRDQSEVEKIAK-YYDFIEVQPPKLYQDLIDRELIRDTETLYEIYERILKAGESTGIPVIATGNAHYLYEHDAIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLDEFHFLGEEK-AHEIVVKNTNELADRIEKVI-PIKDQLFTPRMDGANEEIRELSYTNAKKLYGEDLPQIVIDRLEKELASIIGNGFSVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFDDGSVGSGFDLPDKQCSTCGAELIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQSASWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKETMQIFSSPESLGVTEEEI--LCKTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIRSGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKTMESVRKGKGLTEEMIDAMKENNVPDWYLDSCLKIKYMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKESIKNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGFRMQPISLEKSQAFDFIIEGDTLIPPFISVPGLGENVAKRIVEAREDGPFLSKEDLNKKAGLSQKIIEYLDDLGSLPNLPDKAQLSIFD 1437
>gi|171920237|ref|ZP_02690314.2| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902634|gb|EDT48923.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 1 str. ATCC 27813] (1442 aa)
Score = 2463, Expect = 0.0e+00, Identities = 568/1340 (42%), Positives = 854/1340 (63%)
  Q:   117 LKYNMGIKKPI--ISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYIL----DEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALF--GKKINKDVLSELKEGVWVKAKISIQID-MYENNDI-TGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNA--RNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++YN  +   I  I++  I+ H++ N  E  I K L+ +    +++     +LS +L    ++   DII++H  + Q+ ++ +I++ +   N +KT+  F Y ++ S    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I      G+   K  L ELK    ++A+I I +D M ++  +  G I++I  I    E       +  R EL  HT M++ +G+++ +EL  F+ +    ++ ITD+   Q +P+    +KK   LK IYG++   ++  IP+VLN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T IS E V +A+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ +KNP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L + +K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ II+ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C NCK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T A+ +A   VK YFE     N   R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM  F+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  +P WYIES NKI Y+FPKAHATAYV+ AWK AW+KIYYPL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K+FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   106 IEYNSNLNSLILKINDKLIYDHFIANKLE--ILKILKVWSLPYSNFQIHFENLSSLLNKNHEQAVNDIINNHIEQ-QKHLEQQISQQQNFYNNQKTN--FNY-YKNSSNKTITKLVDINPLMNNAKIQAYVFLKKIDVLKSGAIAYKLNVIDDSETLTIMTYLPSGEHPLKKFLDELKIDQLIEAEIDIVLDNMSKSGQVPIGKIKKIYCI----EDKHAKKQITPRLELNFHTKMSSLDGIISAQELIDFAVKNQLKTIGITDRNVVQAYPEIAKFSKK-QDLKIIYGLETEELEDQIPLVLNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMVNNAIDEKTALLKIKEIFDNHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADAFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIIQ-RYDFITLPSIGSQKHLVYVKKITLENVQKAFKKLVSLALELNKIIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLTPHYLCPNCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAQTSAENTVKKYFENRFNENKIIRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDERDVPMYDPLVMKSFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQIILKELKVPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYYPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFIAIQGLGETVANSIIEARNQKVFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|13357937|ref|NP_078211.1| DNA polymerase III PolC [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762156|ref|YP_001752460.1| DNA polymerase III, alpha subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|13959349|sp|Q9PQB4|DPO3_UREPA DNA polymerase III polC-type (PolIII) >gi|11279168|pir||C82898 DNA polymerase III alpha chain 1 UU377 [imported] - Ureaplasma urealyticum >gi|6899360|gb|AAF30786.1|AE002135_2 DNA polymerase III alpha chain 1 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827733|gb|ACA32995.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 3 str. ATCC 27815] (1442 aa)
Score = 2461, Expect = 0.0e+00, Identities = 564/1340 (42%), Positives = 852/1340 (63%)
  Q:   117 LKYNMGIKKPI--ISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK---TIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALF--GKKINKDVLSELKEGVWVKAKISIQID-MYENNDI-TGLIEEISIISKPKEFIRH-DNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNA--RNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++YN  +   I  I++  I+ H++ N  E  I   L+ +    +++     +LS +L+EK    ++ I  H  + Q+ ++ +I++ +   N +K  ++F Y ++      +TKL D+   M  A I   +F     + K+G   YK  V D S+++ I      G+   K  L ELK    ++A+I I +D M ++  +  G I++I  +       +H    +  R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q +P+    +KK   LK IYG++   ++  IP+VLN  D  + +ATYVIFDIETTGL P +D+IIEFGA+      Q+ E IQ FI P ++I++ +  +T IS E V +A+  K AL+KIK+   D +L+AHNGI FD+ F+N +L +  ++ +KNP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K M +N    D  I  L+EIN+ LQ   L+ R+ G+ I +Y KN+  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S   + ++ +I+ +YDFIT+ S     H ++ +      ++ A K++I +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE+   +P   +       DE ++L D  L+N I+  N  +I S  D +I+P+KE L++P +EG   K    +Y  +  I+G+ +   V+ RI +E++S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C NCK   F  N D GFDL   +C +C++ +  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T A+ +A   VK YFE     N   R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM  F+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  +P WYIES NKI Y+FPKAHATAYV+ AWK AW+KIYYPL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  E + +IPPF AI GLG++VA SI++AR +K+FS+ ED K RTK++ T +K +  LG+   L+E +Q++LF
  S:   106 IEYNSNLNSLILKINDKLIYDHFIANKLE--ILNILKVWSLPYSNFEIHFENLSSLLNEKHEQAVNEIISHHIQQQKHLEQQISQQQNFYNNQK--ANFNY-YKNPSNKTITKLIDINPLMNNAKIRAYVFLKKIDILKSGAIAYKLNVIDDSETLTIMTYLPSGEHPLKKFLDELKIDQLIEAEIDIVLDNMSKSGQVPIGKIKKICCVED-----KHVKKQITPRLELNFHTKMSSLDAIISTQELIDFAVKNQLKTIGITDRNVVQAYPEIAKFSKK-QDLKIIYGLETEELEDQIPLVLNVRDQNLDNATYVIFDIETTGLFPNFDEIIEFGAVIMQNNKQIGEKIQFFIKPIQQINENVTNLTNISQEMVNNAIDEKTALLKIKEIFDDHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDESAHRADYDAIVLADVFKVM-KNNLFNDFGITNLSEINTKLQTTMLKNRSFGNWINLYIKNQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSIHESDLINALYSKNDEEIKRLIQ-RYDFITLPSLGSQKHLVYAKKITIENVQKAFKKLIYLALELNKIIIYSSSPYYFFKDDKKFYDVYVNTKGLEGKAHRF--ANEV--YVPDLEYIDQKNAIDELAYLEDEKLINLIINENPVHINSWFDDSIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGENLPTIVEQRIKKELNSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLTPHYLCPNCKKCEFITNADDGFDLAPKSCEQCQTPMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAQTSAENTVKKYFENRFNENKIIRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDERDVPMYDPLVMKSFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQIILKELKVPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYYPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKENNAIIPPFIAIQGLGETVANSIIEARNQKVFSTIEDLKNRTKISRTDLKNLRVLGVLDHLSETEQLTLF 1442
>gi|172057851|ref|YP_001814311.1| DNA polymerase III, alpha subunit [Exiguobacterium sibiricum 255-15] >gi|171990372|gb|ACB61294.1| DNA polymerase III, alpha subunit [Exiguobacterium sibiricum 255-15] (1431 aa)
Score = 2460, Expect = 0.0e+00, Identities = 517/1299 (39%), Positives = 808/1299 (62%)
  Q:   160 YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNE-ITEVKR--------SSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLE-NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           YGF K      + E  + +    + +++ ++K E I E KR          +    +     +  K +  +V  +  +  E +   I G +F  +    ++G  I+ + +TDY+DS+V+K     + +  +LS +K+G+W++    ++ D +   D+  +I ++S +    E      A  KR EL  H+ M+  + ++N+ +  + ++  G+ +VAITD    Q+FPD Y   KK + +K +YG++ N+++  + +  +  D ++  AT+V+FD+ETTGLS  Y+KIIE  A+K + G  ++  + F +P+  +S     +T I++E V+     ++ + +  D+ G S+L+AHN   FD+ FLN  L     +    P+IDTL+++R +   +  H L  +A+++ I+   TQ HRA  DAE    +  ++L+   ++ ++KT   +N  +  D  R R   +  TVY KN   ++NLY+LIS + T +     +          +  I+ ++   GE+F+AA++ + + L  +++  YDFI I  P  + H I REI +    + + IK++I++A + +   VAT + +YL++ D  Y  V +  +   G  N L     +   LP  +FRTT E+  +F FL  P +   +V+TNS  +A   + NI  I + L +P IEGA ++++ L Y  ++ I+GD +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+DDGY+VGSRGSVGSS+ A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+  C  C   L  DGH+IPFETF+GFKGDK+PDIDLNFS  YQ KAH + K +FG++ V+RAGTI T AEKTAYGYVK Y  E+  +N RNAE+ R+      VKRTTGQHPGGI+VVP   D+YD +P  +PADD   +W TTH  F S+HD+LLK DILGHD+PT+++ML + +  +  TIP  D +VM +F+ST+S+ +    I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA  LI      + DVI CRDDIMVYLI  G+ P +AFKIME VRKGKGL+ E ++ + +N++P WYI+SC KI Y+FPKAHA AYV+MA +IA++K+++P+++YASYF++R   FDI ++  G + +   + +IK+K      +A  K+K   L  + E+ALE++ RG+ F+ +DL KS A++FL++GD L+PPF A+ GLG + A  IV+AR+   F SKED +KR K++ + ++ ++ LG    L +++Q+SLF+ 
  S:   153 YGFPK-----FVCEPVVQMDQTEQEELRNQVKQEDIDEAKRMLELQFKREQSRDDDEGPIDIRIGKPIQDEVVPIKTIQDEERRIAIRGLVFAAESRELRSGKTIFTFKLTDYTDSLVVKMFARDETDVKILSAIKKGMWIQVAGRVEFDTFLR-DLCMMIAQLSEVKM--ELPADPWAGEKRVELHAHSQMSQMDAVMNVTKYVERAAAWGHPAVAITDHAGAQSFPDAYYAGKK-NDIKILYGIEANVVNDGVQVAYHPVDQELEKATFVVFDVETTGLSAMYNKIIELAAVKIYDGDVIDKFEAFADPKHLLSATTIDLTGITDEMVRGKPDPEQVVKEFMDWAGGSILVAHNA-SFDIGFLNATLRSGNHEESTLPVIDTLELARVLMPSLKNHRLNTLAKRFDIEL--TQHHRAIYDAEATGYLMLKLLQMADEMFNMKTHLSLNREMGKDISRARPYHA--TVYAKNRTGLKNLYQLISLAHTKHVHRVVRTPRSQLVAHRDGLIIGSACDNGEVFDAALNKSDEDLAKVMR-FYDFIEIQPPAMYGHLIEREIVQNELELRELIKKVIRVAEENDILPVATGNVHYLDQHDATYREVLIRTQ---GGANML----NMRKQLPPAHFRTTQEMMSDFKFLG-PDVSERLVITNSQQVAGWFE-NIDIIPKDLFTPKIEGADEEVRSLSYDMAHQIYGDVLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSLVATMTEITEVNPLPPHYVCPNCKESEFFDDGSVGSGFDLPDKTCKTCDVPLIKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPKAHAYTKVLFGDDYVYRAGTIGTIAEKTAYGYVKGYQSEND-LNYRNAEVDRLVSGVTGVKRTTGQHPGGIIVVPDYMDIYDISPIQFPADDMGSEWKTTHFDFHSIHDNLLKLDILGHDDPTMIRMLQDLSGRDPKTIPVDDAEVMKIFSSTESIGVTPEQIDS--KTGTLGIPEFGTKFVRQMLEETKPTTFSELVQISGLSHGTDVWLGNASELIYNGTCELKDVIGCRDDIMVYLIYAGLEPSLAFKIMESVRKGKGLSIEMEEAMIENHVPLWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYYKVHHPMYYYASYFTVRAGDFDIGAMNKGSAAVRKVLQDIKDK----GFEATAKDK--GLYTVLEIALEMIERGFTFSKVDLYKSSASEFLIDGDALLPPFDAVTGLGTNAAKQIVEARKGGEFLSKEDLQKRAKLSKSIIETLDNLGCLEGLPDENQLSLFDL 1431
>gi|188024469|ref|ZP_02997117.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188018579|gb|EDU56619.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 7 str. ATCC 27819] (1442 aa)
Score = 2460, Expect = 0.0e+00, Identities = 550/1284 (42%), Positives = 823/1284 (64%)
  Q:   173 EKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E+ ++ I +H  + +++++ +I +     N +K  S+F Y ++ +    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T IS E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ +KNP IDTL I RAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   165 EQAVNEIINHHIQQKKQLEQQINQQLDYQNNQK--SNFNY-YKNTSNKTITKLIDINPLMNNAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKIDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEEQIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLKNPSIDTLMILRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAQKITLENVQKAFKKLVSLALESNKPIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|125718854|ref|YP_001035987.1| DNA polymerase III PolC [Streptococcus sanguinis SK36] >gi|166217455|sp|A3CQI2|DPO3_STRSV DNA polymerase III polC-type (PolIII) >gi|125498771|gb|ABN45437.1| DNA polymerase III polC-type, putative [Streptococcus sanguinis SK36] (1462 aa)
Score = 2454, Expect = 0.0e+00, Identities = 515/1317 (39%), Positives = 833/1317 (63%)
  Q:   141 DQEKCIKKYLEHFRKFLNDYGFSK-----HHLSYILDEKTIDIISDHKNKIQ---EKIKNEITEVKRSSNAKKTDSSFTYKFRKSVT------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIIS--KPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKY--NELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           D E   K +L +  + L  YGF +      H   +  ++  +  +++   +Q   E+    +  +++ +   +   ++ ++ RK+         ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+G W++ + +++++ +   D+T  ++++  ++  + K+ +       KR E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  D ++SDATYV+FD+ETTGLS  Y+ +I+  A K HKG  +     FINP   +S     +T I++E V++A  +++ L + ++F  DSVL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + ++++I  +    H A+ DAE    LL I+ + +  +    +  L ++N++L ++   ++ R    T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+++A +S       ++ K  YDFI +  P  +   I +E I  +  ++  I+ +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   +  N     LPK +FRTT+E+ DEF+FL +  L   +V+TN N +A   +  ++ +K  L++P I+ A + + +L YQK++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P+ +CP+C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG E  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+ KG+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   +  +++EI EK  N +      N E+DL    E+  E+L RG+KF  +DL KS AT+FL+EGD LIPPFSA+DGLGD+VA  +V+AREE  F SK + +KR  +++T ++ M+++GI  ++ ED+Q+SLF+
  S:   133 DTEHFRKNHLPNLSQQLVKYGFPQLTCLVQHSDELTQQQAENFQAENDKIVQAANEEALKAMESLQQMAPPPEEKPAYDFQARKAAAKPKLDKAEITPMIEVQTEENRLVFEGMVFDLEQKVTRTGRVLLNFKMTDYTSSFSLQKWMKNEEEAKKFDMIKKGAWLRVRGNVEMNNF-TRDLTMNVQDVQAVTHYERKDLMPEGQ---KRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVDMELSDATYVVFDVETTGLSAVYNDLIQVAASKMHKGNIIAEFDEFINPGHPLSAFTTDLTGITDEHVRNAKPLEQVLKEFQEFCQDSVLVAHNA-TFDVGFMNVNYERHGLPKIIQPVIDTLEFARNLYPEYKRHGLGPLTKRFQIALE--HHHMANYDAEATGRLLFIFIKDVAEK--HGVTNLKDLNTDLVDENSYKKARVKHATIYVKNQTGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVYDAVVSQGVDAAVEVAK-YYDFIEVMPPAIYEPLIAKEQIKDQEELQTIIRNLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGENAQPAPLPKAHFRTTNEMLDEFAFLGED-LAKKLVITNPNQLAETFEP-VEVVKGDLYTPFIDKAEETVAELTYQKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGKCQYSEFITDGSYGSGFDMPDKDCPECGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGSEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNDIPMDDAGVMALFSGTDILGVTQEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHKGLDPKMAFTIMERVRKGLWLKISEEERNGYIAAMKENNVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMSGGLDAVKRRMSEIAEKRKNNEA----SNVEIDLYTTLEIVNEMLERGFKFGKLDLYKSHATEFLIEGDTLIPPFSAMDGLGDNVARQVVRAREEGEFLSKTELRKRGGLSSTLVEKMDDMGILGNMPEDNQLSLFD 1459
>gi|188524415|ref|ZP_03004436.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530975|ref|ZP_03005237.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195659873|gb|EDX53253.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (1442 aa)
Score = 2454, Expect = 0.0e+00, Identities = 552/1284 (42%), Positives = 824/1284 (64%)
  Q:   173 EKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E+ ++ I +H  + Q++++ +I +     N +K  S+F Y ++ +    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T IS E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ +KNP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   165 EQAVNEIINHHIQQQKQLEQQINQQLDYQNNQK--SNFNY-YKNTSNKTITKLIDINPLMNNAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKIDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEEQIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNISQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAQKITLENVQKAFKKLVSLALESNKPIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|157150704|ref|YP_001451113.1| DNA polymerase III PolC [Streptococcus gordonii str. Challis substr. CH1] >gi|157075498|gb|ABV10181.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus gordonii str. Challis substr. CH1] (1462 aa)
Score = 2454, Expect = 0.0e+00, Identities = 517/1317 (39%), Positives = 832/1317 (63%)
  Q:   141 DQEKCIKKYLEHFRKFLNDYGFSK-----HHLSYILDEKTIDIISDHKNKIQEKIKNEIT---EVKRSSNAKKTDSSFTYKFRKSVT------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIIS--KPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKY--NELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           D E   K +L +  + L  YGF +      H   +  ++  +  +++   +QE  +  +     +++ +   +   ++ ++ RK+         ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+G W++ + +++++ +   D+T  ++++  ++  + K+ +       KR E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  D  +SDATYV+FD+ETTGLS  Y+ +I+  A K HKG  +     FINP   +S     +T I++E V++A  +++ L + ++F  DSVL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + ++++I  +    H A+ DAE    LL I+ + +  +    +  L ++N++L ++   ++ R    T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+++A +S       ++ K  YDFI +  P  +   I +E I  +  ++  I+ +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   +  N     LPK +FRTT+E+ DEF+FL +  L   +V+TN N +A   +  ++ +K  L++P I+ A + + +L YQK++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P+ +CPKC  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++   IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+ KG+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   +  +++EI EK  N +      N E+DL    E+  E+L RG+KF  +DL KS AT+FL+EGD LIPPFSA+DGLGD+VA  +V+AREE  F SK + +KR  +++T ++ M+++GI  ++ ED+Q+SLF+
  S:   133 DTEHFRKNHLPNLSRQLVKYGFPQLACQVQHSDELTQQQAENFQAENDKIVQEANEEALKAMESLQQMAPPPEEKPTYDFQARKATAKPKLDKAEITPMIEVQTEENRLVFEGMVFDLEQKVTRTGRVLLNFKMTDYTSSFSLQKWMKNEEEAKKFDMIKKGAWLRVRGNVEMNNF-TRDLTMNVQDVQEVTHYERKDLMPEGQ---KRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVDMALSDATYVVFDVETTGLSAVYNDLIQVAASKMHKGNIIAEFDEFINPGHPLSAFTTDLTGITDEHVRNAKPLEQVLKEFQEFCQDSVLVAHNA-TFDVGFMNVNYERHGLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQIALE--HHHMANYDAEATGRLLFIFIKDVAEK--YGVTNLKDLNTDLVDENSYKKARVKHATIYVKNQTGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVYDAVVSQGVDAAVEVAK-YYDFIEVMPPAIYEPLIAKEQIKDQEELQTIIRNLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGENAQPAPLPKAHFRTTNEMLDEFAFLGED-LAKKLVITNPNQLAETFEP-VEVVKGDLYTPFIDKAEETVAELTYQKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGKCQYSEFITDGSYGSGFDMPDKDCPKCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPTDIPMDDPGVMALFSGTDILGVTQEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHKGLDPKMAFTIMERVRKGLWLKISEEERNGYIAAMKENNVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMSGGLDAVKRRMSEIAEKRKNNEA----SNVEIDLYTTLEIVNEMLERGFKFGKLDLYKSHATEFLIEGDTLIPPFSAMDGLGDNVARQVVRAREEGEFLSKTELRKRGGLSSTLVEKMDDMGILGNMPEDNQLSLFD 1459
>gi|81428867|ref|YP_395867.1| DNA polymerase III PolC [Lactobacillus sakei subsp. sakei 23K] >gi|123564054|sp|Q38W73|DPO3_LACSS DNA polymerase III polC-type (PolIII) >gi|78610509|emb|CAI55560.1| DNA-directed DNA polymerase III, polC-type [Lactobacillus sakei subsp. sakei 23K] (1446 aa)
Score = 2454, Expect = 0.0e+00, Identities = 525/1267 (41%), Positives = 782/1267 (61%)
  Q:   191 KNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDY-LIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           KNE  + KR +  K  D         +    V ++  +  E ++  IEG IF  +  V ++G ++    +TDYS S  +K       ++ + + + +G+W K + S+Q D +   D+T    ++  +S PK   R D A   KR E+  HTNM+  +    I +  K +++ G  ++A+TD +N Q FPD Y   KK + +K +YGV+ N+++   P+V N  D  +  A YVIFD+ETTGLS  YD IIE  A+K   G  V S   FI+PE  +S     +T I+NE V  A K  E L   K+F GD+VL  HN + FD+ FLN   E N +D+I NP+IDTL++SR ++ +   H L  + ++YKI+ +    HRA+ DAE   YLL  +K   E  +  D+  +N++N  +      ++ R +   +  + +  ++NL+KL+S S+T  +   P++     +      +V ++ + GE+FEA M        D  K  YD+I +     +   + RE+ +    +E+ I+ ++K+  K NK VVAT D +YLN  D +Y ++ +++  +GG        N LN + LP  +FR+TDE+   F FL  P L  ++VV N   IA  ID  I P+K+ L++P + GA D+++ L   +++ ++G  +   V+AR+ +E+ S+I NG+++IY  S  LV +S  DGY+VGSRGSVGSS+ A +  ITEVNPL PHY C+NC Y  F  +  V SG+DL + +CP+C + L  DGH+IPFETF+GF GDK+PDIDLNFS  YQ  AH++ K +FGE  VFRAGTI T A+KTAYGYVK+Y E   +   R AE+ R+AK    VKRTTGQHP GI+VVP   D+YDFTP  +PADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  +IP  D  VM LF+ TDSL +    IN   K G+ G+PEFGT FV+ ML  T P  FS+L++ISGLSHGT+VW  NA+ LI +  +T+ DVI CRD+IM+ LI  G+   ++F IME VRKGKG+ +++Q+ + DN N+P WYI+SC KI Y+FPKAHATAY++MA +IA+FK+Y+P+ +Y +YFS+R   FD+ ++  G+  +  ++ EI +K     T      KE +L+ + E+A E L RG     +D++KS ++DFL++ D+ L+ PF A+  LGD+VA  IV AREEK F SKED   R KV+ T ++ + E  + + L +++Q+SLF+
  S:   199 KNEALKEKRKTEGKPVDGPIVMGRGINPAEPVRQMISITEEERSIVIEGFIFDKEVRVLRSGRQLLILKMTDYSSSFTVKKFSRDASDESLFAAIDKGMWFKVRGSVQEDNFMR-DLTVNANDLVEVSHPK---REDTATDGKRIEMHLHTNMSQMDATNPIGDYVKQAAKWGQPAIAVTDHYNLQAFPDAYAAGKK-NGVKILYGVEVNLVNDGTPVVYNLRDQVLESAEYVIFDVETTGLSAVYDSIIELAAVKMRDGEVVASFDEFIDPERPLSAFTTQLTSITNEMVHGAKKEAEVLAMFKEFTGDAVLAGHN-VSFDMGFLNAGYERNDIDLIDNPVIDTLELSRMLHPEYKNHKLDSLTKRYKINLE--HHHRANADAESTGYLL--YKLEKEAAENYDMVNVNQLNDRVGVGEFYKQARPAHAVLMAQTQAGLKNLFKLVSASMTEYYYRTPRLPKSKLDALREGILVGSACSNGEVFEAMMQKGYNEALDRAK-YYDYIEVMPKAVYAPLLERELVRDNRALEEIIRNLVKVGEKLNKPVVATGDAHYLNPEDAIYRKILIHS--MGGA-------NPLNRSKLPDVHFRSTDEMLTAFDFLG-PELAQELVVANPQKIADQID-EIVPVKDKLYTPKMAGAEDEIQTLTMNRAHELYGAELPEIVEARLKKELKSIIGNGFSVIYLISQKLVYKSGKDGYLVGSRGSVGSSLVATMTGITEVNPLPPHYRCSNCHYSEFFTKGEVGSGYDLADKDCPECGTPLDKDGHDIPFETFLGFHGDKVPDIDLNFSGDYQPVAHNYTKVLFGENNVFRAGTIGTVADKTAYGYVKAY-ERDTEQTFRGAEVDRLAKGSTGVKRTTGQHPAGIIVVPDYMDIYDFTPIQFPADDQDAAWKTTHFDFHSIHDNILKLDILGHDDPTMIRMLQDLSGIDPKSIPTDDPGVMALFSGTDSLGVTPEQINS--KMGTLGVPEFGTRFVRGMLEETHPTTFSELLQISGLSHGTDVWLGNAEELINKGVVTLKDVIGCRDNIMMDLIHWGMDDSMSFNIMERVRKGKGIPDDWQQAMRDNENVPDWYIDSCLKIKYMFPKAHATAYILMALRIAYFKVYFPIIYYCAYFSVRASDFDLVAMAQGKEGVKARMKEITDKGMEAST------KEKNLLTVLEIANECLERGITIKMVDIEKSDSSDFLIQDDHTLLAPFRAVPSLGDNVAKQIVSAREEKPFLSKEDLSNRGKVSKTLIEYLTENNVLNDLPDENQLSLFD 1444
>gi|83319984|ref|YP_424323.1| DNA polymerase III, alpha subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283870|gb|ABC01802.1| DNA polymerase III, alpha subunit, Gram-positive type [Mycoplasma capricolum subsp. capricolum ATCC 27343] (1479 aa)
Score = 2448, Expect = 0.0e+00, Identities = 571/1313 (43%), Positives = 830/1313 (63%)
  Q:   146 IKKYLEHFRKFLNDYGFSKHHLSYILDEKTI--DIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSI------------VIKALFGKKINKDVLSELKEGV-----WVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFY---NEAKK----YSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYH-KGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLN----EINS-NLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEF--NNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN--VDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNA--RNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVE-----GDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           I + L++    LN +GF   +LSY+++ K I  D +   + K    I+ + T +K+        +S+  K           L D+  + +   I+G +   +  ++KTG +I+   +TDY  SI                L  +++N   + E+KE       W+  K    + +Y+   I   I++   I+K +   R D+A  KR EL  HT M+  +G+ +  +  +  S   + ++A TD  N Q FPD Y   N   K      K+KAIYG++ N+++ ++  V N  +  + DA  V FD+ETTGLSP  D+IIEFGAI+Y+ K  + + I + I P+ K+ D    +T I+ E +++   I+ A  +I   I D++L+AHN   FD  FL+   E+     ++N +IDTL ISR I  ++  H LG +A++  I YD + AHR D DA+ L +I++RML++ + +   T++    +IN  N  ++    +N+G    +  KN+  ++ LYKL++ S T+NF   PK++  +  E   NN+ +  +S    EIFE A ++T + L+  I   YD+I I     + + +  +      ++  I  II IA + NK +VA+SD +Y N   +    VY+NAK LGG R+ LF +N      P  Y RTT+E+ +EFS+L D  L+ +IVV NSN I  +ID N+ PIK+ L +P I    +KL+   YQ +  ++G+ + + V+ R+++E+ S+  +G+A++YW SHLLVKQS DDGY+VGSRGSVGSS  A +  ITEVNPL+ HY C NCKY +F+ +     G+DLP   CP C  KL GDGH+IPFETF+GF GDK+PDIDLNFS  YQ +AH+F K MFGE  VFRAGTIST AEKTA+GYVK+YFEE+K+  +  R  EI R+AK  + VKRTTGQHPGGI+++P+  ++ DFTP NYPADD +  W TTH  F S+HD+LLK DILGHD+PT L+ML + TN++  TIP  D +V  LF+S  +L + +  IN  + TG+ GIPEFGT FV+ ML  TKP+ F+DL++ISGLSHGT+VW  NA+ LI++    IS VI CRDDIMVYLI+ G+   +AF IME VRKGKGL +E+  ++  +NIP WYI+SC KI Y+FPKAHATAYV+MA++IAW+KIYYP  +YA+Y S +  VFD+K+ L G   +  K+   ++K+ N +    +  KE DL  +YE+ LE+  R  KF+NID +KS AT F V+        +IPPF+ ID LG++VA SI+ AR  K  +S  D K RT+ T T +KI EE  I  SL+ D+Q++ F+F
  S:   136 ISQELDYCLAKLNQFGFK--NLSYLINVKEISLDALDQQEQKNSTSIEQQ-TVIKQVEKKSSLPTSYKNKRTNLDKPSYQSLLDVEDDAQNIVIQGVVINKEFKLSKTGRKIFYIDITDYHSSIRCMYFAKSDALCEFDDLTDEQLNSKNVEEIKESKIKINDWISVKGKTSLSLYDQEQIF-YIDDFKKINK-QIISRTDDAKTKRVELHAHTKMSVMDGVSDPTDYLELISSWNHKAIAFTDHTNVQAFPDIYKALNSVNKKRIDQEKIKAIYGLEINMLNNDLWYVKNPKNQNLKDAKMVFFDLETTGLSPELDEIIEFGAIEYNFKTGERKKIDILIKPKSKLKDFTKKLTNINEEMLENKPGIEVAFKEINQVIKDAILVAHNA-NFDYTFLSHWSEKLGYGKLENTIIDTLTISRIIYPELKSHRLGSLAKRVNISYDPSIAHRGDYDADILADIYERMLDDTRKKTKITIDSDWDKINPLNNIDNLNYHKNKGFHTNILVKNQTGLKELYKLVTKSHTTNFYSSPKIFKSDLIEVKKNNNLLFGSSCVNSEIFELARTSTLENLKQAIS-FYDYIEIQPISVYKNLLQNDSLDLDQLKKIITNIISIARQENKLIVASSDCHYTNPELKQIREVYINAKGLGGIRHPLFDFNNKVKDYPDQYLRTTNEMLEEFSWLEDENLIYEIVVINSNKINEMIDVNVIPIKDGLFTPKIANVDEKLRDKCYQTAKQMYGENLPDIVEKRLEKELGSITKHGFAIVYWISHLLVKQSYDDGYLVGSRGSVGSSFVATMAQITEVNPLKAHYRCLNCKYSDFDTDPTYKCGYDLPTKKCPNCNEKLIGDGHDIPFETFLGFDGDKVPDIDLNFSGEYQNQAHNFTKKMFGENNVFRAGTISTVAEKTAFGYVKTYFEETKRDASLPRKTEINRLAKLAQGVKRTTGQHPGGIIILPNEYEIEDFTPVNYPADDLSSTWKTTHFDFHSIHDNLLKMDILGHDDPTALRMLRDLTNIDPITIPTDDKNVYSLFSSLQALNLTSDKINDEI-TGAIGIPEFGTGFVRNMLKETKPKTFADLVQISGLSHGTDVWLGNARDLIKDNKANISTVIGCRDDIMVYLINMGLESSLAFMIMESVRKGKGLKKEWIDIMKKHNIPDWYIDSCLKIKYMFPKAHATAYVLMAYRIAWYKIYYPTEYYATYLSTKADVFDLKTALGGYEAVLLKLKSQQQKVKNGEK---LSKKEEDLEVVYEVLLEMFARNIKFSNIDFEKSEATKFKVDILEDNTKIIIPPFNVIDSLGEAVALSIINARNTKPITSVNDLKNRTQTTQTQIKIFEEFNILDSLSVDEQLT-FDF 1479
>gi|167756906|ref|ZP_02429033.1| hypothetical protein CLORAM_02455 [Clostridium ramosum DSM 1402] >gi|167703081|gb|EDS17660.1| hypothetical protein CLORAM_02455 [Clostridium ramosum DSM 1402] (1445 aa)
Score = 2447, Expect = 0.0e+00, Identities = 554/1418 (39%), Positives = 856/1418 (60%)
  Q:    39 QNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQ--EKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEM--KTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELK----EGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIED------AIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLG-GKR-NRLFKYNELNTVLPKYYFRTTDELKDEFSFL-NDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFE-ESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKG----LNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD---YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++S    + FN++LP +     +++ +       + + +  + +NQ ++L Y  Y +            EK +  Y +   + ++   I +  I +      Q + +++         ND G  K+   YI +E   D+  D K +++  E ++ +++ +++        +++   +R+       K+ ++  +       I+G +FK + + T+ G  I   +VTDY+DSI++K       N   L ELK     GVWVK +   + D +    +  +  E+ +I  P    R D +  KR EL  H+ M+A +G+  I +     +  G+ ++A+TD  N Q+FP+    A K + +K IYGV+FN+I+  + IV N  DT I  ATYV FD+ETTGLS  +D I EFGA+K   G  ++ +QMF+NP + IS +I  +T I+N+ V++   I   L +I +F  D +L+AHN   FD+ FLN  L  N M  I NP+ID+L ++RAI + +  + LG + R Y+++YD+  AHRAD DAE L +++  ML +Q +Q  K        L  D + +      +T    N+  ++N++KL+S + T  F  G ++  E    +    +  +S   G++FEAA++ + + LE  + + YD+I I   E + H     +  RG ++D      ++ RII  A K +K +VAT D ++L   D+++  V+++   +G G R + L          P  Y RTT+E+ + + +L  D V   + VVTN+N IA +++  IKP+ + L +P I+GA + LK++ Y  ++  +G+ +   V+ R+++E+S++I +G+ +IY+ SHLLVK+S DDGY+VGSRGSVGSS  A +  ITEVNPL PHY+C +C +  F  E  V  G+DL +  CPKC   +KG+GHNIPFETF+GF  DK+PDIDLNFS  YQ  AH F K +FGE+ VFRAGTIST AEKTAYGY K Y E        R+AE+ RIA  C  VKRTTGQHPGGI+V+P   DV+DFTP+ +PADD    W TTH  F ++HD++LKFDILGH +PT+ + L + T V+   IP  D  VM LF S+++L      I    K G+ G+PEFGT+FV+ ML  T+P+ F+DL+ ISGLSHGT+V+  NA+ LI+    T+S+VI CRDDIMVYLI+KG+    AF IME VRKGK       ++Y++++ + N+P WYI+SC KI Y+FPKAHA AYV+ A ++AW+K+YYP  +YA YF+ R   +DI++++ G+  I  +  EI +  A   +     NK+  L  I+E+ALE++ RG+ F  + L+ S A+ F+++ +    LIPPFSAID LG+SVA ++V AR +  F SKED  KRTK+  +H+K + ++G+ + + E +Q+SLF
  S:    38 RDNSYTFHLVFNQILPFEEYQLLINNRDNFPYPTKYKISYETEFFNQNELLLYTGYLL------------EKLKKDYPVCATLTVESFKIEDKVIRVETCNEIQLEQLRQLRAQIEDMFNDVGIDKNFDFYIDEEN--DVFKDIKEEMEAYEPVEIDLSLIQKPDKPASEQNNYKNNYRQKNAAIDMKIEEITNQTMDNNIVIKGFVFKTEMIKTRAGKHIQSLWVTDYTDSIIVKRFENNSNNS--LEELKVIGKGGVWVKVRGEARFDSFARETVM-MAREVEVIKSPAP--RKDTSEAKRVELHTHSKMSAMDGVGTITQYINAVASWGHKAIAVTDHGNVQSFPEAQMAAGK-AGIKMIYGVEFNMIEPILNIVYNEIDTSIEHATYVSFDLETTGLSVIHDGITEFGAVKIKNGEVIDRLQMFVNPGKSISSRITNLTSITNDMVRNEPTIDALLPRIIEFFDDCILVAHNA-NFDIGFLNENLRRNNMPEITNPIIDSLALARAILKPMKSYRLGNVCRSYRVNYDDEVAHRADYDAEVLGDVFNMML-HQIMQSGKYNLLDLCELTGDDVYKIVYPYHMTALALNKAGLKNMFKLVSEANTKYFHNGSRIPKERLEHYREGLLYGSSCYNGDVFEAALNLSDEKLERAM-EFYDYIEIQPLEDYYH-----LVDRGKLQDTDELIKSLHRIIDCAKKLDKLIVATGDVHFLEVRDKIFRDVFISNPTIGIGHRAHPLCDRRNPKAKNPCQYLRTTNEMLEGYPYLPQDEVF--EYVVTNTNKIADMVE-EIKPVHDKLFTPKIDGADENLKKICYDTAHKTYGNPLPQIVEKRLEKELSNIIKHGFGVIYYISHLLVKKSNDDGYLVGSRGSVGSSFVATMSGITEVNPLPPHYVCLHCSHSEFLEEGIVADGYDLEDKVCPKCGKIMKGEGHNIPFETFLGFNADKVPDIDLNFSGEYQANAHAFTKEIFGEDHVFRAGTISTVAEKTAYGYAKGYAELMGTDQTIRSAELERIAAGCGGVKRTTGQHPGGIIVIPGDMDVFDFTPYQFPADDLNAAWKTTHFDFHAIHDNVLKFDILGHVDPTVTRFLQDLTGVDPKDIPTNDKKVMSLFTSSEALGCNLDFIG--CKNGALGLPEFGTSFVRGMLDQTQPKTFNDLVIISGLSHGTDVYLGNAETLIKSGTCTLSEVIGCRDDIMVYLIEKGLPNKDAFDIMECVRKGKSPVVFPEKKYEELMKEYNVPQWYIDSCKKIKYMFPKAHAAAYVLSAIRVAWWKLYYPREYYAVYFTTRCDFYDIETLVQGKDAIMARRAEITQLRAERSS----SNKDEGLWDIFEIALEMIERGFHFNPVSLEYSQASKFILDPNDEKGLIPPFSAIDALGESVAKTVVDARADGPFLSKEDVIKRTKLNNSHIKTLSKMGVFNGMQERNQLSLF 1445
>gi|188592849|ref|ZP_03006110.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 10] (1442 aa)
Score = 2446, Expect = 0.0e+00, Identities = 543/1249 (43%), Positives = 805/1249 (64%)
  Q:   208 SSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S+F Y ++ +    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T I+ E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ ++NP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   198 SNFNY-YKNTSNKTITKLIDINPLMNNAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKNDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEERIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNINQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSNDEIKSIMQ-RYDFITLPSIGSQKHLVYAKKITLENVQKAFKKLVSLALELNKIIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|186701836|ref|ZP_02971504.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186701125|gb|EDU19407.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma parvum serovar 6 str. ATCC 27818] (1442 aa)
Score = 2445, Expect = 0.0e+00, Identities = 566/1340 (42%), Positives = 847/1340 (63%)
  Q:   117 LKYNMGIKKPI--ISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYIL----DEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALF--GKKINKDVLSELKEGVWVKAKISIQID-MYENNDI-TGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNA--RNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++YN  +   I  I++  I+ H++ N  E  I   L+ +    +++     +LS +L    ++   DII++H  + Q+ ++ +I++ +   N +KT+  F Y ++      +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I      G+   K  L ELK    ++A+I I +D M ++  +  G I++I  I            +  R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q +P+    +KK   LK IYG++   ++  IP+VLN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ  + P ++I++ I  +T IS E V +A+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ +KNP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K M +N    D  I  LNEIN+ LQ   L+ R+ G+ I +Y KN+  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C NCK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T A+ +A   VK YFE     N   R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM  F+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  +P WYIES NKI Y+FPKAHATAYV+ AWK AW+KIYYPL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   106 IEYNSNLNSLILKINDKLIYDHFIANKLE--ILNILKVWSLPYSNFQIHFENLSSLLNKNHEQAVNDIINNHIEQ-QKHLEQQISQQQNFYNNQKTN--FNY-YKNPSNKTITKLVDINPLMNNAKIQAYVFLKKIDVLKSGAIAYKLNVIDDSETLTIMTYLPSGEHPLKKFLDELKIDQLIEAEIDIVLDNMSKSGQVPIGKIKKIYCIEDKYA----KKQITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQAYPEIAKFSKK-QDLKIIYGLETEELEDQIPLVLNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFLVKPIQQINENITNLTNISQEMVNNAIDEKTALLKIKEIFDNHILVAHNGINFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEIAHRADYDAIVLADVFKVM-KNNLFNDFGITNLNEINTKLQTVMLKNRSFGNWINLYIKNQVNVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAKKITIENVQKAFKKLVYLALELNKIIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLTPHYLCPNCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAQTSAENTVKKYFENRFNENKIIRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDERDVPMYDPLVMKSFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQIILKELKVPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYYPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFIAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|195867849|ref|ZP_03079848.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660426|gb|EDX53684.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (1442 aa)
Score = 2444, Expect = 0.0e+00, Identities = 543/1249 (43%), Positives = 805/1249 (64%)
  Q:   208 SSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S+F Y ++ +    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T I+ E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ ++NP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   198 SNFNY-YKNTSNKTITKLIDINPLMNNAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKIDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEERIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNINQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAKKITLENVQKAFKKLVSLALELNKIIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|188569210|ref|ZP_03005726.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 2] (1442 aa)
Score = 2444, Expect = 0.0e+00, Identities = 543/1249 (43%), Positives = 806/1249 (64%)
  Q:   208 SSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S+F Y ++ +    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T I+ E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ ++NP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E++S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   198 SNFNY-YKNTSNKTITKLIDINPLMNNAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKNDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEERIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNINQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAKKITLENVQKAFKKLVSLALESNKLIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELNSIIKHGFSVVYWISHLLVEKSMKDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|171920838|ref|ZP_02932008.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903036|gb|EDT49325.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (1442 aa)
Score = 2444, Expect = 0.0e+00, Identities = 543/1249 (43%), Positives = 804/1249 (64%)
  Q:   208 SSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S+F Y ++ +    +TKL D+   M    I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ ITD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T I+ E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  ++ ++NP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  LVN I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   V+ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   198 SNFNY-YKNTSNKTITKLIDINPLMNNVKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKNDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGITDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEERIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNINQEMVNDAIDEKTALLKIKEIFANHILVAHNGISFDINFINQRLLKWGLEPLENPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAQKITLENVQKAFKKLVNLALESNKLIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLVNLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIVEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|110808209|sp|P0C1P9|DPO3_STAAU DNA polymerase III polC-type (PolIII) >gi|1483182|dbj|BAA13160.1| DNA polymerase III [Staphylococcus aureus] (1435 aa)
Score = 2443, Expect = 0.0e+00, Identities = 523/1227 (42%), Positives = 783/1227 (63%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    I  L+  +S I + K+  + D A  KR E   HT M+  +G+ NI    K +++ G+ ++A+TD    Q FPD +  A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +   NEIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   F   P++     +E+    +V  +  EGE+F A M   Q  +E I K  YDFI I  P  +   I RE+ +    + +  +R+I   +     V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ +EF FL +    ++IVV N+N +A  I+  + PIK+ L++P +EGA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   +FN + +V SGFDLP+  C  C + L  +G +IPFE F+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K C  VK TTGQHPGGI+VVP   D+YDFTP  YPADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F++ +SL +    I  + KTG+ G+P       ++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AFKIME VRKGKGL EE  + + +N +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RGY+   I L+KS A +F++EGD LIPPF ++ GLG++VA  IV+AR++  F SKED  K+  +    ++ ++ELG   +L +  Q+S+F+
  S:   235 EFKVA-IEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLK-MFTRK-NKDDLEHFKALSVGKWVRAQGRIEEDTF----IRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKHG-IKMIYGMEGMLVDDGVPIAYKPQDVVLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKLSNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQSQVEKIAK-YYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLNEFHFLGEEK-AHEIVVKNTNELADRIE-RVVPIKDELYTPRMEGANEEIRELSYANARKLYGEDLPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFN-DGSVGSGFDLPDKTCETCGAPLIKEGQDIPFEKFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGCTGVKATTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEI--LCKTGTFGVPN-SDRIRRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIKYIFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPGLGENVAKRIVEARDDGPFLSKEDLNKKAGLYQKIIEYLDELGSLPNLPDKAQLSIFD 1434
>gi|50365104|ref|YP_053529.1| DNA polymerase III alpha subunit [Mesoplasma florum L1] >gi|50363660|gb|AAT75645.1| DNA polymerase III alpha subunit [Mesoplasma florum L1] (1493 aa)
Score = 2442, Expect = 0.0e+00, Identities = 566/1329 (42%), Positives = 834/1329 (62%)
  Q:   130 ENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDH---KNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTG-DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTG-YEIYKYFVTDYSDSI------------VIKALFGKKINKDVLSELK-----EGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSK-------LKAIYGVQFNIIDK-NIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGV-QVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQ-----DIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFN--NSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVL--PKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMN---ARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD------YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           EN I      N+ +  +   LE+    L  +GF +      +++KT + I      + + +E+ K    E    S         + K+ +S+         D+  + +   + G++  ID   +K    +IY   +TD + SI            ++  L  ++I+ D + E+K     +G W+  K       ++      +IE+I  IS+ +  ++ D++  KR EL  HT M+A +G+ +I+E  +   +  + ++AITD  N Q FPD YNE KK +K       LK IYG++ N+I+K +  IV N    KI ++  V+FD+ETTGLSP +++IIEFGA+ +     +         P++ +      +T I+ E ++D   I +   KI + I DS+L+AHN   FD  FLN   +      ++N +IDTL +SR +   +  H LG + +K+ I YDE  AHR D DA+ L +++ +++   KL      D   +     N +++    R+RG+ + V  KN+  +++++KL+S S T NF   PK++ E   EF   N+ ++       E+FE A   T + LE+II   YD+I I     + + I+    +   + D IK+II++A KYN  +VATSD +Y     +    VY+NAK LGG R+ LF +   N ++  P  Y RTT+E+  EF++L++P LV ++V+TN+N IA +ID+NI  IK+ L +P+IE     LK   Y+ +++++GD +   V++R+++E++S+I +G+A++YW SHLLV++S +DGY+VGSRGSVGSS  A    ITEVNPL+ HY C NCKY  FN    +  G+DLPE NCPKC  KL GDGH+IPFETF+GF GDK+PDIDLNFS  YQ  AH+F K MFGE  VFRAGTIST AEKTA+GYVK+++EE+  +     R  EI R AK  E VKRTTGQHPGGI+++P   ++ DF+P N+PADD +  W TTH  F S+HD+LLK DILGH +PT L+ML + T VN   IP  D  V  LF++  +L IK   IN    TG+ G+PEFGT FV+ ML  TKP+ F+DL++ISGLSHGT+VW  NA+ LI+     IS VI CRDDIMVYL+ +GI    +FKIME VRKG+GL +E+++++  +N+P WYIESC KI Y+FPKAHATAYV+MA++IAW+KIYYP  +YA++ + R   FD+K+ L G + +  K+ E+ E   N K K  +  KEL L+P+ E+ LE+  RG K AN++ +KSLA  +++E D       L PPF  ID LGD+VA SI+KAR E+  +S +D   RT +T T MKI E+L +  +L +D+Q+  F+F
  S:   121 ENLIKFVVDSNELKNQLTTELEYCLAKLKQFGFKELSYDIQVEDKTEEYIKQSLIIEQQTKEQYKQFAPESTEKSQNMIISKQKSQKWNQSLDNPSYDSFEDIEEDAQNIVLHGKMMSIDIRDSKANNRKIYSIGLTDNNSSIKCIYFGKEDERTIMDPLTEEEISSDRIEEIKNKRIAKGDWIAVKGKTSYSQFDKEQ-NFIIEKIGKISRSEAMVK-DDSEQKRVELHVHTKMSAMDGVSSIQEYLQMVDKWNWKAIAITDHINVQTFPDAYNELKKINKNKAEEDKLKLIYGLEMNMIEKEDYWIVKNPKGQKIRESKMVVFDLETTGLSPEFNEIIEFGAVVFDPVTGKTTKYDYLFKPKQPLKQFTIDLTNITPEMLEDKKNIDDDFDKIYELIKDSILVAHNA-NFDFNFLNSLSKRLGYGDLQNTVIDTLTLSRLVRPALKSHRLGAVCKKFGILYDEHVAHRGDYDADVLNDLFFKIIAELKLTTPIIYDADLIKLEPENDKDNINLLRSRGAHVNVLAKNQQGLKDIFKLVSISHTDNFFNSPKIFKEKLKEFKEKNNILIGAGCVNSEVFETARIGTDEKLEEIIP-FYDYIEIQPLSVYKNLINDNQLEEHELIDVIKKIIRLAKKYNVMLVATSDAHYTRPELKKIRDVYINAKGLGGSRHPLFSFRNKNKLIDYPDQYLRTTNEMLKEFAWLSEPALVQEMVITNTNKIAEMIDSNIIVIKDGLFTPNIENVDTLLKDKCYETAHAMYGDVLPEIVESRLEKELTSIIKHGFAVVYWISHLLVERSNNDGYLVGSRGSVGSSFVATASKITEVNPLKAHYRCLNCKYSDFNTPIEIKCGYDLPEQNCPKCNEKLIGDGHDIPFETFLGFDGDKVPDIDLNFSGEYQPIAHNFTKEMFGENNVFRAGTISTVAEKTAFGYVKAFYEETGVLEEDMPRKIEIERQAKLVEGVKRTTGQHPGGIIILPKEFEIEDFSPVNFPADDASSSWKTTHFDFHSIHDNLLKMDILGHVDPTALRMLGDLTGVNPINIPTNDPKVYSLFSNLSALNIKPEQING-ETTGAIGLPEFGTGFVRSMLRETKPKTFADLVQISGLSHGTDVWLGNARDLIKNNTANISTVIGCRDDIMVYLMGQGIDATTSFKIMESVRKGQGLRKEWKEIMLAHNVPEWYIESCLKIKYMFPKAHATAYVLMAYRIAWYKIYYPAEYYATFLTNRADAFDLKTFLGGYNGVKEKLAEL-ELRKNKKDK--MTTKELALMPVLEIGLEMFSRGIKMANLNFEKSLADKYIIEKDESTGEATLYPPFLVIDSLGDAVADSIIKARSERPLTSVKDLTSRTTITQTQMKIFEQLNVLDTLAQDEQLE-FDF 1491
>gi|185178976|ref|ZP_02964733.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188039591|ref|ZP_02998308.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 8] >gi|184209258|gb|EDU06301.1| DNA polymerase III, alpha subunit, Gram-positive type [Ureaplasma urealyticum serovar 5 str. ATCC 27817] (1442 aa)
Score = 2438, Expect = 0.0e+00, Identities = 542/1249 (43%), Positives = 804/1249 (64%)
  Q:   208 SSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKIN--KDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIK----RTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQD--IKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEE--SKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIK-NPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S+F Y ++ +    +TKL D+   M  A I+  +F     V K+G   YK  V D S+++ I        +  K  L ELK    ++A+I I +D   N   +G   ++ I    K +   DN + K    R EL  HT M++ + +++ +EL  F+ +    ++ +TD+   Q++P+    +KK   LK IYG++   +++ IP+ LN  D  + DATYVIFDIETTGL P +D+IIEFGAI      Q+ + IQ F+ P ++I++ I  +T I+ E V DA+  K AL+KIK+   + +L+AHNGI FD+ F+N +L +  +  +KNP IDTL ISRAIN     H LG I +KY++DY++  AHRAD DA  L +++K +++N  + D  I  LN+IN+ LQ+  L+ R+ G+ + +Y K +  ++++Y+L+S S T  +   P +         +  I+SNS  E ++  A  S +   ++ I++ +YDFIT+ S     H ++ +      ++ A K+++ +A + NK ++ +S  YY  + D+ ++ VYVN K L GK +R    NE    +P   +       DE ++L D  L+N I+  N   I S  D  I+P+KE L++P +EG   K    +Y  +  I+GD +   ++ RI +E+ S+I +G++++YW SHLLV++S+ DGY VGSRGSVGSS+ A  ++IT+VNPL PHY+C  CK   F  N D GFDL   +C +C+ ++  DGHNIPFETF+GF GDK+PDIDLNFS VYQ  AH+FIK++FGE   +RAGTI T AEK+A   VK YFE   S+    R++ ++   +KC + KRTTGQHPGGI++VP    ++DF+P+N+PA+D  + W TTH AFE LHDSLLKFDILGHDNPTILK+L + T ++   +P +D  VM LF+   +L IK + ++N+   TG+  IPEFGT FV+ ML+ TKP+ F+DLIRISGLSHG +VW  NA+ LI+  G  + DVI+CRDDIM YLI + + P  AF IMEDVRKGK +  E+Q +L +  IP WYIES NKI Y+FPKAHATAYV+ AWK AW+KIY+PL +YA++FS+R   FD+  I  G+  I    N+I+++  +   +  V ++EL L PIYE+ +ELL RG+K +NI +++S AT +++  + + +IPPF AI GLG++VA SI++AR +K FS+ ED K RTK++ T +K + ELG+   L+E +Q++LF
  S:   198 SNFNY-YKNTSNKTITKLIDINPLMNNAKIQAYVFAKKVDVLKSGAIAYKLNVIDDSETLTIMTYLSNSEHPLKKFLDELKIDQLIEAEIDIVLD---NMSKSG---QVPIGKIKKIYTIQDNHIKKTITPRLELNFHTKMSSLDAIISAQELIDFAVKNQLKTIGVTDRNVVQSYPEIAKFSKK-QDLKIIYGLETEELEEQIPLALNVRDQNLDDATYVIFDIETTGLFPNFDEIIEFGAIIMQNNKQIGDKIQFFVKPIQEINENITNLTNINQEMVNDAIDEKTALLKIKEIFDNHILVAHNGISFDINFINQRLLKWGLKPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDEVAHRADYDAMVLADVFK-IMKNSLVNDFEIINLNQINTKLQSLMLKNRSFGNWVNLYIKTQANVKDMYELVSISHTDMYYTRPTITTSFLANKKDKLIISNSVHESDLINALYSKSDDEIKSIMQ-RYDFITLPSIGSQKHLVYAKKITLENVQKAFKKLVSLALELNKIIIYSSSPYYFLKDDKKFYDVYVNTKGLEGKSHRF--ANE--EYVPDLEYVDQKSAIDELAYLEDENLINLIINENPQIINSWFDDKIQPLKEGLYAPKMEGVDQKTIDYVYHTAKKIYGDNLPTIIEQRIKKELDSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLAPHYLCPKCKKCEFITNADDGFDLVPKDCEQCQIQMLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAEKSAENAVKKYFENRFSENQIVRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDDRDVPMYDPLVMKLFSDISALNIKPSDVLNE--TTGAISIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKS-GKLLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKGKKIKPEHQSILKELKIPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYHPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSRDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKQNNAIIPPFVAIQGLGETVANSIIEARNQKAFSTIEDLKNRTKISRTDLKNLRELGVLDHLSETEQLTLF 1442
>gi|149183493|ref|ZP_01861922.1| DNA polymerase III PolC [Bacillus sp. SG-1] >gi|148848805|gb|EDL63026.1| DNA polymerase III PolC [Bacillus sp. SG-1] (1375 aa)
Score = 2436, Expect = 0.0e+00, Identities = 540/1367 (39%), Positives = 840/1367 (61%)
  Q:    25 HFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDD---SVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIK-KYLEHFRKFLNDYGFSKHHLSYILDE--KTIDIISDHKNKI--------QEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVT----GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKM--ANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYL 1391
           HF++     +  ++Q    +   +  K++P  +   F   L+        V F++    DT+  E +L+Y     N  I++   G S    LL +L   +    P I  N I +      +   +K KY         ++GF     +Y +D   K  D  +D   K         +E+ K  + E+++ +N K  D++ +      +T     +  K+  +  E +   +EG +F  +    ++G  +  + +TDY+ SI++K     K +  V++ LK+G+WV+ + SIQ D +   D+  +  +++ I+     +R D A    KR EL  HT M+  + + ++  L   +S+ G+ +VAITD    Q+FP+ YN +KK + +K +YG++ N++D  IPI  N     + + TYV+FD+ETTGLS  Y+ IIE  A+K   G  ++  + F NP   +S     +T I+++ V+ A ++ EAL   KD+ GD+VL+AHN   FD+ FLN    +  +D  +NP+IDTL+++R +  ++  H L  +A+K+  D + TQ HRA  DAE    +  +ML++   + I   ++ N  +      +R+R S +T+  + E  ++NL+KL++ S    F   P++      ++ +  +V +   +GE+FE  M    + +E+  +  YD++ +   E + H I  E+ +    +E+ I  I+++  K +  VVAT + +Y+N +D+V+  + V ++   G  N L ++      LP  +FRTT+E+ D FSFL       +IVVTN+N IA LID  IKPIK+ L++P IEGA ++++++ Y  + SI+G+ +   V+AR+++E+ S+I +G+A+IY  S  LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C  CK+  F  + +V SGFDLP  NCP+C +  K DGH+IPFETF+GFKGDK+PDIDLNFS  YQ KAHD+ K +FGE+ V+RAGTI T A+KTA+GYVK Y  ++  +  R AE+ R+A+ C  VKRTTGQHPGGI+VVP   D++DF+P  +PADDK  +W TTH  F S+HD+LLK DILGHD+PT+++ML + + ++  TIP  D +VM +F+ T+SL +    I  + KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      +S+VI CRDDIMVYLI +G+ P +AFKIME VRKGKGL  E+++ +  N +P WYI+SC KI Y+FPKAHA AYV+MA +IA+FK+++ L +Y++YF++R + FDI++++ G   I  KI +I  K   A+PK K        + + + ELALE+  RGYKF  +DL +S AT+F+++GD L
  S:    29 HFQSAQIDKLLVDRQEKKWHFYFTLEKLVPCSVWNAFSVRLHQAFQHIARVQFSIKLLDDTHTHEQLLDYW----NECIKEID-GISPP--LLALLNQQV----PTIKGNKIIVQTSNETEATALKRKYSSFISSVFQNFGFP----AYTIDAEVKQFDKGNDDYQKFLEAKRLEDEERAKQAVVEMQKQANEKDQDAAPSGPVSIGLTIKDDAEFRKIEQIHDEERRIALEGYVFAAETKELRSGRTLLTFKITDYTSSIMVKMFSRDKEDAAVMTRLKKGMWVRCRGSIQNDTFVR-DLVMIANDVNEITP---VLRKDTAPDDEKRVELHLHTPMSQMDAVSSVANLVGQASKWGHKAVAITDHAVVQSFPEAYNASKK-NGIKILYGLEANLVDDGIPIAYNDAHRNLEEDTYVVFDVETTGLSAMYNTIIELAAVKIRDGEIIDRFESFANPHHPLSATTINLTGITDDMVEGAPEVAEALKAFKDWAGDAVLVAHNA-SFDMGFLNVGYGKAGLDKAENPVIDTLELARLLYPEMKNHRLNTLAKKF--DVELTQHHRAIYDAEATGYLLLKMLKDANEKGIIYHDQFNDYMGKGDAYKRSRPSHVTLLAQTEEGLKNLFKLVTISHLEYFFRVPRIPRSLLQKYRSGILVGSGCDKGEVFEGMMQKAPEEVEEAAR-FYDYLEVHPKEVYQHLIELELIQSDQNLEEIIGNIVQLGEKLDLPVVATGNVHYINPTDKVHREILVGSQ---GGANPLNRHK-----LPDVHFRTTNEMLDCFSFLGKEK-AKEIVVTNTNKIADLID-EIKPIKDDLYTPKIEGADEEMRRMSYAMAKSIYGEELPEIVEARLEKELKSIIGHGFAVIYLISAKLVKKSLSDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPKCKHSEFFDDGSVGSGFDLPNKNCPECGNVFKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPKAHDYTKVLFGEDNVYRAGTIGTVADKTAFGYVKGYASDNN-LQIRGAEVDRLAQGCTGVKRTTGQHPGGIIVVPDYMDIFDFSPIQFPADDKNSEWKTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGTESLGVTEEQI--MCKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNNICNLSEVIGCRDDIMVYLIYQGLEPSLAFKIMEFVRKGKGLQPEWEEEMMKNGVPNWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFKVHHALLYYSAYFTVRAEDFDIEAMVRGSQAIRAKIEDINSKGLDASPKEK--------NTLTVLELALEMCERGYKFQKVDLYRSSATEFIIDGDTL 1375
>gi|171778812|ref|ZP_02919874.1| hypothetical protein STRINF_00733 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282458|gb|EDT47882.1| hypothetical protein STRINF_00733 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (1464 aa)
Score = 2425, Expect = 0.0e+00, Identities = 523/1321 (39%), Positives = 818/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTI-----DIISDHKNKIQEKIKNEITEVKR-------SSNAKKTDSSFTYKFRKSVTG----DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE----YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIED------AIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL---NEE---YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +  K +L +  +    +GF K  +  + DE        D  S+ +  +++ ++     VK        +  A K    F  + ++   G     +T + ++  E      EG +F ++K  T+TG  I  + +TDY+ S  ++              + +G W++ + ++     ENN+ T  +     +   KE + HD   +     KR E   HTNM+  + L  ++EL   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  N  D ++++AT+V+FD+ETTGLS   + +I+  A K +KG  VE    FINP   +S     +T I++  V++A  I+E L   +DF  D+VL+AHN   FD+ F+N   E + M II  P+IDTL+ +R +  +   H LG + +++++  +    H A+ DAE     L    K   EN  L +   + ++N+ L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G  ++     +      ++  + +EGE+F+A +S+       + K  YDFI +  P      I+  +  +G I+D       I+ ++++  + NK V+AT + +Y+   DE+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL + V   +IVV N+N  A   +  ++ +K+ L++P +E + +++ ++ YQK++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV +S   GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +V SG+DLP+ +CP+C ++ K DGH+IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGT+ T A++TAYG+VK Y  +  KM    AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD + +W TTH  F  + +++LK DILGHD+PT+++ L + + ++   IP  D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L   +EE   Y + + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK++YP+++Y +YFSIR K FDIK++  G   +  ++ EI  K  N +      N E+DL    EL  E+L RGYKF  +DL +S AT+F+++GD LIPPF A+DGLG++VA  IVKAREE  F SK + +KR  V+ T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--KNHLPNLARQFEAFGFGKLTIDMVSDEAMTQALREDFTSNREAMVEKAVQENREAVKSLEASMPTTEEAPKPKFDFKERAKQRRVGFENAKITPMVEVTTEENRIVFEGMVFDVEKKTTRTGRHIINFKMTDYTSSFAMQKWAKDDDELKKYDMIAKGSWLRVRGNV-----ENNNFTHAL--TMNVQDVKEIVHHDRKDLMPEGQKRVEFHAHTNMSTMDALPTVEELIDTAAKWGHKAVAITDHCNVQSFPHGYHRARK-NGIKAIFGLEANIVEDKVPIAYNPQDIELNEATFVVFDVETTGLSAVNNDLIQIAASKMYKGNIVEQFDEFINPGHHLSAFTTELTGITDNHVRNAKPIEEVLQMFQDFCQDTVLVAHNA-TFDVGFMNANYERHGMPIITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLE--HHHMANYDAEATGRLLFIFLKEARENHNLTN---MMDLNTKLVAEDSYKKARVKHATIYVQNQTGLKNIFKLVSLSNVKYFEGVARIPRTVLDAHREGLLLGTACSEGEVFDAVLSSGVDAAVKVAK-YYDFIEVMPPA-----IYAPLLAQGTIKDEEGIRQVIRDLLEVGRRLNKPVLATGNVHYIEPEDEIYREIIVRSLGQGAPINRPIGRGEDAQPAPLPKAHFRTTNEMLDEFAFLGEDV-AYEIVVKNTNDFADRFE-EVEVVKKDLYTPFLEKSEERVAEMTYQKAFEIYGNPLPDIVDRRIEKELTSILGNGFAVIYLASQMLVIRSNKRGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSKFITDGSVGSGYDLPDKDCPECGTRYKKDGHDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEQYAFRAGTVGTVADRTAYGFVKGYERDYGKMYPE-AEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDLSAEWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPKDIPADDPDVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVEETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGMWLKISDEERNGYIEAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHYPIYYYCAYFSIRAKAFDIKTMSAGLDAVKERMAEISTKRKNNEA----SNVEIDLYTTLELVNEMLERGYKFGQLDLYRSDATEFIIDGDTLIPPFVAMDGLGENVAKQIVKAREEGEFLSKMELRKRGGVSATLVEKMDEMGILGNMPEDNQLSLFD 1461
>gi|21314372|gb|AAM46912.1|AF508325_1 DNA polymerase III C [Enterococcus faecalis] (1439 aa)
Score = 2417, Expect = 0.0e+00, Identities = 538/1421 (37%), Positives = 843/1421 (59%)
  Q:    37 NKQNDSINIKISFNKVLPADILIPFVDSLNLVDDS---VLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIIS-ENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-TIDIISDHKNKIQEK------------IKNEITEVKRSSNAKKTDSSFTYKFRKSVTGD--VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNT-VLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGK------GLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++Q+      +SF++++P  +   F+  L L       V   +  N  T+ +E + +Y        +   Q  T   +++L         +K I+  +N   + YL+       ++YL    +    YGF K H+   +D++   +++   + +  E+            +K+E  + ++   A   D     +  +++  D  +  + ++  E +  TIEG IF  +    ++  +I    +TDY+ S V+K     + ++ V   ++   W++ + S+Q D +  + +    + + +   P++    +    KR EL  H+NM+  +    + +L   + + G+ ++AITD    Q FPD +   KK + +K +YGV+ NI+D  +PI  N    +++DATYV+FD+ETTGLS  YD IIE  A+K HKG  +E+ + FI+P   +S     +T I++E V+ +   +E L   K+F   ++L+AHN   FD+ FLN    ++ +    NP+IDTL++SR +      H L  +++K+ ++ +  Q HRA  D+E   ++ W  + E ++  D+   +++N ++      +R R    T+    +  ++NL+KLIS S    F   P++     ++     ++ ++ + GEIFEA M    +  ++  K  YD+I +     +   I +E+ K    +E+ I  ++KI ++  K VVAT + +YLNE D +Y ++ V +  +GG        N LN   LPK +FRTTDE+  EF FL   V    IVV N N +A L +  I P+K+ L++P I G+  ++  L Y ++  ++GD +   V+ R+++E++S+  NG+++I+  S  LV +S +DGY+VGSRGSVGSS  A +  ITEVNPL PHY C  C+Y  F  + +  SGFD+PE  CPKC ++L  DGH+IPFETF+GF GDK+PDIDLNFS  YQ +AH++ K +FGEE V+RAGTI T A+KTAYG+VK Y E    ++ R AEI R+AK    VKRTTGQHPGGI+V+P   DVYDFTP  YPADD+  +W TTH  F S+HD++LK DILGHD+PT+++ML + + +   TIP  D +VM +F   D L +    I    KTG+ GIPEFGT FV+ ML  T P  F++L++ISGLSHGT+VW  NA+ LI      +++VI CRDDIMVYLI  G+   +AFKIME VRKG+       L + Y   + +NN+P WYI+SC+KI Y+FPKAHA AYV+MA ++A+FK+Y+P+ +Y ++FS+R   FD+ ++  G+  +  ++ EI +K  +  T      KE +L+ + EL  E+L RGYKF  IDL KS A +F++EGD LI PF A+  LG +VA +IV AREE+ F SKED   R KV+ T ++ M E G+   L +++Q+SLF+
  S:    27 HQQSHLWEFHLSFDELMPVMLYQTFMQQLELAFQQIAQVSVQITTNQTTFTEEQLTDYW----QLALLNSQCNTPLVQKVLKTQTPQFEDRKIILPVDNEAVIPYLK-------QQYLPIIEELYFSYGFPKFHIEPKMDQQQAAEVLKKFEEQKLEQAAAFQQQAAESLVKHEQMKKEKQQQAPAFDGPI--RLGRNIPNDEPIMPMGNILEEERRITIEGFIFDKEVRELRSKRKILILKITDYTSSFVVKKFSNGEKDEQVFDAIQPQSWIRVRGSVQEDTFMRDLVMNAQDLMEVAHAPRKDYAPEGE--KRVELHMHSNMSTMDATNKVGDLVAQAGKWGHKAIAITDHGGAQAFPDAHAAGKK-AGVKILYGVEANIVDDGVPIAYNEEHIELTDATYVVFDVETTGLSAVYDTIIELAAVKMHKGNVIETFEQFIDPGHPLSQTTINLTGITDEMVRGSKSEEEVLRMFKEFSEGTILVAHNA-SFDMGFLNTSYGKHGIPEAANPVIDTLELSRFLYPHFKSHRLNTLSKKFGVNLE--QHHRAIYDSESTGHLCWIFLKEAKENHDMHFHDDLNRHIGEGDSYKRARPFHATILATTQAGLKNLFKLISMSNVDYFFRVPRIPRSQLSKLREGLLIGSACSNGEIFEAMMQKGVEEAKNRAK-FYDYIEVMPKPVYAPLIEQELVKNEADLEEIISNLVKIGDELGKLVVATGNVHYLNEEDAIYRKILVGS--MGGA-------NPLNRHSLPKVHFRTTDEMLTEFQFLGQDV-AKRIVVENPNKVADLCEEVI-PVKDDLYTPKIPGSEQEITDLSYNRARELYGDPLPEIVEKRLEKELNSINGNGFSVIFLISQKLVHKSNEDGYLVGSRGSVGSSFVATMTGITEVNPLAPHYYCPECQYSEFYEDGSYGSGFDMPEKACPKCGARLFKDGHDIPFETFLGFHGDKVPDIDLNFSGDYQAEAHNYTKVLFGEEYVYRAGTIGTVADKTAYGFVKGY-ERDHNLHLRGAEIDRLAKGSTGVKRTTGQHPGGIIVIPDYMDVYDFTPIQYPADDQEAEWKTTHFDFHSIHDNILKLDILGHDDPTVIRMLQDLSGIEPKTIPTDDPEVMRIFEGPDVLGVDAEQIYS--KTGTLGIPEFGTRFVRGMLEQTHPSTFAELLQISGLSHGTDVWLGNAEELIRRGEANLAEVIGCRDDIMVYLIHAGLDSGMAFKIMETVRKGQWNKIPDELRDTYLNAMKENNVPDWYIDSCSKIKYMFPKAHAAAYVLMALRVAYFKVYFPILYYCAFFSVRADDFDLVAMSQGKEAVKARMKEITDKGMDAST------KEKNLLTVLELCNEMLERGYKFGMIDLYKSDAENFVIEGDTLIAPFRAVPSLGLNVAKAIVAAREEQPFLSKEDLATRGKVSKTLIEYMNENGVLKDLPDENQLSLFD 1437
>gi|29376875|ref|NP_816029.1| DNA polymerase III PolC [Enterococcus faecalis V583] >gi|29344340|gb|AAO82099.1| DNA polymerase III, alpha subunit, Gram-positive type [Enterococcus faecalis V583] (1451 aa)
Score = 2417, Expect = 0.0e+00, Identities = 537/1411 (38%), Positives = 839/1411 (59%)
  Q:    47 ISFNKVLPADILIPFVDSLNLVDDS---VLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIIS-ENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-TIDIISDHKNKIQEK------------IKNEITEVKRSSNAKKTDSSFTYKFRKSVTGD--VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNT-VLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGK------GLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +SF++++P  +   F+  L L       V   +  N  T+ +E + +Y        +   Q  T   +++L         +K I+  +N   + YL+       ++YL    +    YGF K H+   +D++   +++   + +  E+            +K+E  + ++   A   D     +  +++  D  +  + ++  E +  TIEG IF  +    ++  +I    +TDY+ S V+K     + ++ V   ++   W++ + S+Q D +  + +    + + +   P++    +    KR EL  H+NM+  +    + +L   + + G+ ++AITD    Q FPD +   KK + +K +YGV+ NI+D  +PI  N    +++DATYV+FD+ETTGLS  YD IIE  A+K HKG  +E+ + FI+P   +S     +T I++E V+ +   +E L   K+F   ++L+AHN   FD+ FLN    ++ +    NP+IDTL++SR +      H L  +++K+ ++ +  Q HRA  D+E   ++ W  + E ++  D+   +++N ++      +R R    T+    +  ++NL+KLIS S    F   P++     ++     ++ ++ + GEIFEA M    +  ++  K  YD+I +     +   I +E+ K    +E+ I  ++KI ++  K VVAT + +YLNE D +Y ++ V +  +GG        N LN   LPK +FRTTDE+  EF FL   +    IVV N N +A L +  I P+K+ L++P I G+  ++  L Y ++  ++GD +   V+ R+++E++S+  NG+++IY  S  LV +S +DGY+VGSRGSVGSS  A +  ITEVNPL PHY C  C+Y  F  + +  SGFD+PE  CPKC ++L  DGH+IPFETF+GF GDK+PDIDLNFS  YQ +AH++ K +FGEE V+RAGTI T A+KTAYG+VK Y E    ++ R AEI R+AK    VKRTTGQHPGGI+V+P   DVYDFTP  YPADD+  +W TTH  F S+HD++LK DILGHD+PT+++ML + + +   TIP  D +VM +F   D L +    I    KTG+ GIPEFGT FV+ ML  T P  F++L++ISGLSHGT+VW  NA+ LI      +++VI CRDDIMVYLI  G+   +AFKIME VRKG+       L + Y   + +NN+P WYI+SC+KI Y+FPKAHA AYV+MA ++A+FK+Y+P+ +Y ++FS+R   FD+ ++  G+  +  ++ EI +K  +  T      KE +L+ + EL  E+L RGYKF  IDL KS A +F++EGD LI PF A+  LG +VA +IV AREE+ F SKED   R KV+ T ++ M E G+   L +++Q+SLF+
  S:    49 LSFDELMPVMLYQTFMQQLELAFQQIAQVSVQITTNQTTFTEEQLTDYW----QLALLNSQCNTPLVQKVLKTQTPQFEDRKIILPVDNEAVIPYLK-------QQYLPIIEELYFSYGFPKFHIEPKMDQQQAAEVLKKFEEQKLEQAAAFQQQAAESLVKHEQMKKEKQQQAPAFDGPI--RLGRNIPNDEPIMPMGNILEEERRITIEGFIFDKEVRELRSKRKILILKITDYTSSFVVKKFSNGEKDEQVFDAIQPQSWIRVRGSVQEDTFMRDLVMNAQDLMEVAHAPRKDYAPEGE--KRVELHMHSNMSTMDATNKVGDLVAQAGKWGHKAIAITDHGGAQAFPDAHAAGKK-AGVKILYGVEANIVDDGVPIAYNEEHIELTDATYVVFDVETTGLSAVYDTIIELAAVKMHKGNVIETFEQFIDPGHPLSQTTINLTGITDEMVRGSKSEEEVLRMFKEFSEGTILVAHNA-SFDMGFLNTSYGKHGIPEAANPVIDTLELSRFLYPHFKSHRLNTLSKKFGVNLE--QHHRAIYDSESTGHLCWIFLKEAKENHDMHFHDDLNRHIGEGDSYKRARPFHATILATTQAGLKNLFKLISMSNVDYFFRVPRIPRSQLSKLREGLLIGSACSNGEIFEAMMQKGVEEAKNRAK-FYDYIEVMPKPVYAPLIEQELVKNEADLEEIISNLVKIGDELGKLVVATGNVHYLNEEDAIYRKILVGS--MGGA-------NPLNRHSLPKVHFRTTDEMLTEFQFLGQDI-AKRIVVENPNKVADLCEEVI-PVKDDLYTPKIPGSEQEITDLSYNRARELYGDPLPEIVEKRLEKELNSINGNGFSVIYLISQKLVHKSNEDGYLVGSRGSVGSSFVATMTGITEVNPLAPHYYCPECQYSEFYEDGSYGSGFDMPEKACPKCGARLFKDGHDIPFETFLGFHGDKVPDIDLNFSGDYQAEAHNYTKVLFGEEYVYRAGTIGTVADKTAYGFVKGY-ERDHNLHLRGAEIDRLAKGSTGVKRTTGQHPGGIIVIPDYMDVYDFTPIQYPADDQEAEWKTTHFDFHSIHDNILKLDILGHDDPTVIRMLQDLSGIEPKTIPTDDPEVMRIFEGPDVLGVDAEQIYS--KTGTLGIPEFGTRFVRGMLEQTHPSTFAELLQISGLSHGTDVWLGNAEELIRRGEANLAEVIGCRDDIMVYLIHAGLDSGMAFKIMETVRKGQWNKIPDELRDTYLNAMKENNVPDWYIDSCSKIKYMFPKAHAAAYVLMALRVAYFKVYFPILYYCAFFSVRADDFDLVAMSQGKEAVKARMKEITDKGMDAST------KEKNLLTVLELCNEMLERGYKFGMIDLYKSDAENFVIEGDTLIAPFRAVPSLGLNVAKAIVAAREEQPFLSKEDLATRGKVSKTLIEYMNENGVLKDLPDENQLSLFD 1449
>gi|184155198|ref|YP_001843538.1| DNA-directed DNA polymerase III alpha subunit [Lactobacillus fermentum IFO 3956] >gi|183226542|dbj|BAG27058.1| DNA-directed DNA polymerase III alpha subunit [Lactobacillus fermentum IFO 3956] (1447 aa)
Score = 2407, Expect = 0.0e+00, Identities = 510/1297 (39%), Positives = 797/1297 (61%)
  Q:   161 GFSKHHLSYILDE-----KTIDIISDHKNKIQEKIKNEITEVKRSSNAKKT------DSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKK-INKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDF----YNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           GF   H+  ++D+     K  ++ +  +   +E +K   T+++++   ++       D       +      VT+++ +  E     +EG +F  +    ++  +I    +TDY+ S  +K    ++  NK + + L++G+WVK + S+Q D Y   D+     +I+ +S  +   R D A    KR EL  HT M+  +    I E  K + + G  ++AITD    Q FP+     Y+  K  SK+K +YGV+ N++D  +P+V N N   +    YVIFDIETTGLS  YD+II+  A+K   G  ++    FI+P   +S++  A+T I+++ V+ + K +E ++K+ D   D  L+A + + FD+ F+N   E + M  IK P+IDTL ++R ++    G+ L  +++++K+  +    H A  D+E   +LL I+ +  E +    +  ++++N ++ ++      R   +T+    +  ++NLYKL+S S    F   P++     N +    ++  +  +GE+F A M       + +  + YD+I +     +   +    I  +  +ED +K ++K+ +  NK VVAT D +Y+N  D +Y ++ +N++  GG        N LN T  P  +FRTTDE+ D FSFL + V    IVV N++ +  ++D  I+P+K  L+ PH+EGA  +++   +  +   +GD +   VK R++ E++S++ NG+++ Y  +  LV +S  DGY+VGSRGSVGSSV A L  ITEVNPL PHY C NC+Y +F  +    SGFDLP+ +CPKC +K+ GDGH+IPF+TF+GFKG+K+PDIDLNFS  YQ  AH+++K +FGE  V+RAGTI T A+KTAYGYVK+Y E  K++  R AE  R+A     VKRTTGQHP GI++VP   ++YDFTP  YPADD++  W TTH  F S+HD++LK DILGHD+PT+++ L + + +N  +IP  D  VM LF+S ++L +    IN   KTG+ G+PEFGT FV+ ML  T PQ +S L++ISGLSHGT VW DNA+ LI+    TI++VI CRD+IM  LI  G+    +F++ME VRKGKG+ EE+Q+ + +  +P WY++SC KI Y+FP+AHA AYV+MA +IA+FK+Y+PL +YA++FS+R   FD+ ++ +G+  + + +  I  K  N  T      KE  L+ I ELA E+L RG+KF  +D+++S ATD+L++GD LI PF AI GLG +VA  IV AREEK F SK+D  +R KV+ T ++ M    +   L +++Q+SLF+
  S:   153 GFPAFHIHTLVDQSASQAKIEELKAKQQKADEELVKQARTQIEQAKQKRQATASAAPDGPIVIGRKLGPNDQVTRMATITEEESQVVVEGYVFAKEIKELRSERQILILEITDYTSSFSVKMFSDRRGTNKPLFAALEKGMWVKVRGSVQEDTYMR-DLVINARDINEVSHQE---RQDTAPADQKRIELHLHTTMSTMDATNTIGEYVKQAIKWGQPAIAITDHAGLQGFPEAFSSSYDGKKDESKIKMLYGVEANVVDDGVPLVYNENHLPLKGQPYVIFDIETTGLSAIYDRIIQVSAVKMQDGEVLDHFDQFIDPGFHLSEQTTALTSITDDMVQGS-KTEEEVLKLFDDFADGSLLAGHNVSFDMGFMNVAYERHGMGQIKQPVIDTLPLARFLHPDFRGYRLNTLSKRFKVSLE--HHHLASYDSEATGHLLAIFLKDAEER--YGVTYVDDLNKHMTDNGAYRHARPFHVTILAATQAGLKNLYKLVSLSNVEYFARVPRIPRSVLNRYREGLLLGTACADGEVFTAMMQKGYGEAKRL-AEFYDYIEVQPKPNYAPLLESGVITDQAHLEDILKNMVKLGSALNKPVVATGDAHYINPEDAIYRKILINSQ--GGA-------NPLNRTERPDVHFRTTDEMLDLFSFLGEDV-AKQIVVDNTHLVTDMVDDGIRPVKAGLYPPHMEGAEQEIQDRTWTTAKEWYGDPLPQLVKDRVELELNSIVSNGFSVHYLIAQRLVAKSTKDGYLVGSRGSVGSSVVATLSGITEVNPLPPHYRCPNCQYSHFYTKGEYSSGFDLPDKDCPKCGTKMIGDGHDIPFQTFLGFKGNKVPDIDLNFSGDYQPIAHNYMKVLFGENNVYRAGTIGTVADKTAYGYVKAY-ERDKEVQFRGAEEDRLASGATGVKRTTGQHPAGIIIVPDDMEIYDFTPVQYPADDQSAAWETTHFDFHSIHDNILKMDILGHDDPTMIRALQDLSGINPQSIPMDDPGVMSLFSSPEALGVTEEQINS--KTGTLGLPEFGTRFVRGMLEDTHPQNYSQLLQISGLSHGTGVWLDNAQELIKNGTATIANVIGCRDNIMTDLIHYGLDSETSFQVMEHVRKGKGIPEEWQEKMTEVGVPQWYLDSCLKIKYMFPRAHAAAYVLMALRIAYFKVYFPLVYYAAFFSVRADDFDVVAMSHGKEAVKSAMQAITSK-GNEATA-----KEKSLLTILELANEMLERGFKFKMVDIERSDATDWLIDGDTLIAPFRAIPGLGINVAKQIVAAREEKPFLSKQDLSERGKVSKTLIEFMTVNHVLDQLPDENQLSLFD 1445
>gi|163791589|ref|ZP_02185990.1| DNA polymerase III, alpha subunit, Gram-positive type [Carnobacterium sp. AT7] >gi|159873138|gb|EDP67241.1| DNA polymerase III, alpha subunit, Gram-positive type [Carnobacterium sp. AT7] (1395 aa)
Score = 2404, Expect = 0.0e+00, Identities = 518/1273 (40%), Positives = 797/1273 (62%)
  Q:   126 PIISENAIFLHYLENDQEK--CIKKYLEHFRKFLNDYGFSKHHLSYILDEKT-IDIISDHKNKIQE-----------KIKNEITEVKRSSNAKKTDSSFTYKFRK-SVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK---YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAI 1398
           P+++   I  H +EN+  K   + +YL    +     GF K  +  I+DE+  +  I++ + K +E            I+    E K++ N  +         RK +   ++  +  +  E +  TIEG +F ++  V ++  ++    +TDY+ S  +K       ++   + +K+G+WV+A+ S+Q    E+N +  L+     I++     R D A    KR EL  H+NM+  +    + +L   +++ G+ +VAITD F  Q+FPD ++  +K + +K +YG++ NI+D  +PI  N    +++DATYV+FD+ETTGLS  Y+ IIE  A+K HKG  +ES + FI+P   +S     +T I++E V+ +   +E L   K+F GDS+L+AHN   FD+ FLN    ++ +   +NP+IDTL++SR ++ Q   H L  +A+KY ++ +  Q HRA  DAE   ++ W  + E ++  DI   +++N +       +R R    T+    +  ++NL+KLIS+S+   F    ++      +     I+  + ++GE+FEA M    Q   D  K+K   YD+I +   E +   I +E+ K    +E+ I+ ++KI    N  VVAT + +YLN  D +Y ++ +N++  GG        N LN + LP+ +FRTT E+ + FSFL +      IVV N+N I  ++D  I PIK  L++P IEG+ D+++QL Y +++ ++G+ + + ++ RI++E++S+I NG+++IY  S  LV +S+ DGY+VGSRGSVGSS  A +  ITEVNP+ PHY C  C+Y  F  + +V SG+DLP+  CP+C ++L  DGH+IPFETF+GF GDK+PDIDLNFS  YQ KAH++ K +FGEE VFRAGTI T A++TA+GYVK Y E    +N R AEI R+AK    VKRTTGQHPGGI+V+P   DVYDFTP  +PAD +  +W TTH  F S+HD++LK DILGHD+PT+++ML + + V+  TIP  D +VM +F  T+ L +    I    KTG+ GIPEFGT FV+ ML  T P  F++L++ISGLSHGT+VW  NA+ LI    + +S+VI CRDDIMVYLI  G+   +AFKIME VRKGKG+ +++QK + D NIP WYI+SC KI Y+FPKAHA AYV+MA ++A++K+++P+ +YA+YFS+R   FD+ ++  G+  I  K+ EI +K  +  T      KE +L+ + EL  E++ RG++F  +DL KS A+DF++EG+ L+ PF A+
  S:   120 PLLNGKKIQFH-VENEVVKGHLMNQYLPPVEEAYASLGFPKFKIEPIIDEEAHLKKIAEFQAKKEESETLLAIRANENIQKAEQEKKQNKNQVQAHKGQVVLGRKITAKEEIKSMDQIIEEERRVTIEGYVFDVEVRVLRSERQLLILKMTDYTSSFSVKKFSNTPEDEAAFAAIKKGMWVRARGSVQ----EDNFMRDLVLNAQDITEWDHESRKDTAPEDGKRVELHLHSNMSQMDATNTVTDLVNQAAKWGHKAVAITDHFGAQSFPDAFHAGQK-NGIKILYGIEANIVDDGVPIAYNPKHIELTDATYVVFDVETTGLSAVYNSIIELSAVKMHKGNIIESFEQFIDPGHPLSQTTINLTGITDEMVQGSKSEEEVLTLFKEFAGDSILVAHNA-SFDMGFLNTSNAKHNIPDAENPVIDTLELSRFLHPQFKSHRLNTLAKKYGVNLE--QHHRAIFDAETTGHLCWVFLKEAREEHDIHFQDQLNEHTGEGDAYKRARPFHATIIATTQTGLKNLFKLISSSMVDYFYRTARLPRSELIKLREGLIIGTACSQGEVFEAMM----QKGFDEAKNKAKFYDYIEVMPKEVYAPLIEQELVKDESDLEEIIRNLVKIGEDLNIPVVATGNVHYLNPEDSIYRKILINSQ--GGA-------NPLNRSELPEVHFRTTTEMLETFSFLGEET-AQQIVVKNTNKIVDMVDDAITPIKTDLYTPKIEGSEDEIRQLSYDEAHRLYGNPLPDIIEKRIEKELNSIIGNGFSVIYLISQKLVHKSMSDGYLVGSRGSVGSSFVATMTGITEVNPMPPHYSCPKCQYSEFFTDGSVGSGYDLPDKACPECGARLHKDGHDIPFETFLGFYGDKVPDIDLNFSGDYQSKAHNYTKELFGEEYVFRAGTIGTVADRTAFGYVKGY-ERDNNLNLRAAEIDRLAKGSTGVKRTTGQHPGGIIVIPDYMDVYDFTPIQFPADAQDSEWKTTHFDFHSIHDNVLKLDILGHDDPTVIRMLQDLSGVDPKTIPTDDPEVMKIFGGTEVLGVTPEQIQS--KTGTLGIPEFGTRFVRGMLEETLPTTFAELLQISGLSHGTDVWLGNAEELIRVNDIPLSEVIGCRDDIMVYLIHNGMEDGLAFKIMESVRKGKGIPDDWQKAMRDENIPEWYIDSCLKIKYMFPKAHAAAYVLMALRVAYYKVHFPILYYAAYFSVRADDFDLVAMAKGKDSIKLKMKEITDKGLDAST------KEKNLLTVLELTNEMVERGFEFKMVDLAKSDASDFVIEGNTLMAPFRAV 1385
>gi|134299812|ref|YP_001113308.1| DNA polymerase III, alpha subunit [Desulfotomaculum reducens MI-1] >gi|134052512|gb|ABO50483.1| DNA polymerase III catalytic subunit, PolC type [Desulfotomaculum reducens MI-1] (1426 aa)
Score = 2400, Expect = 0.0e+00, Identities = 518/1274 (40%), Positives = 797/1274 (62%)
  Q:   183 KNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFR------KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLN-ANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWK---RMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSN-TQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNC--KYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++++++ +  ++T  K S   +K + S T          K + G+   + ++  E +   +EG++F ++    K+G +I  + +TD +DSI +K  F ++ + +    LK G WV  +  +Q D + + ++T +  +I++    K   R D A  KR EL  HT M++ + +++  +  K ++  G+ +VAITD    Q FP+ Y  AKK + +K IYGV+  +ID  I  V++  ++  +    +VI D ETTG SP  D+IIE GA+KY  G +V      +NP+++I  ++  +T I++E VKDA   KEAL  + +F+G++VL+AHN   FDL FL   L +     + NP IDTL ++R +   +  H L  + +++KI+   T  HRA  DA     +W+   R L  Q++ D+KTL+ +   +  + L+ R+    +T+  K+E  ++NLY+LI+ S    F   P++      ++    ++ ++   GE ++A M+  +Q+ LEDI    YD++ I   G+ E  +     ++     +++  ++I+ + +K    VVAT D ++LN  DEVY R+ +  K           +++ +   P  YF+TT+E+  EFS+L        +VV+N   IAS+I A  KPI +TLH P+IEGA  ++  +  Q++  ++G+ +   V+ R+D+E+ S+I NG+A++Y  +H LVK+S+DDGY+VGSRGSVGSS+ A   +ITEVNPL PHY C NC    F  + +   G D+P+ NCPKC +    DGH+IPFE F+GF GDK+PDIDLNFS  YQ +AH + + +FG++ V+RAGTI T AEKTA+G+VK+YFEE + +  R+AE+ R+   C  VKRTTGQHPGG++VVP+  DV+ FTP   PADD   D  TTH  + S+HDSL+K DILGHD+PT+++ML + T+VNA  IP  D   M LF STD+L +    I    + G+  IPEFGT FV++ML+ TKP  FS+L+RISG SHGT+VW +NA+ LI+E    +S+ IS RDDIMVYLI +G+ P  AFKIME VRKGKG+ EE  + +    +P WYIESC KI Y+FPKAHATAYV+MA++IAWFK+Y P  FYA+YF++R   FD + +++G ++I   I EI+EK  N  ++     KE +++ I E+ALE   RG K   ++L+KS AT FL+  + L+ PF  + G+G S A +IV ARE+  F+S +D + R K++ T +++++  G  ++L E DQ+SLF
  S:   173 QDEMEKILWQKLTAEKVSVQKEKKNGSATGNLDDGIIIGKPIKGEPKPIHEITEEERNIIVEGKVFDVEIKQLKSGRQILTFNITDNTDSIEVKK-FLEEDDTETSERLKNGSWVIVRGPVQYDKF-SQELTVMAYDINL-GTAKVTNRDDKAADKRVELHLHTKMSSMDSVMSAVDAVKQAAAWGHPAVAITDHGVVQAFPEAYAAAKK-AGIKLIYGVEGYLIDDGIATVVSMKHNVPLQGTEHVIIDFETTGFSPQTDEIIEIGAVKYLNGEEVGRFGTLVNPKKEIPFEVTKLTGITDEMVKDAPDGKEALTALSEFMGEAVLVAHNA-SFDLSFLRVGLRKYLKQEVTNPAIDTLGVARVLFPNLKNHKLNTLVKEFKIEL--TNHHRAVDDASATAKLWQIFLRKLAEQEISDVKTLSGMGQGVNQEKLKSRH----VTILVKDEVGLKNLYQLITLSHLRYFHRQPRIPRRELVKYREGLLIGSACEAGEFYQALMAGASQEELEDI-ASFYDYLEIQPLGNNEFMIRT--GQVNGEEDLKEINRKIVALGSKLGIPVVATGDVHFLNPEDEVYRRILMAGK----------GFDDADNQAP-LYFKTTEEMLKEFSYLGRETAFQ-VVVSNPRNIASMIQA-FKPIPDTLHPPYIEGAEQQITDMTLQRARELYGEPLPEVVQQRVDKELKSIIGNGFAVLYLIAHKLVKKSLDDGYLVGSRGSVGSSLVATFTNITEVNPLPPHYRCPNCLNSEFLMDGSAGCGADMPDKNCPKCGTNYIKDGHDIPFEVFLGFDGDKVPDIDLNFSGDYQPRAHKYTEELFGKDYVYRAGTIGTIAEKTAFGFVKNYFEE-RNIKKRSAEMKRLVLGCAGVKRTTGQHPGGLMVVPNSLDVHMFTPVQRPADDVKSDTRTTHFDYHSIHDSLVKLDILGHDDPTVIRMLEDLTSVNAREIPLDDPKTMSLFASTDALGVTPEDIRS--QVGTYAIPEFGTKFVRQMLVDTKPTTFSELVRISGFSHGTDVWLNNAQDLIKEGTCKLSEAISARDDIMVYLIYQGLPPKQAFKIMEGVRKGKGVKEEDAEAMRSQGVPEWYIESCRKIKYMFPKAHATAYVMMAFRIAWFKVYRPEAFYAAYFTVRADDFDAELMVSGPNKIKQVIEEIEEK-GNAASQ-----KEKNMLTILEVALEANCRGIKILPVNLEKSDATKFLITPEGLLSPFGGLQGVGASAAKNIVAAREQAPFTSIDDLRNRAKISKTVIEVLQNHGCLNNLQESDQMSLF 1426
>gi|69246860|ref|ZP_00604152.1| DNA polymerase III, epsilon subunit:DNA polymerase III, alpha subunit, Gram-positive type [Enterococcus faecium DO] >gi|68195041|gb|EAN09504.1| DNA polymerase III, epsilon subunit:DNA polymerase III, alpha subunit, Gram-positive type [Enterococcus faecium DO] (1452 aa)
Score = 2391, Expect = 0.0e+00, Identities = 536/1411 (37%), Positives = 836/1411 (59%)
  Q:    47 ISFNKVLPADILIPFVDSLNLVDD---SVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKK------PIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDE----KTIDIISDHKNKIQEKIKNEITEV---------KRSSNAKKTDSSFTYKFRKSVTGD--VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNT-VLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGK------GLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + F+K+LP  +       L +       V  N++ +  T++++ + +Y        +E +Q  T   ++   VLK  + + K      PI S  AI   YL+       ++YL    +    YGF K  +   +DE    + + +  + K +  E    +  E          +R   +   +     +  +++  D   T +  +  E +  T+EG +F  +    ++  +I    +TDY+ S ++K     + ++ V   +  G W+K + SIQ D +  + +    + I +   P++    +    KR EL  H+NM+  +   +I +L   + + G+ ++AITD    Q FP+ ++  KK + +K +YGV+ N++D  +PI  N     +S+ATYV+FD+ETTGLS  YD IIE  A+K +KG  +ES   FI+P   +S     +T I++  V+ +   +E L    +F  D++L+AHN   FD+ FLN       +    NP+IDTL+++R +  Q     LGV+++K+ +  +  Q HRA  DAE   ++ W  + E     ++   +++N ++      +R R   +T+  KN+  +++L+KLIS S    F+  P++      +   + ++ ++  +GEIFEA M    +   +  K  YD+I +     +   I +E+ K    +E+ I+ +++I    +K VVAT + +YLNE D +Y ++ +N+  +GG        N LN   LP  +FRTTDE+   F FL +     +IVV N+N IA + +  I P+K+ L++P I G+ D++ +L Y K+  ++GD +   ++ R+ +E++S+  NG+++IY  +  LV +S +DGY+VGSRGSVGSS  A +  ITEVNPL PHY C  C+Y  F  +    SGFD+PE  CPKC ++L  DGH+IPFETF+GF GDK+PDIDLNFS  YQ +AH++ K +FGE+ V+RAGTI T A+KTAYGYVK Y E    +  R+AE+ R+AK    VKRTTGQHPGGI+V+P   DVYDFTP  YPADD+  +W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F   + L +    I    KTG+ GIPEFGT FV+ ML  T P  F++L++ISGLSHGT+VW  NA+ LI     T+++VI CRDDIMVYLI  G+   +AFKIME VRKG+       L E Y   + +NN+P WYI+SC+KI Y+FPKAHA AYV+MA ++A+FK+Y+P+ +Y +YFS+R   FD+ S+  G+  +   + EI +K  +         KE + + + ELA E+L RG+KF  IDL KS A +F++EGD LI PF A+  LG +VA  IV+AR++  F SKED   R KV+ T ++ M + G+   L +++Q+SLF+
  S:    48 LHFSKILPIMLYRSLTQHLTIAFKDIAQVKLNILADDQTFDEQLLQDYWA----QALENQQCDTPLAQQ---VLKTQVPVIKDRKVILPIDSTGAI--SYLK-------QQYLPLVEELFVSYGFPKFRIEPEVDEQQAERVLKLFEERKQEQAEAFMKQAAESLVVHEQKKKERKEQSPALEGPIHIQLGRNIPADEPTTPMISIVEEERRVTLEGYVFDKEVRELRSKRKILTLKITDYTSSFIVKKFSNGEKDEQVFDAISVGSWLKVRGSIQEDTFVRDLVMNAQDIIEVKHTPRKDYAPEGE--KRVELHVHSNMSTMDATNSISDLVAQAGKWGHRAIAITDHGGAQAFPEAHSAGKK-AGVKILYGVEANVVDDGVPIAYNDAHEALSEATYVVFDVETTGLSAVYDTIIELAAVKMYKGNVIESFDEFIDPGHPLSRTTVDLTGITDGMVRGSKSEEEVLRMFLEFSKDTILVAHNA-AFDMGFLNTSYARYGIPEAANPVIDTLELARYLYPQFKRFGLGVLSKKFGVSLE--QHHRAIYDAEATGHLAWIFVKEAMDNHNMLYHDQLNEHIGEGDSYKRARPFHVTILAKNQAGLKDLFKLISMSNVEYFERVPRIPRSQLKKMRENLLIGSACDKGEIFEAMMQKGVEEARNRAK-FYDYIEVMPKAVYAPLIEQELVKNEHDLEEIIQNLVEIGKSLDKIVVATGNVHYLNEEDAIYRKILINS--MGGA-------NPLNRHSLPDVHFRTTDEMLTAFHFLGEET-AKEIVVENTNKIADICEEVI-PVKDELYTPKIPGSEDEISELSYTKAKQMYGDPLPEIIQKRLKKELNSINGNGFSVIYLIAQKLVHKSNEDGYLVGSRGSVGSSFVATMTGITEVNPLAPHYYCPECQYSEFFEDGTYGSGFDMPEKQCPKCGARLNKDGHDIPFETFLGFHGDKVPDIDLNFSGDYQAEAHNYTKVLFGEDYVYRAGTIGTVADKTAYGYVKGY-ERDNNLQFRSAEVDRLAKGATGVKRTTGQHPGGIIVIPDYMDVYDFTPIQYPADDQNSEWKTTHFDFHSIHDNVLKLDILGHDDPTVIRMLQDLSGIDPQTIPTDDPEVMRIFAGPEVLGVSQEQIYS--KTGTLGIPEFGTRFVRGMLEETHPTTFAELLQISGLSHGTDVWLGNAEELIRRGDATLAEVIGCRDDIMVYLIHAGLDSGMAFKIMETVRKGQWNKIPDELRETYLSAMKENNVPDWYIDSCSKIKYMFPKAHAAAYVLMALRVAYFKVYFPILYYCAYFSVRADDFDLVSMCKGKDAVKQAMKEITDKGLDASV------KEKNQLTVLELANEMLERGFKFGMIDLYKSDAVNFVIEGDTLIAPFRAVPSLGTNVAKQIVEARKDGPFLSKEDLATRGKVSKTLIEYMNDNGVLKDLPDENQLSLFD 1450
>gi|191638563|ref|YP_001987729.1| DNA polymerase III polC-type (PolIII) [Lactobacillus casei] >gi|190712865|emb|CAQ66871.1| DNA polymerase III polC-type (PolIII) [Lactobacillus casei BL23] (1444 aa)
Score = 2390, Expect = 0.0e+00, Identities = 532/1424 (37%), Positives = 839/1424 (58%)
  Q:    34 ITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVL---FNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPII-SENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSS-----------NAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTK-ISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK-YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDY-LIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +T ++Q+   +  + F+ +LP          L LV   +     ++V    T   E +  Y  Y V H     + GT   +EL       +   + +I +EN     YL       I++ L    +     GFS   +   +DE+     +      Q +   E  ++ +++              +TD       +  +T    ++  +  E ++ T+EG +F ++    ++  ++  + VTDYS S + K       ++ + + +++G W++ + S+Q D Y + ++T   ++I  +S P      D    KR EL  HTNM+  + +  I +  K + E G+ ++A+TD    Q +P+ ++ A K + LK +YGV+ N++D   P+   A++ + ++ A YV+FD+ETTGLS  YDK+IE  A+K   G  ++  +  I+P   +S+    +T I+++ V  +    +     + F   ++++ HN + FD+ FL+   E + +  I NP+IDTL++SR ++ +   H L  +A++YK+  +    HRA+ DAE   YLL   ++  E  K+  + TLN++N  +      +  R S   V+ K +  ++NL+KL+S S    F   P+V      +     +V ++ + GE+F A M   +   E   K   YD++ +     +   I   + K    ++D I++II I ++  K VVAT D +YL++ D +Y ++ ++++   G  N L +++     LP  +FR+T E+  +FS+L +    +++VV NSN IA+ +D +I P+K+ L++P + G  + LK  +   ++ ++GD + + V  R+D+E+ S+I NG+++IY  +  LV +S  DGY+VGSRGSVGSS+AA +  ITEVNPL PHY C NC+Y  F     + SGFDLP+  CPKC + L  DGH+IPFETF+GF GDK+PDIDLNFS  YQ  AH++IK MFGE+  FRAGTI T A+KTAYGYVK+Y E       R AEI R+A+    VKRTTGQHP GI++VP   D+YDFTP  YPADD+   W TTH  F S+HD++LK D+LGHD+PT+++ML + + V   +IP  D  VM LF+ T SL +    IN   K G+ GIPEFGT FV+ ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI++  +T+ +VI CRD+IM+ LI  G+   +AF IME VRKG+G+ +++QK + +N N+P WYIESC KI Y+FPKAHATAY++MA +IAWFK++YPL +Y +YFS+R + FD+ ++ +G+  +   + EI +K  +  T      KE  L+ + E+A E L RG+K   ID+ KS + +FL++ D+ ++ PF A+ GLGD+VA  IV AREEK F SKED   R KV+ T +  M    +   L +++Q+SLF+
  S:    36 VTIHEQSRRYDFTLGFDAILPFQTFNAIATKLPLVFQQIAATDLSVVVTQPTITDELLAQYWQYVVTH----AEIGTGIVRELCEKQVPTLENDRAVIKTENEQIRQYL-------IQQGLGKLEETYRQVGFSGLRMQAEVDEEQA---AQSMAAFQAQRAEETAKMAKAAAEVVKQQAAKQKQVQTDGPVQMGRQMKMTDAPQQMVTITQEERSVTVEGYVFDVEVRELRSKRQLLIFKVTDYSSSFIAKKFSNGPEDEAMFARIQKGQWLRVRGSVQEDNY-SRELTINAQDIQTVSHPDP--TDDAEGEKRVELHLHTNMSQMDAMNPISDYVKRAKEWGHKAIAVTDHAGLQAYPEAHSAAVK-AGLKMLYGVEINLVDDGTPVAYRADEPRDLASAEYVVFDVETTGLSAVYDKVIELAAVKMKDGKVIDQFEEMIDPGFPLSELTINLTHITDDMVHGSKSEVDVFKLFQQFCDGAIMVGHN-VTFDVGFLDNGYERHGLADIDNPVIDTLELSRMLHPERKNHKLDTLAKQYKVSLE--HHHRANADAEATGYLLYALEK--EAAKMYGMTTLNQLNDRVGAGDAYKAARPSHAIVFAKTQAGLKNLFKLVSLSNVKYFYRVPRVPRSQLQKLREGLLVGSACSNGEVFTAMMQKGEA--EARAKASFYDYLEVQPLPVYQPLIEAGLIKGEAHLKDIIQKIINIGSELEKPVVATGDAHYLDQHDAIYRQILIHSQ---GGANPLNRHS-----LPDVHFRSTSEMLTDFSWLGEEK-AHELVVDNSNLIANWVDDDITPVKDKLYTPEVPGVEENLKHDVMTTAHELYGDPLPDIVAQRLDKELKSIIGNGFSVIYNIAQRLVLKSNKDGYLVGSRGSVGSSLAATMAGITEVNPLPPHYRCPNCQYSEFFTHGEIGSGFDLPDKQCPKCGADLHKDGHDIPFETFLGFHGDKVPDIDLNFSGDYQPIAHNYIKVMFGEDHSFRAGTIGTVADKTAYGYVKAY-ERDTGQQLRGAEIDRLAQGDTGVKRTTGQHPAGILIVPADMDIYDFTPIQYPADDQNAAWMTTHFDFHSIHDNILKMDVLGHDDPTMIRMLQDLSGVEPKSIPTDDPGVMALFSGTKSLGVTPEQINS--KMGTLGIPEFGTRFVRGMLEETKPTTFSELLQISGLSHGTDVWLGNAEELIKQGIVTLKEVIGCRDNIMMDLIHWGMEDSMAFNIMEHVRKGRGIPDDWQKAMRENENVPDWYIESCLKIKYMFPKAHATAYILMALRIAWFKVHYPLIYYTAYFSVRAEDFDLAAMSHGKEAVKAAMKEITDKGMDAST------KEKQLLTVLEIANECLERGFKIKMIDVTKSDSHNFLIQDDHTILAPFRAVPGLGDNVAKQIVAAREEKPFLSKEDLANRGKVSKTLIDYMTTNHVLDDLPDENQLSLFD 1441
>gi|148543926|ref|YP_001271296.1| DNA polymerase III PolC [Lactobacillus reuteri F275] >gi|184153322|ref|YP_001841663.1| DNA polymerase III alpha subunit [Lactobacillus reuteri F275] >gi|166918295|sp|A5VJD5|DPO3_LACRF DNA polymerase III polC-type (PolIII) >gi|148530960|gb|ABQ82959.1| DNA polymerase III catalytic subunit, PolC type [Lactobacillus reuteri F275] >gi|183224666|dbj|BAG25183.1| DNA polymerase III alpha subunit [Lactobacillus reuteri F275] (1443 aa)
Score = 2390, Expect = 0.0e+00, Identities = 490/1236 (39%), Positives = 783/1236 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGL--IEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQ-DIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNT-QQVLEDIIKDKYDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +V ++ D+  E ++  +EG +F  +    ++G ++  + +TDY+ S  +K        +   + +K G+W+K +  +Q D +  + +     + E++ I++  +  + D    KR EL  HT M+  +   +I EL   + + G+ ++A+TD  N Q FP+ ++ A+K + +K +YG++ N++D  IP+V N N  +++  TYVIFD+ETTGLS  YDK+IE  A+K   G  +E    FI+P   +S++   +T I+ E V+ +   +E     KDF    ++  HN + FD+ F+N   E ++M  I  P+IDTL ++R +   + G+ L  +++K+K+  +    HRA+ D+E   ++  + L++ + + D+K ++++N +++ +      R   +T++ + +  ++NL+KL+S S    F   P++      ++    ++  + + GE+F A M     Q LE      YDFI +     +   + +  I   G +ED +K ++K+ ++  K VVAT D +YL+  D +Y ++ +N++  GG        N LN T  P+ +FRTTDE+ +EF+FL +    +++VV NSN IA+ ID NI+P+K+ L+ PH++GA  +++   +  +   +GD +   V+ RI+ E++S++ NG+++ Y  +  LV +S  DGY+VGSRGSVGSSV A L  ITEVNPL PHY C NC++ +F  +    SGFDLP+  CPKC + +  DGH+IPF+TF+GFKG+K+PDIDLNFS  YQ  AH+++K +FGE+ VFRAGTI T A+KTAYGYVK+Y  +++K   R AE  R+AK    VKRTTGQHP GI++VP   D+YDFTP  YPADD+T  W TTH  F S+HD++LK DILGHD+PT+++ L + + ++  +IP  D  VM LF+S   L +    I    KTG+ G+PEFGT FV+ ML  T P+ +S L++ISGLSHGT VW DNA+ LI++   TI++VI CRD+IM  LI  G+   I+F+IME VRKG+G+ +E+Q+ +++ N+P WY++SC KI Y+FP+AHA AYV+MA +IA+FK+Y+PL +Y ++FS+R   FD+ ++ +G+  +  ++ EI +K  +         KE +L+ I ELA E+L RG+KF  +D++KS A+D+L++GD LI PF A+ GLG +VA  IV AREE+ F SKED  +R KV+ T +  + +  +   L +++Q+SLF
  S:   229 NVIQMKDIEGEERSVVVEGYVFNAEIRELRSGRQLLTFEITDYTSSFSVKKFSRNSDEEAQFANIKAGMWLKVRGPVQEDTWMRDLVITAYDVNEVTHIARQDKAPQDD----KRVELHTHTTMSQMDATNSITELATRAHKWGHPAIAVTDHGNVQAFPEAFSVAQK-TGIKMLYGMEANVVDDGIPLVYNENHEELAHQTYVIFDVETTGLSAIYDKVIELSAVKMQDGNVLERFDEFIDPGFPLSEQTTNLTSITTEMVQGSKTEEEVFQMFKDFCKGCIIAGHN-VSFDMGFMNTGYERHQMGKIAEPVIDTLPLARFLYPDMRGYRLNTLSKKFKVALE--HHHRANYDSEATGHLLYKFLKDAEARYDVKYVDDLNKHMEENNAYRHARPFHVTIFAQTQAGLKNLFKLVSLSNVEYFYRVPRIPRTVLTKYREGLLLGTACSSGEVFTAMMEKGYDQALEK--ARYYDFIEVQPKPNYAPLLEQHVIADEGHLEDILKNMVKLGDELEKTVVATGDVHYLDPHDGIYRKILINSQ--GGA-------NPLNRTERPEVHFRTTDEMLNEFAFLGEEK-AHELVVENSNKIAAEIDDNIRPVKDKLYPPHMKGAEQEIQDRTWNTARKWYGDPLPQLVQDRIELELNSIVKNGFSVHYLIAQRLVAKSNKDGYLVGSRGSVGSSVVATLSGITEVNPLPPHYRCPNCQFTHFYTQGEYSSGFDLPDKKCPKCGTLMVKDGHDIPFQTFLGFKGNKVPDIDLNFSGDYQPIAHNYMKVLFGEKNVFRAGTIGTVADKTAYGYVKAYERDTEK-EFRKAEEDRLAKGATGVKRTTGQHPAGIIIVPDDMDIYDFTPVQYPADDQTAAWETTHFDFHSIHDNILKMDILGHDDPTMIRALQDLSGIDPQSIPMDDPGVMALFSSPKVLGVTEEQIQS--KTGTLGLPEFGTRFVRGMLEDTHPKNYSQLLQISGLSHGTGVWLDNAQELIKQGIATIANVIGCRDNIMTDLIHYGMDSEISFQIMEHVRKGRGIPDEWQEKMHEANVPQWYMDSCLKIKYMFPRAHAAAYVLMALRIAYFKVYFPLVYYCAFFSVRADDFDVVAMSHGKDAVKQRMKEINDKGNDASA------KEKNLLTILELANEMLERGFKFKMVDIEKSDASDWLIDGDSLIAPFRAVPGLGLNVAKQIVAAREERPFLSKEDLAERGKVSQTLIDFLTDNHVLDKLPDENQLSLF 1443
>gi|146319608|ref|YP_001199320.1| DNA polymerase III PolC [Streptococcus suis 05ZYH33] >gi|146321806|ref|YP_001201517.1| DNA polymerase III PolC [Streptococcus suis 98HAH33] >gi|166217454|sp|A4W428|DPO3_STRS2 DNA polymerase III polC-type (PolIII) >gi|166217456|sp|A4VXT1|DPO3_STRSY DNA polymerase III polC-type (PolIII) >gi|145690414|gb|ABP90920.1| DNA polymerase III, alpha subunit (gram-positive type) [Streptococcus suis 05ZYH33] >gi|145692612|gb|ABP93117.1| DNA polymerase III, alpha subunit (gram-positive type) [Streptococcus suis 98HAH33] (1463 aa)
Score = 2385, Expect = 0.0e+00, Identities = 506/1238 (40%), Positives = 771/1238 (62%)
  Q:   220 GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE----YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK--YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFK--YNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
            ++T + ++  E      EG +F++++  TKTG  I  + +TDY+ S  ++     +        +K+G W++ + +++ + +   D+T  ++E+  + K    IR D  L+    KR E   HTNM+  + L  +++L   ++  G+ +VAITD  N Q+FP  Y+ A+K + +K ++G++ NI++ ++PI  N  D  +SDATYV+FD+ETTGLS   + +I+  A K HKG  +     FI+P   +S     +T I++E V+ +  +++ L + +DF  DSV++AHN   FD+ F+N   E   + II  P+IDTL+ +R +      H LG + +++ +  +    H A+ DAE     L    K  LE   L +   LN++N+ L  +   ++ R    T+Y  N+  ++N++KL+S S T  F+G P++     N      I+  +  EGE+F+  +S     +++ +K    YDFI +  P  +   I +E +K    IE+ IK++I++  +    V+AT + +Y++  +E+Y  + V A   G   N       N     LPK +FRTT E+ DEF+FL +  L  +IV+TN N +    + +++ +K  L++P+IE A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +  SGFDLP+ +C KC +K K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+V+ Y  +  K   R+ E+ R+A     VKRTTGQHPGGI+V P   DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  TKP  FS+L+++SGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + + DN +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++PL++Y +YFSIR K FD+ ++  G   +  K+ EI  K  N +      N E DL    EL  E+L RG+KF  +DL KS ATDFL+E D LIPPF A+DGLG++VA  +V AR E  F SK + +KR  ++ T ++ M+E+GI   + ED+Q+SLF+
  S:   227 AEITPMIEVDSEENRIVFEGLVFEVEQKTTKTGRVIINFKMTDYTSSFTLQKWAKNEEEAQKFDMVKKGNWLRVRGNVETNNF-TRDLTMNVQEVQEVKKE---IRKD--LMPEGEKRVEFHAHTNMSTMDALPAVEDLVARAAAWGHKAVAITDHGNVQSFPHGYHAARK-AGIKPLFGMEANIVEDSVPIAYNEADVVLSDATYVVFDVETTGLSAVNNALIQIAASKMHKGNIIAEFDEFIDPGHPLSQFTTDLTGITDEHVRGSKPLEQVLREFQDFCQDSVMVAHNA-TFDVGFMNVNYERAGLPIISQPVIDTLEFARNLYPDFKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFLKDALEKHNLTN---LNQLNTELIAEDSYKKARVKHATLYVINQVGLKNMFKLVSLSNTKYFEGVPRIPRTVLNAHREGLILGTACQEGEVFDDLLSKG---IDEAVKTAAYYDFIEVMPPALYAPMIAKEQFKDMAEIEETIKQLIEVGRRAGLPVLATGNVHYIDPEEEIYREIIVRALGQGAPINWTIGNGENAQPAPLPKAHFRTTSEMLDEFAFLGES-LAREIVITNPNAMLDRFE-DVQVVKTDLYTPYIEKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVHRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSEFITDGSYGSGFDLPDKDCEKCGTKYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEENAFRAGTVGTVAAKTAYGFVRGYERDYGKF-YRDVEVERLAAGAAGVKRTTGQHPGGIIVFPDYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMVRKLQDLSGIDPQTIPADDKGVMALFSGTEILGVTPEQIGT--PTGMLGIPEFGTNFVRGMVEETKPTTFSELLQLSGLSHGTDVWLGNAQDLIKAGIANLSTVIGCRDDIMVYLMHAGLPPKMAFNIMERVRKGLWLKISEEERNGYIQAMKDNKVPDWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPLYYYCAYFSIRAKAFDLATMSGGLERVKAKMEEIALKKKNNEA----SNVEQDLYTTLELVNEMLERGFKFGKLDLYKSHATDFLIEEDTLIPPFVAMDGLGENVAKQVVAARAEGEFLSKTELRKRGGLSGTLVEKMDEMGILGKMPEDNQLSLFD 1460
>gi|116492651|ref|YP_804386.1| DNA polymerase III PolC [Pediococcus pentosaceus ATCC 25745] >gi|122265885|sp|Q03FS8|DPO3_PEDPA DNA polymerase III polC-type (PolIII) >gi|116102801|gb|ABJ67944.1| DNA polymerase III catalytic subunit, PolC type [Pediococcus pentosaceus ATCC 25745] (1437 aa)
Score = 2385, Expect = 0.0e+00, Identities = 547/1426 (38%), Positives = 858/1426 (60%)
  Q:    31 DFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDI----LNYLIYFV-NHNIEQK------QKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQ----EKIKNEITEVKRSSNA-----------KKTDSSFTYKFR--KSVTG--DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLEN-QKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK--YDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           D T+  N +  + + +  FN +LP  I + F   L     S+   + F+ DT N+ ++     +Y  + + N  I+         K   E K+   V+K +  I K  ++++   L  L N  +K                GF    +   +D+ T       + ++Q    EKIK +   V++++ A            K    F  K +  K + G  ++ +L D+  E ++ +IEG IF  +    ++  ++  + VTDY+ SI IK     + ++ + S +K+G+WV+ + SIQ D +   D+T    +I  +       R D A  KR EL  HTNM+  +    I +L   +++ G+ +VA+TD    Q FP+ +   KK S +K ++GV+ N++D  +PI  N+    +    YVIFD+ETTGLS  YDK+IE  A+K   G  ++  + FI+P   +S+    +T I++E V+ ++  KE   K ++F  D++++ HN + FD+ F+N     + M+ IKNP+IDTL ++R +   + G+ L  +A+K+ +  +    HRA  D+E   ++    L++ ++   I+  +++N ++  +   +  R S   +  K +  ++NL+KL+S S    +   P++      +     IV ++ + G++F A M   Q+   D  +    YD++ +     +   I +E +     +E+ I  I+K+    +  VVAT D +YLN  D +Y ++ +N++  GG        N LN + LP  +FRTTDE+ ++FSFL  P + + IVV NSN IA  +D  I P+K+ L++P + GA D++KQL   ++++++G+ +   V+ R+D+E++S+I NG+++IY  +  LV +S  DGY+VGSRGSVGSS  A +  ITEVNPL PHY C  C+Y  F  +    SG+DLP+  CP+C + + GDG +IPFETF+GFKGDK+PDIDLNFS  YQ  AH++++ +FG++ VFRAGTI T A+KTA+GYVK+Y E     + R AEI R+AK    VKRTTGQHP GI++VP   DVYDF+P  YPADD+T  W TTH  F S+HD++LK DILGHD+PT+++ L + + ++ +TIP  D  VM +F+  + L +    I    KTG+ GIPEFGT FV+ ML  T P  +S+L++ISGLSHGT+VW  NA+ LI+   +T+ +VI CRD+IM+ LI  G+    +F+IME VRKGKG+ E Y+  +   N+P WYIESC KI Y+FP+AHA+AYV+MA +IA+FK+YYPL +YA+YF++R   FDI S+  G+  + N++ EI +K  +  T      KE +L+ + ELA E+L RG++F  ID++KS A ++L+EG  LI PF+A+ GLG +VA  IV AR +K F SKED  KR  V+ T +  M E  + S L +++Q+SLF
  S:    31 DLTVHSNSKRWTFSFE--FNDILPLQIFVEFHHQLVNTFGSIA-QIDFSIDTINKNNVATHATDYWDWIIKNSGIQSSLLQVLCDKSIPEFKDGQLVVKVDNQITKNFLNDDV--LQTLSNTYQKV---------------GFGPIKIKPTIDDNTA------QERLQAYHEEKIKRDQAIVQKATEAIKKAESKKKASDKAMPEFNGKVQMGKPINGKDNIVQLRDITQEERSVSIEGYIFDAEVKTLRSERQLLIFKVTDYTSSITIKKFSRNEADEQLFSAIKKGLWVRVRGSIQEDSFMK-DLTMNAYDIMEVDHAD---RQDTATDKRVELHLHTNMSTMDATNGISDLVGQAAKWGHPAVAVTDHAGLQAFPEAHAAGKK-SGIKTLFGVEANLVDDGVPIGYNSEHCPLKGGKYVIFDVETTGLSAIYDKVIELSAVKMENGNVIDQFEEFIDPGFPLSETTINLTSITDEMVRGSMSEKEVFTKFREFYEDAIIVGHN-VTFDIGFMNTGYLRHGMEEIKNPIIDTLTLARFLYPTLKGYRLNTLAKKFGVALE--HHHRAIYDSETTGHLCYLFLKDAEERYGIEYHDQLNDHMTENEAYKHARPSHAILIAKTQAGLKNLFKLVSMSNVKYYYRVPRIPRSELEKLREGIIVGSACSSGDVFTAMM---QKGYADARRKAKFYDYLEVMPKPVYQPLIEQELVSDNKKLEEIIANIVKLGEDLDIPVVATGDVHYLNPQDYIYRKILINSQ--GGA-------NPLNRSELPDVHFRTTDEMLEDFSFLG-PEVAHKIVVENSNKIADSVDDGISPVKDKLYTPKMPGAEDRIKQLSMDRAHALYGEVLPEIVQERLDKELTSIIGNGFSVIYLIAQRLVHKSNKDGYLVGSRGSVGSSFVATMSGITEVNPLPPHYRCPKCQYSFFYTKGEYGSGYDLPDKECPECGTWMIGDGQDIPFETFLGFKGDKVPDIDLNFSGDYQPIAHNYMQVLFGKDNVFRAGTIGTVADKTAFGYVKAY-ERDTNQHLRGAEIERLAKGATGVKRTTGQHPAGILIVPDYMDVYDFSPIQYPADDQTAAWETTHFDFHSIHDNILKMDILGHDDPTMIRKLQDLSGIDPETIPTDDPGVMKIFSGPEVLGVDENQIQS--KTGTLGIPEFGTRFVRGMLEETHPTSYSELLQISGLSHGTDVWLGNAEELIKAGTVTLKEVIGCRDNIMMDLIHYGLDSQSSFQIMESVRKGKGIPEGYEDKMRAANVPDWYIESCGKIKYMFPRAHASAYVLMALRIAYFKVYYPLVYYAAYFTVRADDFDIVSMARGKESLKNRMQEINDKGNDAST------KEKNLLTVLELANEMLERGFEFKMIDIEKSDAEEWLIEGKSLIAPFNALPGLGLNVAKQIVAARADKPFLSKEDLSKRGHVSQTLIDFMTENNVLSELPDENQLSLF 1437
>gi|81177036|ref|ZP_00875942.1| DNA polymerase III, epsilon subunit:DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus suis 89/1591] >gi|80976267|gb|EAP39894.1| DNA polymerase III, epsilon subunit:DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus suis 89/1591] (1463 aa)
Score = 2382, Expect = 0.0e+00, Identities = 505/1238 (40%), Positives = 772/1238 (62%)
  Q:   220 GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE----YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK--YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFK--YNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
            ++T + ++  E      EG +F++++  TKTG  I  + +TDY+ S  ++     +        +K+G W++ + +++ + +   D+T  ++E+  + K    IR D  L+    KR E   HTNM+  + L  +++L   ++  G+ +VAITD  N Q+FP  Y+ A+K + +K ++G++ NI++ ++PI  N  D  +SDATYV+FD+ETTGLS   + +I+  A K HKG  +     FI+P   +S     +T I++E V+ +  +++ L + +DF  DSV++AHN   FD+ F+N   E   + II  P+IDTL+ +R +      H LG + +++ +  +    H A+ DAE     L    K  LE   L +   LN++N+ L  +   ++ R    T+Y  N+  ++N++KL+S S T  F+G P++     N      I+  +  EGE+F+  +S     +++ +K    YDFI +  P  +   I +E +K    IE+ IK++I++  +    V+AT + +Y++  +E+Y  + V A   G   N       N     LPK +FRTT E+ DEF+FL +  L  +IV+TN N +    + +++ +K  L++P+IE A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +  SGFDLP+ +C KC +K K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+V+ Y  +  K   R+ E+ R+A     VKRTTGQHPGGI+V P   DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  TKP  FS+L+++SGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + + DN +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++PL++Y +YFSIR K FD+ ++  G  ++  K+ EI  K  N +      N E DL    EL  E+L RG+KF  +DL KS ATDFL+E + LIPPF A+DGLG++VA  +V AR E  F SK + +KR  ++ T ++ M+E+GI   + ED+Q+SLF+
  S:   227 AEITPMIEVDSEENRIVFEGLVFEVEQKTTKTGRVIINFKMTDYTSSFTLQKWAKNEEEAQKFDMVKKGNWLRVRGNVETNNF-TRDLTMNVQEVQEVKKE---IRKD--LMPEGEKRVEFHAHTNMSTMDALPAVEDLVARAAAWGHKAVAITDHGNVQSFPHGYHAARK-AGIKPLFGMEANIVEDSVPIAYNEADVVLSDATYVVFDVETTGLSAVNNALIQIAASKMHKGNIIAEFDEFIDPGHPLSQFTTDLTGITDEHVRGSKPLEQVLREFQDFCQDSVMVAHNA-TFDVGFMNVNYERAGLPIISQPVIDTLEFARNLYPDFKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFTFLKDALEKHNLTN---LNQLNTELIAEDSYKKARVKHATLYVINQVGLKNMFKLVSLSNTKYFEGVPRIPRTVLNAHREGLILGTACQEGEVFDDLLSKG---IDEAVKTAAYYDFIEVMPPALYAPMIAKEQFKDMAEIEETIKQLIEVGRRAGLPVLATGNVHYIDPEEEIYREIIVRALGQGAPINWTIGNGENAQPAPLPKAHFRTTSEMLDEFAFLGES-LAREIVITNPNAMLDRFE-DVQVVKTDLYTPYIEKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVHRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSEFITDGSYGSGFDLPDKDCEKCGTKYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEENAFRAGTVGTVAAKTAYGFVRGYERDYGKF-YRDVEVERLAAGAAGVKRTTGQHPGGIIVFPDYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMVRKLQDLSGIDPQTIPADDKGVMALFSGTEILGVTPEQIGT--PTGMLGIPEFGTNFVRGMVEETKPTTFSELLQLSGLSHGTDVWLGNAQDLIKAGIANLSTVIGCRDDIMVYLMHAGLPPKMAFNIMERVRKGLWLKISEEERNGYIQAMKDNKVPDWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPLYYYCAYFSIRAKAFDLATMSGGLDKVKAKMEEIALKKKNNEA----SNVEQDLYTTLELVNEMLERGFKFGKLDLYKSHATDFLIEDNTLIPPFVAMDGLGENVAKQVVAARAEGEFLSKTELRKRGGLSGTLVEKMDEMGILGKMPEDNQLSLFD 1460
>gi|194467743|ref|ZP_03073729.1| DNA polymerase III, alpha subunit [Lactobacillus reuteri 100-23] >gi|194452596|gb|EDX41494.1| DNA polymerase III, alpha subunit [Lactobacillus reuteri 100-23] (1443 aa)
Score = 2377, Expect = 0.0e+00, Identities = 490/1236 (39%), Positives = 784/1236 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGL--IEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQ-DIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNT-QQVLEDIIKDKYDFITIG-----SPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +V ++ D+  E ++  +EG +F  +    ++G ++  + +TDY+ S  +K        +   + +K G+W+K +  +Q D +  + +     + E++ +++  +  + D    KR EL  HT M+  +   +I EL   + + G+ ++A+TD  N Q FP+ ++ A+K + +K +YG++ N++D  IP+V N N  +++  TYVIFD+ETTGLS  YDK+IE  A+K   G  +E    FI+P   +S++   +T I+ E V+ +   +E     KDF    ++  HN + FD+ F+N   E ++M  I  P+IDTL ++R +   + G+ L  +++K+K+  +    HRA+ D+E   ++  + L++ + + D+K ++++N +++ +      R   +T++ + +  ++NL+KL+S S    F   P++      ++    ++  + + GE+F A M     Q LE      YDFI +      +P    H I  E +    +ED +K ++K+ ++  K VVAT D +YL+  D +Y ++ +N++  GG        N LN T  P+ +FRTTDE+ ++F+FL +    +++VV NSN IA+ ID NI+P+K+ L+ PH++GA  +++   +  +   +GD +   V+ RI+ E++S++ NG+++ Y  +  LV +S  DGY+VGSRGSVGSSV A L  ITEVNPL PHY C NC++ +F  +    SGFDLP+  CPKC + +  DGH+IPF+TF+GFKG+K+PDIDLNFS  YQ  AH+++K +FGE+ VFRAGTI T A+KTAYGYVK+Y  +++K   R AE  R+AK    VKRTTGQHP GI++VP   D+YDFTP  YPADD+T  W TTH  F S+HD++LK DILGHD+PT+++ L + + ++  +IP  D  VM LF+S   L +    I    KTG+ G+PEFGT FV+ ML  T P+ +S L++ISGLSHGT VW DNA+ LI++   TI++VI CRD+IM  LI  G+   I+F+IME VRKG+G+ +E+Q+ +++ N+P WY++SC KI Y+FP+AHA AYV+MA +IA+FK+Y+PL +Y ++FS+R   FD+ ++ +G+  +  ++ EI +K  +         KE +L+ I ELA E+L RG+KF  +D++KS A+D+L++GD LI PF A+ GLG +VA  IV AREE+ F SKED  +R KV+ T +  + +  +   L +++Q+SLF
  S:   229 NVIQMKDIEGEERSVVVEGYVFNAEIRELRSGRQLLTFEITDYTSSFAVKKFSRNSDEEAQFANIKAGMWLKVRGPVQEDTWMRDLVITAYDVNEVTHVARQDKAPQDD----KRVELHTHTTMSQMDATNSITELATRAHKWGHPAIAVTDHGNVQAFPEAFSVAQK-TGIKMLYGMEANVVDDGIPLVYNENHEELAHQTYVIFDVETTGLSAIYDKVIELSAVKMQDGNVLERFDEFIDPGFPLSEQTTNLTSITTEMVQGSKTEEEVFQMFKDFCKGCIIAGHN-VAFDMGFMNTGYERHQMGKIAEPVIDTLPLARFLYPDMRGYRLNTLSKKFKVALE--HHHRANYDSEATGHLLYKFLKDAEARYDVKYVDDLNKHMEENNAYRHARPFHVTIFAQTQAGLKNLFKLVSLSNVEYFYRVPRIPRTVLTKYREGLLLGTACSSGEVFTAMMEKGYDQALEK--ARYYDFIEVQPKPNYAPLLEQHVIADEEH----LEDILKNMVKLGDELEKTVVATGDVHYLDPHDGIYRKILINSQ--GGA-------NPLNRTERPEVHFRTTDEMLNKFAFLGEEK-AHELVVENSNKIAAEIDDNIRPVKDKLYPPHMKGAEQEIQDRTWNTARKWYGDPLPQLVQDRIELELNSIVKNGFSVHYLIAQRLVAKSNKDGYLVGSRGSVGSSVVATLSGITEVNPLPPHYRCPNCQFTHFYTQGEYSSGFDLPDKKCPKCGTLMVKDGHDIPFQTFLGFKGNKVPDIDLNFSGDYQPIAHNYMKVLFGEKNVFRAGTIGTVADKTAYGYVKAYERDTEK-EFRKAEEDRLAKGATGVKRTTGQHPAGIIIVPDDMDIYDFTPVQYPADDQTAAWETTHFDFHSIHDNILKMDILGHDDPTMIRALQDLSGIDPQSIPMDDPGVMALFSSPKVLGVTEEQIQS--KTGTLGLPEFGTRFVRGMLEDTHPKNYSQLLQISGLSHGTGVWLDNAQELIKQGIATIANVIGCRDNIMTDLIHYGMDSEISFQIMEHVRKGRGIPDEWQEKMHEANVPQWYMDSCLKIKYMFPRAHAAAYVLMALRIAYFKVYFPLVYYCAFFSVRADDFDVVAMSHGKDAVKQRMKEINDKGNDASA------KEKNLLTILELANEMLERGFKFKMVDIEKSDASDWLIDGDSLIAPFRAVPGLGLNVAKQIVAAREERPFLSKEDLAERGKVSQTLIDFLTDNHVLDKLPDENQLSLF 1443
>gi|116333947|ref|YP_795474.1| DNA polymerase III PolC [Lactobacillus brevis ATCC 367] >gi|122269369|sp|Q03QS9|DPO3_LACBA DNA polymerase III polC-type (PolIII) >gi|116099294|gb|ABJ64443.1| DNA polymerase III catalytic subunit, PolC type [Lactobacillus brevis ATCC 367] (1445 aa)
Score = 2376, Expect = 0.0e+00, Identities = 518/1332 (38%), Positives = 810/1332 (60%)
  Q:   126 PIISENAIFLHYLENDQEKCIKKYLEH-----FRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKN----------EITEVKRSSNAKKTDSSFTYKFRKSVTGD--VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLEN-QKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK-YDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN-TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           P + EN   L Y +N+    +K +L +             GF K ++  ++DE       D     QEK             E    KR S      +    +  K++ GD  VTK+ D+  E ++  +EG +F+ +    ++G ++    +TDY+ S  +K       ++   + ++EG WVK + ++Q D Y ++    L      I++ K   R D A    KR EL  HT+M+  +   +I +  K + + G  ++AITD  + Q FP  +N A K + +K +YGV+ N++D  +PI  N+    +  ATYV+FD+ETTGLS  YDK+IE  A+K      V+  + FI+P   +S++   +T I+++ V  +   +E     ++F GD++++ HN + FD+ F+N   + + M  I NP+IDTL ++R +   +  + L  +A+++ +  +    HRA  DAE   ++    L++ +   DI+  +++N ++ ++   +  R +   +  K +  ++N++KL+S S    +   P+V      E+    IV ++ + GE+F A M   Q  +E   K K YD++ +     +   I    I  R  +E+ ++ ++K+ +  NK VVAT D ++LN  D +Y ++ ++++  GG        N LN   LP  +F TTDE+  +F++L +     +IVVTN+  IA  ID  + P+K+ L++P +EGA D+++Q     +++++GD +   V+ R+DRE+ S+I NG+++IY  +  LV +S  DGY+VGSRGSVGSS+ A L  ITEVNPL PHY C  C+Y +F  +    SG+DLPE +CP+C + + GDGHNIPFETF+GFKG+K+PDIDLNFS  YQ  AH++ K +FGE+ V+RAGTI T A+KTAYGYVK+Y E   +   R AEI R+AK    VKRTTGQHP GI+VVP   D++DFTP  YPADD++  W TTH  F S+HD++LK DILGHD+PT+++ L + + V+  TIP  D  VM LF+ TDSL +    I    KTG+ G+PEFGT FV+ ML  T PQ +S L++ISGLSHGT+VW  NA+ LI+    TI++VI CRD+IM  LI+ G+    +F++ME VRKG+G+ +E+Q+ +   + P WYI+SC KI Y+FP+AHA AYV+MA ++A+FK+Y+P+ +YA+YFS+R   FD+ ++  G++ +   +  I ++  +         K+ +L+ + ELA E+L RG+KF  IDL+KS A D++++GD LI PF A  GLG +VA  IV AR ++ F SKED  KR KV+ T +  M E G+ + L +++Q+SLF+
  S:   119 PELDENNRVLLYAQNE---VVKDFLSNQALGPIESAYRRAGFPKFNIHVMIDESKSQAKIDEFKARQEKTDAQLAQQAAAAIEKANQKRQSQGDTPAAEGPTQIGKAIKGDQPVTKMIDITQEERSVVVEGYVFEKEVRKLRSGRQLLTLKITDYTSSFAVKKFSRGAEDEAQFAGVEEGSWVKVRGNVQEDTYMHD----LALNAYDINQVKHASRQDTAPEGEKRVELHLHTSMSQMDATNSIGDYVKQAKKWGMPALAITDHADVQGFPAAFNSAAK-AGIKMLYGVEANLVDDGVPIGYNSAHVPLDGATYVVFDVETTGLSAIYDKVIELSAVKMEHQNVVDQFEEFIDPGFPLSEQTTNLTSITDDMVAGSKSEEEVFKLFREFCGDAIIVGHN-VTFDVGFMNTGYQRHGMAEISNPIIDTLTLARFLYPTLKSYRLNTLAKRFHVSLE--HHHRAVYDAESTGHLNYLFLKDAEDRYDIQYHDQLNDHMTDNDAYKHARPNHAILLAKTQAGLKNMFKLVSASNVDYYYRVPRVPRSVLEEYREGIIVGSACSSGEVFTAMMQKGQ--VEAAAKAKFYDYLEVQPSAAYQPLIDSGLIADRENMEEIVRNMVKLGHDLNKPVVATGDVHFLNPDDYIYRKILIHSQ--GGA-------NPLNRQELPDVHFMTTDEMLTDFAYLGEET-AKEIVVTNTQKIADDID-EVHPLKDKLYTPRMEGAEDEIRQRTMDTAHAMYGDPLPELVQHRVDRELKSIIGNGFSVIYLIAQRLVAKSNKDGYLVGSRGSVGSSLVATLTGITEVNPLPPHYRCPKCQYSHFYTKGEYSSGYDLPEKDCPECGTLMIGDGHNIPFETFLGFKGNKVPDIDLNFSGDYQPIAHNYTKVLFGEKNVYRAGTIGTVADKTAYGYVKAY-ERDTEQTFRGAEIDRLAKGATGVKRTTGQHPAGIIVVPDYMDIFDFTPIQYPADDQSAAWQTTHFDFHSIHDNILKIDILGHDDPTMIRTLQDLSGVDPTTIPMDDPGVMGLFSGTDSLGVTPEQIQS--KTGTLGVPEFGTRFVRGMLEETHPQNYSQLLQISGLSHGTDVWLGNAEELIKNGTATIANVIGCRDNIMTDLINFGLDSETSFQVMEHVRKGRGIPDEWQEKMKATDCPDWYIDSCLKIKYMFPRAHAAAYVLMALRVAYFKVYFPIIYYAAYFSVRADDFDVVAMSQGKTAVKAAMKAINDQGMDASA------KDKNLLTVLELANEMLERGFKFKMIDLEKSDAADWIIDGDTLIAPFKAAPGLGLNVAKQIVAARNDRPFISKEDLAKRGKVSKTLIDFMTENGVLAGLPDENQLSLFD 1442
>gi|168180697|ref|ZP_02615361.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum NCTC 2916] >gi|182668382|gb|EDT80361.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum NCTC 2916] (1432 aa)
Score = 2373, Expect = 0.0e+00, Identities = 538/1285 (41%), Positives = 795/1285 (61%)
  Q:   174 KTIDIISDH--KNKIQEKIKNEITEVKRSSNAKKT----DSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           KTI+ +     KN + E IK++  +V R  N+ KT    +   +    +S+  D   + DL        + G++FK + + TKTG +I  +F+TDY++S+ +K     K    ++ E+KEG++ K +  +  D Y    +    +    I K  +  + D A  KR EL  H+ M+A +G+  + EL K +++ G+ +VAITD    Q +PD  + AKK   +K IYG++  ++D  +PIV  A D  I D T+V+FD+ETTG S   DKIIE GA+K  KG  V+    F+NP+  I DKI  +T I++  V D   I + L +  DFIGDSV++AHN   FD+ F+N   ++ K++  +N ++DT+ +SR +  ++  H L VIA+   I  +    HRA  DA+   +I  +  E  + ++I TL+ +N     +   ++     + +  KN   ++NLYKL+S S    F   P++     NE+    I+ ++   G+I+ E     T++ L+++I D YD++ I   G+ E  + +    +     +E+  K+I ++   YNK VVAT D ++L+E  EV+ R+ ++ +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +ID  IKPI E    P IEGA + ++++  +K++SI+GD +   V+ R+ +E++S+I+NGYA++Y  +H LV +S +DGY+VGSRGSVGSS AA + DITEVN L PHY+C  CKY  F  + +V SG DL + +CP C +KL  DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E K + A NAEI R++K C  VKRT+GQHPGGI+VVP   ++++FTP  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T V+  ++P  D  V+ LF S ++L +    I+     G+ G+PEFGT FV++MLL TKP+ F++L+RISGLSHGT+VW +NA+Y I+E   TI D IS RDDIMVYL+ K + P  AF IME VRKGKGL EE + ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YFS+R   FD   I+ GE +I  K+NE+     N      +  K+  L+ I E+  E+  RG KF  +DL KS AT FL+EGD + PP SA+ G+G + A SI +AR E  F SKED + RTKVT T ++ +E  G    + E +QISLF+ 
  S:   172 KTIETMEKSMIKNALSE-IKSKEKKVIRKENSPKTREEENKDTSILLGRSIKEDSIFMKDLNENSGIVVVCGDVFKKEVIETKTGRKIVTFFITDYTNSMTVKLFPRPKDADRIIEEIKEGIYCKVRGEVVNDPYARECVIMAKD----IVKTTKIEKMDIAEEKRVELHMHSQMSAMDGMTPVSELVKRAAKWGHKAVAITDHGVVQAYPDAMSAAKK-GNIKVIYGIEAYLVDDGVPIVSKAGDKTIED-TFVVFDLETTGFSSKNDKIIEIGAVKIEKGKIVDRFSEFVNPKRTIPDKITELTSITDNMVDDKETIDKILPRFIDFIGDSVVVAHNA-SFDVSFINKNCKDLKIEF-ENSVMDTVTLSRFLFPELKRHKLNVIAKHLGISLE--NHHRAVDDAKATADILLKSFEMLREKEIITLHSLNKEFLGNINIKKEPTHHLIILAKNAVGLKNLYKLVSKSNLEYFFKRPRMAKSLINEYKEGLIIGSACEAGQIYKEILKGKTKEELKNMI-DFYDYLEIQPLGNNEFLVKN--GSVKDEKELEEINKKICELGEFYNKPVVATCDVHFLDEEHEVFRRILMSGQGFSDADNQ-----------PPLYFRTTEEMLKEFEYLGEEK-AKEVVIYNTNKIADMID-EIKPIPEETFPPKIEGAEEDIRRMTIEKAHSIYGDPLPEIVEKRLTKELNSIINNGYAVLYLIAHKLVAKSYEDGYLVGSRGSVGSSFAATMSDITEVNGLPPHYVCPKCKYSEFFTDGSVGSGADLEDKDCPNCGTKLIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHKYTEVLFGKGHVFKAGTIGTIAEKTAYGFVKKYLDE-KNIKANNAEIERLSKGCTGVKRTSGQHPGGIMVVPADNEIFNFTPIQHPADDTESDVITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTQVDPKSVPLGDPKVISLFTSPEALGVTEEDID--CPVGTYGLPEFGTKFVRQMLLDTKPKSFAELVRISGLSHGTDVWLNNAQYFIKEGYTTIKDCISTRDDIMVYLLQKELPPKSAFTIMEKVRKGKGLTEEQEALMKEHDVPDWYIESCKKIKYMFPKGHAVAYVMMAMRIAYFKVYYPRAYYATYFSVRADDFDADLIVKGEEKIKEKMNELYAMGNN------ITQKDKGLLTILEICYEMYKRGIKFLKVDLYKSNATKFLIEGDSIRPPLSALQGVGKNAAKSIEEARLEGEFISKEDLRLRTKVTKTVIETLENHGCLRGMQETNQISLFSL 1432
>gi|148380379|ref|YP_001254920.1| DNA polymerase III, alpha subunit [Clostridium botulinum A str. ATCC 3502] >gi|153932951|ref|YP_001384598.1| DNA polymerase III PolC [Clostridium botulinum A str. ATCC 19397] >gi|153935522|ref|YP_001388114.1| DNA polymerase III PolC [Clostridium botulinum A str. Hall] >gi|148289863|emb|CAL83971.1| DNA polymerase III PolC-type [Clostridium botulinum A str. ATCC 3502] >gi|152928995|gb|ABS34495.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum A str. ATCC 19397] >gi|152931436|gb|ABS36935.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum A str. Hall] (1432 aa)
Score = 2370, Expect = 0.0e+00, Identities = 534/1282 (41%), Positives = 795/1282 (62%)
  Q:   177 DIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKD-VLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           +++S+ K+K ++ I+ E +   R    K T    +    +S+  D   + DL        + G++FK + + TKTG +I  +F+TDY++S+ +K LF +  + D ++ E+KEG++ K +  +  D Y    +    +    I K  +  + D A  KR EL  H+ M+A +G+  + EL K +++ G+ +VAITD    Q +PD  + AKK   +K IYG++  ++D  +PIV  A D  I D T+V+FD+ETTG S   DKIIE GA+K  KG  V+    F+NPE  I DKI  +T I+++ V D   I + L +  DFIGDSV++AHN   FD+ F+N   ++ K++  +N ++DT+ +SR +  ++  + L VIA+   I  +    HRA  DA+   +I  +  E  + ++I TL+ +N     +   ++     + +  KN   ++NLYKL+S S    F   P++     NE+    I+ ++   G+I+ E     T++ L+++I D YD++ I   G+ E  + +    +     +E+  K+I ++   YNK VVAT D ++L+E  EV+ R+ ++ +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +ID  IKPI E    P IEGA + ++++  +K++SI+GD +   V+ R+ +E++S+I+NGYA++Y  +H LV +S +DGY+VGSRGSVGSS AA + DITEVN L PHY+C  CKY  F  + +V SG DL + +CP C +KL  DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E K + A NAEI R++K C  VKRT+GQHPGGI+VVP   ++++FTP  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T V+  ++P  D  V+ LF S ++L +    I+     G+ G+PEFGT FV++MLL TKP+ F++L+RISGLSHGT+VW +NA+Y I+E   TI D IS RDDIMVYL+ K + P  AF IME VRKGKGL EE + ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YFS+R   FD   I+ GE +I  K+NE+     N      +  K+  L+ I E+  E+  RG KF  +DL KS AT FL+EGD + PP SA+ G+G + A SI +AR E  F SKED + RTK T T ++ +E  G    + E +QISLF+ 
  S:   184 NVLSEIKSKEKKVIRKENSPKTREEENKDT----SVILGRSIKEDSIFMKDLNENSGIVVVCGDVFKKEVIETKTGRKIVTFFITDYTNSMTVK-LFPRPRDADRIIEEIKEGIYCKVRGEVVNDPYARECVIMAKD----IVKTTKIEKMDIAEEKRVELHMHSQMSAMDGMTPVSELVKRAAKWGHKAVAITDHGVVQAYPDAMSAAKK-GNIKVIYGIEAYLVDDGVPIVSKAGDKTIED-TFVVFDLETTGFSSKNDKIIEIGAVKIEKGKIVDRFSEFVNPERSIPDKITELTSITDDMVDDKEAIDKILPRFIDFIGDSVVVAHNA-SFDVSFINKNCKDLKIEF-ENSVMDTVTLSRFLFPELKRYKLNVIAKHLGISLE--NHHRAVDDAKATADILLKSFEMLREKEIITLHSLNKEFLGNINIKKEPTHHLIILAKNAVGLKNLYKLVSKSNLEYFFKRPRMAKSLINEYKEGLIIGSACEAGQIYKEILKGKTKEELKNMI-DFYDYLEIQPLGNNEFLVKN--GSVKDEKELEEINKKICELGEFYNKPVVATCDVHFLDEEHEVFRRILMSGQGFSDADNQ-----------PPLYFRTTEEMLKEFEYLGEEK-AKEVVIYNTNKIADMID-EIKPIPEETFPPKIEGAEEDIRRMTIEKAHSIYGDPLPEIVEKRLTKELNSIINNGYAVLYLIAHKLVAKSYEDGYLVGSRGSVGSSFAATMSDITEVNGLPPHYVCPKCKYSEFFTDGSVGSGADLEDKDCPNCGTKLIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHKYTEVLFGKGHVFKAGTIGTIAEKTAYGFVKKYLDE-KNIKANNAEIERLSKGCTGVKRTSGQHPGGIMVVPADNEIFNFTPIQHPADDTESDVITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTQVDPKSVPLGDPKVISLFTSPEALGVTEEDID--CPVGTYGLPEFGTKFVRQMLLDTKPKSFAELVRISGLSHGTDVWLNNAQYFIKEGYTTIKDCISTRDDIMVYLLQKELPPKSAFTIMEKVRKGKGLTEEQEALMKEHDVPDWYIESCKKIKYMFPKGHAVAYVMMAMRIAYFKVYYPRAYYATYFSVRADDFDADLIVKGEEKIKEKMNELYAMGNN------ITQKDKGLLTILEICYEMYKRGIKFLKVDLYKSNATKFLIEGDSIRPPLSALQGVGKNAAKSIEEARLEGEFISKEDLRLRTKATKTVIETLENHGCLRGMQETNQISLFSL 1432
>gi|169833032|ref|YP_001693801.1| DNA polymerase III, alpha subunit [Streptococcus pneumoniae Hungary19A-6] >gi|168995534|gb|ACA36146.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae Hungary19A-6] (1463 aa)
Score = 2368, Expect = 0.0e+00, Identities = 514/1327 (38%), Positives = 832/1327 (62%)
  Q:   131 NAIFLHYLEN-DQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAK----------------KTDSSFTYKFRKSVT------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           N +F+   E  D+E   K +L +  K L  +GF   +      EK  D+++  +   +E   +E  ++ +++N +                +   +F ++ +K+         ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++  EGE+F+A +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CPKC  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I +++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   122 NQLFIEGSEAIDKEHFKKNHLPNLTKQLEKFGFPTFNCQV---EKN-DVLTQEQ---EEAFHSENEQIVQAANEEALRAMEQLEQMAPPPAEEKPAFDFQAKKAEAKPKLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDV------QEVVHYERKDLMPEGDRRVEFHAHTNMSTMDALPEVEEIVATATKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVERDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHGLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACAEGEVFDAVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKNLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALADIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPNKDCPKCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNEIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLDAIKHRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|170761721|ref|YP_001787734.1| DNA polymerase III, alpha subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169408710|gb|ACA57121.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum A3 str. Loch Maree] (1432 aa)
Score = 2367, Expect = 0.0e+00, Identities = 537/1285 (41%), Positives = 796/1285 (61%)
  Q:   174 KTIDIISDH--KNKIQEKIKNEITEVKRSSNAKKT----DSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           KTI+ +     KN + E I+++  +V R  N+ K     +   +    +S+  D   + DL        + G++FK + + TKTG +I  +F+TDY++S+ +K     K    ++ E+KEG++ K +  +  D Y    +    +    I K  +  + D A  KR EL  H+ M+A +G+  + EL K +++ G+ +VAITD    Q +PD  + AKK   +K IYG++  ++D  +PIV  A D  I D T+V+FD+ETTG S   DKIIE GA+K  KG  V+    F+NP   I DKI  +T I+++ V+D   I + L +  DFIGDSV++AHN   FD+ F+N   ++ K++  +N ++DT+ +SR +  ++  + L VIA+   I  +    HRA  DA+   +I  +  E  K ++I TL+ +N     +   ++     + +  KN   ++NLYKL+S S    F   P++     NE+    I+ ++   G+I+ E     T++ L+++I D YD++ I   G+ E  + +    +     +E+  K+I ++   YNK VVAT D ++L+E  EV+ R+ ++ +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +ID  IKPI +    P IEGA + ++++  +K+++I+GD +   V+ R+ +E++S+I+NGYA++Y  +H LV +S +DGY+VGSRGSVGSS AA + DITEVN L PHY+C  CKY  F  + +V SG DL + +CPKC +KL  DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E K + A NAEI R++K C  VKRT+GQHPGGI+VVP   ++++FTP  +PADD   D  TTH  + S+   LLK DILGHD+PTIL+ML + T V+  ++P  D  V+ LF S  +L +    I+     G+ G+PEFGT FV++MLL TKP+ F++L RISGLSHGT+VW +NA+Y I+E   TI D IS RDDIMVYL+ KG+ P  AF IME VRKGKGL EE + ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YFS+R   FD   I+ GE +I  K+NE+     N      +  K+  L+ I E++ E+  RG KF  +DL KS AT FL+EGD + PP SA+ G+G + A SI +AR E  F SKED + RTKVT T ++ +E  G    + E +QISLF+ 
  S:   172 KTIETMEKSMIKNALSE-IRSKEKKVIRKENSPKIREEGNKDTSIILGRSIKEDSIFMKDLNENSGIVVVCGDVFKKEVIETKTGRKIVTFFITDYTNSMTVKLFPRPKDADRIIEEIKEGIYCKVRGEVVNDPYARECVIMAKD----IVKTTKIEKMDIAEEKRVELHMHSQMSAMDGMTPVSELVKRAAKWGHKAVAITDHGVVQAYPDAMSAAKK-GNIKVIYGIEAYLVDDGVPIVSKAGDKTIED-TFVVFDLETTGFSNKNDKIIEIGAVKIEKGKIVDRFSEFVNPGRSIPDKITELTSITDDMVQDKETIDKILPRFIDFIGDSVVVAHNA-AFDVSFINKNCKDLKIEF-ENSVMDTVTLSRFLFPELKRYKLNVIAKHLGISLE--NHHRAVDDAKATADILLKSFEMLKEKEIITLHNLNKEFLGNINIKKEPTYHLIILAKNAVGLKNLYKLVSKSNLEYFFKRPRMAKSLINEYKEGLIIGSACEAGQIYKEILKGKTKEELKNMI-DFYDYLEIQPLGNNEFLVRN--GSVKDEKELEEINKKICELGEFYNKPVVATCDVHFLDEEHEVFRRILMSGQGFSDADNQ-----------PPLYFRTTEEMLKEFEYLGEEK-AKEVVIYNTNKIADMID-EIKPIPDETFPPKIEGAEEDIRRMTTEKAHAIYGDPLPEIVEKRLTKELNSIINNGYAVLYLIAHKLVAKSYEDGYLVGSRGSVGSSFAATMSDITEVNGLPPHYVCPKCKYSEFFTDGSVGSGADLKDKDCPKCGTKLIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHKYTEVLFGKGHVFKAGTIGTIAEKTAYGFVKKYLDE-KNIKANNAEIERLSKGCTGVKRTSGQHPGGIMVVPADNEIFNFTPIQHPADDTESDVITTHFDYHSISGRLLKLDILGHDDPTILRMLQDLTQVDPKSVPLGDPKVISLFTSPKALGVTEEDID--CPVGTYGLPEFGTKFVRQMLLDTKPKSFAELARISGLSHGTDVWLNNAQYFIKEGYTTIKDCISTRDDIMVYLLQKGLPPKSAFTIMEKVRKGKGLTEEQEALMKEHDVPDWYIESCKKIKYMFPKGHAVAYVMMAMRIAYFKVYYPRAYYATYFSVRADDFDADLIVKGEEKIKEKMNELYAMGNN------ITQKDKGLLTILEISYEMYKRGIKFLKVDLYKSNATKFLIEGDSIRPPLSALQGVGKNAAKSIEEARLEGEFISKEDLRLRTKVTKTVIETLENHGCLRGMQETNQISLFSL 1432
>gi|24378642|ref|NP_720597.1| DNA polymerase III PolC [Streptococcus mutans UA159] >gi|32469722|sp|Q8DWE0|DPO3_STRMU DNA polymerase III polC-type (PolIII) >gi|24376501|gb|AAN57903.1|AE014864_1 DNA polymerase III, alpha subunit [Streptococcus mutans UA159] (1465 aa)
Score = 2365, Expect = 0.0e+00, Identities = 524/1414 (37%), Positives = 849/1414 (60%)
  Q:    44 NIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDH----KNKIQEKIKNEITEVKRSSNAK-------KTDSSFTYKFRKSVTG----DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKY--NELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTN--CKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + + SF  +LP D        L    ++     VF+ +  N E     L  +     +Q    ++  K     L  +    K +IS       ++ ND  +  K +L +  K    +GF K     + ++K  + I  H    + +  +K   E  E+++S  A        K  S+F  + +         ++T ++++  E    T EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +       +    +I+ K ++ +       KR E   HTNM+  + L  +++L   +++ G+ +VAITD  N Q+FP  Y+  KK + +K ++G++ N+++  +PIV N  D  +++ATYV+FD+ETTGLS   + +I+  A K HKG  VE    FI+P   +S     +T I+++ VK A  I + L + + F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  +    H A+ DAE    LL I+ +  E ++   +  L ++N+ + +D   ++ R    T+Y  N+  ++NL+KL+S S  + F G  ++     +++ +  ++  + ++GE+F+  +S   +   ++ K  YDFI +  P  +   + RE+ K    I+  IK +I++  + +K V+AT D +YL   DE+Y  + V +   G   NR      N     LPK +FRTT+E+ DEF+FL +  L  DIV+ N N +    + +++ +K  L++P IE + +K+ ++ Y+K++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHYIC N  CK+  F  + +V SG+DLP+  C +C +  K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A++TAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++  TIP  D +VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++   T+S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K F++K++  G   +  ++ +I +K    +      N E+DL    E+  E+L RG+KF  +DL +S AT+F+++GD LIPPF A++GLG++VA  IVKAR E  F SK + +KR  +++T ++ M ++GI  S+ ED+Q+SLF+
  S:    42 DFRFSFETILPIDFYQELRSRLVTSFETADIKAVFDIEVENAEFSNELLQAYYQEAFKQPTCNSASFKSSFSHLTVSYTDGKVLISAP----QFVNNDHFR--KNHLPNLEKQFEAFGFGKLSFDIVSNQKMTEEIKHHFESSRQQQIQKASQETLEIQKSLEASIPPEEIPKPVSNFKERIKDRQAAFEKAEITPMAEIETEENRITFEGLVFDVERKTTRTGRHIINFKMTDYTSSFPMQKWAKDDEELKKYDMISKGAWLRVRGNIENNPFTKALTMNVQNVKTIVHKERKDLMPQGE--KRVEFHAHTNMSTMDALPTVEQLVAKAAQFGHPAVAITDHGNVQSFPHGYHAGKK-NGIKVLFGLEANLVEDRVPIVYNEVDMDMNEATYVVFDVETTGLSAINNDLIQIAASKMHKGNIVEQFDEFIDPGHPLSQFTTDLTGITDQHVKGAKPISQVLQEFQSFCQDTVLVAHNA-TFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLE--HHHMANYDAEATGRLLFIFLK--EAKEKHGVNNLLDLNTKIVDDNSYKKARVKHATIYVLNQKGLKNLFKLVSLSNVTYFAGVARIPRTILDQYRDGLLLGTACSDGEVFDTVLSKGVEDAVEVAK-YYDFIEVMPPALYEPLLARELIKDEAGIQQIIKDLIEVGRRLDKPVLATGDVHYLEPEDEIYREIIVRSLGQGAMINRPIGRGENAQPAPLPKAHFRTTNEMLDEFAFLGED-LARDIVIKNPNEMVERFE-DVEVVKTDLYTPFIENSEEKVAEMTYEKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYICPNPDCKHSEFITDGSVGSGYDLPDKICSECGTPYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEEYAFRAGTVGTVADRTAYGFVKGYERDYGKF-YRDAEVDRLAQGSAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDLTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPKTIPADDPEVMKLFSGTEVLGVTEEEIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIATLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGAWLKISEEERNGYISAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIYYYCAYFSIRAKAFELKTMSAGLDAVKARMADISQK----RKINQASNVEIDLFTTLEIVNEMLERGFKFGQLDLYRSDATEFIIDGDTLIPPFVALEGLGENVAKQIVKARNEGEFLSKTELRKRGGLSSTLVEKMSDMGILGSMPEDNQLSLFD 1462
>gi|168490797|ref|ZP_02714940.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC0288-04] >gi|183574875|gb|EDT95403.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC0288-04] (1463 aa)
Score = 2365, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 786/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGIEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-AFDVGFMNANYERHGLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|149006027|ref|ZP_01829756.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae SP18-BS74] >gi|147762383|gb|EDK69344.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae SP18-BS74] (1463 aa)
Score = 2365, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 786/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNEIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEAIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|148994700|ref|ZP_01823804.1| DNA polymerase III PolC [Streptococcus pneumoniae SP9-BS68] >gi|168489751|ref|ZP_02713950.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae SP195] >gi|147927100|gb|EDK78140.1| DNA polymerase III PolC [Streptococcus pneumoniae SP9-BS68] >gi|183571799|gb|EDT92327.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae SP195] (1463 aa)
Score = 2365, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 785/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I  A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGIEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-AFDVGFMNANYERHGLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFINKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEAIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|168576299|ref|ZP_02722182.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae MLV-016] >gi|183577861|gb|EDT98389.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae MLV-016] (1463 aa)
Score = 2364, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 787/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + ++ ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFES-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|168184630|ref|ZP_02619294.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum Bf] >gi|182672306|gb|EDT84267.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum Bf] (1432 aa)
Score = 2364, Expect = 0.0e+00, Identities = 537/1285 (41%), Positives = 799/1285 (62%)
  Q:   174 KTIDIISDH--KNKIQEKIKNEITEVKRSSNAKKT----DSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           KTI+ +     KN + E IK++  +V R  N+ KT    +   +    +S+  D   + DL        + G++FK + + TKTG +I  +F+TDY++S+ +K     K    ++ E+KEG++ K +  +  D Y    +    +    I K  +  + D A  KR EL  H+ M+A +G+  + EL K +++ G+ +VAITD    Q +PD  + AKK S +K IYG++  ++D  +PIV  A D  I D T+V+FD+ETTG S   DKIIE GA+K  KG  V+    F+NP+  I DKI  +T I+++ V+D   I + L +  DFIGDSV++AHN   FD+ F+N   ++ K++  +N ++DT+ +SR +  ++  + L VIA+   I  +    HRA  DA+   +I  +  E  K ++I TL+ +N     +   ++     + +  KN   ++NLYKL+S S    F   P++     NE+    I+ ++   G+I+ E     T++ L+++I D YD++ I   G+ E  + +    +     +E+  K+I ++   YNK VVAT D ++L+E  EV+ R+ ++ +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +ID  IKPI E    P IEGA + ++++  +K+++I+GD +   V+ R+ +E++S+I+NGYA++Y  +H LV +S +DGY+VGSRGSVGSS AA + DITEVN L PHY+C  CKY  F  + +V SG DL + +CP C +KL  DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E K + A NAEI R++K C  VKRT+GQHPGGI+VVP   ++++FTP  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T V+  ++P  D  V+ LF S ++L +    I+     G+ G+PEFGT FV++MLL TKP+ F++L+RISGLSHGT+VW +NA+Y I+E   TI D IS RDDIMVYL+ K + P  AF IME VRKGKGL EE + ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YFS+R   FD   I+ GE +I  K+NE+     N      +  K+  L+ I E++ E+  RG KF  +DL KS AT FL+EGD + PP SA+ G+G + A SI ++R E  F SKED + RTKVT T ++ +E  G    + E +QISLF+ 
  S:   172 KTIETMEKSMIKNALSE-IKSKEKKVIRKENSPKTREEENKDTSIILGRSIKEDSIFMKDLNENSGIVVVCGDVFKKEVIETKTGRKIVTFFITDYTNSMTVKLFPRPKDADRIIEEIKEGIYCKVRGEVVNDPYARECVIMAKD----IVKTTKIEKMDIAEEKRVELHMHSQMSAMDGMTPVSELVKRAAKWGHKAVAITDHGVVQAYPDAMSAAKK-SNIKVIYGIEAYLVDDGVPIVSKAGDKTIED-TFVVFDLETTGFSSKNDKIIEIGAVKIEKGKIVDRFSEFVNPKRIIPDKITELTSITDDMVQDKETIDKILPRFIDFIGDSVVVAHNA-DFDVSFINKNCKDLKIEF-ENSVMDTVTLSRFLFPELKRYKLNVIAKHLGISLE--NHHRAVDDAKATADILLKSFEMLKEKEIITLHNLNKEFLGNINIKKEPTYHLIILVKNAVGLKNLYKLVSKSNLEYFFKRPRMAKSLINEYKEGLIIGSACEAGQIYKEILKGKTKEELKNMI-DFYDYLEIQPLGNNEFLVKN--GSVKDEKELEEINKKICELGEFYNKPVVATCDVHFLDEEHEVFRRILMSGQGFSDADNQ-----------PPLYFRTTEEMLKEFEYLGEEK-AKEVVIYNTNKIADMID-EIKPIPEETFPPKIEGAEEDIRRMTIEKAHAIYGDPLPEIVEKRLTKELNSIINNGYAVLYLIAHKLVAKSYEDGYLVGSRGSVGSSFAATMSDITEVNGLPPHYVCPKCKYSEFFTDGSVGSGADLEDKDCPNCGTKLIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHKYTEVLFGKGHVFKAGTIGTIAEKTAYGFVKKYLDE-KNIKANNAEIERLSKGCTGVKRTSGQHPGGIMVVPADNEIFNFTPIQHPADDTESDVITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTQVDPKSVPLGDPKVISLFTSPEALGVTEEDID--CPVGTYGLPEFGTKFVRQMLLDTKPKSFAELVRISGLSHGTDVWLNNAQYFIKEGYTTIKDCISTRDDIMVYLLQKELPPKSAFTIMEKVRKGKGLTEEQEALMKEHDVPDWYIESCKKIKYMFPKGHAVAYVMMAMRIAYFKVYYPRAYYATYFSVRADDFDADLIVKGEEKIKEKMNELYAMGNN------ITQKDKGLLTILEISYEMYKRGIKFLKVDLYKSNATKFLIEGDSIRPPLSALQGVGKNAAKSIEESRLEGEFISKEDLRLRTKVTKTVIETLENHGCLRGMQETNQISLFSL 1432
>gi|168493969|ref|ZP_02718112.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC3059-06] >gi|183576230|gb|EDT96758.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC3059-06] (1463 aa)
Score = 2362, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 786/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|194397447|ref|YP_002036972.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae G54] >gi|194357114|gb|ACF55562.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae G54] (1463 aa)
Score = 2362, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 787/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + ++ ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFES-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|116627026|ref|YP_819645.1| DNA polymerase III PolC [Streptococcus thermophilus LMD-9] >gi|122268369|sp|Q03MX3|DPO3_STRTD DNA polymerase III polC-type (PolIII) >gi|116100303|gb|ABJ65449.1| DNA polymerase III catalytic subunit, PolC type [Streptococcus thermophilus LMD-9] (1464 aa)
Score = 2360, Expect = 0.0e+00, Identities = 526/1344 (39%), Positives = 845/1344 (62%)
  Q:   114 LYVLKYNMGIKKPIISENAIFL----HYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISD----HKNKIQEKIKNEITEVKRS--------SNAKKTDSSFTYKFRKSVT----GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIIS-KPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKY--NELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +Y L  N+GI+   IS N+I +    H L   +E   ++++      L++ G S   +S + D++    + +    +K  +QE+ +++  +  +S           K    +F  K  + V      ++T + ++  E      EG IF +++  TKTG  I  + VTDY+ S  ++              +K+G WV+ +  I+ + + ++ +T  +++I  IS  P++ +  +    KR E   HTNM+  + +  ++EL   ++  G+ +VAITD  N Q+FP  Y++AKK + +KAI+G++ N+++  +PIV N+ + ++ +ATYV+FD+ETTGLS  ++ +I+  A K HKG  VE    FI+P   +S     +T I++  VK A  + + L + ++F   +VL+AHN   FD+ F+N   E +++  I  P+IDTL+ +R +  +   H LG + +++ +  D    H A+ DAE    LL I+ K + E   L +   L ++N+ L +D   +++R    T+Y +N+  ++NL+KL+S S  S F+G  ++  +  +E+    IV ++  +GE+F+  +S+      ++ K  YDFI +  P  +   I +++ K  G IE  IK +I++AN+ +K V+AT + +Y+N  D +Y  + V A   G   NR      N     LP+ +FRTT+E+ DEF+FL    L  +IVV N+  +A+ I+  ++ +K+ L++P+I+ A +++ ++ Y K++ ++G+ + + +  RI++E+SS++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C  C++  F  + +  SGFDLP+  C +C ++ K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGT+ T A++TAYG+VK Y  +  K   R+AE+ R+A     VKR TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K F++K++  G   +  ++ +IKEK    + +    N E DL    E+  E+L RG+ F  +DL KS AT+FL+EGD LIPPF A++GLG++VA  +V AREE  F SK + +KR  +++T ++ ++E+GI  ++ ED+Q+SLF+
  S:   108 IYSLFSNLGIE---ISNNSISVKAPAHIL---RENLHERFIALIADVLSNVGLSNVSISVLEDKEASSSLEEAYETNKISLQEEAESQARQALQSIVQSSPVPPPQKHQAQNFAEKQSQRVASFDKAEITPMIEVNSEENRIVFEGYIFDVEQRETKTGRIIINFKVTDYTSSFAMQRWVKDSEELVKFGMIKKGNWVRVRGRIENNPFTHS-LTMNVQDIKEISHTPRKDLMPEGQ--KRVEFHAHTNMSTMDAIPTVEELIDTAAFWGHPAVAITDHANVQSFPHGYHKAKK-AGIKAIFGLEANLVEDKVPIVYNSENLELKEATYVVFDVETTGLSAVHNDLIQIAASKMHKGNIVEQFDEFIDPGYPLSAFTTELTGITDNHVKGAKPLVQVLQEFQEFCKGAVLVAHNA-TFDVGFMNANYERHQLPTISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALD--HHHMANYDAEATGRLLFIFIKDVFEKHGLTN---LEQLNTELVSDDSYKKSRVKHATLYVQNQTGLKNLFKLVSLSNVSYFEGVARIPRKVLDEYREGIIVGSACADGEVFDTLLSHGIDKAVEVAK-YYDFIEVMPPAIYAPLIAKDLIKDEGAIEQLIKDLIEVANRLDKPVLATGNVHYINPEDAIYREIIVRALGQGAMINRPIGKGENAQPAPLPEAHFRTTNEMLDEFAFLGKD-LAYEIVVANTQAMANQIE-EVEVVKKDLYTPYIDRAEEQVAEMTYAKAFELYGNPLPDIIDLRIEKELSSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYLCPKCQHSEFITDGSYGSGFDLPDKECSECGTEYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEQYAFRAGTVGTVADRTAYGFVKGYERDYNKF-YRDAEVDRLAMGVAGVKRNTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPKDIRADDPDVMKLFSGTEVLGVTPEQIGT--STGVLGIPEFGTNFVRGMVEETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLDPKMAFTIMERVRKGMWLKISEEERNGYIQAMRENNVPDWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFELKTMSAGLDAVKARMEDIKEK----RQRNEATNLENDLFTTLEIVNEMLERGFTFGQLDLYKSQATEFLIEGDTLIPPFIALEGLGENVAKQLVAAREEGEFLSKTELRKRGGLSSTLVERLDEMGILGNMPEDNQLSLFD 1461
>gi|116495060|ref|YP_806794.1| DNA polymerase III PolC [Lactobacillus casei ATCC 334] >gi|122263523|sp|Q038M0|DPO3_LACC3 DNA polymerase III polC-type (PolIII) >gi|116105210|gb|ABJ70352.1| DNA polymerase III catalytic subunit, PolC type [Lactobacillus casei ATCC 334] (1444 aa)
Score = 2360, Expect = 0.0e+00, Identities = 533/1424 (37%), Positives = 840/1424 (58%)
  Q:    34 ITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVL---FNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPII-SENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSS-----------NAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTK-ISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK-YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDY-LIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +T ++Q+   +  + F+ +LP          L LV   +     ++V    T   E +  Y  Y V H     + GT   +EL       +   + +I +EN     YL       I++ L    +     GFS   +   +DE+     +      Q +   E  ++ +++              +TD       +  +T    ++  +  E ++ T+EG +F ++    ++  ++  + VTDYS S + K       ++ + + +++G W++ + S+Q D Y + ++T   ++I  +S P      D    KR EL  HTNM+  + +  I +  K + E G+ ++A+TD    Q +P+ ++ A K + LK +YGV+ N++D   P+   A++ + ++ A YV+FD+ETTGLS  YDK+IE  A+K   G  ++  +  I+P   +S+    +T I+++ V  +    +     + F   ++++ HN + FD+ FL+   E + +  I NP+IDTL++SR ++ +   H L  +A++YK+  +    HRA+ DAE   YLL   ++  E  K+  + TLN++N  +      +  R S   V+ K +  ++NL+KL+S S    F   P+V      +     +V ++ + GE+F A M   +   E   K   YD++ +     +   I   + K    ++D I++IIKI ++  K VVAT D +YL++ D +Y ++ ++++   G  N L +++     LP  +FR+T E+  +FS+L +    +++VV NSN IA+ +D +I P+K+ L++P + G  + LK  +   ++ ++GD + + V  R+D+E+ S+I NG+++IY  +  LV +S  DGY+VGSRGSVGSS+AA +  ITEVNPL PHY C NC+Y  F     + SGFDLP+  CPKC + L  DGH+IPFETF+GF GDK+PDIDLNFS  YQ  AH++IK MFGE+  FRAGTI T A+KTAYGYVK+Y E       R AEI R+A+    VKRTTGQHP GI++VP   D+YDFTP  YPADD+   W TTH  F S+HD++LK D+LGHD+PT+++ML + + V   +IP  D  VM LF+ T SL +    IN   K G+ GIPEFGT FV+ ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI++  +T+ +VI CRD+IM+ LI  G+   +AF IME VRKG+G+ +++QK + +N N+P WYIESC KI Y+FPKAHATAY++MA +IAWFK++YPL +Y +YFS+R + FD+ ++ +G+  +   + EI +K  +  T      KE  L+ + E+A E L RG+K   ID+ KS + +FL++ D+ ++ PF A+ GLGD+VA  IV AREEK F SKED   R KV+ T +  M    +   L +++Q+SLF+
  S:    36 VTIHEQSRRYDFTLGFDAILPFQTFNAIATKLPLVFQQIAATDLSVVVTQPTITDELLAQYWQYVVTH----AEIGTGIVRELCEKQVPTLENDRAVIKTENEQIRQYL-------IQQGLGKLEETYRQVGFSGLRMQAEVDEEQA---AQSMAAFQAQRAEETAKMAKAAAEVVKQQAAKQKQVQTDGPVQMGRQMKMTDAPQQMVTITQEERSVTVEGYVFDVEVRELRSKRQLLIFKVTDYSSSFIAKKFSNGPEDEAMFARIQKGQWLRVRGSVQEDNY-SRELTINAQDIQTVSHPDP--TDDAEGEKRVELHLHTNMSQMDAMNPISDYVKRAKEWGHKAIAVTDHAGLQAYPEAHSAAVK-AGLKMLYGVEINLVDDGTPVAYRADEPRDLASAEYVVFDVETTGLSAVYDKVIELAAVKMKDGKVIDQFEEMIDPGFPLSELTINLTHITDDMVHGSKSEVDVFKLFQQFCDGAIMVGHN-VTFDVGFLDNGYERHGLADIDNPVIDTLELSRMLHPERKNHKLDTLAKQYKVSLE--HHHRANADAEATGYLLYALEK--EAAKMYGMTTLNQLNDRVGAGDAYKAARPSHAIVFAKTQAGLKNLFKLVSLSNVKYFYRVPRVPRSQLQKLREGLLVGSACSNGEVFTAMMQKGEA--EARAKASFYDYLEVQPLPVYQPLIEAGLIKGEAHLKDIIQKIIKIGSELEKPVVATGDAHYLDQHDAIYRQILIHSQ---GGANPLNRHS-----LPDVHFRSTSEMLTDFSWLGEEK-AHELVVDNSNLIANWVDDDITPVKDKLYTPEVPGVEENLKHDVMTTAHELYGDPLPDIVAQRLDKELKSIIGNGFSVIYNIAQRLVLKSNKDGYLVGSRGSVGSSLAATMAGITEVNPLPPHYRCPNCQYSEFFTHGEIGSGFDLPDKQCPKCGADLHKDGHDIPFETFLGFHGDKVPDIDLNFSGDYQPIAHNYIKVMFGEDHSFRAGTIGTVADKTAYGYVKAY-ERDTGQQLRGAEIDRLAQGDTGVKRTTGQHPAGILIVPADMDIYDFTPIQYPADDQNAAWMTTHFDFHSIHDNILKMDVLGHDDPTMIRMLQDLSGVEPKSIPTDDPGVMALFSGTKSLGVTPEQINS--KMGTLGIPEFGTRFVRGMLEETKPTTFSELLQISGLSHGTDVWLGNAEELIKQGIVTLKEVIGCRDNIMMDLIHWGMEDSMAFNIMEHVRKGRGIPDDWQKAMRENENVPDWYIESCLKIKYMFPKAHATAYILMALRIAWFKVHYPLIYYTAYFSVRAEDFDLAAMSHGKEAVKAAMKEITDKGMDAST------KEKQLLTVLEIANECLERGFKIKMIDVTKSDSHNFLIQDDHTILAPFRAVPGLGDNVAKQIVAAREEKPFLSKEDLANRGKVSKTLIDYMTTNHVLDDLPDENQLSLFD 1441
>gi|15900208|ref|NP_344812.1| DNA polymerase III PolC [Streptococcus pneumoniae TIGR4] >gi|111658314|ref|ZP_01409003.1| hypothetical protein SpneT_02000504 [Streptococcus pneumoniae TIGR4] >gi|21263563|sp|Q97SQ2|DPO3_STRPN DNA polymerase III polC-type (PolIII) >gi|14971745|gb|AAK74452.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae TIGR4] (1463 aa)
Score = 2360, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 786/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + ++ ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL  S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFES-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|153938397|ref|YP_001391721.1| DNA polymerase III PolC [Clostridium botulinum F str. Langeland] >gi|152934293|gb|ABS39791.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum F str. Langeland] (1432 aa)
Score = 2360, Expect = 0.0e+00, Identities = 534/1282 (41%), Positives = 795/1282 (62%)
  Q:   177 DIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKD-VLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           +++S+ K+K ++ I+ E +   R    K T    +    +S+  D   + DL        + G++FK + + TKTG +I  +F+TDY++S+ +K LF +  + D ++ E+KEG++ K +  +  D Y    +    +    I K  +  + D A  KR EL  H+ M+A +G+  + EL K +++ G+ +VAITD    Q +PD  + AKK   +K IYG++  ++D  +PIV  A D  I D T+V+FD+ETTG S   DKIIE GA+K  KG  V+    F+NPE  I DKI  +T I+++ V D   I + L +  +FIG+SV++AHN   FD+ F+N   ++ K++  KN ++DT+ +SR +  ++  + L VIA+   I  +    HRA  DA+   +I  +  E  K ++I TL+ +N     +   ++     + +  KN   ++NLYKL+S S    F   P++     NE+    I+ ++   G+I+ E     T++ L+++I D YD++ I   G+ E  + +    +     +++  K+I ++   YNK VVAT D ++L+E  EV+ R+ ++ +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +ID  IKPI E    P IEGA + ++++  +K+++I+GD +   V+ R+ +E++S+I+NGYA++Y  +H LV +S +DGY+VGSRGSVGSS AA + DITEVN L PHY+C  CKY  F  + +V SG DL + +CP C +KL  DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E K + A NAEI R++K C  VKRT+GQHPGGI+VVP   ++++FTP  +PADD   D  TTH  + S+   LLK DILGHD+PTIL+ML + T V+  ++P  D  V+ LF S ++L +    I+     G+ G+PEFGT FV++MLL TKP+ F++L RISGLSHGT+VW +NA+Y I+E   TI D IS RDDIMVYL+ K + P  AF IME VRKGKGL EE + ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YFS+R   FD   I+ GE +I  K+NE+     N      +  K+  L+ I E+  E+  RG KF  +DL KS AT FL+EGD + PP SA+ G+G + A SI +AR E  F SKED + RTKVT T ++ +E  G    + E +QISLF+ 
  S:   184 NVLSEIKSKEKKVIRKENSPKTREEENKDT----SVILGRSIKEDSIFMKDLNENSGIVVVCGDVFKKEVIETKTGRKIVTFFITDYTNSMTVK-LFPRPRDADRIIEEIKEGIYCKVRGEVVNDPYARECVIMAKD----IVKTTKIEKMDIAEEKRVELHMHSQMSAMDGMTPVSELVKRAAKWGHKAVAITDHGVVQAYPDAMSAAKK-GNIKVIYGIEAYLVDDGVPIVSKAGDKTIED-TFVVFDLETTGFSSKNDKIIEIGAVKIEKGKIVDRFSEFVNPERSIPDKITELTSITDDMVDDKEAIDKILPRFIEFIGNSVVVAHNA-AFDVSFINKNCKDLKIEF-KNSVMDTVTLSRFLFPELKRYKLNVIAKHLGISLE--NHHRAVDDAKATADILLKAFEMLKEKEIITLHNLNKEFLGNINIKKEPTYHLIILAKNAVGLKNLYKLVSKSNLEYFFKRPRMAKSLINEYKEGLIIGSACEAGQIYKEILKGKTKEELKNMI-DFYDYLEIQPLGNNEFLVKN--GSVKDEKELQEINKKICELGEFYNKPVVATCDVHFLDEEHEVFRRILMSGQGFSDADNQ-----------PPLYFRTTEEMLKEFEYLGEEK-AKEVVIYNTNKIADMID-EIKPIPEETFPPKIEGAEEDIRRMTIEKAHAIYGDPLPEIVEKRLTKELNSIINNGYAVLYLIAHKLVAKSYEDGYLVGSRGSVGSSFAATMSDITEVNGLPPHYVCPKCKYSEFFTDGSVGSGADLEDKDCPNCGTKLIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHKYTEVLFGKGHVFKAGTIGTIAEKTAYGFVKKYLDE-KNIKANNAEIERLSKGCTGVKRTSGQHPGGIMVVPADNEIFNFTPIQHPADDTESDVITTHFDYHSISGRLLKLDILGHDDPTILRMLQDLTKVDPKSVPLGDPKVISLFTSPEALGVTEEDID--CPVGTYGLPEFGTKFVRQMLLDTKPKSFAELARISGLSHGTDVWLNNAQYFIKEGYTTIKDCISTRDDIMVYLLQKELPPKSAFTIMEKVRKGKGLTEEQEALMKEHDVPDWYIESCKKIKYMFPKGHAVAYVMMAMRIAYFKVYYPRAYYATYFSVRADDFDADLIVKGEEKIKEKMNELYAMGNN------IAQKDKGLLTILEICYEMYKRGIKFLKVDLYKSNATKFLIEGDNIRPPLSALQGVGKNAAKSIEEARLEGEFISKEDLRLRTKVTKTVIETLENHGCLRGMQETNQISLFSL 1432
>gi|58337539|ref|YP_194124.1| DNA polymerase III alpha chain [Lactobacillus acidophilus NCFM] >gi|58254856|gb|AAV43093.1| DNA polymerase III alpha chain [Lactobacillus acidophilus NCFM] (1437 aa)
Score = 2358, Expect = 0.0e+00, Identities = 529/1300 (40%), Positives = 783/1300 (60%)
  Q:   157 LNDYGFSKHHLSYILDEKTI--------DIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFT-YKFRK-SVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLE--NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK---YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDF-LVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + +YGF        LD+ ++        ++  +H+  +QE+ +N   + K    AK+  +  T Y  RK      +T++ ++    +   IEG IF I+    K+G  I+   +TDYSDSI  K     K   + +S +K G W K + S   D +E+ D+   I     +       ++D    KR EL  HTNM+  +      +  K + + G  ++A+TD  + Q+FP+ Y+  K  + +K +YGV+ N+ID +  +VLN       D  +VIFD+ETTGLS  YD IIE GA+K   G  +E    FINP   +S++   +T I++E V  A      + + +DF GD  L  HN ++FD+ F+N  L  N    I  P++DTL++SR ++ + + H+L  +A+KY +  +    HRA++DAE    +  ++L+  N+K  +    N  N     +  + R R S +TV  KN+  ++NLYKL+S + T +F   P+    +    +      +   +G++F A M    Q   D  ++K   YDF+ +  P+ +   I   + K    +E+ I  I K+  + NK VVAT D +Y+   D +Y  + ++A+     RN+           P  +F +T E+ D FSFL + +   +IV+ N+N IA  I + I+PIKE L+ PHIE A +++K+L Y K+Y ++G+ +   VK RID E++S+I NGYA+IY  S  LV +S  DGY+VGSRGSVGSS+ A +  ITEVNPL PHY C NCKY  F +N +  SGFDLP+ +CP+C + L  DG +IPF TF+GF GDK+PDIDLNFS  YQ  AH+FI+ MFG +  +RAGTI+T A+KTAYGY K +F+E + +  RNAE+ R+A     VKRTTGQHP GIVVVP   D+YDFTP +YPADD    W  TH  F S+HD++LKFDILGHD+PT+++ L + + ++  TIP  D  VM LF+ T +L +    I    KTG+ G+PEFGT FV+ ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      + DVI CRD+IM+ LI  G+ P +AF  ME VR G+G+++E   +L  N NIP WYI+SC KI Y+FPKAHATAY++MA +IAWFK+YYP  +Y +YFS+R  +FD+ ++ +G++ +   +  I++K  +      V  K+  L+ + E+A E L RG K   +D+ +S ATDF +++   ++ PF+A+ GLGD+ A  IV AR EK F SKED  KR KV+ T M   E+ G+   + +++Q+SLF
  S:   149 MRNYGFFNLKFITQLDQTSLQNSMQSLQELHQEHEKNMQEQYENTPDKPKPQPQAKQYPTKRTSYGKRKLDENAPITQIKEVEDGTRNVVIEGNIFNIESRELKSGAVIFTGEITDYSDSIAFKKFVSDKEQIEQMSAIKPGTWAKMQGSAADDQWEH-DVVFTISSFETVEHIGRTEKYDGEK-KRVELHLHTNMSQLDATNTPTDFIKTAKKFGQKAIAVTDHGDVQSFPEAYSTGKS-TDMKILYGVEANMIDDHALLVLNPAPMTYEDREFVIFDVETTGLSSVYDTIIEIGAVKMKNGEVIERFDKFINPHHPLSEQTINLTSITDEMVSAADDEAIVIKQFQDFYGDRPLCGHN-VQFDVGFVNAALRRNGFSEITQPVVDTLEVSRLLHPEQNRHTLDSLAKKYNVSLE--HHHRANQDAEATGYLMYKLLDAFNEKYHEDNLNNLNNYAAHGEVYK-RARPSHMTVLAKNQAGLKNLYKLVSIASTKDFYRIPRTPKSDLARLHEGLFYGSGCWQGDVFIAMM----QKGYDEAREKARFYDFLEVQPPKNYSQLIEDGLIKDEEQLEEIISNIYKLGKELNKPVVATGDAHYVEPHDAIYRTILISAQRSNPNRNK---------PQPDLHFYSTQEMLDAFSFLGEDI-AKEIVIENTNKIADEI-SEIQPIKEGLYPPHIEHADEEMKKLTYDKAYELYGNPLPKIVKDRIDLELNSIISNGYAVIYLISQRLVAKSNKDGYLVGSRGSVGSSLVATMSGITEVNPLAPHYRCPNCKYSQFFENGEYGSGFDLPDKDCPECGTPLVKDGQDIPFATFLGFHGDKVPDIDLNFSGDYQPVAHNFIRVMFGPDNSYRAGTIATVADKTAYGYAK-HFDEERDLKLRNAELDRLASGVRGVKRTTGQHPAGIVVVPDDMDIYDFTPVSYPADDVNAAWLITHYDFHSIHDNILKFDILGHDDPTMIRHLQDLSGIDPLTIPPDDPGVMSLFSGTKALGVTPEQIGS--KTGTLGVPEFGTRFVRGMLEETKPTTFSELLQISGLSHGTDVWLGNAEDLINNGTCDLKDVIGCRDNIMMDLIHWGVKPEVAFSTMESVRHGRGISDENMAILQKNKNIPDWYIDSCLKIKYMFPKAHATAYILMALRIAWFKVYYPEIYYTAYFSVRADLFDLVAMSHGKNTVKAAMKAIQDKGND------VSAKDKSLLTVLEIANECLERGIKIKMVDIDQSEATDFKILDKHTILAPFNAVPGLGDNAAKQIVAARAEKKFLSKEDLAKRGKVSQTIMNYFEDNGVLDGMPDENQLSLF 1437
>gi|182683255|ref|YP_001835002.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae CGSP14] >gi|182628589|gb|ACB89537.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae CGSP14] (1463 aa)
Score = 2357, Expect = 0.0e+00, Identities = 491/1237 (39%), Positives = 784/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L        +Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDGAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNEIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNDYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|149011144|ref|ZP_01832449.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP19-BS75] >gi|147764780|gb|EDK71710.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP19-BS75] (1463 aa)
Score = 2357, Expect = 0.0e+00, Identities = 492/1237 (39%), Positives = 785/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P ++ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL  S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFVDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|55822053|ref|YP_140494.1| DNA polymerase III PolC [Streptococcus thermophilus CNRZ1066] >gi|81559957|sp|Q5M1Y0|DPO3_STRT1 DNA polymerase III polC-type (PolIII) >gi|55738038|gb|AAV61679.1| DNA polymerase III alpha subunit [Streptococcus thermophilus CNRZ1066] (1464 aa)
Score = 2356, Expect = 0.0e+00, Identities = 524/1344 (38%), Positives = 846/1344 (62%)
  Q:   114 LYVLKYNMGIKKPIISENAIFL----HYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISD----HKNKIQEKIKNEITEVKRS--------SNAKKTDSSFTYKFRKSVT----GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIIS-KPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLF--KYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +Y L  N+GI+   IS N+I +    H L   +E   ++++      L++ G S   +S + D++    + +    +K  +QE+ +++  +  +S           K    +F  K  + V      ++T + ++  E      EG IF +++  TKTG  I  + VTDY+ S  ++              +K+G WV+ +  I+ + + ++ +T  +++I  IS  P++ +  +    KR E   HTNM+  + +  ++EL   ++  G+ +VAITD  N Q+FP  Y++AKK + +KAI+G++ N+++  +PIV N+ + ++ +ATYV+FD+ETTGLS  ++ +I+  A K HKG  VE    FI+P   +S     +T I++  VK A  + + L + ++F   +VL+AHN   FD+ F+N   E +++  I  P+IDTL+ +R +  +   H LG + +++ +  D    H A+ DAE    LL I+ K + E   L +   L ++N+ L +D   +++R    T+Y +N+  ++N++KL+S S  S F+G  ++  +  +E+    IV ++  +GE+F+  +S+      ++ K  YDFI +  P  +   I +++ K  G IE  I+ +I++AN+ +K V+AT + +Y+N  D +Y  + V A   G   NR    + N     LP+ +FRTT+E+ DEF+FL    L  +IVV N+  +A+ I+  ++ +K+ L++P+I+ A +++ ++ Y K++ ++G+ + + +  RI++E+SS++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C  C++  F  + +  SGFDLP+  C +C ++ K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGT+ T A++TAYG+VK Y  +  K   R+AE+ R+A     VKR TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K F++K++  G   +  ++ +IKEK    + +    N E DL    E+  E+L RG+ F  +DL KS AT+FL+EGD LIPPF A++GLG++VA  +V AREE  F SK + +KR  +++T ++ ++E+GI  ++ ED+Q+SLF+
  S:   108 IYSLFSNLGIE---ISNNSISVKAPAHIL---RENLHERFIALIADVLSNVGLSNVSISVLEDKEASSSLEEAYETNKISLQEEAESQARQALQSIVQSSPVPPPQKHQAQNFAEKQSQRVASFDKAEITPMIEVNSEENRIVFEGYIFDVEQRETKTGRIIINFKVTDYTSSFAMQRWVKDSEELVKFGMIKKGNWVRVRGRIENNPFTHS-LTMNVQDIKEISHTPRKDLMPEGQ--KRVEFHAHTNMSTMDAIPTVEELIDTAAFWGHPAVAITDHANVQSFPHGYHKAKK-AGIKAIFGLEANLVEDKVPIVYNSENLELKEATYVVFDVETTGLSAVHNDLIQIAASKMHKGNIVEQFDEFIDPGYPLSAFTTELTGITDNHVKGAKPLVQVLQEFQEFCKGAVLVAHNA-TFDVGFMNANYERHQLPTISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALD--HHHMANYDAEATGRLLFIFIKDVFEKHGLTN---LEQLNTELVSDDSYKKSRVKHATLYVQNQTGLKNIFKLVSLSNVSYFEGVARIPRKVLDEYREGIIVGSACADGEVFDTLLSHGIDKAVEVAK-YYDFIEVMPPAIYAPLIAKDLIKDEGAIEQLIRDLIEVANRLDKPVLATGNVHYINPEDAIYREIIVRALGQGAMINRPIGKEENAQPAPLPEAHFRTTNEMLDEFAFLGKD-LAYEIVVANTQAMANQIE-EVEVVKKDLYTPYIDRAEEQVAEMTYAKAFELYGNPLPDIIDLRIEKELSSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYLCPKCQHSEFITDGSYGSGFDLPDKECSECGTEYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEQYAFRAGTVGTVADRTAYGFVKGYERDYNKF-YRDAEVDRLAMGVAGVKRNTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPKDIRADDPDVMKLFSGTEVLGVTPEQIGT--STGVLGIPEFGTNFVRGMVEETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLDPKMAFTIMERVRKGMWLKISEEERNGYIQAMRENNVPDWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFELKTMSAGLDAVKARMEDIKEK----RQRNEATNLENDLFTTLEIVNEMLERGFTFGQLDLYKSQATEFLIEGDTLIPPFIALEGLGENVAKQLVAAREEGEFLSKTELRKRGGLSSTLVERLDEMGILGNMPEDNQLSLFD 1461
>gi|168485959|ref|ZP_02710467.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC1087-00] >gi|183570911|gb|EDT91439.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC1087-00] (1463 aa)
Score = 2356, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 785/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL  S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSVFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHGLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|149017968|ref|ZP_01834427.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP23-BS72] >gi|147931532|gb|EDK82510.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP23-BS72] (1463 aa)
Score = 2355, Expect = 0.0e+00, Identities = 493/1237 (39%), Positives = 784/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I  A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL  S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHGLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFINKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|71904322|ref|YP_281125.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS6180] >gi|123747742|sp|Q48R90|DPO3_STRPM DNA polymerase III polC-type (PolIII) >gi|71803417|gb|AAX72770.1| DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS6180] (1465 aa)
Score = 2355, Expect = 0.0e+00, Identities = 513/1321 (38%), Positives = 813/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K    +GF    +  + D++     T D +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE + HD   +     KR EL  HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++DA  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ R  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  + NK V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NSHLPNLVKQFEAFGFGTLTIDMVSDQEMTEHLTKDFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHDRKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQDAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLR--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRANKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVENTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEILGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|15902295|ref|NP_357845.1| DNA polymerase III PolC [Streptococcus pneumoniae R6] >gi|116515846|ref|YP_815772.1| DNA polymerase III PolC [Streptococcus pneumoniae D39] >gi|122279342|sp|Q04MH6|DPO3_STRP2 DNA polymerase III polC-type (PolIII) >gi|32469721|sp|Q8DRA5|DPO3_STRR6 DNA polymerase III polC-type (PolIII) >gi|15457800|gb|AAK99055.1| DNA polymerase III, alpha subunit [Streptococcus pneumoniae R6] >gi|116076422|gb|ABJ54142.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae D39] (1463 aa)
Score = 2355, Expect = 0.0e+00, Identities = 492/1237 (39%), Positives = 785/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G  ++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL +S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGIEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVSRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEAIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|187778984|ref|ZP_02995457.1| hypothetical protein CLOSPO_02579 [Clostridium sporogenes ATCC 15579] >gi|187772609|gb|EDU36411.1| hypothetical protein CLOSPO_02579 [Clostridium sporogenes ATCC 15579] (1442 aa)
Score = 2354, Expect = 0.0e+00, Identities = 526/1243 (42%), Positives = 771/1243 (62%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           +S+  D   + DL        + G+IFK + + TKTG +I  +F+TDY++S+ +K     K    ++ E+KEG++ K +  +  D Y    +    +    I K  +  + D A  KR EL  H+ M+A +G+  + EL K +++ G+ +VAITD    Q +PD  + AKK   +K IYG++  ++D  +PIV  A D  I D T+V+FD+ETTG S   DKIIE GA+K  KG  V+    F+NPE  I +KI  +T I+++ V D   I + L +  +FIGDSV++AHN   FD+ F+N   ++ K++  KN ++DT+ +SR +  ++  + L VIA+   I  +    HRA  DA+   +I  +  E  K ++I TL+ +N     +   ++     + +  KN   ++NLYKL+S S    F   P++     NE+    I+ ++   G+I+ E     T++ L+++I D YD++ I   G+ E  + +    +     +++  K+I ++   YNK VVAT D ++L+E  EV+ R+ ++ +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +ID  IKPI E    P IEGA + ++ +  +K++ I+GD +   V+ R+ +E++S+I+NGYA++Y  +H LV +S +DGY+VGSRGSVGSS AA + DITEVN L PHYIC  CKY  F  + +V SG DL + +CPKC +KL  DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E K + A NAEI R++K C  VKRT+GQHPGGI+VVP   ++++FTP  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T V+   +P  D  V+ LF ST +L +    I+     G+ G+PEFGT FV++MLL TKP+ F++L+RISGLSHGT+VW +NA+Y I+E   TI D IS RDDIMVYL+ KG+ P  AF IME VRKGKGL EE + ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +Y +YFS+R   FD   I+ GE +I  K+NE+     N      +  K+  L+ I E+  E+  RG KF  +DL KS AT FL+EGD + PP SA+ G+G + A SI +AR E  F SKED + RTKVT T ++ +   G    + E +QISLF+ 
  S:   229 RSIREDSIFMKDLNENSGIVVVCGDIFKKEVIETKTGRKIVTFFITDYTNSMTVKLFPRPKDADRIIEEIKEGIYCKVRGEVVNDPYARECVIMAKD----IVKTTKIEKMDIAEEKRVELHMHSQMSAMDGMTPVSELVKRAAKWGHKAVAITDHGVVQAYPDAMSAAKK-GNIKVIYGIEAYLVDDGVPIVSKAGDKTIED-TFVVFDLETTGFSSKNDKIIEIGAVKIEKGKIVDRFSEFVNPERSIPEKITELTSITDDMVDDKEAIDKILPRFIEFIGDSVVVAHNA-AFDVSFINKNCKDLKIEF-KNSVMDTVTLSRFLFPELKRYKLNVIAKHLGISLE--NHHRAVDDAKATADILLKSFEMLKEKEIITLHNLNKEFLGNINIKKEPTYHLIILAKNAVGLKNLYKLVSKSNLEYFFKRPRMAKSLINEYKEGLIIGSACEAGQIYKEILKGKTKEELKNMI-DFYDYLEIQPLGNNEFLVKN--GSVKDEEELKEINKKICELGEFYNKPVVATCDVHFLDEEHEVFRRILMSGQGFSDADNQ-----------PPLYFRTTEEMLKEFEYLGEEK-AKEVVIYNTNKIADMID-EIKPIPEETFPPKIEGAEEDIRNMTIKKAHDIYGDPLPEIVEKRLTKELNSIINNGYAVLYLIAHKLVAKSYEDGYLVGSRGSVGSSFAATMSDITEVNGLPPHYICPKCKYSEFFTDGSVGSGADLEDKDCPKCGTKLIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHKYTEVLFGKGHVFKAGTIGTIAEKTAYGFVKKYLDE-KNIKANNAEIERLSKGCTGVKRTSGQHPGGIMVVPADNEIFNFTPIQHPADDTESDVITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTQVDPKAVPLGDPKVISLFTSTKALGVTEEDID--CPVGTYGLPEFGTKFVRQMLLDTKPKSFAELVRISGLSHGTDVWLNNAQYFIKEGYTTIKDCISTRDDIMVYLLQKGLPPKSAFTIMEKVRKGKGLTEEQEALMKEHDVPDWYIESCKKIKYMFPKGHAVAYVMMAMRIAYFKVYYPKAYYTTYFSVRADDFDADLIVKGEEKIKEKMNELYAMGNN------ITQKDKGLLTILEICYEMYKRGIKFLKVDLYKSNATKFLIEGDSIRPPLSALQGVGKNAAKSIEEARLEGEFISKEDLRLRTKVTKTVIETLANHGCLRGMQETNQISLFSL 1442
>gi|148983680|ref|ZP_01816999.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP3-BS71] >gi|147923827|gb|EDK74939.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP3-BS71] (1463 aa)
Score = 2354, Expect = 0.0e+00, Identities = 490/1237 (39%), Positives = 782/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G P++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L        +Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL  S  T+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDV------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHGLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNDYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQTTEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|168484148|ref|ZP_02709100.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC1873-00] >gi|172042563|gb|EDT50609.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus pneumoniae CDC1873-00] (1463 aa)
Score = 2350, Expect = 0.0e+00, Identities = 490/1237 (39%), Positives = 782/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G  ++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  K V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L        +Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL  S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVSRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPSCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNEIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNDYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEAIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNIPEDNQLSLFD 1460
>gi|139474447|ref|YP_001129163.1| DNA polymerase III PolC [Streptococcus pyogenes str. Manfredo] >gi|166217453|sp|A2RGI3|DPO3_STRPG DNA polymerase III polC-type (PolIII) >gi|134272694|emb|CAM30965.1| DNA polymerase III PolC-type [Streptococcus pyogenes str. Manfredo] (1465 aa)
Score = 2350, Expect = 0.0e+00, Identities = 513/1321 (38%), Positives = 814/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +  K +L +  K L  +GF    +  + D++     T D +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE + H+   +     KR EL  HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++   PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ R  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  + NK V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++ +G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--KNHLPNLVKQLEAFGFGTLTIDMVSDQEMTEHLTKDFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHERKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKAPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLR--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRANKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVENTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEILGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGVATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSDGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|94991249|ref|YP_599349.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS10270] >gi|166217452|sp|Q1JEV4|DPO3_STRPD DNA polymerase III polC-type (PolIII) >gi|94544757|gb|ABF34805.1| DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS10270] (1465 aa)
Score = 2349, Expect = 0.0e+00, Identities = 511/1321 (38%), Positives = 813/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS-------FTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +  K +L +  K    +GF    +  + D++     T D +S  +  +++ +++ + E ++S  A    +        F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE + HD   +     KR E   HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++DA  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  + NK V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++V   IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--KNHLPNLVKQFEAFGFGTLTIDMVSDQEMTEHLTKDFVSSRQALVEKAVQDNL-EAQKSLEAMMPPAEEATPAPKFDYKERVAQRQAGFEKAAITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHDRKDLMPEGQKRVEFHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQDAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRANKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVENTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVGKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|170754900|ref|YP_001781966.1| DNA polymerase III, alpha subunit [Clostridium botulinum B1 str. Okra] >gi|169120112|gb|ACA43948.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum B1 str. Okra] (1432 aa)
Score = 2348, Expect = 0.0e+00, Identities = 532/1282 (41%), Positives = 794/1282 (61%)
  Q:   177 DIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKD-VLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           +++S+ K+K ++ I+ E +   R    K T    +    +S+  D   + DL        + G++FK + + TKTG +I  +F+TDY++S+ +K LF +  + D ++ E+KEG++ K +  +  D Y    +    +    I K  +  + D A  KR EL  H+ M+A +G+  + EL K +++ G+ +VAITD    Q +PD  + AKK   +K IYG++  ++D  +PIV  A D  I D T+V+FD+ETTG S   DKIIE GA+K  KG  V+    F+NPE  I DKI  +T I+++ V D   I + L +  +FIGDSV++AHN   FD  F+N   ++ K++  KN ++DT+ +SR +  ++  + L VIA+   I  +    HRA  DA+   +I  +  E  K ++I TL+ +N     +   ++     + +  KN   ++NLYKL+S S    F   P++     NE+    I+ ++   G+I+ E     T++ L+++I + YD++ I   G+ E  + +    +     +++  K+I ++   YNK VVAT D ++L+E  EV+ R+ ++ +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +ID  IKPI E    P IEGA + ++++  +K+++I+GD +   V+ R+ +E++S+I+NGYA++Y  +H LV +S +DGY+VGSRGSVGSS AA + DITEVN L PHY+C  CKY  F  + +V SG DL + +CP C +KL  DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E K + A NAEI R++K C  VKRT+GQHPGGI+VVP   ++++FTP  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T V+  ++P  D  V+ LF S  +L +    I+     G+ G+PEFGT FV++MLL TKP+ F++L+RISGLSHGT+VW +NA+Y I+E   TI D IS RDDIMVYL+ K + P  AF IME VRKGKGL EE + ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YFS+R   FD   I+ GE +I  K+NE+     N      +  K+  L+ I E++ E+  R  KF  +DL KS AT FL+EGD + PP SA+ G+G + A SI +AR E  F SKED + RTKVT T ++ +E  G    + E +QISLF+ 
  S:   184 NVLSEIKSKEKKVIRKENSPKTREEENKDT----SVILGRSIKEDSIFMKDLNENSGIVVVCGDVFKKEVIETKTGRKIVTFFITDYTNSMTVK-LFPRPRDADRIIEEIKEGIYCKVRGEVVNDPYARECVIMAKD----IVKTTKIEKMDIAEEKRVELHMHSQMSAMDGMTPVSELVKRAAKWGHKAVAITDHGVVQAYPDAMSAAKK-GNIKVIYGIEAYLVDDGVPIVSKAGDKTIED-TFVVFDLETTGFSSKNDKIIEIGAVKIEKGKIVDRFSEFVNPERSIPDKITELTSITDDMVDDKEAIDKILPRFIEFIGDSVVVAHNA-AFDASFINKNCKDLKIEF-KNSVMDTVTLSRFLFPELKRYKLNVIAKHLGISLE--NHHRAVDDAKATADILLKSFEMLKEKEIITLHNLNKEFLGNINIKKEPTYHLIILAKNAVGLKNLYKLVSKSNLEYFFKRPRMAKSLINEYKEGLIIGSACEAGQIYKEILKGKTKEELKNMI-NFYDYLEIQPLGNNEFLVKN--GSVKDEKELQEINKKICELGEFYNKPVVATCDVHFLDEEHEVFRRILMSGQGFSDADNQ-----------PPLYFRTTEEMLKEFEYLGEEK-AKEVVIHNTNKIADMID-EIKPIPEETFPPKIEGAEEDIRRMTIEKAHAIYGDPLPEIVEKRLTKELNSIINNGYAVLYLIAHKLVAKSYEDGYLVGSRGSVGSSFAATMSDITEVNGLPPHYVCPKCKYSEFFTDGSVGSGADLEDKDCPNCGTKLIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHKYTEVLFGKGHVFKAGTIGTIAEKTAYGFVKKYLDE-KNIKANNAEIERLSKGCTGVKRTSGQHPGGIMVVPADNEIFNFTPIQHPADDTESDVITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTQVDPKSVPLGDPKVISLFTSPKALGVTEEDID--CPVGTYGLPEFGTKFVRQMLLDTKPKSFAELVRISGLSHGTDVWLNNAQYFIKEGYTTIKDCISTRDDIMVYLLQKELPPKSAFTIMEKVRKGKGLTEEQEALMKEHDVPDWYIESCKKIKYMFPKGHAVAYVMMAMRIAYFKVYYPRAYYATYFSVRADDFDADLIVKGEEKIKEKMNELYAMGNN------ITQKDKGLLTILEISYEMYKREIKFLKVDLYKSNATKFLIEGDSIRPPLSALQGVGKNAAKSIEEARLEGEFISKEDLRLRTKVTKTVIETLENHGCLRGMQETNQISLFSL 1432
>gi|76787214|ref|YP_330464.1| DNA polymerase III PolC [Streptococcus agalactiae A909] >gi|76562271|gb|ABA44855.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae A909] (1468 aa)
Score = 2348, Expect = 0.0e+00, Identities = 511/1311 (38%), Positives = 811/1311 (61%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEK-TIDIISDHKNKIQEKIKNEITEVKRSSNAKKT--DS---------SFTYKFRKSVT--------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDIT-GLIEEISIISKPKEFIRHDN-----ALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + +L    +  + +GF K  +  + DE+ T D+ S  +   ++ ++    E  ++  A+K+  DS         +  Y F++ +          ++T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I     ENN+ T  L   +  I   KE + H+      A  KR E   HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ AKK + +KAI+G++ NI++  +PI  N  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  +E    FI+P   +SD    +T I++  V+ +  I + L + ++F   +VL+AHN   FD+ F+N   E + + +I  P+IDTL+ +R +  +   H LG + +++++  +    H A+ DAE    LL I+ +  E ++ +D+  L E+N+ L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G  ++     +      ++  + ++GE+F+A +SN       + K  YDFI +  P  +   + R++ K    I+  I+ +I++  + +K V+AT + +Y+   DE+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L  +IVVTN+N  A   + +++ +K  L++P ++ A +++ +L Y K++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +  SG+DLP  NCPKC +  K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T AEKTA+G+VK Y  +  K    +AE+ R+A     VKR+TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+S VI CRDDIMVYL+  G+ P +AF IME VRKG  L         Y + + DNN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK++YP+ +Y +YFSIR K F+++++  G   +  ++ +I EK    + +    N E DL    EL  E+L RG+KF  +DL +S ATDF++E D LIPPF A++GLG++VA  IV+ARE+  F SK + +KR  V++T ++  +E+GI  +L ED+Q+SLF+
  S:   139 QNHLPRLEQQFSLFGFGKLAIDMVSDEQMTQDLKSSFETNREQLLEKANQEAMQALEAQKSLEDSAPPSEEVTPTQNYDFKERIKQRQAGFEKAEITPMIEVTTEENRIVFEGMVFSVERKTTRTGRHIINFKMTDYTSSFAMQKWAKDDEELKKYDMISKGSWLRVRGNI-----ENNNFTKSLTMNVQDI---KEIVHHERKDLMPADQKRVEFHAHTNMSTMDALPTVESLIDTAAKWGHPAIAITDHANVQSFPHGYHRAKK-AGIKAIFGLEANIVEDKVPISYNEVDMNLHEATYVVFDVETTGLSAANNDLIQIAASKMFKGNIIEQFDEFIDPGHPLSDFTTELTGITDNHVRGSKPILQVLQEFQNFCQGTVLVAHNA-TFDVGFMNANYERHNLPLITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVALE--HHHMANYDAEATGRLLFIFLK--EARENRDVTNLMELNTKLVAEDSYKKARIKHATIYVQNQVGLKNIFKLVSLSNVKYFEGVARIPRSVLDAHREGLLLGTACSDGEVFDALLSNGIDAAVTLAK-YYDFIEVMPPAIYRPLVVRDLIKDEAGIQQIIRDLIEVGRRLDKPVLATGNVHYIEPEDEIYREIIVRSLGQGAMINRTIGRGEDAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYEIVVTNTNTFADRFE-DVEVVKGDLYTPFVDRAEERVAELTYAKAFEIYGNPLPDIIDLRIEKELASILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSEFITDGSCGSGYDLPNKNCPKCGTLYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEEYAFRAGTVGTVAEKTAFGFVKGYERDYNKF-YNDAEVERLATGAAGVKRSTGQHPGGIVVIPNYMDVYDFTPVQYPADDMTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPSNILPDDPDVMKLFSGTEVLGVTEEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLSTVIGCRDDIMVYLMHAGLQPKMAFTIMERVRKGLWLKISEDERNGYIQAMRDNNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHYPIFYYCAYFSIRAKAFELRTMSAGLDAVKARMKDITEK----RQRNEATNVENDLFTTLELVNEMLERGFKFGKLDLYRSHATDFIIEEDTLIPPFVAMEGLGENVAKQIVRAREDGEFLSKTELRKRGGVSSTLVEKFDEMGILGNLPEDNQLSLFD 1465
>gi|77405656|ref|ZP_00782744.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae H36B] >gi|77175729|gb|EAO78510.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae H36B] (1468 aa)
Score = 2348, Expect = 0.0e+00, Identities = 511/1311 (38%), Positives = 811/1311 (61%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEK-TIDIISDHKNKIQEKIKNEITEVKRSSNAKKT--DS---------SFTYKFRKSVT--------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDIT-GLIEEISIISKPKEFIRHDN-----ALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + +L    +  + +GF K  +  + DE+ T D+ S  +   ++ ++    E  ++  A+K+  DS         +  Y F++ +          ++T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I     ENN+ T  L   +  I   KE + H+      A  KR E   HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ AKK + +KAI+G++ NI++  +PI  N  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  +E    FI+P   +SD    +T I++  V+ +  I + L + ++F   +VL+AHN   FD+ F+N   E + + +I  P+IDTL+ +R +  +   H LG + +++++  +    H A+ DAE    LL I+ +  E ++ +D+  L E+N+ L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G  ++     +      ++  + ++GE+F+A +SN       + K  YDFI +  P  +   + R++ K    I+  I+ +I++  + +K V+AT + +Y+   DE+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L  +IVVTN+N  A   + +++ +K  L++P ++ A +++ +L Y K++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +  SG+DLP  NCPKC +  K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T AEKTA+G+VK Y  +  K    +AE+ R+A     VKR+TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+S VI CRDDIMVYL+  G+ P +AF IME VRKG  L         Y + + DNN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK++YP+ +Y +YFSIR K F+++++  G   +  ++ +I EK    + +    N E DL    EL  E+L RG+KF  +DL +S ATDF++E D LIPPF A++GLG++VA  IV+ARE+  F SK + +KR  V++T ++  +E+GI  +L ED+Q+SLF+
  S:   139 QNHLPRLEQQFSLFGFGKLAIDMVSDEQMTQDLKSSFETNREQLLEKANQEAMQALEAQKSLEDSAPPSEEVTPTQNYDFKERIKQRQAGFEKAEITPMIEVTTEENRIVFEGMVFSVERKTTRTGRHIINFKMTDYTSSFAMQKWAKDDEELKKYDMISKGSWLRVRGNI-----ENNNFTKSLTMNVQDI---KEIVHHERKDLMPADQKRVEFHAHTNMSTMDALPTVESLIDTAAKWGHPAIAITDHANVQSFPHGYHRAKK-AGIKAIFGLEANIVEDKVPISYNEVDMNLHEATYVVFDVETTGLSAANNDLIQIAASKMFKGNIIEQFDEFIDPGHPLSDFTTELTGITDNHVRGSKPILQVLQEFQNFCQGTVLVAHNA-TFDVGFMNANYERHNLPLITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVALE--HHHMANYDAEATGRLLFIFLK--EARENRDVTNLMELNTKLVAEDSYKKARIKHATIYVQNQVGLKNIFKLVSLSNVKYFEGVARIPRSVLDAHREGLLLGTACSDGEVFDALLSNGIDAAVTLAK-YYDFIEVMPPAIYRPLVVRDLIKDEAGIQQIIRDLIEVGRRLDKPVLATGNVHYIEPEDEIYREIIVRSLGQGAMINRTIGRGEDAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYEIVVTNTNTFADRFE-DVEVVKGDLYTPFVDRAEERVAELTYAKAFEIYGNPLPDIIDLRIEKELASILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSEFITDGSCGSGYDLPNKNCPKCGTLYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEEYAFRAGTVGTVAEKTAFGFVKGYERDYNKF-YNDAEVERLATGAAGVKRSTGQHPGGIVVIPNYMDVYDFTPVQYPADDMTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPSNILPDDPDVMKLFSGTEVLGVTEEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLSTVIGCRDDIMVYLMHAGLQPKMAFTIMERVRKGLWLKISEDERNGYIQAMRDNNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHYPIFYYCAYFSIRAKAFELRTMSAGLDAVKARMKDITEK----RQRNEATNVENDLFTTLELVNEMLERGFKFGKLDLYRSHATDFIIEEDTLIPPFVAMEGLGENVAKQIVRAREDGEFLSKTELRKRGGVSSTLVEKFDEMGILGNLPEDNQLSLFD 1465
>gi|148988015|ref|ZP_01819478.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP6-BS73] >gi|147926479|gb|EDK77552.1| DNA polymerase III subunit alpha [Streptococcus pneumoniae SP6-BS73] (1463 aa)
Score = 2347, Expect = 0.0e+00, Identities = 491/1237 (39%), Positives = 784/1237 (63%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++T + ++  E      EG +F +++ VT+TG  +  + +TDY+ S  ++     +        +K+  W++ + +++++ +   D+T  ++++      +E + ++   +     +R E   HTNM+  + L  ++E+   +++ G+ +VAITD  N Q+FP  Y  AKK + ++ IYG++ NI++  +PIV N  +  +S+ATYV+FD+ETTGLS  Y+ +I+  A K +KG  +     FINP   +S     +T I+++ VK+A  +++ L + ++F  D+VL+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++ +  +    H A+ DAE    LL I+ K + E   + D+  LN I+    + + + R + +  T+Y KN+  ++N++KL+S S T  F+G  ++     +      I+ ++ +EGE+F+  +S       ++ K  YDFI +  P  +   I +E  K    ++  IK +I++ ++  + V+AT + +Y+   +E+Y  + V +   G   NR   + E      LPK +FRTT+E+ DEF+FL +  L   +V+ N+N +A + +  ++ +K  L++P I+ A + + +L Y+K++ I+G+ + + V  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNPL PHY+C  C+Y  F  + +  SGFD+P  +CP C  KL  +G +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T A KTAYG+VK Y  +  K   R+AE+ R+A+    VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T +W TTH  F  + +++LK D+LGHD+PT+++ L + + ++ + IP  D  VM LF+ TD L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI++    +S VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + +  N +P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K FDIK++  G   I  ++ EI EK  N +      N E+DL    E+  E+  RG+KF  +DL  S AT+FL++GD LIPPF A+DGLG++VA  +V+AREE  F SK + +KR  +++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   228 EITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNF-TRDLTMNVQDL------QEVVHYERKDLMPEGERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKK-AGIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNA-TFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALE--HHHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLN-IDLISPDSYKKARIKHA--TIYVKNQVGLKNIFKLVSLSNTKYFEGVSRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDAAVEVAK-YYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGRPVLATGNVHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEE-LARKLVIENTNALAEIFEP-VEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKF-YRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIEAMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISEKRKNNEA----SNVEIDLYTTLEIVNEMWERGFKFGKLDLYCSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFD 1460
>gi|55820164|ref|YP_138606.1| DNA polymerase III PolC [Streptococcus thermophilus LMG 18311] >gi|81561132|sp|Q5M6H0|DPO3_STRT2 DNA polymerase III polC-type (PolIII) >gi|55736149|gb|AAV59791.1| DNA polymerase III alpha subunit [Streptococcus thermophilus LMG 18311] (1464 aa)
Score = 2346, Expect = 0.0e+00, Identities = 523/1344 (38%), Positives = 844/1344 (62%)
  Q:   114 LYVLKYNMGIKKPIISENAIFL----HYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISD----HKNKIQEKIKNEITEVKRS--------SNAKKTDSSFTYKFRKSVT----GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIIS-KPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKY--NELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +Y L  N+GI+   IS N+I +    H L   +E   ++++      L++ G S   +S + D++    + +    +K  +QE+ +++  +  +S           K    +F  K  + V      ++T + ++  E      EG IF +++  TKTG  I  + VTDY+ S  ++              +K+G WV+ +  I+ + + ++ +T  +++I  IS  P++ +  +    KR E   HTNM+  + +  ++EL   ++  G+ +VAITD  N Q+FP  Y++AKK + +KAI+G++ N+++  +PIV N+ + ++ +ATYV+FD+ETTGLS  ++ +I+  A K HKG  VE    FI+P   +S     +T I++  VK A  + + L + ++F   +VL+AHN   FD+ F+N   E +++  I  P+IDTL+ +R +  +   H LG + +++ +  D    H A+ DAE    LL I+ K + E   L +   L ++N+ L +D   +++R    T+Y +N+  ++N++KL+S S  S F+G  ++  +  +E+    IV ++  +GE+F+  +S+      ++ K  YDFI +  P  +   I +++ K    IE  I+ +I++AN+ +K V+AT + +Y+N  D +Y  + V A   G   NR      N     LP+ +FRTT+E+ DEF+FL    L  +IVV N+  +A+ I+  ++ +K+ L++P+I+ A +++ ++ Y K++ ++G+ + + +  RI++E+SS++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C  C++  F  + +  SGFDLP+  C +C ++ K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGT+ T A++TAYG+VK Y  +  K   R+AE+ R+A     VKR TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y + + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+++Y +YFSIR K F++K++  G   +  ++ +IKEK    + +    N E DL    E+  E+L RG+ F  +DL KS AT+FL+EGD LIPPF A++GLG++VA  +V AREE  F SK + +KR  +++T ++ ++E+GI  ++ ED+Q+SLF+
  S:   108 IYSLFSNLGIE---ISNNSISVKAPAHIL---RENLHERFIALIADVLSNVGLSNVSISVLEDKEASSSLEEAYETNKISLQEEAESQARQALQSIVQSSPVPPPQKHQAQNFAEKQSQRVASFDKAEITPMIEVNSEENRIVFEGYIFDVEQRETKTGRIIINFKVTDYTSSFAMQRWVKDSEELVKFGMIKKGNWVRVRGRIENNPFTHS-LTMNVQDIKEISHTPRKDLMPEGQ--KRVEFHAHTNMSTMDAIPTVEELIDTAAFWGHPAVAITDHANVQSFPHGYHKAKK-AGIKAIFGLEANLVEDKVPIVYNSENLELKEATYVVFDVETTGLSAVHNDLIQIAASKMHKGNIVEQFDEFIDPGYPLSAFTTELTGITDNHVKGAKPLVQVLQEFQEFCKGAVLVAHNA-TFDVGFMNANYERHQLPTISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALD--HHHMANYDAEATGRLLFIFIKDVFEKHGLTN---LEQLNTELVSDDSYKKSRVKHATLYVQNQTGLKNIFKLVSLSNVSYFEGVARIPRKVLDEYREGIIVGSACADGEVFDTLLSHGIDKAVEVAK-YYDFIEVMPPAIYAPLIAKDLIKDEEAIEQLIRDLIEVANRLDKPVLATGNVHYINPEDAIYREIIVRALGQGAMINRPIGKGENAQPAPLPEAHFRTTNEMLDEFAFLGKD-LAYEIVVANTQAMANQIE-EVEVVKKDLYTPYIDRAEEQVAEMTYAKAFELYGNPLPDIIDLRIEKELSSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYLCPKCQHSEFITDGSYGSGFDLPDKECSECGTEYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEQYAFRAGTVGTVADRTAYGFVKGYERDYNKF-YRDAEVDRLAMGVAGVKRNTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPKDIRADDPDVMKLFSGTEVLGVTPEQIGT--STGVLGIPEFGTNFVRGMVEETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLDPKMAFTIMERVRKGMWLKISEEERNGYIQAMRENNVPDWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFELKTMSAGLDAVKARMEDIKEK----RQRNEATNLENDLFTTLEIVNEMLERGFTFGQLDLYKSQATEFLIEGDTLIPPFIALEGLGENVAKQLVAAREEGEFLSKTELRKRGGLSSTLVERLDEMGILGNMPEDNQLSLFD 1461
>gi|56808719|ref|ZP_00366439.1| COG2176: DNA polymerase III, alpha subunit (gram-positive type) [Streptococcus pyogenes M49 591] (1465 aa)
Score = 2342, Expect = 0.0e+00, Identities = 510/1321 (38%), Positives = 814/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K L  +GF    +  + D++     T + +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +GVW++ + +I+ + +  + +T  ++++      KE + H+   +     KR EL  HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++DA  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ +  YDFI I  P  +   + RE+ K +  IE  I+ +I++  +  K V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQLEAFGFGTLTIDMVSDQEMTEHLTKNFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGVWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHERKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQDAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAR-YYDFIEIMPPAVYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVENTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEILGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|19746871|ref|NP_608007.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS8232] >gi|24418360|sp|Q8NZB5|DPO3_STRP8 DNA polymerase III polC-type (PolIII) >gi|19749113|gb|AAL98506.1| DNA polymerase III alpha chain [Streptococcus pyogenes MGAS8232] (1465 aa)
Score = 2342, Expect = 0.0e+00, Identities = 511/1321 (38%), Positives = 811/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K    +GF    +  + D++     T D +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE + HD   +     KR EL  HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ R  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  +  K V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQFEAFGFGTLTIDMVSDQEMTEHLTKDFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHDRKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHNLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLR--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVQNTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEILGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|77409408|ref|ZP_00786106.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae COH1] >gi|77171990|gb|EAO75161.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae COH1] (1468 aa)
Score = 2342, Expect = 0.0e+00, Identities = 510/1311 (38%), Positives = 811/1311 (61%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEK-TIDIISDHKNKIQEKIKNEITEVKRSSNAKKT--DS---------SFTYKFRKSVT--------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDIT-GLIEEISIISKPKEFIRHDN-----ALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + +L    +  + +GF K  +  + DE+ T ++ S  +   ++ ++    E  ++  A+K+  DS         +  Y F++ +          ++T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I     ENN+ T  L   +  I   KE + H+      A  KR E   HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ AKK + +KAI+G++ NI++  +PI  N  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  +E    FI+P   +SD    +T I++  V+ +  I + L + ++F   +VL+AHN   FD+ F+N   E + + +I  P+IDTL+ +R +  +   H LG + +++++  +    H A+ DAE    LL I+ +  E ++ +D+  L E+N+ L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G  ++     +      ++  + ++GE+F+A +SN       + K  YDFI +  P  +   + R++ K    I+  I+ +I++  + +K V+AT + +Y+   DE+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L  +IVVTN+N  A   + +++ +K  L++P ++ A +++ +L Y K++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +  SG+DLP  NCPKC +  K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T AEKTA+G+VK Y  +  K    +AE+ R+A     VKR+TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+S VI CRDDIMVYL+  G+ P +AF IME VRKG  L         Y + + DNN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK++YP+ +Y +YFSIR K F+++++  G   +  ++ +I EK    + +    N E DL    EL  E+L RG+KF  +DL +S ATDF++E D LIPPF A++GLG++VA  IV+ARE+  F SK + +KR  V++T ++  +E+GI  +L ED+Q+SLF+
  S:   139 QNHLPRLEQQFSLFGFGKLAIDMVSDEQMTQNLKSSFETNREQLLEKANQEAMQALEAQKSLEDSAPPSEEVTPTQNYDFKERIKQRQAGFEKAEITPMIEVTTEENRIVFEGMVFSVERKTTRTGRHIINFKMTDYTSSFAMQKWAKDDEELKKYDMISKGSWLRVRGNI-----ENNNFTKSLTMNVQDI---KEIVHHERKDLMPADQKRVEFHAHTNMSTMDALPTVESLIDTAAKWGHPAIAITDHANVQSFPHGYHRAKK-AGIKAIFGLEANIVEDKVPISYNEVDMNLHEATYVVFDVETTGLSAANNDLIQIAASKMFKGNIIEQFDEFIDPGHPLSDFTTELTGITDNHVRGSKPILQVLQEFQNFCQGTVLVAHNA-TFDVGFMNANYERHNLPLITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVALE--HHHMANYDAEATGRLLFIFLK--EARENRDVTNLMELNTKLVAEDSYKKARIKHATIYVQNQVGLKNIFKLVSLSNVKYFEGVARIPRSVLDAHREGLLLGTACSDGEVFDALLSNGIDAAVTLAK-YYDFIEVMPPAIYRPLVVRDLIKDEAGIQQIIRDLIEVGRRLDKPVLATGNVHYIEPEDEIYREIIVRSLGQGAMINRTIGRGEDAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYEIVVTNTNTFADRFE-DVEVVKGDLYTPFVDRAEERVAELTYAKAFEIYGNPLPDIIDLRIEKELASILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSEFITDGSCGSGYDLPNKNCPKCGTLYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEEYAFRAGTVGTVAEKTAFGFVKGYERDYNKF-YNDAEVERLATGAAGVKRSTGQHPGGIVVIPNYMDVYDFTPVQYPADDMTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPSNILPDDPDVMKLFSGTEVLGVTEEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLSTVIGCRDDIMVYLMHAGLQPKMAFTIMERVRKGLWLKISEDERNGYIQAMRDNNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHYPIFYYCAYFSIRAKAFELRTMSAGLDAVKARMKDITEK----RQRNEATNVENDLFTTLELVNEMLERGFKFGKLDLYRSHATDFIIEEDTLIPPFVAMEGLGENVAKQIVRAREDGEFLSKTELRKRGGVSSTLVEKFDEMGILGNLPEDNQLSLFD 1465
>gi|94989303|ref|YP_597404.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS9429] >gi|94993192|ref|YP_601291.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS2096] >gi|123257711|sp|Q1J9R4|DPO3_STRPB DNA polymerase III polC-type (PolIII) >gi|123382486|sp|Q1JJW3|DPO3_STRPC DNA polymerase III polC-type (PolIII) >gi|94542811|gb|ABF32860.1| DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS9429] >gi|94546700|gb|ABF36747.1| DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS2096] (1465 aa)
Score = 2339, Expect = 0.0e+00, Identities = 511/1321 (38%), Positives = 811/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K L  +GF    +  + D++     T D +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE + HD   +     KR EL  HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ R  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  +  K V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+ I  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQLEAFGFGTLTIDMVSDQEMTEHLTKDFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHDRKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLR--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVQNTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEILGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMSILGNMPEDNQLSLFD 1462
>gi|21911223|ref|NP_665491.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS315] >gi|28896601|ref|NP_802951.1| DNA polymerase III PolC [Streptococcus pyogenes SSI-1] >gi|25452927|sp|Q8K5S8|DPO3_STRP3 DNA polymerase III polC-type (PolIII) >gi|21905436|gb|AAM80294.1| putative DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS315] >gi|28811855|dbj|BAC64784.1| putative DNA polymerase III alpha subunit [Streptococcus pyogenes SSI-1] (1465 aa)
Score = 2338, Expect = 0.0e+00, Identities = 510/1321 (38%), Positives = 813/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K L  +GF    +  + D++     T + +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +GVW++ + +I+ + +  + +T  ++++      KE + H+   +     KR EL  HTNM+  + L+ ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  +  K V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQLEAFGFGTLTIDMVSDQEMTEHLTKNFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGVWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHERKDLMPEGQKRVELHAHTNMSTMDALLTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVENTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKACPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGAEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|71911485|ref|YP_283035.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS5005] >gi|71854267|gb|AAZ52290.1| DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS5005] (1465 aa)
Score = 2336, Expect = 0.0e+00, Identities = 508/1321 (38%), Positives = 812/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K L  +GF    +  + D++     T + +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE +RH+   +     KR EL  HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI     D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ +  YDFI I  P  +   + RE+ K +  IE  I+ +I++  +  K V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQLEAFGFGTLTIDMVSDQEMTEHLTKNFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVRHERKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAIAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYEPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAR-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVQNTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|94995162|ref|YP_603260.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS10750] >gi|123382133|sp|Q1J4M0|DPO3_STRPF DNA polymerase III polC-type (PolIII) >gi|94548670|gb|ABF38716.1| DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS10750] (1465 aa)
Score = 2336, Expect = 0.0e+00, Identities = 510/1321 (38%), Positives = 811/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K    +GF    +  + D++     T D +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE + H+   +     KR EL  HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  + NK V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQFEAFGFGTLTIDMVSDQEMTEHLTKDFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHERKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRANKLVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVENTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGAEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|77412300|ref|ZP_00788615.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae CJB111] >gi|77161647|gb|EAO72643.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae CJB111] (1468 aa)
Score = 2336, Expect = 0.0e+00, Identities = 508/1311 (38%), Positives = 808/1311 (61%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEK-TIDIISD---HKNKIQEKIKNEITEVKRSSNA--------KKTDSSFTYKFRKSVT--------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDIT-GLIEEISIISKPKEFIRHDN-----ALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + +L    +  + +GF K  +  + DE+ T D+ S    ++ ++ EK   E  +   +  +        ++   +  Y F++ +          ++T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I     ENN+ T  L   +  I   KE + H+      A  KR E   HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ AKK + +KAI+G++ NI++  +PI  N  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  +E    FI+P   +S     +T I++  V+ +  I + L + ++F   +VL+AHN   FD+ F+N   E + + +I  P+IDTL+ +R +  +   H LG + +++++  +    H A+ DAE    LL I+ +  E ++ +D+  L E+N+ L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G  ++     +      ++  + ++GE+F+A +SN       + K  YDFI +  P  +   + R++ K    I+  I+ +I++  + +K V+AT + +Y+   DE+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L  +IVVTN+N  A   + +++ +K  L++P ++ A +++ +L Y K++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +  SG+DLP  NCPKC +  K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T AEKTA+G+VK Y  +  K    +AE+ R+A     VKR+TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+S VI CRDDIMVYL+  G+ P +AF IME VRKG  L         Y + + DNN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK++YP+ +Y +YFSIR K F+++++  G   +  ++ +I EK    + +    N E DL    EL  E+L RG+KF  +DL +S ATDF++E D LIPPF A++GLG++VA  IV+ARE+  F SK + +KR  V++T ++  +E+GI  +L ED+Q+SLF+
  S:   139 QNHLPRLEQQFSLFGFGKLAIDMVSDEQMTQDLKSSFETNRERLLEKANQEAMQALETQKSLEDSAPPSEEVTPTQNYDFKERIKQRQAGFEKAEITPMIEVTTEENRIVFEGMVFSVERKTTRTGRHIINFKMTDYTSSFAMQKWAKDDEELKKYDMISKGSWLRVRGNI-----ENNNFTKSLTMNVQDI---KEIVHHERKDLMPADQKRVEFHAHTNMSTMDALPTVESLIDTAAKWGHPAIAITDHANVQSFPHGYHRAKK-AGIKAIFGLEANIVEDKVPISYNEVDMNLHEATYVVFDVETTGLSAANNDLIQIAASKMFKGNIIEQFDEFIDPGHPLSAFTTELTGITDNHVRGSKPILQVLQEFQNFCQGTVLVAHNA-TFDVGFMNANYERHNLPLITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVALE--HHHMANYDAEATGRLLFIFLK--EARENRDVTNLMELNTKLVAEDSYKKARIKHATIYVQNQVGLKNIFKLVSLSNVKYFEGVARIPRSVLDAHREGLLLGTACSDGEVFDALLSNGIDAAVTLAK-YYDFIEVMPPAIYRPLVVRDLIKDEAGIQQIIRDLIEVGRRLDKPVLATGNVHYIEPEDEIYREIIVRSLGQGAMINRTIGRGEDAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYEIVVTNTNTFADRFE-DVEVVKGDLYTPFVDRAEERVAELTYAKAFEIYGNPLPDIIDLRIEKELASILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSEFITDGSCGSGYDLPNKNCPKCGTLYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEEYAFRAGTVGTVAEKTAFGFVKGYERDYNKF-YNDAEVERLATGAAGVKRSTGQHPGGIVVIPNYMDVYDFTPVQYPADDMTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPSNILPDDPDVMKLFSGTEVLGVTEEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLSTVIGCRDDIMVYLMHAGLQPKMAFTIMERVRKGLWLKISEDERNGYIQAMRDNNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHYPIFYYCAYFSIRAKAFELRTMSAGLDAVKARMKDITEK----RQRNEATNVENDLFTTLELVNEMLERGFKFGKLDLYRSHATDFIIEEDTLIPPFVAMEGLGENVAKQIVRAREDGEFLSKTELRKRGGVSSTLVEKFDEMGILGNLPEDNQLSLFD 1465
>gi|22538049|ref|NP_688900.1| DNA polymerase III PolC [Streptococcus agalactiae 2603V/R] >gi|25011937|ref|NP_736332.1| DNA polymerase III PolC [Streptococcus agalactiae NEM316] >gi|76798733|ref|ZP_00780952.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae 18RS21] >gi|54036993|sp|P63984|DPO3_STRA5 DNA polymerase III polC-type (PolIII) >gi|54040954|sp|P63983|DPO3_STRA3 DNA polymerase III polC-type (PolIII) >gi|22534952|gb|AAN00773.1|AE014277_21 DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae 2603V/R] >gi|24413479|emb|CAD47557.1| DNA polymerase III (alpha subunit) [Streptococcus agalactiae NEM316] >gi|76585912|gb|EAO62451.1| DNA polymerase III, alpha subunit, Gram-positive type [Streptococcus agalactiae 18RS21] (1468 aa)
Score = 2335, Expect = 0.0e+00, Identities = 510/1311 (38%), Positives = 810/1311 (61%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEK-TIDIISDHKNKIQEKIKNEITEVKRSSNAKKT--DS---------SFTYKFRKSVT--------GDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDIT-GLIEEISIISKPKEFIRHDN-----ALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN------EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + +L    +  + +GF K  +  + DE+ T D+ S  +   ++ ++    E  ++  A+K+  DS         +  Y F++ +          ++T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I     ENN+ T  L   +  I   KE + H+      A  KR E   HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ AKK + +KAI+G++ NI++  +PI  N  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  +E    FI+P   +S     +T I++  V+ +  I + L + ++F   +VL+AHN   FD+ F+N   E + + +I  P+IDTL+ +R +  +   H LG + +++++  +    H A+ DAE    LL I+ +  E ++ +D+  L E+N+ L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G  ++     +      ++  + ++GE+F+A +SN       + K  YDFI +  P  +   + R++ K    I+  I+ +I++  + +K V+AT + +Y+   DE+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L  +IVVTN+N  A   + +++ +K  L++P ++ A +++ +L Y K++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV++S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C NC++  F  + +  SG+DLP  NCPKC +  K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T AEKTA+G+VK Y  +  K    +AE+ R+A     VKR+TGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++   I   D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+S VI CRDDIMVYL+  G+ P +AF IME VRKG  L         Y + + DNN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK++YP+ +Y +YFSIR K F+++++  G   +  ++ +I EK    + +    N E DL    EL  E+L RG+KF  +DL +S ATDF++E D LIPPF A++GLG++VA  IV+ARE+  F SK + +KR  V++T ++  +E+GI  +L ED+Q+SLF+
  S:   139 QNHLPRLEQQFSLFGFGKLAIDMVSDEQMTQDLKSSFETNREQLLEKANQEAMQALEAQKSLEDSAPPSEEVTPTQNYDFKERIKQRQAGFEKAEITPMIEVTTEENRIVFEGMVFSVERKTTRTGRHIINFKMTDYTSSFAMQKWAKDDEELKKYDMISKGSWLRVRGNI-----ENNNFTKSLTMNVQDI---KEIVHHERKDLMPADQKRVEFHAHTNMSTMDALPTVESLIDTAAKWGHPAIAITDHANVQSFPHGYHRAKK-AGIKAIFGLEANIVEDKVPISYNEVDMNLHEATYVVFDVETTGLSAANNDLIQIAASKMFKGNIIEQFDEFIDPGHPLSAFTTELTGITDNHVRGSKPILQVLQEFQNFCQGTVLVAHNA-TFDVGFMNANYERHNLPLITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVALE--HHHMANYDAEATGRLLFIFLK--EARENRDVTNLMELNTKLVAEDSYKKARIKHATIYVQNQVGLKNIFKLVSLSNVKYFEGVARIPRSVLDAHREGLLLGTACSDGEVFDALLSNGIDAAVTLAK-YYDFIEVMPPAIYRPLVVRDLIKDEVGIQQIIRDLIEVGRRLDKPVLATGNVHYIEPEDEIYREIIVRSLGQGAMINRTIGRGEDAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYEIVVTNTNTFADRFE-DVEVVKGDLYTPFVDRAEERVAELTYAKAFEIYGNPLPDIIDLRIEKELASILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPNCQHSEFITDGSCGSGYDLPNKNCPKCGTLYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGEEYAFRAGTVGTVAEKTAFGFVKGYERDYNKF-YNDAEVERLATGAAGVKRSTGQHPGGIVVIPNYMDVYDFTPVQYPADDMTAAWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPSNILPDDPDVMKLFSGTEVLGVTEEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLSTVIGCRDDIMVYLMHAGLQPKMAFTIMERVRKGLWLKISEDERNGYIQAMRDNNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHYPIFYYCAYFSIRAKAFELRTMSAGLDAVKARMKDITEK----RQRNEATNVENDLFTTLELVNEMLERGFKFGKLDLYRSHATDFIIEEDTLIPPFVAMEGLGENVAKQIVRAREDGEFLSKTELRKRGGVSSTLVEKFDEMGILGNLPEDNQLSLFD 1465
>gi|15675759|ref|NP_269933.1| DNA polymerase III PolC [Streptococcus pyogenes M1 GAS] >gi|81175278|sp|P0C0B8|DPO3_STRP1 DNA polymerase III polC-type (PolIII) >gi|13622981|gb|AAK34654.1| DNA polymerase III (alpha subunit) [Streptococcus pyogenes M1 GAS] (1465 aa)
Score = 2334, Expect = 0.0e+00, Identities = 508/1321 (38%), Positives = 812/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K L  +GF    +  + D++     T + +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE +RH+   +     KR EL  HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI     D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ +  YDFI I  P  +   + RE+ K +  IE  I+ +I++  +  K V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQLEAFGFGILTIDMVSDQEMTEHLTKNFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVRHERKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAIAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYEPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAR-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVQNTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|50915026|ref|YP_060998.1| DNA polymerase III PolC [Streptococcus pyogenes MGAS10394] >gi|73919253|sp|Q5X9U8|DPO3_STRP6 DNA polymerase III polC-type (PolIII) >gi|50904100|gb|AAT87815.1| DNA polymerase III alpha subunit [Streptococcus pyogenes MGAS10394] (1465 aa)
Score = 2331, Expect = 0.0e+00, Identities = 510/1302 (39%), Positives = 804/1302 (61%)
  Q:   156 FLNDYGFSKHHLSYILDE--------KTIDIISDH-------------KNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           F+N+  F  +HL  ++ +         TID++SD              +  + EK   +  E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE + H+   +     KR E   HTNM+  + L  ++ L   +++ G+ +VAITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI  +  D  + +ATYV+FD+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  IE  I+ +I++  + NK V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+ I  ++ ED+Q+SLF+
  S:   131 FVNNDHFRNNHLPNLVKQFEAFGFGTLTIDMVSDQEMTEHLTKNFVSSRQALVEKAVQDNLEAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVHHERKDLMPEGQKRVEFHAHTNMSTMDALPTVESLIDMAAKWGHKAVAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGIPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRANKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVENTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVERLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMSILGNMPEDNQLSLFD 1462
>gi|90961543|ref|YP_535459.1| DNA polymerase III PolC [Lactobacillus salivarius UCC118] >gi|122449173|sp|Q1WUF9|DPO3_LACS1 DNA polymerase III polC-type (PolIII) >gi|90820737|gb|ABD99376.1| DNA polymerase III alpha subunit [Lactobacillus salivarius UCC118] (1444 aa)
Score = 2330, Expect = 0.0e+00, Identities = 526/1338 (39%), Positives = 817/1338 (61%)
  Q:   119 YNMGIKKPIISE-NAIFLHYLEND------QEKCIKKYLEH-----FRKFLNDYGFSKHHLSYILDE-KTIDIISDHK-----------NKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGD--VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNL-QNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVE--GDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +N GI+   I E +   + YL+N+      + + +K++L            +  GF K  ++ ++DE K  +II + K            K  E IK + +E +  S A+        +  K ++ D  +T++ ++  E ++ T++G +F  +    ++G ++    VTDY+ S V+K     + ++ +   +  GVW+K + S+Q D Y  + +    +   I  + ++    +N   KR EL  H+NM+  +   +I E    ++E G+ ++AITD    Q FP+ +   +K + +K +YGV+ NI+D  +PI  N     + DATYVIFD ETTGLS  YDK+IE  A+K  KG  +++ + FI+P   +S     +T I+++ V+ +   +E     K+F  D +++ HN   FD+ F+N   E + M++I+ P IDTL ++R +  ++ G  L  +A+K  I  +    HRA  DAE    I+  ML++ + + I   ++ N ++ +ND  +  +    I +    EG ++NL+KL S S+   F   P+V      ++    IV ++  +GE+F A M     + +    + YD++ +     +   + +E+ K    +E+ I  ++K+A++ +K +VAT D +++N+ D +Y ++ ++++      NRL K       LP  +FRTTDE+ +EFSFL + +   +IVVTN N +   I + I P+K+ L++P +EGA   +  L   ++++ +GD +   V+ R+D+E+ SVI NG+++IY  S  LV +S  DGY+VGSRGSVGSS+ A +  ITEVNPL PHY C  CK+ +F +  +  SG+DLP+ +CP C ++L  DG +IPFETF+GFKG+K+PDIDLNFS  YQ  AH++ K +FGE  V+RAGTI T A+KTAYGYVK+Y E   + N R AEI R+AK    VKRTTGQHP GI+VVP   D+YDFTP  YPADD T  W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D  VM LF+ TD L +    I     TG+ G+PEFGT FV+ ML  T P+ F++L++ISGLSHGT+VW  NA+ LI+   +T+ DVI CRDDIM+ LI  G+    AFKIME VRKG+G+ +E+Q  +   ++P WYI +C KI Y+FPKAHA AYV+MA +IA+FK+YYPL +YA+YFS+R   FD+ S+  G+  + N +  I  K     T      KE +L+ + E+A E+L RG+ F+ +D+ KS A ++ ++  G  L+ PF+AI GLG +VA  IV AREE+ F SKED  KR KV+ + +  M E  +   L +++Q+SLF
  S:   102 FNSGIQSSFIQELSRSKVPYLDNNRVILLAENEIVKRFLVDQALGPLESTYHKIGFPKFSVNTLVDETKAQEIIENIKEQKAKSDAELAQKAVEAIKKQ-SEQREKSKAEVPSIEGPVQLGKKISPDQEITQMINITEEERSVTVQGYVFDKEVRELRSGRKLLILEVTDYTASFVVKKFSRTEEDEAMFDAINSGVWIKVRGSVQEDNYMRDLVINAYDLNEIKHESRKDTAPENE--KRVELHLHSNMSMMDATNSITEYVSKAAEWGHKAIAITDHGTLQAFPEAHAAGQK-NNVKILYGVEANIVDDGVPIAYNEQHKNLRDATYVIFDTETTGLSAQYDKVIELAAVKMEKGNVIDTFEEFIDPGHPLSQTTINLTSITDDMVRGSKSEEEVFRLFKEFCKDCIIVGHNA-TFDVDFMNTGYERHNMEMIQEPWIDTLPLARYLYPEMKGFRLNTLAKKLNIKLE--HHHRAIYDAEATGFIYYAMLKDAEEKQILYHDDFNKHVGENDAYKHEHPSHAIILAKTQEG-LKNLFKLTSESMVKYFYRVPRVPRSILEKYREGLIVGSACADGEVFTAMMQKGYTIAKQK-AEFYDYLEVQPKPLYEPLLEQELVKDNDNLEEIITNMVKLAHELDKPIVATGDVHFMNKEDAIYRKILIHSQAGANPLNRLKK-------LPDAHFRTTDEMLEEFSFLGEDI-AKEIVVTNPNKLVDEI-SEITPVKDKLYTPKMEGAEQDIHDLTMNRAHAWYGDTLPEIVQKRLDKELKSVIGNGFSVIYLISQKLVYKSNKDGYLVGSRGSVGSSLVATMTGITEVNPLPPHYRCPKCKWTHFYEKGEYGSGYDLPDKDCPNCGTELIKDGQDIPFETFLGFKGNKVPDIDLNFSGDYQPIAHNYTKVLFGENNVYRAGTIGTVADKTAYGYVKAY-ERDTEQNFRGAEIDRLAKGATGVKRTTGQHPAGILVVPDYMDIYDFTPIQYPADDLTAAWRTTHFDFHSIHDNILKLDILGHDDPTMIRMLQDLSGIDPKTIPTDDPGVMALFSGTDILGVTPEEIQS--STGTLGVPEFGTRFVRGMLEETHPKTFAELLKISGLSHGTDVWLGNAEELIKNGTVTMPDVIGCRDDIMMDLIHMGVESDKAFKIMEHVRKGRGIPDEWQADMRAADVPEWYIGACLKIKYMFPKAHAAAYVLMALRIAYFKVYYPLVYYAAYFSVRADDFDLVSMSRGKEAVKNAMELINSKGNEATT------KEKNLLTVLEIANEMLERGFDFSMVDINKSDAQNWTIQEDGRTLLAPFTAIPGLGLNVAKQIVAAREEQEFISKEDLSKRGKVSQSLIDFMTENHVLDDLPDENQLSLF 1444
>gi|193216948|ref|YP_002000190.1| DNA polymerase III subunit alpha [Mycoplasma arthritidis 158L3-1] >gi|193002271|gb|ACF07486.1| DNA polymerase III subunit alpha [Mycoplasma arthritidis 158L3-1] (1438 aa)
Score = 2329, Expect = 0.0e+00, Identities = 531/1311 (40%), Positives = 808/1311 (61%)
  Q:   146 IKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKN-EITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDIT--GLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNA-NDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRM-LENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKD--KYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN--VDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNAR---NAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +KK   + ++ L + GF  + +   + E+  D       KI+  ++N +  + + ++N   + S+  Y+  K+   ++   S L       T++GE+F ID     +G  +  + ++DY+++I+IK L   + N+++     E V V  K++   D Y    I   G  + I I+++  + +  DN   KR E    +NM+  +G+ +     K +   G+ ++AITD  + Q+FP+FYN  KK   +  IYG   + I  +         D  +S  TYV+FD+ETTGLSP +++IIEFGA     G+  ES Q FI P + I   I  ITKI++  V +    +E + KI D + + + +AHN  KFD+        +  +D  K   ID+L I+R + ++   + L ++A+K+ + Y   +AHRAD DA  L N+W  M L+  + ++I+T NE+ + + +D L  +     + V  KN+  ++ L+K+IS SLT ++ GGP+++ + + E +   ++  S   G ++E AM+ T    E+I+K    YD+I       F +    +      ++ A K +++ A K  K  +A SD  Y+ +   + +R+YVNA  LGG ++ L KY E+ T  P + + TT ++KDEF FLND  L+N+IVV N++ +A  I   I+ IK+ L+ P  + +++KLK+++YQ +   +G+ ++  + +RI++E+  +   GY++IYW SH LVK+S  DGY+VGSRGSVGSS+ A L  ITEVNPL+PHY+C  CK+F + ++  + SG+DLP+  CPKC + +  DGH+IPFETF+GF+ +K+PDIDLNFS  YQ   H+++K +FGE   FRAGTI+T A KTAYG+ + Y EE   ++        +  +A K E VKRTTGQHPGGI+++P   DV DFTP NYPA+D T  W TTH  F S+HD++LK D+LGHD+PT+++ML + T  +A  IP FD  VM LF+ST+++KI NP       TG+ G+PEFGT FV+ ML   KP+ F+DLI +SGLSHGT+VW+ NA+ LI++ G  + D + CRDDIM  LI+  I  + AF+IME VRKGKGL+E  + +L   N+P WYIES  KI Y+FPKAHATAYVIMAW+IAW+K YYPL FYAS++S R    DIK + +G+  + NK+ E+K++  +   K  +  KE +LIPI E+  EL  RG+K  N+ + KS A  ++V  E   LIPPF  ++GLG++VA SI++AR E  F S EDF+KRTKV +     ++ LGI   L+E +Q SLF
  S:   133 LKKLENNLKESLENIGFGFYKIKLKIIEE--DTKKRRAKKIEAVVENFDKFKKEEANNTPSSTSNQPYRRSKAKAIEMDIKSALNSYADLITLKGEVFSIDVRKFSSGKSMASFGLSDYNEAIIIKVLL--EDNEELKITNGETVIVTGKLTD--DQYSKTKIVFCGSTKNI-IVTEGLQRLSDDNEENKRIEFALRSNMSTQDGISSPSAYLKAAKHFGHRAIAITDLDDVQSFPEFYNATKKDKSVVPIYGATISSISSDNGFFYGTPADFDLSSQTYVVFDLETTGLSPRFNEIIEFGASIIENGIIKESHQFFIKPTKPIPPSITEITKITDNTVANGYSQEEGVRKIYDILKNRICVAHNA-KFDINVCKENFLKYGLDNSKIIGIDSLAIARFLIDEAKSYRLEIVAKKFNVYYARNEAHRADYDANVLANVWILMILKLAREKNIRTANELAA-VNDDKLFAKKFPREVRVIAKNQKGLKKLFKIISKSLTDDYHGGPRLFIDKW-EHDEDLLLGTSTNAGWVWEEAMTGTD---ENILKALAPYDYIEFPPISTFNYIYKDDSITLEQVQFAYKDLLEKAKKLGKLCIAVSDARYIYDYQSLIYRIYVNAPTLGGGQHWLKKYREIAT--PDFKYLTTRQMKDEFKFLNDGTLINEIVVDNTHKLAEQITPKIEVIKDKLYFPTFDDSANKLKEVVYQTAKERYGNNIDEKILSRIEKELGPITKYGYSVIYWISHKLVKRSNQDGYLVGSRGSVGSSIVANLAGITEVNPLKPHYLCEKCKHFEWSEDPHIFSGWDLPDKKCPKCATIMLKDGHDIPFETFLGFEANKVPDIDLNFSGEYQVTIHNYVKELFGEAHTFRAGTIATIASKTAYGFCRKYDEEIHSLHEEPWTRTFLDFLASKTEGVKRTTGQHPGGIIIIPKEFDVEDFTPVNYPANDITSAWKTTHFDFTSIHDNVLKLDLLGHDDPTVIRMLEDLTKTDAKKIPKFDEKVMSLFSSTEAIKI-NPSEISNETTGAYGLPEFGTTFVRRMLKTAKPKSFNDLILMSGLSHGTDVWSGNAEELIKQ-GKKLQDCVCCRDDIMRDLINWNIDHLEAFEIMEKVRKGKGLSEYQESLLQSKNVPIWYIESLKKIKYMFPKAHATAYVIMAWRIAWYKFYYPLQFYASFYSTRPDAIDIKVMSDGKDAVDNKLLELKKR--SDSKKEPLSTKETNLIPILEITQELYARGFKITNVHISKSKAARWIVDIENKALIPPFVVVEGLGETVADSIIQARNEHEFLSVEDFEKRTKVNSKIASQLKLLGILDELDETNQNSLF 1438
>gi|642270|emb|CAA88043.1| DNA polymerase III [Staphylococcus aureus] (1415 aa)
Score = 2327, Expect = 0.0e+00, Identities = 508/1227 (41%), Positives = 767/1227 (62%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKE---GVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRG-WIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCK---YFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K A IEG IF I+    K+G  I +  VTDY+DS+V+K +F +K NKD L   K    G WV+A+  I+ D +    I  L+  +S I + K+  + D A  KR E   HT M+  +G+ NI    K +++ G+ ++A+TD    Q FPD +  A+K+  +K IYG++  ++D  +PI     D  + DATYV+FD+ETTGLS  YDKIIE  A+K H G  ++  + F NP E++S+ I  +T I+++ + DA +I+E L + K+++GD++ +AHN   FD+ F++   E        N +IDTL++SR IN +   H L  +A+KY ++   TQ HRA  D E    I+ +M++  K   +   NEIN  L N+   +R R S +T+  +N+  ++NL+K++S SL   F   P++     +E+    +V  +  EGE+F A M   Q  +E I K  YDFI I  P  +   I RE+ +    + +  +R+I   +     V+AT + +YL E D +  ++ + A   G   NR        + LP+ +FRTTDE+ +EF FL +    ++IVV N+N +A  I+  + PIK+ L++P +EGA++++++L Y  +  ++G+ +   V  R+++E+ S+I NG+A+IY  S  LVK+S+DDGY+VGSRGSVGSS  A + +ITEVNPL PHYIC NCK   +FN + +V SGFDLP+  C  C + L  +G +IPFE F+GFKGDK+PDIDLNFS  YQ  AH++ K +FGE++VFRAGTI T AEKTA+GYVK Y  + + ++ R AEI R+ K                       D+YDFTP  YPADD+   W TTH  F S+HD++LK DILGHD+PT+++ML + + ++  TIP  D +VM +F++ +SL +    I  + KTG+ G+P       ++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+     +S VI CRDDIMVYL+  G+ P +AFKIME VRKGKGL EE  + + +N +P WY++SC KI Y+FPKAHA AYV+MA +IA+FK+++PL++YASYF+IR   FD+ +++  ++ I N + ++  +  +      +  KE D++ + E+  E+  RGY+   I L+KS A +F++EGD LIPPF ++ GLG++VA  IV+AR++  F SKED  K+  +    ++ ++ELG   +L +  Q+S+F+
  S:   235 EFKVA-IEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLK-MFTRK-NKDDLEHFKALSVGKWVRAQGRIEEDTF----IRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKHG-IKMIYGMEGMLVDDGVPIAYKPQDVVLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNA-SFDMGFIDTGYERLGFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGVEL--TQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKLSNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQSQVEKIAK-YYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILI-ASQPGNPLNR--------STLPEAHFRTTDEMLNEFHFLGEEK-AHEIVVKNTNELADRIE-RVVPIKDELYTPRMEGANEEIRELSYANARKLYGEDLPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTSEFFN-DGSVGSGFDLPDKTCETCGAPLIKEGQDIPFEKFLGFKGDKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLND-QGIHKRGAEIDRLVKGY--------------------MDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEI--LCKTGTFGVPN-SDRIRRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIKYIFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRYMD------LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPGLGENVAKRIVEARDDGPFLSKEDLNKKAGLYQKIIEYLDELGSLPNLPDKAQLSIFD 1414
>gi|116629466|ref|YP_814638.1| DNA polymerase III, alpha subunit ( type) [Lactobacillus gasseri ATCC 33323] >gi|116095048|gb|ABJ60200.1| DNA polymerase III catalytic subunit, PolC type [Lactobacillus gasseri ATCC 33323] (1432 aa)
Score = 2324, Expect = 0.0e+00, Identities = 552/1385 (39%), Positives = 821/1385 (59%)
  Q:    72 VLFNLVFNYDTYNQEDILNYLIY-----FVNHNIEQKQKGTSEK---KELLYVLKYNMGIKKPIISENAIFLH----YLENDQ---------------EKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTID--------IISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLE--NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK---YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNN-IPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDY-LIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           V F+   +++TY     LN LI+     FVN  +  + K  S K   +   Y ++ +  +K P + E   FL     YLE ++               E+ + +    FR+    YGF     +  +DE  ID        + + H++ +QE  + +  E K+    K T        +K+      ++ DL        IEG IF  D    K+G  I+   +TDY+DSI  K     K   D L E+K GVW + +     D Y++ D+   I  + +I       +++    KR EL  HTNM+  +      +  K + + G  ++AITD  + Q FP+ Y+      K+K +YG + N+ID +  +VLN  +    D  YVIFD+ETTGLS  YD IIE GA+K   G  +E    FINP   +SD    +T I++E V  A   K+ + K KDF GD  L  HN ++FD+ F+N  L    +D I  P++DTL++SR ++ +   H+L  +A+KY +  +    HRA++DAE    +  ++L+  N +  +   L ++N   +   + +R + S ++V   N+  ++N+YKL+S + T  F   P+       +++   +  +   +G++F + M    Q   D  ++K   YD++ +  P  +   I  ++ K    + + I+ I K+  + NK VVAT D++Y+   + +Y ++ + A+     RN+          LP  +F +T E+ D FSFL + V   +IV+ N+N +A  I+  I PIK  L+ PHIE A  ++K L Y K+Y ++G  +   V+ RI+ E++S+I NGYA+IY  S  LV +S  DGY+VGSRGSVGSS+ A +  ITEVNPL PHY C  CKY  F +N +  SG+DLP+ NCPKC + L  DG +IPF TF+GF GDK+PDIDLNFS  YQ  AH++I+ MFG +  FRAGTI+T A+KTAYGYVK Y E+  +++ RNAE+ R+A     VKRTTGQHP GIVVVP   D+YDFTP  YPADD +  W TTH  F S+HD++LKFDILGHD+PT+++ML + + ++  TIP  D  VM LF+S   L +    I    KTG+ G+PEFGT FV+ ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      + +VI CRD+IM+ LI  G+ P +AF  ME VR GKG+++E  ++L  N+ IP WYI SC KI Y+FPKAHATAY++MA +IAWFK+YYP+ +YASYFS+R  +FD+ ++ +G++ +   + EI++K  +      V  K+  L+ + E+A E L RG K   +D+ +S A DF +  D+ ++ PF+A+ GLGD+ A  IV AR E+ F SKED   R KV+ T M+  E  G+   + + +Q+SLF
  S:    48 VFFDTPLDFETYRS---LNELIHQTFEPFVNVELIVRTKDGSSKNLPEYWTYAIQNSTNLK-PAVRE---FLQGQAPYLEKEKWLIPTQNNVVNGLLSEQVLAELNSEFRR----YGFFNIKFTTKVDETNIDENLKSLEQVQAQHESAMQEFYEKQPAEPKKKMPVKSTRMGSNKVDKKA---KFIQIKDLEDGSGNVAIEGHIFNTDIHELKSGSVIFTGEITDYTDSISFKKFVSDKEQIDYLKEIKPGVWARMQGYAADDQYQH-DVVFNIRNLELIEHKGREEKYEGEE-KRVELHLHTNMSQLDATSTASDFIKTAKKFGQKAIAITDHADVQAFPEAYHTGAS-EKMKILYGYEANMIDDHALLVLNPTEMDYRDREYVIFDVETTGLSSVYDTIIEIGAVKMKNGEVLERFDEFINPHHPLSDTTINLTSITDEMVGAADDEKDVIKKFKDFYGDRPLCGHN-VQFDVGFVNAALRRAGLDEISQPVVDTLEVSRLLHPEQTRHTLDSLAKKYNVVLE--HHHRANQDAEATGYLMFKLLDAFNARFHE-ADLGKMNDYAKYGQVYKRAKPSHMSVLALNQEGLKNMYKLVSLASTKYFYRIPRTPKSELRKYHKGLLFGSGCWQGDVFISMM----QKGYDEAREKARFYDYLEVQPPAAYQTLIDDDLIKDEDELHEIIQNIYKLGKELNKPVVATGDSHYVEPHEAIYRKILLAAQKSNPNRNK---------KLPDLHFYSTQEMLDAFSFLGEDV-AKEIVIENTNKLADQIE-EIAPIKSGLYPPHIENADQEMKDLTYNKAYELYGKPLPKIVEDRIELELNSIISNGYAVIYLISQRLVAKSNKDGYLVGSRGSVGSSLVATMSGITEVNPLAPHYRCPKCKYSKFFENGEYGSGYDLPDKNCPKCGTPLVKDGQDIPFATFLGFHGDKVPDIDLNFSGDYQPVAHNYIRVMFGPDNSFRAGTIATVADKTAYGYVKHY-EDENELHLRNAELDRLAAGASGVKRTTGQHPAGIVVVPDDMDIYDFTPVQYPADDLSAAWLTTHFDFHSIHDNILKFDILGHDDPTMIRMLQDLSGIDPLTIPPDDPGVMSLFSSPKILGVTPEQIQS--KTGTLGVPEFGTKFVRGMLEETKPTTFSELLQISGLSHGTDVWLGNAEDLINNGTCKLKNVIGCRDNIMMDLIHWGVKPEVAFFTMESVRHGKGISDENMEILKKNDKIPDWYIPSCLKIKYMFPKAHATAYILMALRIAWFKVYYPVIYYASYFSVRADLFDLVAMSHGKNTVKAAMKEIQDKGMD------VSAKDKSLLTVLEIANECLERGIKIKMVDVNESEAMDFKIIDDHTILAPFNAVPGLGDNAAKQIVAARAEQKFLSKEDLATRGKVSQTIMEYFENNGVLEGMPDQNQLSLF 1432
>gi|42519364|ref|NP_965294.1| DNA polymerase III alpha subunit [Lactobacillus johnsonii NCC 533] >gi|41583652|gb|AAS09260.1| DNA polymerase III alpha subunit [Lactobacillus johnsonii NCC 533] (1432 aa)
Score = 2315, Expect = 0.0e+00, Identities = 551/1385 (39%), Positives = 824/1385 (59%)
  Q:    72 VLFNLVFNYDTYNQEDILNYLIY-----FVNHNIEQKQKGTSEKK---ELLYVLKYNMGIKKPIISENAIFLH----YLEND------QEKCI-----KKYLEHFRKFLNDYGFSKHHLSYILDEKTIDI--------ISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLE--NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK---YDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNN-IPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDY-LIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           V F+   +++TY     LN LI+     FVN  +  + +  S KK      Y ++ +  +K P + E   FL     YLE +      Q + +     ++ L    K    YGF     +  +DE  ID          + H++ +QE  + +  E K+    K T        +K+      ++ DL        IEG IF  D    K+G  I+   +TDY+DSI  K     K   D L  +K GVW + +     D Y++ D+   I  + +I       +++    KR EL  HTNM+  +      +  K + + G  ++AITD  + Q+FP+ Y+      K+K +YG + N+ID +  +VLN  +    +  YVIFD+ETTGLS  YD IIE GA+K   G  +E    FINP   +SD    +T I++E V  A   K+ + K K+F GD  L  HN ++FD+ F+N  L    ++ I  P++DTL++SR ++ +   H+L  +A+KY +  +    HRA++DAE    +  ++L+  N++  +   L ++N   +   + +R + S ++V   N+  ++N+YKL+S + T  F   P+       +++   +  +   +G++F + M    Q   D  ++K   YD++ +  P  +   I  ++ K    + + I+ I K+  + NK VVATSD++Y+   + +Y ++ + A+   G  NR       N  LP  +F +T E+ D FSFL + V   +IV+ N+N +A  I+  I PIK  L+ PHIE A  ++K L Y K+Y ++G  +   V+ RI+ E++S+I NGYA+IY  S  LV +S  DGY+VGSRGSVGSS+ A +  ITEVNPL PHY C NCKY  F +N +  SG+DLP+  CPKC + L  DG +IPF TF+GF GDK+PDIDLNFS  YQ  AH++I+ MFG +  FRAGTI+T A+KTAYGYVK Y E+  +++ R AE+ R+A     VKRTTGQHP GIVVVP   D+YDFTP  YPADD +  W TTH  F S+HD++LKFDILGHD+PT+++ML + + V+  TIP  D  VM LF+S + L + +  I    KTG+ G+PEFGT FV+ ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI      + +VI CRD+IM+ LI  G+ P +AF  ME VR G+G+++E  ++L  N+ IP WYI SC KI Y+FPKAHATAY++MA +IAWFK+YYP+ +YASYFS+R  +FD+ ++ +G++ +   + EI++K  +      V  K+  L+ + E+A E L RG K   +D+ +S ATDF +  D+ ++ PF+A+ GLGD+ A  IV AR E+ F SKED   R KV+ T M+  E  G+   + + +Q+SLF
  S:    48 VFFDTPLDFETYRS---LNELIHETFEPFVNVELLVQTRDGSSKKLPAYWTYAIQNSTNLK-PAVRE---FLQGQAPYLEKEKWLIPTQNQVVNGLLSEQVLAELNKEFRRYGFFNIKFTTKVDETNIDENLRSLEQEQAQHESAMQEFYEKQPAEPKKKMPVKSTRMGNKKVDKKA---KFIQIKDLEDGSGNVAIEGHIFNTDIHELKSGSVIFTGEITDYTDSISFKKFVSDKDQIDYLKGIKPGVWARMQGYAADDQYQH-DVVFNIRNLELIEHKGREEKYEGEK-KRVELHLHTNMSQLDATSTASDFIKTAKKFGQKAIAITDHADVQSFPEAYHTGAS-EKMKILYGYEANMIDDHALLVLNPTEMDYRNREYVIFDVETTGLSSVYDTIIEIGAVKMKNGEVLERFDEFINPHHPLSDTTINLTSITDEMVGAADDEKDVIKKFKEFYGDRPLCGHN-VQFDVGFVNAALRRAGLEEITQPVVDTLEVSRLLHPEQTRHTLDSLAKKYNVVLE--HHHRANQDAEATGYLMFKLLDAFNERFHE-ADLGKMNDYAKYGQVYKRAKPSHMSVLALNQEGLKNMYKLVSLASTKYFYRIPRTPKSELRKYHKGLLFGSGCWQGDVFISMM----QKGYDEAREKARFYDYLEVQPPAAYQTLIEDDLIKDEDELHEIIQNIYKLGKELNKPVVATSDSHYVEPHEAIYRKILLAAQ--KGNSNR-------NKNLPDLHFYSTQEMLDAFSFLGEDV-AKEIVIDNTNKLADQIE-EIAPIKSGLYPPHIENADQEMKDLTYNKAYELYGKPLPKIVEDRIELELNSIISNGYAVIYLISQRLVAKSNKDGYLVGSRGSVGSSLVATMSGITEVNPLAPHYRCPNCKYSKFFENGEYGSGYDLPDKECPKCGTPLVKDGQDIPFATFLGFHGDKVPDIDLNFSGDYQPVAHNYIRVMFGPDNSFRAGTIATVADKTAYGYVKHY-EDENELHLRKAELDRLAAGASGVKRTTGQHPAGIVVVPDDMDIYDFTPVQYPADDLSAAWLTTHFDFHSIHDNILKFDILGHDDPTMIRMLQDLSGVDPLTIPPDDPGVMSLFSSPEILGVTSEQIQS--KTGTLGVPEFGTKFVRGMLEETKPTTFSELLQISGLSHGTDVWLGNAEDLINNGTCKLKNVIGCRDNIMMDLIHWGVKPEVAFFTMESVRHGRGISDENMEILKKNDKIPDWYIPSCLKIKYMFPKAHATAYILMALRIAWFKVYYPVIYYASYFSVRADLFDLVAMSHGKNTVKAAMKEIQDKGMD------VSAKDKSLLTVLEIANECLERGIKIKMVDVNESEATDFKIIDDHTILAPFNAVPGLGDNAAKQIVAARAEQKFLSKEDLATRGKVSQTIMEYFENNGVLEGMPDQNQLSLF 1432
>gi|192812883|ref|ZP_03041549.1| DNA polymerase III, alpha subunit [Geobacillus sp. Y412MC10] >gi|192798211|gb|EDV74725.1| DNA polymerase III, alpha subunit [Geobacillus sp. Y412MC10] (1438 aa)
Score = 2313, Expect = 0.0e+00, Identities = 502/1226 (40%), Positives = 759/1226 (61%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGK-KINKDVLSELKEGVWVKAKISIQIDMY-ENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLEN-QKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKR-GWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVL-PKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTN--CKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDK-GITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEK--MANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E K  TI+G IF +D+   + G  ++ + +TD+SDS+ +K +FGK K +  VLS L+ G WVKA+  ++ D + +  ++  +  +++ +  P    R DNA  KR E   HT M+  + +  I    K ++  G+ ++A++D    Q +PD    AKK+  +K +YG++ N+++  + IV  A   ++S ATYV+FDIETTGLS   +KIIE  A+K H+G ++     F+NP E+I   I  +T I+++ VKDA +++  L +  +F+GD VL+AHN  +FD+ F+   L+   MD ++NP +DTL+++R ++  +  H L  +A KYK+  +    HRA  D   L  I   +L +  K + +K L+ +N  +  D      R     +Y  N    +NLYKL+S S T  F   P +      E  +  +V +   +GE FE  ++ T++  E+I    YD + I     ++H + + +      I+ AI ++++I  K NK V+AT + +YL   D+++  + ++          +  ++ L  +  P  +FRTT+E+  EF FL       ++VVTN++ +A   + +++   + L +P +EGA ++++   Y  + SI+G+ +   V AR+++E+  +I  G++  Y  S  LVK+S  DGY+VGSRGSVGSSV A  + I+EVNPL  HYIC N  CK+  +  + +V SGFDLP+  CP+C + +KG+G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH+F K MFGE+ VFRAGTI T AEKTA+G+ K Y EE      R AE+ R+A  C  VKR+TGQHPGGIVVVP   +V + TP  YPADD   +W TTH  + +   +LLK DILGHD+PT+++ML + T V+  TIP  D  VM +FNST++L +K   I   + T   G+PE GT FV++ML+ ++P  F+DL++ISGLSHGT VW  NA+ LI+     I  VI CRDDIM++LI K G+   +AFKI E VRKG+GL++E+   +    +P WYI+SC KI Y+FPKAHA AYVI A + A+FK+YYP+ +YA+YFS+R + FDI+    G   I  +I EI++    A+PK K         ++PI E+ALE+  RG+ F NIDL +S A  F V+GD LIPPFSA+ G+GD+ A +I  ARE   F S EDF++++K + T ++++ ++G    L E +Q+SLF
  S:   233 EEKKITIQGTIFGLDRKELRNGSTLFTFNLTDFSDSLQMK-MFGKTKDDLKVLSLLENGKWVKARGRVEYDRFMQVPELVMIPSDLNEVKAPPS--RKDNAAEKRVEFHLHTTMSTMDAVTPIDRYIKTAAAWGHKAIAVSDHGGVQCYPDAAKNAKKHG-IKMMYGIEANVVNDAVNIVEQAQPIELSSATYVVFDIETTGLSITANKIIELAAVKMHEGKEIGRYATFVNPHERIPYHIQQLTNINDDMVKDAPELEPVLKEFVEFVGDGVLVAHNA-RFDMGFIQAALKNAGMDTLENPYLDTLELARLVHPGLKNHRLNTLADKYKVLLE--SHHRAIDDTIALAGILNGLLSDVDKTKGVKMLDRLNDYVGMDL--SNTRPFHCGIYALNMTGKKNLYKLVSMSHTEYFKRVPCIPKSKLQEMRDGLLVLSGCEKGEFFETVLNKTEEEAEEI-AGFYDVLEIQPLTMYMHLVDKGLVGSPEEIKTAISKVVRIGEKLNKPVIATGNVHYLEPRDKLFRDITIHG---------ITGFSPLKDMRKPDAHFRTTEEMLQEFEFLGQDKCY-EVVVTNTSELADRFE-DLELFPDKLFTPILEGADEEIRNTCYDTAKSIYGENLPEVVVARLEKELEPIIRYGFSANYLISEKLVKKSNRDGYLVGSRGSVGSSVVATFLGISEVNPLPAHYICLNSDCKHSEWFLDGSVPSGFDLPDKACPECGNMMKGEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPHAHNFTKEMFGEKNVFRAGTIGTVAEKTAFGFAKKY-EEHNNKRWRGAELNRLASGCTGVKRSTGQHPGGIVVVPDYIEVEEITPVQYPADDVNAEWKTTHFDYHAFEANLLKLDILGHDDPTMMRMLQDLTGVDPTTIPMNDPKVMSMFNSTEALGVKPEQIRSPVAT--FGVPEMGTKFVRQMLVESQPSSFADLLQISGLSHGTGVWLGNAQELIKNGTCNIKTVIGCRDDIMLFLIYKAGMDASLAFKITESVRKGRGLSQEWIDEMKKCKVPQWYIDSCLKIQYMFPKAHAAAYVISAVRTAYFKLYYPIEYYATYFSVRAEDFDIELCCQGYEAIYRRIEEIEQLGFGASPKEKG--------MLPILEMALEMTARGFSFKNIDLYQSDALRFKVDGDSLIPPFSALAGIGDNAARNIAAAREFGEFLSIEDFQQKSKASKTAVELLTQMGCFRGLPESNQLSLF 1438
>gi|125973511|ref|YP_001037421.1| DNA polymerase III PolC [Clostridium thermocellum ATCC 27405] >gi|125713736|gb|ABN52228.1| DNA polymerase III catalytic subunit, PolC type [Clostridium thermocellum ATCC 27405] (1442 aa)
Score = 2311, Expect = 0.0e+00, Identities = 551/1441 (38%), Positives = 850/1441 (58%)
  Q:    16 LVSLENWKNHFETNCDFTITRNKQNDSINIKISFNKVLPADILIPFVDSLNLVDD--SVLFNLVFNYDTYNQEDILNY---LIYFVNHNIEQKQ------KGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLE-HFRKFLNDYGFSKHHLSYILDEKT---IDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFT-YKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++ EN +  F+T     I   K++  + I I  + ++PA  L     S   + +   V   + FN +   +E +  Y   ++Y V  NI   +      K   E K+L   LK     K   I +       +EN  ++C    ++  F+ F  D      ++ +  +E+     D +  +  K Q+  K+E T  +  SN        +   F K+    V  +S++  +     ++GEI + +    K+G  +Y + VTD+++S+ +K    K  +  V+  LKE   VK +   Q D + + +++ L  +I  +  P + +R DNA  KR EL  HT M+A +G+ ++ EL K +++ G+ ++A+TD    Q +P+    AKK +K+K IYG++  ++D ++PIV +AN   + D  +V+FDIETTGLS   DKI E GA+K  +G  V++   F+NPE  I + +  +T I+++ V DA  I + L +  +F+G S L+AHN + FD  F+  N +L    +D   NP+IDTL++SR +  ++  H L V+A+   +  +    HRA  DA+    I+ + LE    +++KT+++I +  +  +  ++       +  KN   +RNLYK++S +    F   P++  +         I+ ++   GE++ A + N  +     I   YD++ I   G+    +     ++     +++  ++I+ +  KYNK VVAT D ++++  DEV+ R+ +  +      N+              YFRTTDE+ +EF +L       ++VVTN+N IA + + +I PI E    P IEGA ++++ L   K+  I+GD +   V+ R+++E++S+I NG++++Y  +  LV +S+ DGY+VGSRGSVGSS  A+L+ ITEVN L PHYIC NCKY  F  + +   GFD+PE  CP+C   LK DG++IPFETF+GF+GDK PDIDLNFS  YQ  AH + + +FG   V+RAGTI T AEKTAYG+VK+Y +E + + A NAEI R+ K C  VKRTTGQHPGG+++VP  +++Y+F P  YPADD      TTH  + S+   LLK DILGHD+PT++KML + T VNA TIP  +   M +F+ST+ L I+   IN     G+  IPEFGT FV++ML+ TKP+ FS+LIRISGLSHGT+VW +NA+ L+     ++S+VI  RDDIM+ LI  G+    AFKIMEDVRKGKGL EEY++++ +  +P WYIESC KI Y+FPKAHA AYV+MA++IAWFK+YYP  FYA+YF++R   FD   + +G+ ++ NKI E + K  N      +  KE + + I E+A E+  RG KF  ID+ KS A  F +E D L PP +A+ GLG S A SI +AR +  F S +D + R KV+ T ++I+++ G    L E +QISLF
  S:    18 VINNENERELFDTARIQNINVYKKSRKLEIFIVSDTLIPAKTLDSVEQSFKKLFELEQVHLRVSFNVELSIEEALEKYWDSILYIVKKNIALCRGILSGCKWKIEDKKLYIYLK----TKGTEILKCKSCDTLIENIIKECFGLEIKVEFKDFEIDEDKINEYIEFKENEEAKIVTDTVIKNNEKTQKTEKSEKTSGESKSNVSSAGGEKSEVIFGKNFNDSVMNMSEVTQDSGRVVVKGEIIRTEARELKSGKLLYVFDVTDFTNSLTVKIFLDKDKSGSVIERLKEKANVKIRGEAQYDKF-SRELSILASDI--VEVPVQ-VRTDNAAEKRVELHLHTQMSAMDGVTSVGELIKRAAQWGHKAIAVTDHGVVQAYPEACEAAKK-NKIKVIYGIEAYLLDDSVPIVYHANGHPV-DGEFVVFDIETTGLSADKDKITEIGAVKIKEGKIVDTFSTFVNPEIPIPEFVVKLTGITDDMVSDAPTIDKVLPEFLEFVGTSPLVAHNAV-FDTGFIRHNARLINRNVD---NPVIDTLELSRQMFPELKKHKLDVVAKHLGVSLE--NHHRALDDAKACGEIFIKCLEILAEKNVKTIDDIQNVFEGCWNYQKANSYHAIILVKNYVGLRNLYKIVSKTHLEYFHKRPRLPRKLLMMHREGLILGSACEAGELYRAILENKDEDEISRIVKFYDYLEIQPLGNNRFLVES--GKVNSEEDLKNINRKIVALGEKYNKPVVATCDVHFMDPQDEVFRRILMAGQGFSDADNQ-----------APLYFRTTDEMLEEFEYLGREKCY-EVVVTNTNLIADMCE-DILPIPEGTFPPKIEGAEEEIRMLAENKAREIYGDPLPEIVEKRMEKELNSIIKNGFSVMYIIAQKLVWKSLSDGYLVGSRGSVGSSFVAYLIGITEVNSLPPHYICENCKYSEFIEDGSYGCGFDMPEKECPRCGKILKKDGYDIPFETFLGFEGDKEPDIDLNFSGEYQPIAHKYTEELFGVGHVYRAGTIGTIAEKTAYGFVKNYLDE-RGIVATNAEINRLVKGCTGVKRTTGQHPGGVMIVPQDREIYEFCPIQYPADDPDSGTITTHFDYHSISGRLLKLDILGHDDPTVIKMLEDLTGVNARTIPIGEKRTMGIFSSTEPLGIRPEDIN--CPVGTFAIPEFGTKFVRQMLVDTKPKTFSELIRISGLSHGTDVWLNNAQDLVRNNIASLSEVICTRDDIMLNLIHYGLPNKTAFKIMEDVRKGKGLKEEYEQIMREKKVPDWYIESCKKIKYMFPKAHAAAYVMMAFRIAWFKVYYPEAFYATYFTVRADEFDASMMCHGKEKVKNKIKEYELKGNN------MTQKEKNTLTILEVANEMYARGIKFLPIDIYKSDAVKFKIEKDGLRPPLNALQGLGVSAAHSIAQARNQGEFLSVDDLRIRAKVSKTVIEILQQNGCLDGLPESNQISLF 1441
>gi|118726343|ref|ZP_01574970.1| DNA polymerase III, alpha subunit [Clostridium cellulolyticum H10] >gi|118664222|gb|EAV70857.1| DNA polymerase III, alpha subunit [Clostridium cellulolyticum H10] (1433 aa)
Score = 2310, Expect = 0.0e+00, Identities = 506/1280 (39%), Positives = 790/1280 (61%)
  Q:   177 DIISDH---KNKIQEKIKNEITEVKRSSNA-KKTDSSFTYKFRKSVTGD---------------VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDF-LRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           D+  DH   +  + EK+KNE   V  +  A  +      Y+F+   +GD               + K+S++  +     + GE+F+ +    + G  IY + VTD++ S+ +K    KK   ++   + EGV ++ +   Q D +        I    I+   +E IRHD+A  KR EL  HT M++ +G+  +K+L K +++ G+ ++A+TD    Q +PD Y  +KK + +K IYG++  ++D ++PIV    +  + D  +V+FDIETTGL+P  D+I E GA+K   G  V+    F+NP   I   I  +T I+N+ VKDA  I++ L +  +FI  SVL+AHN   FD+ F+  N K+   K   +KNP +DTL++ R +  ++  + L ++A+  KI+ +    HRA  D+     I+   L   K +  K + +I +    +  L+  +  ++I V  KN+  ++NLYK++S S        P+V  +   E+    I+ ++   GE++ A ++N  +     I   YD++ I   G+ +  +++   ++  +  ++   K+II++  ++ K VVAT D ++++  DEV+ R+ ++ +      N+              YFRTT+E+ +EFS+L +     ++V+ N+N IA +I++ I P+ E    P IEGA   ++ +   ++  I+G+ +   V  R+++E++S+I NG+A++Y  +  LV +S++DGY+VGSRGSVGSS  A +  ITEVN L+PHY+C  CKY  F  + + D GFDLPE +CP C +KLK DG++IPFETF+GF GDK PDIDLNFS  YQ  AH + + +FGE  VFRAGTI++ AEKTAYGYVK+Y +E + +   NAEI R+ K C  +KRTTGQHPGGI++VP  K+++DF+P   PADD   +  TTH  +  LH S+LK DILGHD+PT+++ML + T V+A TIP  +   M LF+ST++L +K   I    +TG+  +PEFGT FV++MLL TKPQ FS+LIRISGLSHGT+VW +NA+ LI +   T+S  I CRDDIM+YL+  G+ P  AFKIMEDVRKGKG+ EEY+ ++ +NN+P WYI+SC KI Y+FPKAHA AYV+MA++IAWFK+YYP  FYA+YF++R   FD + +  G+ ++ NKI E + K  N      +  KE +++ I E+  E+  RG  F  I+L  S AT F +E   + PP +A+ GLG + A +I++AR+   F S ++ + R K++ + ++I+E   +   + E +Q+ LF
  S:   165 DMHVDHVIIEEYVAEKVKNEAKVVSSAITALPENQKQKKYEFKSYGSGDMPSKAVITGKPFTDSIMKISEVTPDSGKVAVAGEVFRTEYREIRGGKYIYIFDVTDFTSSVTVKMFLEKKDFGNISERITEGVCLRIRGEAQYDKFSKELA---IMAFDIVETERE-IRHDDAEEKRVELHLHTQMSSMDGVTAVKDLVKRAAQWGHKAIAVTDHGIVQAYPDAYAASKK-NNIKVIYGLECYLLDDSVPIVYGIKEHSLDD-DFVVFDIETTGLNPQQDRITEIGAVKVRNGQIVDRFSAFVNPGVSIPSFIVKLTGITNDMVKDAPPIEQVLNEFMEFIQGSVLVAHNA-NFDVGFIKHNAKIIGEK---VKNPYLDTLELCRKMFPELGRYKLNIVAKHLKIELE--NHHRAVDDSMATAKIFIHCLNELKEKGCKNIKDIQNAFDGEVNLKASSYHAIILV--KNKVGLKNLYKIVSQSHLKYLYKKPRVPKKLLMEYREGLILGSACEAGELYRAILNNKSEDEISKIVRFYDYLEIQPLGNNQFLINN--GKVSSQEELKKINKKIIRLGERHRKPVVATCDVHFMDPRDEVFRRILMSGRGFTDADNQ-----------APLYFRTTEEMLEEFSYLGEEK-AREVVIENTNLIADMIES-IAPVLEGTFPPKIEGAEQDIENMAMNRAKEIYGEELPEVVAKRLEKELNSIIKNGFAVMYLIAQKLVSKSLNDGYLVGSRGSVGSSFVANMSGITEVNSLQPHYVCEKCKYSEFILDGSYDCGFDLPEKDCPNCGNKLKKDGYDIPFETFLGFDGDKEPDIDLNFSGDYQPVAHKYTEELFGEGYVFRAGTIASVAEKTAYGYVKNYLDE-RSIVVTNAEINRLVKGCTGIKRTTGQHPGGIMIVPKDKEIFDFSPIQRPADDIKSEIITTHFDYHFLHGSILKLDILGHDDPTVIRMLEDLTGVDARTIPIGEKKTMSLFSSTEALGVKPEDIGS--ETGTFAVPEFGTKFVRQMLLDTKPQSFSELIRISGLSHGTDVWLNNAQELIRDGITTLSQSICCRDDIMIYLMHAGLPPKTAFKIMEDVRKGKGVKEEYEAIMKENNVPDWYIQSCKKIKYMFPKAHAAAYVMMAFRIAWFKVYYPEAFYATYFTVRADDFDAEMMTYGQDKVRNKIKEFEMKGNN------ITTKEKNVLTILEVVNEMYARGINFLPINLYLSEATKFRIEDKSIRPPMNALQGLGGAAAQNIIEARKNGEFLSIDELRTRAKISKSVIEILERNNVLEGMPESNQLCLF 1433
>gi|195978859|ref|YP_002124103.1| DNA polymerase III PolC [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975564|gb|ACG63090.1| DNA polymerase III PolC [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (1465 aa)
Score = 2310, Expect = 0.0e+00, Identities = 504/1321 (38%), Positives = 805/1321 (60%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDS---------------SFTYKFR---KSVTGD---VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISI-ISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELN--TVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +  K +L +       +GF +  +  + D++    ++DH  K  E  +  + E     N     S               SF Y+ R   +  + D   +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I     ENN  T   + +++ + + K  + H+   +     KR E   HTNM+  + L  +++L   ++  G+ +VAITD  N Q+FP  Y+ A+K   +KAI+G++ NI++  +PI  N     + +ATYV+FD+ETTGLS   + +I+  A K  KG  +E    FINP   +S     +T I++  +  A  I++ L   + F   ++L+AHN   FD+ F+N   +   +  I  P+IDTL+++R +  +   H LG + +++++  +    H A+ DAE    LL I+ +  E ++   I  L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     ++     ++  + ++GE+F+A ++       D+ K  YDFI I  P  +   + RE+ K +  +E  I+ +I++  +  K V+AT + +Y+   D +Y  + V +   G   NR     E      LP+ +FRTT+E+ D+F+FL    L  ++VV N+  +A  I+  ++ +K  L++P+I+ A + + +L YQK+++I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C+   F  + +V SG+DLP   CP+C +  K DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FGEE  FRAGT+ T AEKTAYG+VK Y  +  K    +AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  +PADD T  W TTH  F  + +++LK D+LGHD+PT+++ L + + ++  TIP  D DVM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y K +  NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G + +  ++    E ++N + +    N E DL    E+  E+L RG+KF  +DL KS AT+F +EGD LIPPF A++GLG++VA  IVKAR++  F SK + +KR   + T +  M+ELGI  ++ +D+Q+SLF+
  S:   131 FVNNDHFR--KNHLPNLAAQFERFGFGRLSIDMVSDQE----MTDHLTKDFETNRQALVEKAVQDNIAAQQSLEAMQPPVEETVPSPSFDYRERMAQRQASFDKAVITPMIEVDTEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFAMQKWAKDDDELRKFDLIAKGAWLRVQGNI-----ENNPFT---KSLTMNVQQVKAIVHHERKDLMPEGQKRVEFHAHTNMSTMDALPTVEDLIDTAARWGHQAVAITDHANVQSFPHGYHRARKVG-IKAIFGLEANIVEDKVPISFNPVAMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIIEQFDEFINPGHPLSAFTTELTGITDNHLVGAKPIQQVLEAFQAFCQGTILVAHNA-SFDVGFMNANYDRYGLAKISQPVIDTLELARNLYPEYKRHGLGPLTKRFQVSLE--HHHMANYDAEATGRLLFIFLK--EAREKHGITNLLQLNTDLVAEDSYKKARIKHATIYVQNQLGLKNMFKLVSLSNVKYFEGVPRIPRTVLDQHREGLLLGTACSDGEVFDAVLTQGIDAAVDLAK-YYDFIEIMPPAIYQPLVVRELIKDQAGVEQIIRDLIEVGRRAEKPVLATGNVHYIEPEDAIYRDIIVRSLGQGALINRTIGRGEAAKPVPLPEAHFRTTNEMLDDFAFLGQD-LAYEVVVQNTQALADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFAIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQQSEFITDGSVGSGYDLPNKACPRCGTLYKKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPNAHLDVRDIFGEEYAFRAGTVGTVAEKTAYGFVKGYERDYGKFYP-DAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQFPADDVTASWQTTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPITIPADDPDVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERSSYIKAMRQNNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLAAVKARM----EDISNKRKRNEASNVENDLFTTLEIVNEMLERGFKFGKLDLYKSEATEFQIEGDTLIPPFIALEGLGENVARQIVKARQDGEFLSKMELRKRGGASATLVDKMDELGILGNMPDDNQLSLFD 1462
>gi|161507686|ref|YP_001577640.1| DNA polymerase [Lactobacillus helveticus DPC 4571] >gi|160348675|gb|ABX27349.1| DNA polymerase [Lactobacillus helveticus DPC 4571] (1438 aa)
Score = 2308, Expect = 0.0e+00, Identities = 517/1310 (39%), Positives = 779/1310 (59%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEKTI--------DIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS--FTYKFRK-SVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGL--IEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLEN-QKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDF-LVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +K L+   + + D+GF        +D+  +        ++  +H+  +QE   N   + K     K+   +   +Y  RK      +T++ D+    +   I+G IF I+    K G  I+   +TDY+DSI  K     K   + ++ +K G W K + S   D + ++ +  +   E +  I + +++        KR EL  HTNM+  +      +  K + + G  ++AITD  + Q+FP+ Y+  K  +  K +YGV+ N+ID +  +V+N       D  +VIFD+ETTGLS  YD IIE GA+K   G  +E    FINP   +S++   +T I++E V  A      + + +DF GD  L  HN ++FD+ F+N  L    +  I  P++DTL++SR ++ + + H+L  +A+KY +  +    HRA++DAE    +  ++L+  +K  +   LN +N    +  + +R R S +TV  K++  ++NLYKL+S + T +F   P+    +    +      +   +G++F A M        +  K  YDF+ +  P  +   I   + K    +ED I+ I K+  + NK VVAT D +Y+   D +Y  + ++A+     RN+           P  +F +T E+ D FSFL + +   +IV+ N+N IA  I + I+PIK+ L+ PHI  A +++K+L Y K+Y ++G  +   VK RID E++S+I NGYA+IY  S  LV +S  DGY+VGSRGSVGSS+ A +  ITEVNPL PHY C  CKY  F +N +  SGFDLP+  CPKC ++L  DG +IPF TF+GF GDK+PDIDLNFS  YQ  AH+FI+ MFG +  +RAGTI+T A+KTAYGY K +F+E + + ARNAE+ R+A     VKRTTGQHP GIVVVP   D+YDFTP +YPADD    W  TH  F S+HD++LKFDILGHD+PT+++ L + + ++  TIP  D  VM LF+S   L +    I    +TG+ G+PEFGT FV+ ML  TKP  F++L++ISGLSHGT+VW  NA+ L+      + DVI CRD+IM+ LI  G+ P +AF  ME VR G+G+++E   +L  N NIP WYI SC KI Y+FPKAHATAY++MA +IAWFK+YYP  +Y +YFS+R  +FD+ ++ +G++ +   + EI++K  +         K+  L+ + E+A E L RG K   +D+ +S ATDF +++   ++ PF+A+ GLGD+ A  IV AR EK F SKED  KR KV+ T M   E+ G+   + +++Q+SLF
  S:   139 QKTLDDLAEKMRDFGFFNLKFITEVDQTNLQNSLESLRELQQEHEKSMQEAFNNTPEKPKPKPKPKQQYQTKRTSYGGRKLDEKAPITQIQDVEDGTRNVVIKGNIFNIESRELKNGSVIFTGEITDYTDSIAFKKFASNKEQIEQMAAIKPGTWAKMQGSAMDDQWVHDVVFNISSFETVEHIGRTEKY----EGEQKRVELHLHTNMSQLDATNAPSDFIKTAKKFGQKAIAITDHGDVQSFPEAYSTGKA-TGTKILYGVEANMIDDHALLVINPAPMTYEDREFVIFDVETTGLSSVYDTIIEIGAVKMKNGEVIERFDKFINPHHPLSEQTINLTSITDEMVSAADDEDVVIKQFQDFYGDRPLCGHN-VQFDVGFVNAALRRAGLSEITQPVVDTLEVSRLLHPEQNRHTLDSLAKKYNVSLE--HHHRANQDAEATGYLMYKLLDAFKKKYNEDNLNNLNGYAAHGEVYKRARPSHMTVLAKDQKGLKNLYKLVSIASTKDFYRIPRTPKSDLARLHEGLFYGSGCWQGDVFIAMMQKGYDEAREKAK-FYDFLEVQPPANYSQLIEDGLIKDEAQLEDIIRNIYKLGKELNKPVVATGDAHYVEPHDAIYRTILISAQRSNPNRNK---------PQPDLHFYSTQEMLDAFSFLGEDI-AKEIVIDNTNKIADEI-SEIQPIKDGLYPPHIAHADEEMKKLTYDKAYELYGKPLPKIVKDRIDLELNSIISNGYAVIYLISQRLVAKSNKDGYLVGSRGSVGSSLVATMSGITEVNPLAPHYRCPKCKYSQFFENGEYGSGFDLPDKACPKCGTQLVKDGQDIPFATFLGFHGDKVPDIDLNFSGDYQPVAHNFIRVMFGPDNSYRAGTIATVADKTAYGYAK-HFDEERDLKARNAELDRLASGIRGVKRTTGQHPAGIVVVPDDMDIYDFTPVSYPADDVNAAWLITHYDFHSIHDNILKFDILGHDDPTMIRHLQDLSGIDPLTIPPDDPGVMSLFSSPKILGVTPEQIQS--ETGTLGVPEFGTRFVRGMLEETKPTTFAELLQISGLSHGTDVWLGNAEDLVNNGTCKLKDVIGCRDNIMMDLIHWGVKPEVAFSTMESVRHGRGISDENMAILKKNKNIPDWYIPSCLKIKYMFPKAHATAYILMALRIAWFKVYYPEIYYTAYFSVRADLFDLVAMSHGKNTVKAAMKEIQDKGNDASA------KDKSLLTVLEIANECLERGIKIKMVDIDQSEATDFKILDKHTILAPFNAVPGLGDNAAKQIVAARAEKKFLSKEDLAKRGKVSQTIMNYFEDNGVLEGMPDENQLSLF 1438
>gi|47458892|ref|YP_015754.1| DNA polymerase III PolC [Mycoplasma mobile 163K] >gi|47458220|gb|AAT27543.1| DNA polymerase III alpha subunit [Mycoplasma mobile 163K] (1433 aa)
Score = 2304, Expect = 0.0e+00, Identities = 519/1217 (42%), Positives = 774/1217 (63%)
  Q:   240 EIFKIDKVV--TKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLN-ANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E + +DK +  TK    I    ++D +++I ++  F  K   +       G ++  +  +  D +    I  +  +   ISK K+    D  + KR EL   T M+  +G     +   F+ ++ + S+AI D  + Q+FP+F+N  KK + +K IYG  F+ I KN   + N   +T I + TYV+FD+ETTGLSP +D IIEFGA K   G  ++++Q F+ P ++IS+KI  IT I N+DV++A+  KEAL KI +F+GD  ++AHN   FD+ F+N K+E+         +IDTL +S+ I  +    SL  +A +  I Y+ T+AHRAD DA+ L  +W   ++     ++K  ++I  N +++ + E+ R   IT+  KN+  ++ L++ IS + T  +  GPK+++E+  E + + ++ +   +  I       T++ L + +K  +D++ I  P+ F H I  E   +  + + +K +++ + K NK VVA  D  Y+ + +++   +Y+NAK L G R+ LFKY++  T  P   +  T E+ D+F FL D  L+ +IVV N++ I++ I+ NI+ IK+ L +P IE +++ L++L+Y K++ I+G  +   + +RI++E++ +I+ GY +IYW SH +V +S++DGY+VGSRGSVGSS+ A+L  ITEVNPL PHYIC+NCK   F KN+D  SG+DLP  NC  C   LK +G  IPFETF+GF  +K+PDIDLNFS  YQ   HD ++  FGE+  FRAGTIS TA+KTAYGYV ++ EE+  +   NA I  +A K    KRTTGQHPGGI+V+P    V DFTP N+PA+D    W TTH  F ++HD++LK D+LGH++PT +K LT  TNVN   IP  D  V+ LF ST +L IK   I+    TG+ G PEFGT FV++ML+  K + FSDLI +SGLSHGT+VWN+NA+ LI +K L + D+ISCRDDIMV+LI KG+  + AF+IME+VRKGKGLN E +++L  + +  WYI+S NKI Y+FPKAHA AYV+MAW+IAWFK+YYPL FYASYF+ R    DIK + + +  I+ K+++ K +  N K +  +  KE  LI + E+A E+  RG+K + I + KS AT++++  E + LIPPF+A+DGLG +VA SI++ R++K F S ED  +RT V  T  +   EL I   LNE +Q SLF
  S:   219 EAYVVDKKIFETKNKNLILTITISDNTEAIKLRRFFESKDQLNSFDITNIGDFIVIEGKVDFDTFNKEKI--IYPKTITISKDKKESSVDMEIEKRIELSIRTTMSTMDGFKEADDFVSFAKQLNHESLAIVDIDSVQSFPNFFNAVKK-ANIKGIYGASFSTIFKNNQAIKNLKKNTLIKNETYVVFDLETTGLSPIFDDIIEFGAQKILNGKVIDTLQFFVKPNKEISEKITLITGIKNQDVENAISEKEALKKILEFMGDHTVVAHNA-TFDMNFINEKIEKYNFQESNLQIIDTLVVSKIIEPEAKKFSLENLASRSGIIYNSTEAHRADYDADVLAKVWNLYIQKLSDMNVKYFDDI-YNFKSNIIYEKTRPFEITILAKNQSGLKELFQKISLTSTKQYFNGPKMFFEDLLEKSKNILIGSGTLKSLIINEVFRGTRKGLREYLK-YFDYVEIIPPKNFSHWIKNEDILKEELLEGLKILVEESKKLNKIVVAVGDVRYVQKDEKILHEIYINAKGLQGIRHPLFKYDQSETDYPTLNYLNTQEMIDQFLFLQDNDLIKEIVVKNTHLISNQIENNIEVIKKDLFTPKIENSANLLRELVYAKAFEIYGKNLPELIISRIEKELNPIIEQGYDVIYWISHKIVAKSLEDGYIVGSRGSVGSSLVAYLSGITEVNPLPPHYICSNCKDCEFIKNLDITSGYDLPHKNCNNCYKALKREGQTIPFETFLGFGANKVPDIDLNFSNEYQHIVHDEVRKWFGEDHCFRAGTISKTADKTAYGYVLAWAEENN-LTFSNAFIGYLASKIVGTKRTTGQHPGGIIVIPKDFSVEDFTPINFPANDPNSSWKTTHFDFHAIHDNVLKLDLLGHNDPTAIKFLTSLTNVNVFDIPFNDEKVLSLFTSTKALNIKPEDISG-EHTGALGFPEFGTTFVRKMLVSAKAKSFSDLISVSGLSHGTDVWNNNAEDLILKKNLQLKDIISCRDDIMVFLITKGVNELKAFQIMENVRKGKGLNSEEEQLLKAHKVSDWYIDSLNKIKYMFPKAHAAAYVMMAWRIAWFKLYYPLEFYASYFTTRADFIDIKIMSSTKKTISEKLSDFKRRR-NSKGEDKLSAKEQGLITVLEIAEEMYARGFKISKISINKSEATNWIIDKESNSLIPPFNAMDGLGVAVAESIIEQRKKKPFISIEDVIERTSVNKTLNEKFIELEIYEDLNESNQTSLF 1433
>gi|76363558|sp|P0C0B7|DPO3_STRPY DNA polymerase III polC-type (PolIII) >gi|9789541|gb|AAF98345.1| DNA polymerase III alpha chain [Streptococcus pyogenes] (1465 aa)
Score = 2297, Expect = 0.0e+00, Identities = 503/1321 (38%), Positives = 807/1321 (61%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEK-----TIDIISDHKNKIQEKIKNEITEVKRSSNA-------KKTDSSFTYKFRKSV------TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI-----KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNE--LNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL--NEE----YQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           ++ ND  +    +L +  K L  +GF    +  + D++     T + +S  +  +++ +++ + E ++S  A             F YK R +          +T + ++  E      EG +F +++  T+TG  I  + +TDY+ S  ++              + +G W++ + +I+ + +  + +T  ++++      KE +RH+   +     KR EL  HTNM+  + L  ++ L   +++ G+ ++AITD  N Q+FP  Y+ A+K + +KAI+G++ NI++  +PI     D  + +    + D+ETTGLS   + +I+  A K  KG  VE    FI+P   +S     +T I+++ ++ A  +   L   +DF  DS+L+AHN   FD+ F+N   E + +  I  P+IDTL+ +R +  +   H LG + +++++  D    H A+ DAE    LL I+ +  + ++   IK L ++N++L  +   ++ R    T+Y +N+  ++N++KL+S S    F+G P++     +      ++  + ++GE+F+A ++       D+ +  YDFI I  P  +   + RE+ K +  IE  I+ +I++  +  K V+AT + +YL   +E+Y  + V +   G   NR     E      LPK +FRTT+E+ DEF+FL    L   +VV N+   A  I+  ++ +K  L++P+I+ A + + +L YQK++ I+G+ + + +  RI++E++S++ NG+A+IY  S +LV +S + GY+VGSRGSVGSS  A ++ ITEVNP+ PHY+C +C++  F  + +V SG+DLP   CPKC +  + DG +IPFETF+GF GDK+PDIDLNFS   Q  AH  ++++FG+E  FRAGT+ T AEKTAYG+VK Y  +  K   R+AE+ R+A     VKRTTGQHPGGIVV+P+  DVYDFTP  YPADD T  W TTH  F  + +++LK DILGHD+PT+++ L + + ++  TIP  D  VM LF+ T+ L +    I     TG  GIPEFGTNFV+ M+  T P  F++L+++SGLSHGT+VW  NA+ LI+E   T+  VI CRDDIMVYL+  G+ P +AF IME VRKG  L  +EE    Y   + +NN+P WYIESC KI Y+FPKAHA AYV+MA ++A+FK+++P+ +Y +YFSIR K F++K++  G   +  ++ +I  K  N +      N E DL    E+  E+L RG+KF  +DL KS A +F ++GD LIPPF A++GLG++VA  IVKAR+E  F SK + +KR   ++T ++ M+E+GI  ++ ED+Q+SLF+
  S:   131 FVNNDHFR--NNHLPNLVKQLEAFGFGILTIDMVSDQEMTEHLTKNFVSSRQALVKKAVQDNL-EAQKSLEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKWAKDDEELRKFDMIAKGAWLRVQGNIETNPFTKS-LTMNVQQV------KEIVRHERKDLMPEGQKRVELHAHTNMSTMDALPTVESLIDTAAKWGHKAIAITDHANVQSFPHGYHRARK-AGIKAIFGLEANIVEDKVPISYEPVDMDLHEDLCGLSDVETTGLSAMNNDLIQIAASKMFKGNIVEQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNA-SFDVGFMNANYERHDLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLD--HHHMANYDAEATGRLLFIFLK--DAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLAR-YYDFIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKD-LAYQVVVQNTQDFADRIE-EVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPSAHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYGKF-YRDAEVDRLAAGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGT--PTGMLGIPEFGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKNNEA----TNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDTLIPPFIALEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFD 1462
>gi|28378678|ref|NP_785570.1| DNA polymerase III PolC [Lactobacillus plantarum WCFS1] >gi|32469698|sp|Q88VK2|DPO3_LACPL DNA polymerase III polC-type (PolIII) >gi|28271514|emb|CAD64419.1| DNA-directed DNA polymerase III, alpha chain PolC-type [Lactobacillus plantarum WCFS1] (1437 aa)
Score = 2288, Expect = 0.0e+00, Identities = 473/1226 (38%), Positives = 761/1226 (62%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALI--KRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLEN-QKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E ++  +EG +F ++    ++  ++    VTDYS S+V+K       ++   + LK G+WV+ + S+Q D +   D+T    +I+  S      R D A    KR EL  H+NM+  +   ++ +  K +++ G+ ++AITD    Q FP+ +   +K + +K +YGV+ N++D  +PI  N     + ++TYVIFD ETTGLS  YD++IE  A+K  KG  V+  + FI+P   +S+    +T I+++ V+ +   +E     ++F GD++++ HN + FD+ F+N     + M  I NP+IDTL ++R +   + G+ L  +A+K+ ++ +    HRA  DAE   ++    L++ +    ++  +++N ++  +      R    T+Y + +  ++NL+++IS S    +   P+V     N++ +  +V ++ + GE+F A M   ++         YDF+ +     +   I    I     +E+ I  ++++ ++ N  V AT D +YLN  D++Y ++ ++++  G   NR        T  P  +FR+TDE+  +F FL      +++VV     +A   +  ++P+K+ L++P ++GA  ++++L   ++++ +G+ +   V+ R+D+E+ S+I NG+++IY  +  LV +S  DGY+VGSRGSVGSS+ A L  ITEVNP+ PHY C NC+Y +F  N +  SG+DLP  +CP+C + +  DG NIPFETF+GF G+K+PDIDLNFS  YQ  AH++ K +FGE+ V+RAGTI T A+KT YGYVK+Y E       R+AE+ R+AK    VKRTTGQHP GI+VVP   D+YDFTP  YPADD++  W TTH  F S+HD++LK DILGHD+PT+++ML + + V  ++IP  D  VM +F+S + L +    I    KTG+ GIPEFGT FV+ ML  T P  F++L++ISGLSHGT+VW  NA+ LI++  +T+++VI CRD+IM  LI  G+   ++F+IME VRKG+G+ +E+Q+ + D N+P WYIESC KI Y+FP+AHA AY++MA ++A+FK+Y+PL +Y +YFS+R   FD+ ++ +G+  +   +  I +K  +         KE +L+ + ELA E+L RG+KF+ +DL KS A+D+L++GD LI PF A+ GLG +VA  IV AR +K F SKED  KR KV+ + +  M E G+ S L +++Q+SLF
  S:   235 EERSVVVEGYVFDMEVRTLRSQRQLLILKVTDYSSSMVVKKFSRNADDEAQFAALKPGMWVRVRGSVQEDSFMR-DLTINAYDINETSHAS---RQDTAPADEKRVELHLHSNMSQMDATNSVSDYVKQAAKWGHPAIAITDHSGAQAFPEAFAAGEK-NNIKILYGVEANMVDDGVPIAYNDAHVDLKESTYVIFDTETTGLSAIYDRVIELSAVKMVKGNVVDQFEEFIDPGFHLSETTTNLTSITDDMVRGSKSEEEVFKLFREFYGDAIVVGHN-VTFDIGFMNTGYARHHMGPITNPIIDTLTLARWLYPNLRGYRLNTLAKKFNVNLE--HHHRAIYDAETTGHLNHLFLKDAEDRYQVQFHDQLNDHMNENAAYRHARPFHATLYAQTQAGLKNLFRIISLSNVEYYYRVPRVPRSVLNKYRDGILVGSACSSGEVFTAMMQKGKEEARQK-AGYYDFLEVQPKPAYSALIESGLIADTDHLEEIISNMVELGHEMNIPVAATGDVHYLNPEDKIYRKILIHSQP-GNPLNR--------TERPDVHFRSTDEMLKDFDFLGTET-AHEVVVDTPRALADQFEI-VRPVKDKLYTPRMKGAEAEIEKLTMDRAHAWYGNPLPEIVQKRVDKELKSIIGNGFSVIYLIAQRLVFKSNKDGYLVGSRGSVGSSIVATLSGITEVNPMPPHYRCPNCQYSHFYTNNEYGSGYDLPPKDCPECGTDMVRDGQNIPFETFLGFYGNKVPDIDLNFSGDYQPIAHNYTKVLFGEKNVYRAGTIGTVADKTGYGYVKAY-ERDTNQTLRSAEVDRLAKGTTGVKRTTGQHPAGIIVVPDYMDIYDFTPVQYPADDQSAAWQTTHFDFHSIHDNILKIDILGHDDPTMIRMLQDLSGVQPESIPPVDPHVMKIFSSPEVLGVTEDQI--FSKTGTLGIPEFGTRFVRGMLEETHPSTFNELLQISGLSHGTDVWLGNAEELIKDGTVTLAEVIGCRDNIMTDLIHYGMESDMSFQIMEHVRKGRGIPDEWQQAMKDANVPDWYIESCLKIKYMFPRAHAAAYILMALRVAYFKVYFPLIYYTAYFSVRADDFDLVAMAHGKDAVKASMKAITDKGMDASA------KEKNLLTVLELANEMLERGFKFSMVDLDKSDASDWLIDGDTLIAPFRAVPGLGLNVAKQIVAARADKPFLSKEDLSKRGKVSKSLIDFMTENGVLSDLPDENQLSLF 1437
>gi|89209761|ref|ZP_01188156.1| DNA polymerase III, epsilon subunit:DNA polymerase III, alpha subunit, Gram-positive type [Halothermothrix orenii H 168] >gi|89160830|gb|EAR80483.1| DNA polymerase III, epsilon subunit:DNA polymerase III, alpha subunit, Gram-positive type [Halothermothrix orenii H 168] (1397 aa)
Score = 2276, Expect = 0.0e+00, Identities = 496/1239 (40%), Positives = 757/1239 (61%)
  Q:   219 TGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIK--DKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           T ++T + ++  E +   I+GE+F +++ VT+ G  +Y + VTD S SI  K     K   D+ S L    WV  K  +Q D Y N     ++   + I K +  +R D A  KR EL  HT M+A + +V+++++ + ++E G+S++AITD    Q +PD Y   KK++ +K +YG++  ++D   PI+LN  D  +  AT+V+FD+ETTGL+ + ++IIE GA+K   G  ++    F+ P E I +KI  +T I+NE V  A  I+  +    +FI  S+L+AHN   FD  FL   L++     I  P++DTL +SRA+   +  H L  +AR   +  D    HRA +DA     I+   L N K + I+T+  IN        RE      + ++ KN+  ++++Y+L+S S  + F   P++   +  +   + I+ ++   G+++ + ++N  +   +IIK    YD++ I         +  ++     +E    +I K+  K NK VVAT D ++L+  D++Y +V    +           Y+E     P  YFRTT+E+ +EFS+L       ++V+ N   I+  I+  +KP+ + L +P IEGA+D+++++ YQ+++ ++GD + + ++ R+++E+ ++IDNGYA+IY  SH LVK+S++DGY+VGSRGSVGSS+ A + +ITEVNPL PHY C  CK   F  ++N   G DLP+ NCP C ++   DG +IPFE FMGF+GDK+PDIDLNFS  YQG+ H + + +FG   VFRAGTIST A++TA+G+VK Y +++  +    AEI R+ K C  VKRTTGQHPGG++VVP   D++DF+P   PA+D+  D  TTH  + S+   +LK D+LGHD+PT ++ML + T VN   IP  D D MD+F+STD L +    I  ++  G+ GIPEFGT+FV++ML+ T+P  F++L+RISGLSHGT+VW +NA+ LI+     +S+VIS RDDIM YLI KG+ P  +F IME VRKGKGL EE ++ + ++N+P WYIESC KI Y+FPKAHA AYV+MA++IA+FK++YP  FY +YF+I+   FD   I  G   I  ++ +  E   N  T      KE  ++ + E+ +E + RG +F  +DL KS AT F +    L+PP  ++ GLG S A  I   R+E  FSS ED   RT+++ T ++I+EE G    L E DQ+SLFN
  S:   190 TEEITPIEEVKHEGQGVVIKGEVFNLEERVTRRGKYLYIFAVTDRSSSITCKFFIDDK--SDLKSTLNNEDWVMVKGRVQFDTYSNE----IVIMCNSIEKTEAEVRVDTADDKRIELHLHTKMSALDSVVDVEKVIERAAEWGHSAIAITDHGVVQAYPDAYQAGKKHN-IKILYGLEAYMVDDGEPIILNPPDVSLESATFVVFDLETTGLNKFKNEIIEIGAVKVKSGKVIDEFSSFVKPGESIPNKITELTGITNEMVSRAPDIEGVIGDFLEFIDGSILVAHNA-DFDYGFLQVALKKTGQGDISYPVLDTLTLSRALLPDLSNHKLNTLARHLNVRLD--NHHRAVEDARATSEIFINFLSNIKNEGIETVPGINRLSTKINWRELPTYHTV-IFAKNKQGLKDIYRLVSESHLNYFYRKPRILKSHLIQCRKNLIIGSACEAGQLYRSIINN--KPYREIIKIASFYDYLEIQPTGNNKFLVGNKVESIDELEKINYQIYKLGKKLNKPVVATCDVHFLDPEDDIYRKVLQAGQ----------GYDEAEEQAP-LYFRTTNEMLEEFSYLGKKA-AREVVIENPAKISDQIE-ELKPLPDGLFAPEIEGANDQIRKMTYQRAHELYGDPLPSIIEERLEKELKAIIDNGYAVIYLISHKLVKKSLEDGYLVGSRGSVGSSLVATMCEITEVNPLPPHYRCPRCKQVEFVNDENTGVGADLPDKNCPHCGTRYVKDGFDIPFEVFMGFEGDKVPDIDLNFSGEYQGEIHKYTEELFGSNYVFRAGTISTIAKRTAFGFVKGYLDDNG-LRLNKAEIDRLVKGCTGVKRTTGQHPGGLMVVPKAYDIHDFSPIQRPANDQETDVITTHFDYHSISGRILKLDLLGHDDPTTIRMLQDLTGVNPHDIPLDDPDTMDIFSSTDPLGVSPEEIGTVV--GTLGIPEFGTSFVRQMLVDTRPTTFAELVRISGLSHGTDVWLNNAQDLIKSGKARLSEVISVRDDIMNYLIQKGLEPGKSFWIMEHVRKGKGLTEEEEQYMREHNVPDWYIESCKKIKYMFPKAHAAAYVMMAFRIAYFKVHYPEAFYTTYFTIKADDFDAHMINQGYDHII-EVKKNLEARGNDMTA-----KEKGILTVLEIVIEAMARGIEFLPVDLYKSDATKFKLTDKGLLPPLVSLQGLGSSAAEKIAVTRQEAPFSSVEDLVNRTRISKTVVEILEEHGSLDGLPERDQLSLFN 1397
>gi|54020575|ref|YP_116058.1| DNA polymerase III PolC [Mycoplasma hyopneumoniae 232] >gi|53987748|gb|AAV27949.1| DNA polymerase III, alpha chain [Mycoplasma hyopneumoniae 232] (1469 aa)
Score = 2267, Expect = 0.0e+00, Identities = 549/1391 (39%), Positives = 835/1391 (60%)
  Q:    67 LVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFF----EMKTATIEGEIFKIDKVVTKTGYEIYKYFVT--DYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISK---PKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTK--ISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKD-ALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRML---ENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNEL-------NTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNAR---NAEITR--------IAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEI-KEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           L++  + F+     + +  + +L YL   +   I  K KG    KE   +++ N    K I S+   F         + + KY +  RK +  +G     L +IL+EK +         I+ K   ++  V R        ++F+ + +K +     +L DL F    +      + +I+KI  + TKTG  I K F+   DY++++ +     K  N D+  ++ + V +KAKI      Y++N    L E   I S    P E  + D A IKR E+   T  +  +G+ + KE  + + + GY ++ ITD  + Q FP+FYN A K + +K IYG  F+     I  V+N N          +VIFD+ETTGLS +Y++I+EFGA+    G+++E  Q FI P  KI   I  IT IS + + + A+  + AL KI   I DSVL+AHN   FD  FL     +     +KNP+IDTL++SR +N     HSL  +A++Y+I+YDE  AHRAD DA+ L  IWK  L   ++Q + D+ +L+EI +++  +   E+     +T+  KN+  I+ LYKL+S + T N    P +++++  +  +  I S       I        + V E      +DFI I  P  F+H + REI+ +  IE+ +K +I +A K     VA  D  Y    +++++ +Y+ AK +GG  + LF + E        + + P+ +F +T+ELK EF FL D  L+ +IVV NSN++A LI+ NI+ IK  L+ P  + +  KLK+ +Y+K+Y  +G  +   ++ RI  E+  +I++G+ ++YW S  +V ++   G +V SRGSVGSS+ A+L  IT+VNPL PHY C  C    F K+    SG+DLP+ NC  C  K++ DGHNIPFETF+GF  +K+PDIDLNFS   Q K HDF++ +FG  + FRAGTI T AEKT YG  +   E   +++ +   N E++         +A K + VKRT+G+H GGI+V+P  +++ DFTP NYPA+++  DW TTH  + +LHD+LLK DILGHD+PTIL  L + TN+ +D IP  D  ++ LF S   L I +  I   + TG+ GIPEFGT FV++ML + + + F+D++ I GL+HGT VW DNA+ LI EK   I+++ISCRDDIM+YL+ K I   +AF IME+VRKGKGL ++ +++L    +P+WYIES  KI YLFPKAHA AY + AWKIA+FK+Y+PL FY+SYFSIR  V D+++++    +I  KIN + K+++ + K    +  KE DLI   E++LEL  RG++   + L+KS A ++++  E + LIPPF AIDG+GD  A  IV+AR  + FSS EDF+KRT+  +T +K ++ELGI   +++  Q+++F+
  S:    78 LINCKIEFDFEIQQNYFTDQQLLEYLNGIMQ--IISKNKGFFNDKE---IIRANASRFKIIFSDAKSF---------EFMSKYEKKMRKIIKYFGLIHLDLDFILEEKPV---------IENKFNLDLETVMRPLEYNFL-ANFSERNKKIID---FELIDLKFIRSHKNPNVQFDAQIYKISPIKTKTGGLILKIFLNNNDYTEAVSVSKFLIKNQNYDL--KVGDLVNIKAKIKDPTSRYKSNVDLNLYEIKRIDSSIFFPNE--KLDTAKIKRVEIAARTWKSTMDGISSAKEYVQHALKNGYLAIGITDLDSVQAFPEFYN-AIKSTNIKPIYGSTFSTYRSKIEKVINFNGKNYIFDKLKFVIFDLETTGLSAFYNEIVEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYDEEIAHRADYDAKILTTIWKNFLAELKSQNINDLTSLSEIKNSI-FELRPEKVFPKQLTIIAKNQIGIKKLYKLVSLANTENLISRPLIFYDHLQKDPDLLIGSGGPESLLIQTMLYFGPKNVAE--FAHIFDFIEIPPPSAFIHLVKREIFTKDQIEEMLKNLINLAKKLQIPAVAIGDVRYCLPKEKIFYELYIYAKGVGGVNHVLFDHREKEREDFRNSHIFPEKHFFSTEELKKEFEFLEDQQLIEEIVVKNSNFVADLIENNIQIIKSGLYPPSFDNSEVKLKEFVYKKAYEKYGRFLPKLIENRIKTELEPIINHGFHVVYWISKHIVTEAKSQGAIVDSRGSVGSSIVAFLTGITDVNPLLPHYWCKKCSKVEFPKSQQFLSGYDLPDKNCLDCYKKMEKDGHNIPFETFLGFNVEKVPDIDLNFSGQTQLKMHDFVRTLFGINKTFRAGTILTNAEKTVYGLARKLGEYRARLDPKFDLNREVSYFTSAFLDFLATKAQGVKRTSGKHAGGIIVIPQNQEIEDFTPINYPANNEKSDWKTTHFDYNALHDNLLKLDILGHDDPTILLHLEKLTNIKSDEIPKSDPKILSLFRSCKELGISSDQILGEV-TGTIGIPEFGTQFVRKMLQIAQVKSFADIVAICGLAHGTGVWQDNAEKLILEKKHVINELISCRDDIMIYLLQKNIDHQVAFNIMENVRKGKGLTDQEKELLELKKVPSWYIESLQKIGYLFPKAHAVAYAMKAWKIAYFKLYHPLAFYSSYFSIRPDVKDLETLIQPVEKIREKINILNKKRLESQKGIQQLSAKEKDLIQFLEISLELKSRGFEIEKVSLEKSEAQEWIINKENNSLIPPFIAIDGIGDVNARKIVQARNLRPFSSIEDFEKRTETNSTSLKKLKELGIFDKISKRAQVNIFD 1469
>gi|72080863|ref|YP_287921.1| DNA polymerase III PolC [Mycoplasma hyopneumoniae 7448] (1420 aa)
Score = 2261, Expect = 0.0e+00, Identities = 548/1391 (39%), Positives = 833/1391 (59%)
  Q:    67 LVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFF----EMKTATIEGEIFKIDKVVTKTGYEIYKYFVT--DYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISK---PKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTK--ISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKD-ALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRML---ENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNEL-------NTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNAR---NAEITR--------IAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEI-KEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           L++  + F+     + +  + +L YL   +   I  K KG    KE   +++ N    K I S+   F         + + KY +  RK +  +G     L +IL+EK +         I+ K   ++  V R        ++F+ + +K +     +L DL F    +      + +I+KI  + TKTG  I K F+   DY++++ +     K  N D+  ++ + V +KAKI      Y++N    L E   I S    P E  + D A IKR E+   T  +  +G+ + KE  +++ + GY ++ I D  + Q FP+FYN A K + +K IYG  F+     I  V+N N          +VIFD+ETTGLS +Y++IIEFGA+    G+++E  Q FI P  KI   I  IT IS + + + A+  + AL KI   I DSVL+AHN   FD  FL     +     +KNP+IDTL++SR +N     HSL  +A++Y+I+Y E  AHRAD DA+ L  IWK  L   ++Q + D+ +L+EI +++  +   E+     +T+  KN+  I+ LYKL+S + T N    P +++++  +  +  I S       I        + V E      +DFI I  P  F+H + REI+ +  IED +K +I +A K     VA  D  Y    +++++ +Y+ AK +GG  + LF + E        + + P+ +F +T+ELK EF FL D  L+ +IVV NSN++A LI+ NI+ IK  L+ P  + +  KLK+ +Y+K+Y  +G  +   ++ RI  E+  +I+ G+ ++YW S  +V ++   G +V SRGSVGSS+ A+L  IT+VNPL PHY C  C    F K+    SG+DLP+ NC  C  K+  DGHNIPFETF+GF  +K+PDIDLNFS   Q K HDF++ +FG  + FRAGTI T AEKT YG  +   E   +++ +   N E++         +A K + VKRT+G+H GGI+V+P  +++ DFTP NYPA+++  DW TTH  + +LHD+LLK DILGHD+PTIL  L + TN+ +D IP  D  ++ LF S   L I +  I   + TG+ GIPEFGT FV++ML + + + F+D++ I GL+HGT VW DNA+ LI EK   I+++ISCRDDIM+YL++K I   +AF IME+VRKGKGL ++ +++L    +P+WYIES  KI YLFPKAHA AY + AWKIA+FK+Y+PL FY+SYFSIR  V D+++++    +I  KI+ + K+++ + K    +  KE DLI   E++LEL  RG++   + L+KS A ++++  E + LIPPF AIDG+GD  A  IV+AR  + FSS EDF+KRT+  +T +K ++ELGI   +++  Q+++F+
  S:    29 LINCKIEFDFEIQQNYFTDQQLLEYLNGIMQ--IISKNKGFFNDKE---IIRANASRFKIIFSDAKSF---------EFMSKYEKKMRKIIKYFGLIHLDLDFILEEKPV---------IENKFNLDLETVMRPLEYNFL-ANFSERNKKIID---FELIDLKFIRSHKNPNVQFDAQIYKISPIKTKTGGLILKIFLNNNDYTEAVSVSKFLIKNQNYDL--KVGDLVNIKAKIKDPTSRYKSNVDLNLYEIKKIDSSIFFPNE--KLDTAKIKRVEIAARTWKSTMDGISSAKEYVQYALKNGYLAIGIADLDSVQAFPEFYN-AIKSTNIKPIYGSTFSTYRSKIEKVINFNGKNYIFDKLKFVIFDLETTGLSAFYNEIIEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYAEEIAHRADYDAKILTTIWKNFLAELKSQNINDLTSLSEIKNSI-FELRPEKVFPKQLTIIAKNQIGIKKLYKLVSLANTENLISRPLIFYDHLQKDPDLLIGSGGPESLLIQTMLYFGPKNVAE--FAHIFDFIEIPPPIAFIHLVKREIFTKDQIEDMLKNLINLAKKLQIPAVAIGDVRYCLPKEKIFYELYIYAKGVGGVNHVLFDHREKEREDFRNSHIFPEKHFFSTEELKKEFEFLEDQQLIEEIVVKNSNFVADLIENNIQIIKSGLYPPSFDSSEVKLKEFVYKKAYEKYGRFLPKLIENRIKTELEPIINQGFHVVYWISKHIVTEAKSQGAIVDSRGSVGSSIVAFLTGITDVNPLLPHYWCKKCSKVEFPKSQQFLSGYDLPDKNCLDCYKKMDKDGHNIPFETFLGFNVEKVPDIDLNFSGQTQLKMHDFVRTLFGINKTFRAGTILTNAEKTVYGLARKLGEFRARLDPKFDLNREVSYFTSAFLDFLATKAQGVKRTSGKHAGGIIVIPQNQEIEDFTPINYPANNEKSDWKTTHFDYNALHDNLLKLDILGHDDPTILLHLEKLTNIKSDEIPKSDPKILSLFRSCKELGISSDQILGEV-TGTIGIPEFGTQFVRKMLQIAQVKSFADIVAICGLAHGTGVWQDNAEKLILEKNHVINELISCRDDIMIYLLEKNIDHKVAFNIMENVRKGKGLTDQEKELLELKKVPSWYIESLQKIGYLFPKAHAVAYAMKAWKIAYFKLYHPLAFYSSYFSIRPDVKDLETLIQPVEKIREKISILNKKRLESQKGIQQLSAKEKDLIQFLEISLELKSRGFEIEKVSLEKSEAQEWIINKENNSLIPPFIAIDGIGDVNARKIVQARNLRPFSSIEDFEKRTETNSTSLKKLKELGIFDKISKSAQVNIFD 1420
>gi|71893884|ref|YP_279330.1| DNA polymerase III PolC [Mycoplasma hyopneumoniae J] >gi|71852011|gb|AAZ44619.1| DNA polymerase III alpha subunit [Mycoplasma hyopneumoniae J] (1468 aa)
Score = 2261, Expect = 0.0e+00, Identities = 548/1400 (39%), Positives = 837/1400 (59%)
  Q:    58 LIPFVDSLNLVDDSVLFNLVFNYDTYNQEDIL--NYLIYFVNHNIE--QKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDL-FFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVT--DYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISK---PKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTK--ISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKD-ALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRML---ENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNEL-------NTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNAR---NAEITR--------IAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEI-KEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           L  F+D +   +    FN    +D   Q++      L+ ++N  ++   K KG    KE   +++ N    K I S+   F         + + KY +  RK +  +G     L +IL+EK +         I+ K   ++  V R        ++F+ + +K +  ++  L  +   +      + +I+KI  + TKTG  I K F+   DY++++ +     K  N D+  ++ + V +KAKI      Y++N    L E   I S    P E  + D A IKR E+   T  +  +G+ + KE  + + + GY ++ I D  + Q FP+FYN A K + +K IYG  F+     I  V+N N          +VIFD+ETTGLS +Y++I+EFGA+    G+++E  Q FI P  KI   I  IT IS + + + A+  + AL KI   I DSVL+AHN   FD  FL     +     +KNP+IDTL++SR +N     HSL  +A++Y+I+YDE  AHRAD DA+ L  IWK  L   ++Q + D+ +L+EI +++  +   E+     +T+  KN+  I+ LYKL+S + T N    P +++++  +  +  I S       I        + V E      +DFI I  P  F+H + REI+ +  IED +K +I +A K     VA  D  Y    +++++ +Y+ AK +GG  + LF + E        + + P+ +F +T+ELK EF FL D  L+ +IVV NSN++A LI+ NI+ IK  L+ P  + +  KLK+ +Y+K+Y  +G  +   ++ RI  E+  +I+ G+ ++YW S  +V ++   G +V SRGSVGSS+ A+L  IT+VNPL PHY C  C    F K+    SG+DLP+ NC  C  K++ DGHNIPFETF+GF  +K+PDIDLNFS   Q K HDF++ +FG  + FRAGTI T AEKT YG  +   E   +++ +   N E++         +A K + VKRT+G+H GGI+V+P  +++ DFTP NYPA+++  DW TTH  + +LHD+LLK DILGHD+PTIL  L + TN+ +D IP  D  ++ LF S   L I +  I   + TG+ GIPEFGT FV++ML + + + F+D++ I GL+HGT VW DNA+ LI EK   I+++ISCRDDIM+YL+ K I   +AF IME+VRKGKGL ++ +++L    +P+WYIES  KI YLFPKAHA AY + AWKIA+FK+Y+PL FY+SYFSIR  V D+++++    +I  KI+ + K+++ + K    +  KE DLI   E++LEL  RG++   + L+KS A ++++  E + LIPPF AIDG+GD  A  IV+AR  + FSS EDF+KRT+  +T +K ++ELGI   +++  Q+++F+
  S:    62 LCAFIDLVQKTNRQSKFNCKIEFDFEIQQNYFTDQQLLEYLNGIMQGISKNKGFFNDKE---IIRANASRFKIIFSDAKSF---------EFMSKYEKKMRKIIKYFGLIHLDLDFILEEKPV---------IENKFNLDLETVMRPLEYNFL-ANFSERNKKIIDFELIDLKFIRSHKNPNVQFDAQIYKISPIKTKTGGLILKIFLNNNDYTEAVSVSKFLIKNQNYDL--KVGDLVNIKAKIKDPTSRYKSNVDLNLYEIKRIDSSIFFPNE--KLDTAKIKRVEIAARTWKSTMDGISSAKEYVQHALKNGYLAIGIADLDSVQAFPEFYN-AIKSTNIKPIYGSTFSTYRSKIEKVINFNGKNYIFDKLKFVIFDLETTGLSAFYNEIVEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYDEEIAHRADYDAKILTTIWKNFLAELKSQNINDLTSLSEIKNSI-FELRPEKVFPKQLTIIAKNQIGIKKLYKLVSLANTENLISRPLIFYDHLQKDPDLLIGSGGPESLLIQTMLYFGPKNVAE--FAHIFDFIEIPPPSAFIHLVKREIFTKDQIEDMLKNLINLAKKLQIPAVAIGDVRYCLPKEKIFYELYIYAKGVGGVNHVLFDHREKEREDFRNSHIFPEKHFFSTEELKKEFEFLEDQQLIEEIVVKNSNFVADLIENNIQIIKSGLYPPSFDNSEVKLKEFVYKKAYEKYGRFLPKLIENRIKTELEPIINQGFHVVYWISKHIVTEAKSQGAIVDSRGSVGSSIVAFLTGITDVNPLLPHYWCKKCSKVEFPKSQQFLSGYDLPDKNCLDCYKKMEKDGHNIPFETFLGFNVEKVPDIDLNFSGQTQLKMHDFVRTLFGINKTFRAGTILTNAEKTVYGLARKLGEYRARLDPKFDLNREVSYFTSAFLDFLATKAQGVKRTSGKHAGGIIVIPQNQEIEDFTPINYPANNEKSDWKTTHFDYNALHDNLLKLDILGHDDPTILLHLEKLTNIKSDEIPKSDPKILSLFRSCKELGISSDQILGEV-TGTIGIPEFGTQFVRKMLQIAQVKSFADIVAICGLAHGTGVWQDNAEKLILEKKHVINELISCRDDIMIYLLQKNIDHQVAFNIMENVRKGKGLTDQEKELLELKKVPSWYIESLQKIGYLFPKAHAVAYAMKAWKIAYFKLYHPLAFYSSYFSIRPDVKDLETLIQPVEKIREKISILNKKRLESQKGIQQLSAKEKDLIQFLEISLELKSRGFEIEKVSLEKSEAQEWIINKENNSLIPPFIAIDGIGDVNARKIVQARNLRPFSSIEDFEKRTETNSTSLKKLKELGIFDKISKRAQVNIFD 1468
>gi|144575503|gb|AAZ53898.2| DNA polymerase III alpha subunit [Mycoplasma hyopneumoniae 7448] (1469 aa)
Score = 2257, Expect = 0.0e+00, Identities = 548/1391 (39%), Positives = 833/1391 (59%)
  Q:    67 LVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFF----EMKTATIEGEIFKIDKVVTKTGYEIYKYFVT--DYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISK---PKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTK--ISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKD-ALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRML---ENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNEL-------NTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNAR---NAEITR--------IAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEI-KEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLV--EGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           L++  + F+     + +  + +L YL   +   I  K KG    KE   +++ N    K I S+   F         + + KY +  RK +  +G     L +IL+EK +         I+ K   ++  V R        ++F+ + +K +     +L DL F    +      + +I+KI  + TKTG  I K F+   DY++++ +     K  N D+  ++ + V +KAKI      Y++N    L E   I S    P E  + D A IKR E+   T  +  +G+ + KE  +++ + GY ++ I D  + Q FP+FYN A K + +K IYG  F+     I  V+N N          +VIFD+ETTGLS +Y++IIEFGA+    G+++E  Q FI P  KI   I  IT IS + + + A+  + AL KI   I DSVL+AHN   FD  FL     +     +KNP+IDTL++SR +N     HSL  +A++Y+I+Y E  AHRAD DA+ L  IWK  L   ++Q + D+ +L+EI +++  +   E+     +T+  KN+  I+ LYKL+S + T N    P +++++  +  +  I S       I        + V E      +DFI I  P  F+H + REI+ +  IED +K +I +A K     VA  D  Y    +++++ +Y+ AK +GG  + LF + E        + + P+ +F +T+ELK EF FL D  L+ +IVV NSN++A LI+ NI+ IK  L+ P  + +  KLK+ +Y+K+Y  +G  +   ++ RI  E+  +I+ G+ ++YW S  +V ++   G +V SRGSVGSS+ A+L  IT+VNPL PHY C  C    F K+    SG+DLP+ NC  C  K+  DGHNIPFETF+GF  +K+PDIDLNFS   Q K HDF++ +FG  + FRAGTI T AEKT YG  +   E   +++ +   N E++         +A K + VKRT+G+H GGI+V+P  +++ DFTP NYPA+++  DW TTH  + +LHD+LLK DILGHD+PTIL  L + TN+ +D IP  D  ++ LF S   L I +  I   + TG+ GIPEFGT FV++ML + + + F+D++ I GL+HGT VW DNA+ LI EK   I+++ISCRDDIM+YL++K I   +AF IME+VRKGKGL ++ +++L    +P+WYIES  KI YLFPKAHA AY + AWKIA+FK+Y+PL FY+SYFSIR  V D+++++    +I  KI+ + K+++ + K    +  KE DLI   E++LEL  RG++   + L+KS A ++++  E + LIPPF AIDG+GD  A  IV+AR  + FSS EDF+KRT+  +T +K ++ELGI   +++  Q+++F+
  S:    78 LINCKIEFDFEIQQNYFTDQQLLEYLNGIMQ--IISKNKGFFNDKE---IIRANASRFKIIFSDAKSF---------EFMSKYEKKMRKIIKYFGLIHLDLDFILEEKPV---------IENKFNLDLETVMRPLEYNFL-ANFSERNKKIID---FELIDLKFIRSHKNPNVQFDAQIYKISPIKTKTGGLILKIFLNNNDYTEAVSVSKFLIKNQNYDL--KVGDLVNIKAKIKDPTSRYKSNVDLNLYEIKKIDSSIFFPNE--KLDTAKIKRVEIAARTWKSTMDGISSAKEYVQYALKNGYLAIGIADLDSVQAFPEFYN-AIKSTNIKPIYGSTFSTYRSKIEKVINFNGKNYIFDKLKFVIFDLETTGLSAFYNEIIEFGAVVLQNGIEIEKHQFFIKPTGKIPPAITKITGISQKMIDETAISWEIALEKITKIIKDSVLVAHNA-AFDFSFLEQFFRQKAKKSLKNPIIDTLEVSRFLNPNEKSHSLKNVAKRYEIEYAEEIAHRADYDAKILTTIWKNFLAELKSQNINDLTSLSEIKNSI-FELRPEKVFPKQLTIIAKNQIGIKKLYKLVSLANTENLISRPLIFYDHLQKDPDLLIGSGGPESLLIQTMLYFGPKNVAE--FAHIFDFIEIPPPIAFIHLVKREIFTKDQIEDMLKNLINLAKKLQIPAVAIGDVRYCLPKEKIFYELYIYAKGVGGVNHVLFDHREKEREDFRNSHIFPEKHFFSTEELKKEFEFLEDQQLIEEIVVKNSNFVADLIENNIQIIKSGLYPPSFDSSEVKLKEFVYKKAYEKYGRFLPKLIENRIKTELEPIINQGFHVVYWISKHIVTEAKSQGAIVDSRGSVGSSIVAFLTGITDVNPLLPHYWCKKCSKVEFPKSQQFLSGYDLPDKNCLDCYKKMDKDGHNIPFETFLGFNVEKVPDIDLNFSGQTQLKMHDFVRTLFGINKTFRAGTILTNAEKTVYGLARKLGEFRARLDPKFDLNREVSYFTSAFLDFLATKAQGVKRTSGKHAGGIIVIPQNQEIEDFTPINYPANNEKSDWKTTHFDYNALHDNLLKLDILGHDDPTILLHLEKLTNIKSDEIPKSDPKILSLFRSCKELGISSDQILGEV-TGTIGIPEFGTQFVRKMLQIAQVKSFADIVAICGLAHGTGVWQDNAEKLILEKNHVINELISCRDDIMIYLLEKNIDHKVAFNIMENVRKGKGLTDQEKELLELKKVPSWYIESLQKIGYLFPKAHAVAYAMKAWKIAYFKLYHPLAFYSSYFSIRPDVKDLETLIQPVEKIREKISILNKKRLESQKGIQQLSAKEKDLIQFLEISLELKSRGFEIEKVSLEKSEAQEWIINKENNSLIPPFIAIDGIGDVNARKIVQARNLRPFSSIEDFEKRTETNSTSLKKLKELGIFDKISKSAQVNIFD 1469
>gi|28210957|ref|NP_781901.1| DNA polymerase III PolC [Clostridium tetani E88] >gi|32469700|sp|Q895K2|DPO3_CLOTE DNA polymerase III polC-type (PolIII) >gi|28203396|gb|AAO35838.1| DNA polymerase III, alpha chain [Clostridium tetani E88] (1427 aa)
Score = 2257, Expect = 0.0e+00, Identities = 549/1335 (41%), Positives = 813/1335 (60%)
  Q:   124 KKPIISENAIFLHYLEND------QEKCIKKYL----------EHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQE-KIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIF-EAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           K+ +I EN + L Y  ND      +EK  +K L          E   KF+ D    K +     +E+   II   KN I+E +I+  I +   + N ++ + + +    K++  D   +S++       +I G++FK   + TKTG +I  +++TDY+ SI +K     K  + V+ E+KEG++ K +  +  D Y   +I  +  +I  ++K ++    D A  KR EL  HT M+A +G+ + + L K +++ G+ +VAITD    Q +P+    AKKY+ +K IYGV+  ++D  IPI +NA    + D +YV+FDIETTG S   DKIIE GA+K  +G  V+    F+NPE  I +KI  +T I +  VKDA KI+E L K  DFI DS+L+AHN   FD+ F+    ++  +    NP++DT+ + + +  ++  + L V+A+   I       HRA +DA+   +I  +  E+ K ++I  LN +N     +   +++    + +  KN+  ++NLYKLIS S  ++F   P++     N++    ++ ++   G+++ E  M  +++ L+++I   YD++ I   +     I   I K    + D  K+I  +A + N  VVAT D ++L++ DEV+ ++ +  +      N+           P  Y RTTDE+  EF +L         VVTN+  IA  ID NIKPI +    P IEG+ ++++++  +K++SI+G+ +   V+ R+++E++S+I+NGYA++Y  +H LV +SV DGY+VGSRGSVGSS+ A + DITEVN L PHY+C  CKY  F  + +V SG DLP+ NCP C   L  DGH+IPFETF+GF+GDK PDIDLNFS  YQ   H + + +FGE +VF+AGTI T AEKTAYG+VK Y  E K +N R AEI R+   C  VKRTTGQHPGGI+VVP   ++++FTP   PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T V+   IP  D  VM LF S  +L +    +    + G+ G+PEFGT FV++ML+ T+P  FSDL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIM YLI K + P IAF IME VRKGKGL EE++ ++ ++++P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YFS+R   FD +++  GE  I NKI+EI     N      V  K+  L+ + E+  E+  RG KF   DL KS A+ FL+E + +  P SAI G+G++ A +IV+AREE  F SKED  KR K T T ++ +E  G    L E +Q+SLFN 
  S:   109 KRKVIDENTLKLQY-GNDFLYNILKEKNFEKILSSTIKDVFGVECKVKFILDKSNGKCNYLDFKEEQEALII---KNIIKESRIEKTIPKKDNNYNKREENKNSSIIVGKNINEDPVDISNIDETSGIISICGDVFKTKIIETKTGRKIVTFYITDYTSSITVKLFPKPKDTERVIEEIKEGLYCKIRGEVVNDSYAR-EIVIMARDIVKLNKIEKM---DIAEEKRVELHLHTKMSAMDGMNSAESLIKRAAKWGHKAVAITDHGVVQAYPEAMEAAKKYN-IKIIYGVEGYLVDDGIPIAINAGHRTLED-SYVVFDIETTGFSNKNDKIIEIGAVKIKEGKVVDKYSTFVNPERIIPEKIIELTGIHDYMVKDAPKIEEVLPKFIDFIEDSILVAHNA-NFDVSFIKKNCKDFGIHF-NNPILDTIPLCKFLYPELKRYKLNVVAKHLGIPL--LNHHRAVEDAKTTGDILLKAFEDLKDKEIMNLNMLNEEYFKNQDIKKSPTYHVIILVKNKIGLKNLYKLISESHLNHFYKKPRMPKSLINKYREGLMIGSACEAGQVYKEVLMDKSKEELKEVIS-FYDYLEIQPIKNNYFMIRNGIVKDEEELRDINKKIYNLAEENNMPVVATCDVHFLDKKDEVFRKILMAGQGFSDAENQ-----------PPLYLRTTDEMLKEFEYLGKEKAYK-AVVTNTVKIADSID-NIKPIPDETFPPKIEGSEEEVRKMTIEKAHSIYGEVLPEIVEKRLEKELNSIINNGYAVLYLIAHKLVDKSVQDGYLVGSRGSVGSSLVATMTDITEVNGLPPHYVCPGCKYNEFITDGSVSSGADLPDKNCPNCGVLLSKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGEGKVFKAGTIGTIAEKTAYGFVKKYISE-KDLNVRQAEIERLTLGCSGVKRTTGQHPGGIMVVPQDNEIFNFTPIQRPADDNDTDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGVDPKKIPLADPKVMSLFTSPKALGVNAEELK--CEVGTYGLPEFGTKFVRQMLVDTQPNSFSDLVRISGLSHGTDVWLNNAQYYIKEGYTTLKDCIATRDDIMTYLIQKDLPPKIAFTIMEKVRKGKGLTEEHEAIMREHDVPGWYIESCKKIKYMFPKGHAVAYVMMAVRIAYFKVYYPTAYYATYFSVRASDFDAETVFKGEEAILNKIDEINSLGNN------VTQKDKGLLTVLEICHEMNLRGIKFLKADLYKSNASKFLIEEEGIRIPLSAIQGVGENAAKNIVEAREEGEFISKEDLNKRGKATKTVIENLENHGCLRGLPESNQLSLFNL 1427
>gi|78044072|ref|YP_360592.1| DNA polymerase III, alpha subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77996187|gb|ABB15086.1| DNA polymerase III, alpha subunit, Gram-positive type [Carboxydothermus hydrogenoformans Z-2901] (1407 aa)
Score = 2256, Expect = 0.0e+00, Identities = 512/1310 (39%), Positives = 782/1310 (59%)
  Q:   147 KKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVK---RSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDV-KDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKD----AEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNT--QQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           KK +E   KFL         ++   +E   + + D + +++E++  ++ E K   R     K +        K +     K+++L  E K   + G IF ++    KT   +  + +TD +D+I  K LF KK  ++  S +K+G++VK +  +Q D + + ++   I ++  I KP    R D A  KR EL  H+ M+A + +V++++LF+     G+ +VAITD    Q FP+    + KY  +K IYG++  ++D  +P+V N     + +   V FD ET+GLS   D+IIE GA+K   G   E+  + I P++ IS KI  +T I+N+ + K+ L   EA+ K   F   S+L+AHN   FD  FL   L+    +  K  ++D L + R +  ++  H L  I    ++  +    HRA  D    AE  L +  R+ E + L  +  L +IN N  ND    R++   +++  KN+  + NLY+LI+ S    F   P++       +    ++  +   GE+F A + N    ++LE  I   YD+  I   G+    L +  + +     +E+  ++II +  K NK VVAT D ++L   DE+Y R+         ++ + +   EL    P  Y +TT+E+  EF++L       ++VV N   IA  I+  IKPI +  + P IEGA  ++ ++ YQ+++ ++GD +   V+ R+ RE+ ++I+NG+A++Y  +H LVK+S+DDGY+VGSRGSVGSS+ A +  ITEVNPL PHY+C NC+Y  F  + +   G D+P+ NCP+C + LK +GH+IPFETFMGF+GDK+PDIDLNFS  YQ +AH + + +FG++ VFRAGTI+T A+KTA+G+VK YFEE+ +  AR A I  +      VKRTTGQHPGG++VVP   DV+ FTP  YPADDK+    TTH  + S+   L+K DILGHD+PT+LKML + T ++  TI   D   + +F+ST+ L +    I   +  G+ GIPEFGT FV++ML  T+P+ F++L+RISG SHGT+VW +NA+ LI      +SD IS RDDIM+YL+ KG+ P  AFKIME+VRKGKG++EE   V+ ++ +P W+I SC KI YLFPKAHA AYV+MA++IA+FK+YYP  FYA+YF++R   FD+  IL G  +I   ++E++++  N      +  KE  L+ + E+ALE+L RG K   +DL+KS AT FL+  + ++PPF A+ G+G++ A +IVKAREE MF S ED K R K T   +++++  G    L    Q+ LF
  S:   124 KKVVETITKFLAKVAPDYKFIAKFKEEA--NEVLDWQLEMEEELVQKLWEEKVAEREGQENKEEVPVKLSIGKEIKETPCKIANLTEEEKNVVVSGVIFDLEVKKLKTERILITFNLTDQTDAISAK-LFLKKGEEEKASLIKDGMYVKVRGEVQFDRFAD-ELVLFINDLEEIEKPAG--RMDLAETKRIELHLHSKMSAMDSVVDLEKLFQTLKSWGHEAVAITDHGVVQAFPEAAELSAKYG-IKVIYGLEGYLVDDGLPVVFNPEPLSLKETPIVAFDFETSGLSSQRDEIIEIGAVKIFDGEIKETFSVLIRPQKPISAKISELTGITNDLLEKEGLDFGEAIEKFLRFCDGSILLAHNA-AFDYGFLRQALKRLGHER-KFSVVDNLALVRILFPELKNHKLKTITEHLEVSLN--NHHRALADSYALAEVFLKLLPRLFE-RGLYSLDDLAKINYNYIND----RSKTYHVSILVKNQEGLYNLYRLITLSHLKYFHRHPRIPKSELMRYREGLLIGTACEAGELFTALLENQPESRILE--IARFYDYFEIMPKGNNAFLLRN--QRLKSEQELEELNRKIIALGEKLNKPVVATGDVHFLEPEDEIYRRIL--------QKGQGYDDAELQ---PPIYLKTTEEMLKEFAYLGQEK-AYEVVVDNPRKIAEQIE-EIKPIPDEFYPPIIEGADRQIYEMTYQRAHELYGDPLPEIVEKRLKRELDAIINNGFAVLYLIAHKLVKKSLDDGYLVGSRGSVGSSLVATMTMITEVNPLPPHYLCPNCRYSEFITDGSYGCGADMPDKNCPRCGTLLKKEGHDIPFETFMGFEGDKVPDIDLNFSGEYQPRAHKYTEELFGKDYVFRAGTIATVADKTAFGFVKKYFEETGR-PARQAWINWLTNGIVGVKRTTGQHPGGLMVVPKNNDVHRFTPLQYPADDKSAGVVTTHFDYHSISSRLVKLDILGHDDPTVLKMLEDLTGIDPRTIRLDDRKTLGIFSSTEPLGVTPEQIRTTV--GTYGIPEFGTRFVRQMLEDTRPKSFTELVRISGFSHGTDVWLNNAQDLIRAGICKLSDAISTRDDIMIYLLQKGVPPKKAFKIMENVRKGKGISEEEIAVMKEHGVPDWFIGSCQKIKYLFPKAHAVAYVMMAFRIAYFKVYYPEAFYATYFTVRADDFDLPVILAGPEKIWKTLDELEQRGGN------LTAKEKGLVTVLEVALEMLARGIKMLPVDLEKSDATRFLITPEGILPPFVALPGIGEAAAINIVKAREEGMFVSIEDLKTRGKATKAVIEVLDAHGCLKGLAPTSQLVLF 1406
>gi|167037626|ref|YP_001665204.1| DNA polymerase III PolC [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856460|gb|ABY94868.1| DNA polymerase III, alpha subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] (1407 aa)
Score = 2249, Expect = 0.0e+00, Identities = 518/1304 (39%), Positives = 796/1304 (61%)
  Q:   153 FRKFLND-YGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYK------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSL-ITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQV-LEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
            +KFL D YGF K  +  +L E+  D +     +   K+  EIT+  +     KT      K        K +  +V  + D+  E + A IEGEIF ++    K+   +  + +TDY+ SI++KA   ++    +   ++ G +VK +  +  D YE + +  L +++ +IS PKE  R D +  KR EL  HT M++ + + +  E+ K +++ G+ ++AITD    Q FP+    + KY  +K IYGV+  ++D  +PIV    +  + D  + +FDIETTGLS   D+IIE GA+K  +G  +++ + F+NP+  IS  I  +T I    VKDA  I+E L K  +F  +SVL+AHN   FD+ F+  K ++  +++  N ++DTL++SR + + +  + L  +A   ++  +    HRA  DA     I+ + ++  K   ++ + +IN+ L+   +  R      +T+  K++  +RNLY++IS S    F   P++            I+ ++  +GE+F A +SN ++  LE+II   YD++ +   G+ E  +     E+     + +  ++I  +  KYNK VVAT D ++L+  D++Y ++ +  K           Y + +   P  YF+TTDE+  EF +L + V   +IV+ N N IA L++  +KPI +    P IEGA ++L++L   K++ I+GD +   V+ R+DRE++S+I+NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS+ A +  ITEVNPL PHY+C NCKY  F  + +   G D+P+  CP C + ++ DG +IPFE F+GF+GDK PDIDLNFS  YQ  AH + + +FG+  VFRAGTI T A+KTAYGYVK YFEE + +    +EI R+   C  VKRTTGQHPGGI+VVP  K +YDFTP  +PAD +  D  TTH  + S+   LLK DILGHD+PT+++ML + T +NA  IP  D   M LF S ++L I    +N     G+ G+PEFGT FV++ML+ T+P  F++L+RISGLSHGT+VW +NA+ +I E   T+ +VIS RDDIM+YLI KG+   ++FKIME+VRKGKG+ +E  + +  + +P W+IESC KI Y+FPKAHA AYVIMA++IA+FK++YP  FYA+YF++R   F++  +L G+  I N I EI+ K  N         KE  L+ + E+ALE+  RG+KF N+DL KS A  F +  + L+PP ++++G+G   A +I + RE   F S EDF+ RTKV+ T ++I+++ G  + L E +Q+SLF
  S:   127 LKKFLKDKYGF-KTEIDVVLLEEFEDTMERMIMEEDIKVIEEITKSGQKQETGKTTEKMEDKEDSQVLLGKEIKAEVISIKDVTAETEEAVIEGEIFSLEFKELKSKI-LMTFDITDYTSSILVKAFLTEEKYNYLKENIQVGSFVKLRGKVFYDKYEGDLVISL-KDLQLIS-PKE--RKDLSEEKRVELHLHTQMSSMDAVASATEVIKRAAKWGHKAIAITDHAVVQAFPEAMEASSKYG-VKVIYGVEGYLVDDGVPIVTGDTEATLEDE-FTVFDIETTGLSNINDEIIEIGAVKIKEGKIIDTFETFVNPKIPISSFITKLTGIDESMVKDAPSIEEILPKFLEFASNSVLVAHNA-NFDVSFIKSKAKKFNLNV-NNAVLDTLELSRHLYKDLKNYKLDTLADHLQVKLE--HHHRAVDDAMATAEIFIKTIDRLKELGVEKVKDINAILKESEVDIRKLPVYHVTILVKDQKGLRNLYEIISKSNLEYFHRTPRIPKSLLISRREGLIIGSACEQGEVFRAIVSNLEEKKLENIIS-FYDYLEVQPVGNNEFLIGK--GEVKSVEELREINRKIYLLGKKYNKLVVATGDVHFLDPWDDIYRKILMAGK----------GYKDADR-QPPLYFKTTDEMLKEFEYLGEEV-AKEIVIDNPNKIADLVE-EVKPIPDGTFPPVIEGAEEELRKLTLDKAHEIYGDPLPEIVQNRLDRELNSIINNGYAVMYIIAQKLVSKSLKDGYLVGSRGSVGSSLVATMSGITEVNPLPPHYVCPNCKYSEFITDGSYGCGVDMPDKTCPHCGTLMRKDGFDIPFEVFLGFEGDKEPDIDLNFSGEYQPIAHKYTEELFGKGHVFRAGTIGTLADKTAYGYVKKYFEE-RNLIVHKSEIKRLTVGCTGVKRTTGQHPGGIMVVPKDKSIYDFTPIQHPADAEDTDVITTHFDYHSISGRLLKLDILGHDDPTVIRMLEDLTGINAREIPLDDKKTMSLFTSVEALGIDPEELNT--PVGTLGLPEFGTKFVRQMLIDTRPTTFAELVRISGLSHGTDVWLNNAQDIIREGIATLKEVISTRDDIMLYLISKGMDKKLSFKIMENVRKGKGVTQEEIEEMRKHGVPNWFIESCQKIKYMFPKAHAVAYVIMAFRIAYFKVHYPEAFYATYFTVRADDFNLDIVLKGKDSIKNAIKEIEAKGNNASP------KEKSLLTVLEVALEMYLRGFKFINVDLYKSDAVKFFITEEGLLPPLNSLEGVGIQAAKTIAQERENGKFLSVEDFRNRTKVSKTVIEILKQYGCLTDLPESNQLSLF 1407
>gi|20807845|ref|NP_623016.1| DNA polymerase III PolC [Thermoanaerobacter tengcongensis MB4] >gi|24418364|sp|Q8RA32|DPO3_THETN DNA polymerase III polC-type (PolIII) >gi|20516408|gb|AAM24620.1| DNA polymerase III alpha subunit, the Gram-positive type [Thermoanaerobacter tengcongensis MB4] (1401 aa)
Score = 2245, Expect = 0.0e+00, Identities = 499/1241 (40%), Positives = 768/1241 (61%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSL----ITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQV-LEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           K +      + D+  E     IEGEIF ID    K+   +  + +TDY+ SI++K    ++  + +  E+  G +V+ + ++  D YE + +  L +++ +I   K   R D +  KR EL  HT M+  + + +  E+ K ++E G+ +VAITD    Q FP+    +++Y  +K IYG++  ++D  IPIV   ++  + +  +V+FDIETTGLS   D+IIE GA+K      V++ + F+NP+  IS  I  +T I    VKDA  I+E L K  +F   +VL+AHN   FD+ F+  K ++  +  ++N ++DTL++SR + + +  + L  +A  +++       HRA +DA+    I+ +MLE  +   IK+++EINS L     RE +   L    +T+  K++  +RNLY++IS S    F   P++      +     I+ ++  +GE+F A +SN ++  LEDII + YD++ I   G+ E  +     E+     +++  ++I ++  KYNK VVAT D ++L+  D+VY ++ +  K           Y + +   P  YFRTT+E+  EF +L +     ++V+ N N IA +++ ++KPI E    P IEGA ++L+++  +K++ I+GD +   V+ R+DRE++++I+NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS+ A +  ITEVNPL PHY+C  CK+  F  + +   G D+P+  CP C + +K DG +IPFE FMGF+GDK PDIDLNFS  YQ  AH + + +FG+  VFRAGTI T A+KTAYGYVK YFEE + +    +EI R+   C  +KRTTGQHPGG++VVP  K +YDFTP   PAD +  D  TTH  + SL   LLK DILGHD+PT+++ML + T VNA  IP  D   M LF S ++L I    +      G+ G+PEFGT FV++ML+ T+P  F +L+RISGLSHGT+VW +NA+ +I E   T+ +VI+ RDDIM+YLI KG+   ++FKIME+VRKGKG+ +E  + +  + +P W+I+SC KI Y+FPKAHA AYVIMA++IA+FK+YYP  FYA+YF++R   F++  +L G+  I   I EI+ K  N         KE +L+ + E+ALE+  RG KF N+DL +S A  FL+  + L+PP ++++G+G   A +I + RE   F S EDF+ RT+V+ T ++I+++ G    L E +Q+SLF
  S:   190 KEMKAKPISIKDVSAETDEVVIEGEIFSIDFKELKSKV-LMVFDITDYTSSILVKTFLTEEKYEILKDEIDVGTFVRLRGNVIYDKYEGDLVIDL-KDLELIPPKK---RMDLSEEKRVELHLHTQMSTLDAVPSATEVIKRAAEWGHKAVAITDHAVVQAFPEAMEASREYG-VKVIYGMEGYMVDDGIPIVTGESEASL-EGEFVVFDIETTGLSNINDEIIEIGAVKIKNKKIVDTFETFVNPQIPISSFITKLTGIDESMVKDAPLIEEVLPKFLEFAKGAVLVAHNA-NFDVSFIKSKAKKLGL-TVENTVLDTLELSRHLYQDLKNYKLDTLAEFFEVKL--LHHHRAVEDAKATAEIFIKMLEKLQEIGIKSVSEINSVLME---REVDVKKLPVYHVTILVKDQKGLRNLYEIISRSNLEFFHRTPRIPKSLLVKMREGLIIGSACEQGEVFRALVSNLEEKKLEDII-NFYDYLEIQPVGNNEFLIE--RGEVRSVEELKEINRKIYELGKKYNKLVVATGDVHFLDPWDDVYRKILMAGK----------GYKDADR-QPPLYFRTTEEMLMEFEYLGEEA-AREVVIENPNKIAEIVE-DVKPIPEGTFPPVIEGAEEELRRITLEKAHEIYGDPLPPIVQERLDRELNAIINNGYAVMYVIAQKLVSKSLQDGYLVGSRGSVGSSLVATMSGITEVNPLPPHYVCPKCKHSEFVTDGSFGCGVDMPDKYCPNCGTLMKKDGFDIPFEVFMGFEGDKEPDIDLNFSGEYQPIAHRYTEELFGKGHVFRAGTIGTLADKTAYGYVKKYFEE-RNLTVHKSEIKRLTMGCTGIKRTTGQHPGGVMVVPKDKSIYDFTPIQRPADAEDTDVITTHFDYHSLSGKLLKLDILGHDDPTVIRMLEDLTGVNARKIPLDDKKTMSLFTSVEALGIDPEELGT--PVGTLGLPEFGTKFVRQMLIETRPTTFDELVRISGLSHGTDVWLNNAQDIIREGIATLKEVIAARDDIMLYLISKGMDKKLSFKIMENVRKGKGVTQEEIEEMKKHGVPDWFIQSCQKIKYMFPKAHAVAYVIMAFRIAYFKVYYPEAFYATYFTVRADDFNLDIVLGGKESIKRAIKEIEAKGNNATP------KEKNLLTVLEVALEMYLRGIKFTNVDLYRSDAEKFLITEEGLLPPLNSLEGVGIQAAKAIAQERENGKFISIEDFRNRTRVSKTVIEILKQYGCLEDLPESNQLSLF 1401
>gi|167453947|ref|ZP_02320170.1| DNA polymerase III, alpha chain, Gram-positive type [Listeria monocytogenes FSL J2-064] (1012 aa)
Score = 2244, Expect = 0.0e+00, Identities = 454/1031 (44%), Positives = 669/1031 (64%)
  Q:   426 IETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTV-LPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +ETTGLS  YD IIE   +K   G  ++  + FI+P   +S     +T I+++ VK +  I   L + K++ GD +L+AHN   FD+ F+N   E+  ++  +N ++DTL+++R +      H L  + +K+ I  +  Q HRA  DAE    + WK + + +++ +I   + +N  +      +R R    T+Y +    ++NL+KLI+ S  + F   P++      +     I+  + ++GE+FEA M    Q  E +  + YDFI +     +   I RE+ +    +E+ +K I+++  K  K VVAT + +Y +  D++Y ++ ++++  GG        N LN   LP  +FRTTDE+  EF+FL +     +IVVTN+N +   ++ ++KPIK+ L++P I+GA D+++ + Y  ++ ++G+ +   V+AR+++E+ S+I +G+A+IY  SH LVK+S+ DGY+VGSRGSVGSS  A + +ITEVNPL PHY+C NCK   F  + +V SGFDLP+ +CP C +  + +G +IPFETF+GFKGDK+PDIDLNFS  YQ  AH + K +FGE+ VFRAGTI T AEKTA+GYV++Y E    M  R AEI R+   C  VKRTTGQHPGGI+V+P   DVYDFTP  +PAD    +W TTH  F S+HD++LK DILGHD+PT ++ML + + ++  TIP  D DVM LF ST+SL +K   I+   KTG+ GIPEFGT FV++ML  TKP  FS+L++ISGLSHGT+VW  NA+ LI+ K   + DVI CRDDIMV+LI +G+   +AFKIME VRKGKGL EE ++ +  N +P WYIESC KI Y+FPKAHA AYV+MA +IA+FK++YPL+FYA+YF++R   FD+ S++NG+  +   + E+ +K     T      KE +L+ + E+A E+L RG+ F  +DL KS A +F+++GD LIPPF+AI  LG +VA  IV ARE   F SKED ++R KV+ T ++ M++ G    L + +Q+SLF
  S:     1 VETTGLSAVYDTIIELAGVKMKNGEIIDKFEAFIDPGHPLSATTINLTGITDDMVKGSDPIDVVLKRFKEWSGDDILVAHNA-SFDMGFINTAYEKVGLEKAENAVVDTLELARFLYPHFKNHRLNTLTKKFNIILE--QHHRAVFDAEATAYLAWKLIKDAKEMHNIDFHDSLNDYMGEGDAYKRARPFHATIYAQTAVGLKNLFKLITMSNINYFYRVPRIPRSQLKKLREGLIIGTACSQGELFEAMMQKGMQAAEKV-AEFYDFIEVQPKPVYAPLIERELVRDEKALEEILKNIVRVGEKTGKPVVATGNVHYKDPVDKIYRKILIHSQ--GGA-------NPLNRAELPDVHFRTTDEMLKEFAFLGEEK-AKEIVVTNANLVVDWME-DLKPIKDELYTPKIDGAEDEVRNMSYAMAHQLYGEKLPEIVEARLEKELKSIIGHGFAVIYLISHKLVKKSLVDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYLCPNCKDSEFFDDGSVGSGFDLPDKDCPHCGTPYQKEGQDIPFETFLGFKGDKVPDIDLNFSGDYQPVAHAYTKEIFGEDYVFRAGTIGTVAEKTAFGYVRNY-ERDMNMTIRGAEIDRLVAGCTGVKRTTGQHPGGIIVIPDYMDVYDFTPVQFPADATDSEWKTTHFDFHSIHDNVLKLDILGHDDPTAIRMLQDLSGIDPKTIPTDDPDVMKLFGSTESLGVKPADIDS--KTGTLGIPEFGTRFVRQMLEQTKPTTFSELVQISGLSHGTDVWLGNAEELIKNKTCELPDVIGCRDDIMVFLIYQGLESSLAFKIMESVRKGKGLTEEMEEAMMANKVPLWYIESCKKIKYMFPKAHAAAYVLMAVRIAYFKVHYPLYFYATYFTVRADDFDLTSMVNGKEAVKATMKEVNDKGMEAST------KEKNLLTVLEIANEMLARGFHFQKVDLYKSSADEFIIDGDSLIPPFNAIPSLGTNVAKQIVAARENGEFLSKEDLQQRGKVSKTIIQYMDDQGCLEGLPDQNQLSLF 1012
>gi|126698903|ref|YP_001087800.1| DNA polymerase III PolC-type [Clostridium difficile 630] >gi|168714767|ref|ZP_02747044.1| DNA polymerase III PolC-type [Clostridium difficile QCD-63q42] >gi|196127247|ref|ZP_03118996.1| DNA polymerase III PolC-type [Clostridium difficile ATCC 43255] >gi|115250340|emb|CAJ68162.1| DNA polymerase III PolC-type [Clostridium difficile 630] (1432 aa)
Score = 2243, Expect = 0.0e+00, Identities = 522/1223 (42%), Positives = 763/1223 (62%)
  Q:   234 TATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKD-VLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI------KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTN--CKYFNFEK--NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD-YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           T  + G+IF +D    K G  +    +TDY+ SI  K LF    NKD VL  +K+G ++K K  I  D Y+  +I+ +I   S I K     R D +  KR EL  HT M++ + + ++K+L + +++ G+S++AITD    Q FPD  N A K + +K +YGV+  +++ +  I+ +AND ++S  T+V+FDIETTG S   DKI E GA+K      V+     INPE+ IS KI  +T I+NE +KD   I+E L K  +F+GDSVL+AHN  +FD  F++ K  E  + +  N  +DTL ++R +   +  H L V+A++  I       HRA  DAE    I+ + L+    +  KTL+++N N+       +   + IT+  KN   I+NLYK+IS +  ++F   P++     NE+    I+ ++   G +F+A   N        I D YD+I     E    D +R +  +G ++D        +++I  A K++K  VAT D ++L++ + V  +V         K ++ FK +E  T L   +FRTTDE+ +EFS+L +  L  ++VV NSN IA +++ +IKPI +  + P IEG+  +L+++ Y+K+  I+GD +   V+ R+DRE++S+I NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS AA + DITEVNPL  HYIC N  CKY  F +     SG DLP+ +CPKC  KL  +GH+IPFE F+GF+GDK PDIDLNFS  YQ   H + + +FGE  V+RAGTI T AEKTA+GY + Y EE+  ++  NAE+ R++  C  VKRT+GQHPGG++V+P  KDVYDFTP  YPA+D +    TTH  + S+   +LK DILGHD PTI++ML + T +N   IP  D + M LF ST++L +    IN     G   +PEFGT FV++MLL TKP  F++L+RISGLSHGT+VW +NA+ L+ E  + + DVIS RDDIM YLI KG+ P ++F IME VRKGKGL  E+ + +  NN+P WYI SC KI Y+FPKAHA AYV+ +++IA+ K++YP  FYA+YF+ +++ FD   I+ G   I +KINEI E + N  T      KE  ++ + E+ALE+  RG K   +D+ KS AT+F+V G+  L+PP +AI GLG + A +I   R+   F SKED +KRTK++ T ++ +   G   +++E +Q+SLF
  S:   237 TVAVVGDIFDVDTKELKNGKILMIASITDYTSSISCK-LFLTDTNKDGVLENVKKGAYLKIKGDIVYDTYQR-EISMMI---SGIRKETRIEREDKSEEKRVELHAHTQMSSMDAICSVKKLVERAAKWGHSAIAITDHGVVQGFPDAMN-AGKSNNIKILYGVEGYLVEDDSLIIEDANDKELSQ-TFVVFDIETTGFSNTNDKITEIGAVKIENFKIVDRFSELINPEKDISYKIQELTGITNELIKDKPTIEEVLPKFMEFVGDSVLVAHNA-EFDTGFISQKCREQGL-LYNNKKVDTLMLARVMLPNLKRHRLNVVAKELGIPL--LNHHRAVDDAEATALIFNKFLQMLTEKGAKTLSDVN-NILGKIDYTKLSTNHITLIAKNSIGIKNLYKIISDAHVNHFFRAPRILRSVLNEYKEGLIIGSACEAGVVFQAVKKNVSDEEMKKIIDLYDYI-----EVMPIDNNRFMIDKGEVKDEEELRELNRKLIDTAKKFDKIPVATGDVHFLDKHEAVLRKVL--------KYSQGFKVDEEETYL---HFRTTDEMLEEFSYLGEE-LAYEVVVENSNLIADMVE-DIKPIPDDTYPPIIEGSDVELREMCYKKAKRIYGDPIPEIVQKRLDRELNSIISNGYAVMYIIAQKLVAKSLSDGYLVGSRGSVGSSFAATMSDITEVNPLPAHYICENEDCKYSFFYEIGEWGSGVDLPDKDCPKCGRKLAKNGHDIPFEVFLGFEGDKEPDIDLNFSGNYQPTIHKYTEELFGEGYVYRAGTIGTVAEKTAFGYARKYVEENN-ISVPNAEVLRLSNGCTGVKRTSGQHPGGVMVIPDYKDVYDFTPIQYPANDTSCGVITTHFDYHSISGRILKLDILGHDGPTIIRMLEDMTGINITEIPLDDKETMSLFTSTEALGVTPEEIN--CPIGCLAVPEFGTKFVRQMLLDTKPTTFAELVRISGLSHGTDVWVNNAQDLVREDIVGLKDVISTRDDIMNYLIFKGLPPKMSFTIMESVRKGKGLKPEHIEEMKKNNVPEWYIGSCKKIKYMFPKAHAVAYVMTSFRIAYCKVHYPEAFYATYFTTKVEDFDADLIVKGLDAIKSKINEI-ESLGNDAT-----TKEKGMLTVLEVALEMYARGIKLLPVDIYKSDATEFIVVGEKTLLPPMAAIQGLGGNAAINIQNERKNGEFISKEDLRKRTKISKTVIETLTNHGSLENMSERNQLSLF 1432
>gi|168696365|ref|ZP_02728642.1| DNA polymerase III PolC-type [Clostridium difficile QCD-37x79] >gi|168723270|ref|ZP_02755547.1| DNA polymerase III PolC-type [Clostridium difficile QCD-76w55] >gi|168730903|ref|ZP_02763180.1| DNA polymerase III PolC-type [Clostridium difficile QCD-97b34] (1432 aa)
Score = 2242, Expect = 0.0e+00, Identities = 522/1223 (42%), Positives = 763/1223 (62%)
  Q:   234 TATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKD-VLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI------KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTN--CKYFNFEK--NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD-YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           T  + G+IF +D    K G  +    +TDY+ SI  K LF    NKD VL  +K+G ++K K  I  D Y+  +I+ +I   S I K     R D +  KR EL  HT M++ + + ++K+L + +++ G+S++AITD    Q FPD  N A K + +K +YGV+  +++ +  I+ +AND ++S  T+V+FDIETTG S   DKI E GA+K      V+     INPE+ IS KI  +T I+NE +KD   I+E L K  +F+GDSVL+AHN  +FD  F++ K  E  + +  N  +DTL ++R +   +  H L V+A++  I       HRA  DAE    I+ + L+    +  KTL+++N N+       +   + IT+  KN   I+NLYK+IS +  ++F   P++     NE+    I+ ++   G +F+A   N        I D YD+I     E    D +R +  +G ++D        +++I  A K++K  VAT D ++L++ + V  +V         K ++ FK +E  T L   +FRTTDE+ +EFS+L +  L  ++VV NSN IA +++ +IKPI +  + P IEG+  +L+++ Y+K+  I+GD +   V+ R+DRE++S+I NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS AA + DITEVNPL  HYIC N  CKY  F +     SG DLP+ +CPKC  KL  +GH+IPFE F+GF+GDK PDIDLNFS  YQ   H + + +FGE  V+RAGTI T AEKTA+GY + Y EE+  ++  NAE+ R++  C  VKRT+GQHPGG++V+P  KDVYDFTP  YPA+D +    TTH  + S+   +LK DILGHD PTI++ML + T +N   IP  D + M LF ST++L +    IN     G   +PEFGT FV++MLL TKP  F++L+RISGLSHGT+VW +NA+ L+ E  + + DVIS RDDIM YLI KG+ P ++F IME VRKGKGL  E+ + +  NN+P WYI SC KI Y+FPKAHA AYV+ +++IA+ K++YP  FYA+YF+ +++ FD   I+ G   I +KINEI E + N  T      KE  ++ + E+ALE+  RG K   +D+ KS AT+F+V G+  L+PP +AI GLG + A +I   R+   F SKED +KRTK++ T ++ +   G   +++E +Q+SLF
  S:   237 TVAVVGDIFDVDTKELKNGKILMIASITDYTSSISCK-LFLTDTNKDGVLENVKKGAYLKIKGDIVYDTYQR-EISMMI---SGIRKETRIEREDKSEEKRVELHAHTQMSSMDAICSVKKLVERAAKWGHSAIAITDHGVVQGFPDAMN-AGKSNNIKILYGVEGYLVEDDSLIIEDANDKELSQ-TFVVFDIETTGFSNTNDKITEIGAVKIENFKIVDRFSELINPEKDISYKIQELTGITNELIKDKPTIEEILPKFMEFVGDSVLVAHNA-EFDTGFISQKCREQGL-LYNNKKVDTLMLARVMLPNLKRHRLNVVAKELGIPL--LNHHRAVDDAEATALIFNKFLQMLTEKGAKTLSDVN-NILGKIDYTKLSTNHITLIAKNSIGIKNLYKIISDAHVNHFFRAPRILRSVLNEYKEGLIIGSACEAGVVFQAVKKNVSDEEMKKIIDLYDYI-----EVMPIDNNRFMIDKGEVKDEEELRELNRKLIDTAKKFDKIPVATGDVHFLDKHEAVLRKVL--------KYSQGFKVDEEETYL---HFRTTDEMLEEFSYLGEE-LAYEVVVENSNLIADMVE-DIKPIPDDTYPPIIEGSDVELREMCYKKAKRIYGDPIPEIVQKRLDRELNSIISNGYAVMYIIAQKLVAKSLSDGYLVGSRGSVGSSFAATMSDITEVNPLPAHYICENEDCKYSFFYEIGEWGSGVDLPDKDCPKCGRKLAKNGHDIPFEVFLGFEGDKEPDIDLNFSGNYQPTIHKYTEELFGEGYVYRAGTIGTVAEKTAFGYARKYVEENN-ISVPNAEVLRLSNGCTGVKRTSGQHPGGVMVIPDYKDVYDFTPIQYPANDTSCGVITTHFDYHSISGRILKLDILGHDGPTIIRMLEDMTGINITEIPLDDKETMSLFTSTEALGVTPEEIN--CPIGCLAVPEFGTKFVRQMLLDTKPTTFAELVRISGLSHGTDVWVNNAQDLVREDIVGLKDVISTRDDIMNYLIFKGLPPKMSFTIMESVRKGKGLKPEHIEEMKKNNVPEWYIGSCKKIKYMFPKAHAVAYVMTSFRIAYCKVHYPEAFYATYFTTKVEDFDADLIVKGLDAIKSKINEI-ESLGNDAT-----TKEKGMLTVLEVALEMYARGIKLLPVDIYKSDATEFIVVGEKTLLPPMAAIQGLGGNAAINIQNERKNGEFISKEDLRKRTKISKTVIETLTNHGSLENMSERNQLSLF 1432
>gi|125625168|ref|YP_001033651.1| DNA polymerase III PolC [Lactococcus lactis subsp. cremoris MG1363] >gi|124493976|emb|CAL98973.1| DNA polymerase III alpha subunit [Lactococcus lactis subsp. cremoris MG1363] (1635 aa)
Score = 2241, Expect = 0.0e+00, Identities = 476/1220 (39%), Positives = 754/1220 (61%)
  Q:   238 EGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDI--KTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNT-QQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLP--KYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHI-----EGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKG------KGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +GE+ +I    T     + ++ +TDY+ S  ++     +    +  ++K G+W + + ++Q D ++N+ +  L + I I   P + +R D +  KR E   HTNM+  + + +   L   +++ G+ ++AITD    Q+FP+ ++  KK + +K IYGV+ N+++  IPIV N  D  + ++TYV+FD+ETTGLS  ++ +I+  A K HKG  ++    FINP  ++S+    +T I+++ VK+A  + E L K + F   ++L+AHN   FD+ F+N     N + II  P++DTL+ +R +  ++    LG + +K++I  +    H A+ DAE    +    LE  + ++    +L E+N+ L ++   ++ R   +T+Y K +  ++NL+K++S      + G P++        +   +V ++   GE+F+AA++ T ++ LE  I   YDFI +  P  +   +    +K    +E  +K +IKI     K V+AT + +YLN  D +Y  + V +  LG + N    + E    LP  + +FRTTDE+ + FSFL++     +IV+ N+  +A   D  + P+++ L++P +     E + +++ +L Y+K++  +G+ + + + AR+++E+ S++ NG++++Y  S  LVK+S + GY+VGSRGSVGSS+ A ++ ITEVNPL PHY C  C+YF    + +  SG+D+P+ NCPKC  KL  DGH+IPFETF+GFKGDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGTI T AEKTA+G+VK Y  +  +    NAEI R+A     VKRTTGQHPGGI+V+P+  DVYDF+P  +PADD   +W TTH  F ++HD++LK DILGHD+PT+++ L   + +    IP  D  VM LF  T+SL +    +   +K G+ GIPE GT     M+   KP+ F+DL++ISGLSHGT+VW+ NA+ LI      +S VI CRDDIMVYLI KG+   +AF IME VRKG          E+Y + + ++ +P WYIESC+KI Y+FPKAHA AY++MA ++A+FK+++P+ +Y ++FSIR   FDI  +  G   +  K+ EIK+K           N E +L    EL  E+L RG+ F  IDL +S AT+F+++GD LIPPF  +DGLG++VA  IV AR E  F SK + +KR  V+ T ++ M  +G+   + +D+Q+SLF+
  S:   414 KGELREIKSRKTGNISYLLEFEMTDYTSSFYVQKWLRGEEEIQLAKQIKAGLWCRVRGNVQRDNFKNDLVLQLTDLIEI---PTQNVREDKSDEKRVEFHAHTNMSQMDAIPSASSLVAQAAKWGHKAIAITDHGGLQSFPEAHSAGKK-NGVKIIYGVEANLVEDKIPIVFNETDVDMYESTYVVFDVETTGLSAVHNDLIQIAATKMHKGNPIDEFDEFINPGYRLSEFTTELTGITDDHVKNAKPLYEVLTKFQKFCEGTILVAHNA-SFDVGFMNMNYSRNGLPIISQPVVDTLEFARNLYPEMKRFGLGQLTKKFQIGLE--HHHMANFDAEATGRLLFVFLEELRTRNTGWTSLLELNAKLVSEDSYKKVRPKHVTLYAKTQEGLKNLFKIVSFGNVKYYAGLPRLPRSVLEANSEGLLVGSACEVGEVFDAAINKTFEETLE--IAKFYDFIEVFPPALYRSLVVGGSFKSEKELEQTLKDLIKIGKTLGKPVLATGNLHYLNPEDAIYREIIVRSLGLGAEINWTQGHGEHAKPLPLPEAHFRTTDEMLEAFSFLDEKT-AREIVIDNTQKMADEFDV-LTPVRDDLYTPKMVFDGGETSEERIVRLTYEKAHEWYGNPLPDIIDARLEKELRSILGNGFSVVYIISQELVKRSNERGYIVGSRGSVGSSLVATMIGITEVNPLAPHYRCPECQYFECYDDGSFGSGYDMPDKNCPKCDHKLIKDGHDIPFETFLGFKGDKVPDIDLNFSGDDQPLAHLDVRDIFGEDYAFRAGTIGTVAEKTAFGFVKGYERDYDQFYG-NAEIDRLAAGSTGVKRTTGQHPGGIIVIPNYMDVYDFSPVQFPADDVNAEWQTTHFDFHAIHDNILKLDILGHDDPTMIRKLQSLSGIVPQDIPMDDPGVMKLFTGTESLGLTEEQLG--VKLGTLGIPEMGTFTSMNMIAEAKPKNFADLLQISGLSHGTDVWSGNAQDLIRSGIADLSSVIGCRDDIMVYLIHKGLENGLAFTIMERVRKGMWNKIPAEEREKYVEAMREHEVPEWYIESCSKIKYMFPKAHAAAYIMMALRVAYFKVHHPIFYYCAWFSIRATAFDIGVMGAGLEAVKAKMKEIKDKGFE------ATNVETNLYTTLELCNEMLERGFTFGKIDLYRSEATEFVIDGDTLIPPFVTMDGLGENVAKQIVAARAEGEFLSKMELRKRGGVSQTIIENMTNMGVLEGMPDDNQLSLFD 1632
>gi|116513078|ref|YP_811985.1| DNA polymerase III PolC [Lactococcus lactis subsp. cremoris SK11] >gi|116108732|gb|ABJ73872.1| DNA polymerase III catalytic subunit, PolC type [Lactococcus lactis subsp. cremoris SK11] (1635 aa)
Score = 2237, Expect = 0.0e+00, Identities = 476/1220 (39%), Positives = 754/1220 (61%)
  Q:   238 EGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDI--KTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNT-QQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLP--KYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHI-----EGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKG------KGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +GE+ +I    T     + ++ +TDY+ S  ++     +    +  ++K G+W + + ++Q D ++N+ +  L + I I   P + +R D +  KR E   HTNM+  + + +   L   +++ G+ ++AITD    Q+FP+ ++  KK + +K IYGV+ N+++  IPIV N  D  + ++TYV+FD+ETTGLS  ++ +I+  A K HKG  ++    FINP  ++S+    +T I+++ VK+A  + E L K + F   ++L+AHN   FD+ F+N     N + II  P++DTL+ +R +  ++    LG + +K++I  +    H A+ DAE    +    LE  + ++    +L E+N+ L ++   ++ R   +T+Y K +  ++NL+K++S      + G P++            +V ++   GE+F+AA++ T ++ LE  I   YDFI +  P  +   +    +K    +E  +K +IKI     K V+AT + +YLN  D +Y  + V +  LG + N    + E    LP  + +FRTTDE+ + FSFL++     +IV+ N+  +A   D  + P+++ L++P +     E + +++ +L Y+K++  +G+ + + + AR+++E+ S++ NG++++Y  S  LVK+S + GY+VGSRGSVGSS+ A ++ ITEVNPL PHY C  C+YF    + +  SG+D+P+ NCPKC  KL  DGH+IPFETF+GFKGDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGTI T AEKTA+G+VK Y  +  +    NAEI R+A     VKRTTGQHPGGI+V+P+  DVYDF+P  +PADD   +W TTH  F ++HD++LK DILGHD+PT+++ L   + +    IP  D  VM LF  T+SL +    +   +K G+ GIPE GT     M+   KP+ F+DL++ISGLSHGT+VW+ NA+ LI      +S VI CRDDIMVYLI KG+   +AF IME VRKG          E+Y + + ++ +P WYIESC+KI Y+FPKAHA AY++MA ++A+FK+++P+ +Y ++FSIR   FDI  +  G   + +K+ EIK+K           N E +L    EL  E+L RG+ F  IDL +S AT+F+++GD LIPPF  +DGLG++VA  IV AR E  F SK + +KR  V+ T ++ M  +G+   + +D+Q+SLF+
  S:   414 KGELREIKSRKTGNISYLLEFEMTDYTSSFYVQKWLRGEEEIQLAKQIKAGLWCRVRGNVQRDNFKNDLVLQLTDLIEI---PTQNVREDKSDEKRVEFHAHTNMSQMDAIPSASSLVAQAAKWGHKAIAITDHGGLQSFPEAHSAGKK-NGVKIIYGVEANLVEDKIPIVFNETDVDMYESTYVVFDVETTGLSAVHNDLIQIAATKMHKGNPIDEFDEFINPGYRLSEFTTELTGITDDHVKNAKPLYEVLTKFQKFCEGTILVAHNA-SFDVGFMNMNYSRNGLPIISQPVVDTLEFARNLYPEMKRFGLGQLTKKFQIGLE--HHHMANFDAEATGRLLFVFLEELRTRNTGWTSLLELNAKLVSEDSYKKVRPKHVTLYAKTQEGLKNLFKIVSFENVKYYAGLPRLPRSVLEANREGLLVGSACEVGEVFDAAINKTFEETLE--IAKFYDFIEVFPPALYRSLVVGGSFKSEKELEQTLKDLIKIGKTLVKPVLATGNLHYLNPEDAIYREIIVRSLGLGAEINWTQGHGEHAKPLPLPEAHFRTTDEMLEAFSFLDEKT-AREIVIDNTQKMADEFDV-LTPVRDDLYTPKMVFDGGETSEERIVRLTYEKAHEWYGNPLPDIIDARLEKELRSILGNGFSVVYIISQELVKRSNERGYIVGSRGSVGSSLVATMIGITEVNPLAPHYRCPECQYFECYDDGSFGSGYDMPDKNCPKCDHKLIKDGHDIPFETFLGFKGDKVPDIDLNFSGDDQPLAHLDVRDIFGEDYAFRAGTIGTVAEKTAFGFVKGYERDYDQFYG-NAEIDRLAAGSTGVKRTTGQHPGGIIVIPNYMDVYDFSPVQFPADDVNAEWQTTHFDFHAIHDNILKLDILGHDDPTMIRKLQSLSGIVPQDIPMDDPGVMKLFTGTESLGLTEEQLG--VKLGTLGIPEMGTFTSMNMIAEAKPKNFADLLQISGLSHGTDVWSGNAQDLIRSGIADLSSVIGCRDDIMVYLIHKGLENGLAFTIMERVRKGMWNKIPAEEREKYVEAMREHEVPEWYIESCSKIKYMFPKAHAAAYIMMALRVAYFKVHHPIFYYCAWFSIRATAFDIGVMGAGLEAVKSKMKEIKDKGFE------ATNVETNLYTTLELCNEMLERGFTFGKIDLYRSEATEFVIDGDTLIPPFVTMDGLGENVAKQIVAARAEGEFLSKMELRKRGGVSQTIIENMTNMGVLEGMPDDNQLSLFD 1632
>gi|196165550|ref|ZP_03126081.1| DNA polymerase III PolC-type [Clostridium difficile QCD-23m63] (1432 aa)
Score = 2237, Expect = 0.0e+00, Identities = 520/1223 (42%), Positives = 761/1223 (62%)
  Q:   234 TATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKD-VLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI------KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTN--CKYFNFEK--NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD-YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           T  + G+IF +D    K G  +    +TDY+ SI  K LF    NKD VL  +K+G ++K K  I  D Y+  +I+ +I   S I K     R D +  KR EL  HT M++ + + ++K+L + +++ G+ ++AITD    Q FPD  N A K + +K +YGV+  +++ +  I+ +AND ++S  T+V+FDIETTG S   DKI E GA+K      V+     INPE+ IS KI  +T I+NE +KD   I+E L K  +F+GDSVL+AHN  +FD  F++ K  E  + +  N  +DTL ++R +   +  H L V+A++  I       HRA  DAE    I+ + L+    +  KTL+++N N+       +   + IT+  KN   I+NLYK+IS +  ++F   P++     NE+    I+ ++   G +F+A   N        I D YD+I     E    D +R +  +G ++D        +++I  A K+NK  VAT D ++L++ + +  +V         K ++ FK +E  T L   +FRTTDE+ +EFS+L +  L  ++VV NSN IA +++ +IKPI +  + P IEG+  +L+++ Y+K+  I+GD +   V+ R+DRE++S+I NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS AA + DITEVNPL  HYIC N  CKY  F +     SG DLP+ +CPKC  KL  +GH+IPFE F+GF+GDK PDIDLNFS  YQ   H + + +FGE  V+RAGTI T AEKTA+GY + Y EE+  ++  NAE+ R++  C  VKRT+GQHPGG++V+P  KDVYDFTP  YPA+D +    TTH  + S+   +LK DILGHD PTI++ML + T +N   IP  D + M LF ST++L +    IN     G   +PEFGT FV++MLL TKP  F++L+RISGLSHGT+VW +NA+ L+ E  + + DVIS RDDIM YLI KG+ P ++F IME VRKGKGL  E+   +  NN+P WYI SC KI Y+FPKAHA AYV+ +++IA+ K++YP  FYA+YF+ +++ FD   I+ G   I +KINEI E + N  T      KE  ++ + E+ALE+  RG K   +D+ KS AT+F++ G+  L+PP +AI GLG + A +I   R+   F SKED +KRTK++ T ++ +   G   +++E +Q+SLF
  S:   237 TVAVVGDIFDVDTKELKNGKILMIASITDYTSSISCK-LFLTDTNKDGVLENVKKGAYLKIKGDIVYDTYQR-EISMMI---SGIRKETRKEREDKSEEKRVELHAHTQMSSMDAICSVKKLVERAAKWGHPAIAITDHGVVQGFPDAMN-AGKSNNIKILYGVEGYLVEDDSLIIEDANDKELSQ-TFVVFDIETTGFSNTNDKITEIGAVKIENFKIVDRFSELINPEKDISYKIQELTGITNELIKDKPTIEEVLPKFMEFVGDSVLVAHNA-EFDTGFISQKCREQGL-LYNNKKVDTLMLARVMLPNLKRHRLNVVAKELGIPL--LNHHRAVDDAEATALIFNKFLQMLTEKGAKTLSDVN-NILGKIDYTKLSTNHITLIAKNSVGIKNLYKIISDAHVNHFFRAPRILRSVLNEYKEGLIIGSACEAGVVFQAVKKNVSDEEMKKIIDLYDYI-----EVMPIDNNRFMIDKGEVKDEEELRELNRKLIDTAKKFNKIPVATGDVHFLDKHEAILRKVL--------KYSQGFKVDEEETYL---HFRTTDEMLEEFSYLGEE-LAYEVVVENSNLIADMVE-DIKPIPDDTYPPIIEGSDVELREMCYKKAKRIYGDPIPEIVQKRLDRELNSIISNGYAVMYIIAQKLVAKSLSDGYLVGSRGSVGSSFAATMSDITEVNPLPAHYICENEDCKYSFFYEIGEWGSGVDLPDKDCPKCGRKLAKNGHDIPFEVFLGFEGDKEPDIDLNFSGNYQPTIHKYTEELFGEGYVYRAGTIGTVAEKTAFGYARKYVEENN-ISVPNAEVLRLSNGCTGVKRTSGQHPGGVMVIPDYKDVYDFTPIQYPANDTSCGVITTHFDYHSISGRILKLDILGHDGPTIIRMLEDMTGINITEIPLDDKETMSLFTSTEALGVTPEEIN--CPIGCLAVPEFGTKFVRQMLLDTKPTTFAELVRISGLSHGTDVWVNNAQDLVREDIVGLKDVISTRDDIMNYLIFKGLPPKMSFTIMESVRKGKGLKPEHIAEMKKNNVPEWYIGSCKKIKYMFPKAHAVAYVMTSFRIAYCKVHYPEAFYATYFTTKVEDFDADLIVKGLDAIKSKINEI-ESLGNDAT-----TKEKGMLTVLEVALEMYARGIKLLPVDIYKSDATEFIIVGEKTLLPPMAAIQGLGGNAAINIQTERKNGEFISKEDLRKRTKISKTVIETLTNHGSLENMSERNQLSLF 1432
>gi|13959345|sp|Q9CDT7|DPO3_LACLA DNA polymerase III polC-type (PolIII) (1638 aa)
Score = 2236, Expect = 0.0e+00, Identities = 478/1220 (39%), Positives = 754/1220 (61%)
  Q:   238 EGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDI--KTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNT-QQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLP--KYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHI-----EGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKG------KGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +GE+ +I    T     + ++ +TDY+ S  ++     +    +  ++K G+W + + ++Q D ++N+ +  L + I I   P + +R D +  KR E   HTNM+  + + +   L   +++ G+ ++AITD    Q+FP+ ++  KK + +K IYGV+ N+++  IPIV N  D  + ++TYV+FD+ETTGLS  ++ +I+  A K HKG  ++    FINP  ++S+    +T I+++ VK+A  + E L K + F   ++L+AHN   FD+ F+N     N + II  P++DTL+ +R +  ++    LG + +K++I  +    H A+ DAE    +    LE  + ++    +L E+N  L ++   ++ R   +T+Y K +  ++NL+K++S      + G P+V            +V ++   GE+F+AA++ T ++ LE  I   YDFI +  P  +   +    +K    +E  +K +IKI     K V+AT + +YLN  D +Y  + V +  LG + N    + E    LP  + +FRTTDE+ + FSFL++     +IV+ N+  +A   D  + P+++ L++P +     E + +++ +L Y+K++  +G+ + + + AR+++E+ S++ NG++++Y  S  LVK+S D GY+VGSRGSVGSS+ A ++ ITEVNPL PHY C  C+YF    + +  SG+D+P+ NCPKC  KL  DGH+IPFETF+GFKGDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGTI T AEKTA+G+VK Y  +  +    NAEI R+A     VKRTTGQHPGGI+V+P+  DVYDF+P  +PADD   +W TTH  F ++HD++LK DILGHD+PT+++ L   + +    IP  D  VM LF  T+SL +    +   +K G+ GIPE GT     M+   KP+ F+DL++ISGLSHGT+VW+ NA+ LI      +S VI CRDDIMVYLI KG+   +AF IME VRKG          E+Y + + ++++P WYIESC+KI Y+FPKAHA AY++MA ++A+FK+++P+ +Y ++FSIR   FDI  +  G   +  K+ EIK+K  +        N E +L    EL  E+L RG+ F  IDL +S AT+F+++GD LIPPF  +DGLG++VA  IV AR E  F SK + +KR  V+ T ++ M  +G+   + +D+Q+SLF+
  S:   417 KGELREIKSRKTGNISYLLEFEMTDYTSSFYVQKWLRGEEEIQLAKQIKAGLWCRVRGNVQRDNFKNDLVLQLTDLIEI---PTQNVREDKSDEKRVEFHAHTNMSQMDAIPSASSLVAQAAKWGHKAIAITDHGGLQSFPEAHSAGKK-NGVKIIYGVEANLVEDKIPIVYNETDVDMYESTYVVFDVETTGLSAVHNDLIQIAATKMHKGNPIDEFDEFINPGYRLSEFTTELTGITDDHVKNAKPLYEVLTKFQKFCEGTILVAHNA-TFDVGFMNMNYSRNGLPIITQPVVDTLEFARNLYPEMKRFGLGQLTKKFQIGLE--HHHMANFDAEATGRLLFVFLEELRTRNTGWTSLLELNDKLVSEDSYKKVRPKHVTLYAKTQEGLKNLFKIVSFGNVKYYAGLPRVPRSVLEANREGLLVGSACEIGEVFDAAINKTFEETLE--IAKFYDFIEVFPPALYRSLVVGGSFKSEKELEQTLKDLIKIGKTLGKPVLATGNLHYLNPEDAIYREIIVRSLGLGAEINWTQGHGEHAKPLPLPEAHFRTTDEMLEAFSFLDEKT-AREIVIDNTQKMADEFDV-LTPVRDDLYTPKMVFDGGETSEERIVRLTYEKAHEWYGNPLPDIIDARLEKELRSILGNGFSVVYIISQELVKRSNDRGYIVGSRGSVGSSLVATMIGITEVNPLAPHYRCPECQYFECYDDGSFGSGYDMPDKNCPKCDHKLIKDGHDIPFETFLGFKGDKVPDIDLNFSGDDQPLAHLDVRDIFGEDYAFRAGTIGTVAEKTAFGFVKGYERDYDQFYG-NAEIDRLAAGSTGVKRTTGQHPGGIIVIPNYMDVYDFSPVQFPADDVNAEWQTTHFDFHAIHDNILKLDILGHDDPTMIRKLQSLSGIVPQDIPMDDPGVMKLFTGTESLGLTEEQLG--VKLGTLGIPEMGTFTSMNMIAEAKPKNFADLLQISGLSHGTDVWSGNAQDLIRSGIADLSSVIGCRDDIMVYLIHKGLENGLAFTIMERVRKGMWNKIPAEEREKYVEAMREHDVPEWYIESCSKIKYMFPKAHAAAYIMMALRVAYFKVHHPILYYCAWFSIRATAFDIGVMGAGLEAVKAKMKEIKDKGFD------ATNVETNLYTTLELCNEMLERGFTFGKIDLYRSEATEFVIDGDTLIPPFVTMDGLGENVAKQIVAARAEGEFLSKMELRKRGGVSQTIIENMTNMGVLEGMPDDNQLSLFD 1635
>gi|167040287|ref|YP_001663272.1| DNA polymerase III PolC [Thermoanaerobacter sp. X514] >gi|166854527|gb|ABY92936.1| DNA polymerase III, alpha subunit [Thermoanaerobacter sp. X514] (1407 aa)
Score = 2233, Expect = 0.0e+00, Identities = 514/1304 (39%), Positives = 794/1304 (60%)
  Q:   153 FRKFLN-DYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYK------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSL-ITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQV-LEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
            ++FL  +YG  K  +  +L E+  D +     +   K+  EIT+  +     KT      K        K +  +   + D+  E + A IEGEIF ++    K+   +  + +TDY+ SI++KA   ++    +   ++ G +VK +  +  D YE + +  L +++ +IS PKE  R D +  KR EL  HT M++ + + +  E+ K +++ G+ ++AITD    Q FP+    + KY  +K IYGV+  ++D  +PIV    +  + D  + +FDIETTGLS   D+IIE GA+K  +G  +++ + F+NP+  IS  I  +T I    VKDA  I+E L K  +F  +SVL+AHN   FD+ F+  K ++  +++  N ++DTL++SR + + +  + L  +A   ++  +    HRA  DA     I+ + ++  K   ++ + +IN+ L+   +  R      +T+  K++  +RNLY++IS S    F   P++            I+ ++  +GE+F A +SN ++  LE+II   YD++ +   G+ E  +     E+     + +  ++I  +  KYNK +VAT D ++L+  D++Y ++ +  K           Y + +   P  YF+TTDE+  EF +L + V   +IV+ N N IA L++  +KPI +    P IEGA ++L++L   K++ I+GD +   V+ R+DRE++S+I+NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS+ A +  ITEVNPL PHY+C NCKY  F  + +   G D+P+  CP C + ++ DG +IPFE F+GF+GDK PDIDLNFS  YQ  AH + + +FG+  VFRAGTI T A+KTAYGYVK YFEE + +    +EI R+   C  VKRTTGQHPGGI+VVP  K +YDFTP  +PAD +  D  TTH  + S+   LLK DILGHD+PT+++ML + T +NA  IP  D   M LF S ++L I    +N     G+ G+PEFGT FV++ML+ T+P  F++L+RISGLSHGT+VW +NA+ +I E   T+ +VIS RDDIM+YLI KG+   ++FKIME+VRKGKG+ +E  + +  + +P W+IESC KI Y+FPKAHA AYVIMA++IA+FK++YP  FYA+YF++R   F++  +L G+  I N I EI+ K  N         KE  L+ + E+ALE+  RG+KF N+DL KS A  FL+  + L+PP ++++G+G   A +I + RE   F S EDF+ RTKV+ T ++I+++ G    L E +Q+SLF
  S:   127 LKEFLQKEYGL-KTEIDVVLLEEFEDTMERMIMEEDIKVIEEITKSGQKQETGKTTEKMEDKEDSQVLLGKEIKAEAISIKDITAETEEAIIEGEIFSLEFKELKSKI-LMTFDITDYTSSILVKAFLTEEKYNSLKENIQVGGFVKLRGKVFYDKYEGDLVISL-KDLQLIS-PKE--RKDLSEEKRVELHLHTQMSSMDAVASATEVIKRAAKWGHKAIAITDHAVVQAFPEAMEASSKYG-VKVIYGVEGYLVDDGVPIVTGDTEATLEDE-FTVFDIETTGLSNINDEIIEIGAVKIKEGKIIDTFETFVNPKIPISSFITKLTGIDESMVKDAPSIEEILPKFLEFASNSVLVAHNA-NFDVSFIKSKAKKFNLNV-NNAVLDTLELSRHLYKDLKNYKLDTLAEHLQVKLE--HHHRAVDDAMATAEIFIKTIDRLKELGVEKVKDINAILKESEVDIRKLPVYHVTILVKDQKGLRNLYEIISKSNLEYFHRTPRIPKSLLISRREGLIIGSACEQGEVFRAIVSNLEEKKLENIIS-FYDYLEVQPVGNNEFLIGK--GEVKSVEELREINRKIYLLGKKYNKLIVATGDVHFLDPWDDIYRKILMAGK----------GYKDADR-QPPLYFKTTDEMLKEFEYLGEEV-AKEIVIDNPNKIADLVE-EVKPIPDGTFPPVIEGAEEELRRLTLDKAHEIYGDPLPEIVQNRLDRELNSIINNGYAVMYIIAQKLVSKSLKDGYLVGSRGSVGSSLVATMSGITEVNPLPPHYVCPNCKYSEFITDGSYGCGVDMPDKTCPHCGTLMRKDGFDIPFEVFLGFEGDKEPDIDLNFSGEYQPIAHKYTEELFGKGHVFRAGTIGTLADKTAYGYVKKYFEE-RNLIVHKSEIKRLTVGCTGVKRTTGQHPGGIMVVPKDKSIYDFTPIQHPADAEDTDVITTHFDYHSISGRLLKLDILGHDDPTVIRMLEDLTGINAREIPLDDKKTMSLFTSVEALGIDPEELNT--PVGTLGLPEFGTKFVRQMLIDTRPTTFAELVRISGLSHGTDVWLNNAQDIIREGIATLKEVISTRDDIMLYLISKGMDKKLSFKIMENVRKGKGVTQEEIEEMRKHGVPNWFIESCQKIKYMFPKAHAVAYVIMAFRIAYFKVHYPEAFYATYFTVRADDFNLDIVLKGKDSIKNAIKEIEAKGNNASP------KEKSLLTVLEVALEMYLRGFKFINVDLYKSDAVKFLITEEGLLPPLNSLEGVGIQAAKTIAQERENGKFLSVEDFRNRTKVSKTVIEILKQHGCLIDLPESNQLSLF 1407
>gi|15674106|ref|NP_268281.1| DNA polymerase III PolC [Lactococcus lactis subsp. lactis Il1403] >gi|12725180|gb|AAK06222.1|AE006440_8 DNA polymerase III, alpha chain (EC 2.7.7.7) [Lactococcus lactis subsp. lactis Il1403] (1658 aa)
Score = 2232, Expect = 0.0e+00, Identities = 478/1220 (39%), Positives = 754/1220 (61%)
  Q:   238 EGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDI--KTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNT-QQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLP--KYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHI-----EGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKG------KGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +GE+ +I    T     + ++ +TDY+ S  ++     +    +  ++K G+W + + ++Q D ++N+ +  L + I I   P + +R D +  KR E   HTNM+  + + +   L   +++ G+ ++AITD    Q+FP+ ++  KK + +K IYGV+ N+++  IPIV N  D  + ++TYV+FD+ETTGLS  ++ +I+  A K HKG  ++    FINP  ++S+    +T I+++ VK+A  + E L K + F   ++L+AHN   FD+ F+N     N + II  P++DTL+ +R +  ++    LG + +K++I  +    H A+ DAE    +    LE  + ++    +L E+N  L ++   ++ R   +T+Y K +  ++NL+K++S      + G P+V            +V ++   GE+F+AA++ T ++ LE  I   YDFI +  P  +   +    +K    +E  +K +IKI     K V+AT + +YLN  D +Y  + V +  LG + N    + E    LP  + +FRTTDE+ + FSFL++     +IV+ N+  +A   D  + P+++ L++P +     E + +++ +L Y+K++  +G+ + + + AR+++E+ S++ NG++++Y  S  LVK+S D GY+VGSRGSVGSS+ A ++ ITEVNPL PHY C  C+YF    + +  SG+D+P+ NCPKC  KL  DGH+IPFETF+GFKGDK+PDIDLNFS   Q  AH  ++++FGE+  FRAGTI T AEKTA+G+VK Y  +  +    NAEI R+A     VKRTTGQHPGGI+V+P+  DVYDF+P  +PADD   +W TTH  F ++HD++LK DILGHD+PT+++ L   + +    IP  D  VM LF  T+SL +    +   +K G+ GIPE GT     M+   KP+ F+DL++ISGLSHGT+VW+ NA+ LI      +S VI CRDDIMVYLI KG+   +AF IME VRKG          E+Y + + ++++P WYIESC+KI Y+FPKAHA AY++MA ++A+FK+++P+ +Y ++FSIR   FDI  +  G   +  K+ EIK+K  +        N E +L    EL  E+L RG+ F  IDL +S AT+F+++GD LIPPF  +DGLG++VA  IV AR E  F SK + +KR  V+ T ++ M  +G+   + +D+Q+SLF+
  S:   437 KGELREIKSRKTGNISYLLEFEMTDYTSSFYVQKWLRGEEEIQLAKQIKAGLWCRVRGNVQRDNFKNDLVLQLTDLIEI---PTQNVREDKSDEKRVEFHAHTNMSQMDAIPSASSLVAQAAKWGHKAIAITDHGGLQSFPEAHSAGKK-NGVKIIYGVEANLVEDKIPIVYNETDVDMYESTYVVFDVETTGLSAVHNDLIQIAATKMHKGNPIDEFDEFINPGYRLSEFTTELTGITDDHVKNAKPLYEVLTKFQKFCEGTILVAHNA-TFDVGFMNMNYSRNGLPIITQPVVDTLEFARNLYPEMKRFGLGQLTKKFQIGLE--HHHMANFDAEATGRLLFVFLEELRTRNTGWTSLLELNDKLVSEDSYKKVRPKHVTLYAKTQEGLKNLFKIVSFGNVKYYAGLPRVPRSVLEANREGLLVGSACEIGEVFDAAINKTFEETLE--IAKFYDFIEVFPPALYRSLVVGGSFKSEKELEQTLKDLIKIGKTLGKPVLATGNLHYLNPEDAIYREIIVRSLGLGAEINWTQGHGEHAKPLPLPEAHFRTTDEMLEAFSFLDEKT-AREIVIDNTQKMADEFDV-LTPVRDDLYTPKMVFDGGETSEERIVRLTYEKAHEWYGNPLPDIIDARLEKELRSILGNGFSVVYIISQELVKRSNDRGYIVGSRGSVGSSLVATMIGITEVNPLAPHYRCPECQYFECYDDGSFGSGYDMPDKNCPKCDHKLIKDGHDIPFETFLGFKGDKVPDIDLNFSGDDQPLAHLDVRDIFGEDYAFRAGTIGTVAEKTAFGFVKGYERDYDQFYG-NAEIDRLAAGSTGVKRTTGQHPGGIIVIPNYMDVYDFSPVQFPADDVNAEWQTTHFDFHAIHDNILKLDILGHDDPTMIRKLQSLSGIVPQDIPMDDPGVMKLFTGTESLGLTEEQLG--VKLGTLGIPEMGTFTSMNMIAEAKPKNFADLLQISGLSHGTDVWSGNAQDLIRSGIADLSSVIGCRDDIMVYLIHKGLENGLAFTIMERVRKGMWNKIPAEEREKYVEAMREHDVPEWYIESCSKIKYMFPKAHAAAYIMMALRVAYFKVHHPILYYCAWFSIRATAFDIGVMGAGLEAVKAKMKEIKDKGFD------ATNVETNLYTTLELCNEMLERGFTFGKIDLYRSEATEFVIDGDTLIPPFVTMDGLGENVAKQIVAARAEGEFLSKMELRKRGGVSQTIIENMTNMGVLEGMPDDNQLSLFD 1655
>gi|104774216|ref|YP_619196.1| DNA polymerase III, alpha subunit ( type) (PolC) [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423297|emb|CAI98138.1| DNA polymerase III, alpha subunit (gram-positive type) (PolC) [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (1411 aa)
Score = 2232, Expect = 0.0e+00, Identities = 508/1310 (38%), Positives = 784/1310 (59%)
  Q:   147 KKYLEHFRKFLNDYGF-SKHHLSYILD-------EKTIDIISDHKNKIQEKIKNEITEVKR----SSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDV--LSELKEGVWVKAKISIQIDMYENNDITGL--IEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLE--NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGE-IRNLYKLISTS-LTSNFDG--GPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK--YDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDF-LVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++ L+ F   L DYGF +   L+ + D       E    ++  H+  +QE  +    + K     S   ++   +       S   ++T+L DL  + ++A +EG +FK +    ++G  I+   +TDY+ SI  K        +++  L  +K GVW++ + S++ D Y ++ I  +  +E    + + + +   +    K  EL  HTNM+  +   ++ ++ K + + G  +VAITD    Q  P+ + EA K + +K I G++ N+++ +  +VLN    K  D  +VIFD+ETTGLS  YD IIE GA+K   G  ++    FINP   +S+    +T I++E V+ A      + +  DF G+  L  HN ++FD+ F++  L+      I  P++DTL++SR ++ +   H+L  + RKY +  +    HRA++DAE    +  ++L+  N K Q+   L ++N +  N    +R R + ITV  +N+   +RNLY+L+S + +  NF G   PK         +   +  ++ ++GE+F A M   Q+  E+  K    YDF+ I  P  +   I    I     +E+ +  I K+  + NK VVATSD +Y+++ + +Y  V + A+   G  NR       N   P  +F TT E+ DEFSF+ + +   ++V++N N I ++ID  ++P+++    P I   ++++++L Y K++ ++GD + ++++AR+DRE+ ++I NGY ++Y  S +LV +SV DGY+VGSRGSVGSS+ A ++ ITE+NP+ PHY C  CK   F +N +  SGFDLP+  CP C+  +  DG NIPFETF+GF GDK+PDIDLNFS  YQ  AH+FI+ MFG    F+AGT+ T A+K A GYVK Y +E  ++   NAE+ R+A     VK TTGQHP GIVV+P  KD+Y+ TP  YP+DD +++W TTH  F  +HD+LLKFDILGH +PT+++ML + + ++  TIP  D  VM LF+S ++L +    IN   KTG+ G+PEFGT FV+ ML  TKP  F++L++ISGLSHGT+VW  NA+ LI      + +VI CRD+IM  LI  G+   +AF  ME VRKGKG+++E   VL +N NIP WYI SC KI Y+FPKAHA AY++MA ++AWFK+YYP  +YA+YFS+R    D++++  G++ +   IN IKEK     TK      E DL    EL  E + RG  F  +D+ +S AT + +V+   ++ PF+A+DGLGDS A  IV AR E  F SKED + R KV+   M   E   +   + + +Q+SLF
  S:   107 QRLLDSFSLELRDYGFFNVKLLTEVTDQGGQSDFESLAQLVEAHEKNMQEAFQQAPAKPKPAPRPSYQGRRGKKTSFGPGAISDKAEITQLKDLSEDQRSAVVEGHVFKAEMQELRSGSFIFYGEMTDYTGSISFKKFVRDSDKEEIEYLKGIKPGVWIRMQGSLKDDQYAHDLIFNIYSMELTEHVGRQEAYQGEE----KHVELHVHTNMSQLDATSDVADIIKTAKKFGQPAVAITDHAGLQALPNAF-EAGKKTGMKVIMGLEANMVEDHGLLVLNPASMKYEDQEFVIFDVETTGLSSVYDTIIEIGAVKMKNGEVIDRFDKFINPHHPLSETTINLTSITDEMVQAADDEAVVIKQFMDFYGNDPLCGHN-VQFDVGFVDAALKRCGYPEISQPVVDTLEVSRLLHPEQSRHTLDSLCRKYNVPLE--HHHRANQDAEATGYLMFKLLDAFNDKYQE-DDLGKMN-DYSNGEGYKRARPTHITVLAQNQKPGLRNLYELVSLAGIKYNFKGLRTPK---SELRRLHAGLLYGSACSQGEVFIAMM---QKGYEEAKKKAEFYDFLEIQPPSNYSSLIADGLIADEAQLEEILTNIYKLGRELNKPVVATSDAHYIDKHEAIYRDVLLAAQ--RGNPNR-------NKQHPDLHFYTTQEMLDEFSFMGEDI-AKEVVISNPNKINAMIDEGVQPVQDESFPPKIPHTAERVRKLTYDKAHELYGDPLPDNIQARLDRELDAIIGNGYGVVYLISQMLVAKSVKDGYLVGSRGSVGSSLVATMMGITEINPMPPHYRCPKCKQSEFFENGEYASGFDLPDKKCPDCQVMMVKDGQNIPFETFLGFHGDKVPDIDLNFSGDYQPVAHNFIRVMFGPNHSFKAGTVGTLADKKAIGYVKHYQDEHPEIKMNNAEVDRLAIGVTGVKATTGQHPAGIVVLPDDKDIYELTPLQYPSDDISKEWKTTHFDFHQIHDNLLKFDILGHQDPTMIRMLQDLSGIDPLTIPTDDPKVMSLFSSPEALGVTPEQINS--KTGTLGLPEFGTPFVRGMLEETKPSTFAELLQISGLSHGTDVWLGNAEELINNGTCKLKNVIGCRDNIMTDLIRWGVKEEVAFSTMETVRKGKGISDENMAVLKENKNIPDWYIPSCLKIKYMFPKAHAAAYILMALRVAWFKVYYPEIYYAAYFSVRADKVDLEAMSRGKNTVVALINRIKEK-GTAATKL-----EKDLQTYMELVNEAIERGINFKMVDINESEATTYKIVDKHTILAPFNAVDGLGDSAAKQIVAARSEAPFLSKEDLQVRGKVSQKIMDFFENNNVLEGMPDQNQLSLF 1411
>gi|110799061|ref|YP_696378.1| DNA polymerase III PolC [Clostridium perfringens ATCC 13124] >gi|168211421|ref|ZP_02637046.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens B str. ATCC 3626] >gi|110673708|gb|ABG82695.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens ATCC 13124] >gi|170710571|gb|EDT22753.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens B str. ATCC 3626] (1449 aa)
Score = 2227, Expect = 0.0e+00, Identities = 508/1270 (40%), Positives = 767/1270 (60%)
  Q:   187 QEK-IKNEITEVKRSSNA--KKTDSSFTYK---------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDI---IKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI----WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           QEK +K EI++ K  SN   K      +YK           +++ GD   +S +       TI G++FK D   TKTG  I  +F+TDY+ SI +K     K  + VL  +K+G++ K +    +D Y   ++  +  +I+ ++K +   R D A  KR EL  HT M++ + +    ++ + +++ G+ +VAITD    Q FPD    AKK + +K IYGV+  + D   PIV+N ++    D  YV+FDIETTG S   DKIIE GA+K   G  V+S   F++P+  I  KI  +T I+   V     I E L K  +F+GDSVL+AHN   FD+ F+    ++N MD+   +KNP++DT+ ++R +   +    L ++A+   I  +    HRA  DA+    I    +K+M E   + D+KTLNE    L N  +++     +I +  KN+  I+NLYKL+S +    F   P++      E+    I+ ++   G++++A +          I   YD++ I   +     I +  +     + +  ++I  +  + +K VVAT D ++L+ +DEV+ R+ +  +  G   N+           P  YFRTT+E+  EF +L +     ++V+ N+  IA +++A +KPI +    P IEGA ++++ +   K +SI+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S++DGY+VGSRGSVGSS  A + DITEVN L PHY+C NCK   F  + ++ SG DLP+ NCP C +K   DGH+IPFETF+GF+GDK PDIDLNFS  YQ   H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E + +    AEI R+   C  +KRT+GQHPGGI+VVP+  ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S D+L +    +    + GS G+PEFGT FV++ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ K + P  AF IME VRKGKGL+E+ + ++ + N+P WYIESC +I Y+FPK HA AYV+MA +IA++K+YYP  +Y +YF++R   FD   I  GE  I  K+ E+     N      +  KE  L+ I E++ E+  RG  F  +DL KS AT F +E D + PP +A+ G+GD+ A SIV+ R    F SKED + R+KV+ T ++ ++  G    + E +Q+SLF
  S:   195 QEKPVKKEISDNKHKSNGGNKGGYEKKSYKDEPKNENTILGRNIQGDTIDISSIDMGSGIVTISGDVFKTDIFETKTGRIILTFFITDYTSSIAVKCFLRDKDKEHVLENVKKGLYCKVRGEATMDPYAK-EVVIMARDINKLTKIE---RMDTAEEKRVELHMHTTMSSMDAVTAASKIVERAAKFGHKAVAITDHGVVQAFPDAQIAAKK-NNIKVIYGVEGYLADNGTPIVINGHEESFDDE-YVVFDIETTGFSSKNDKIIEIGAVKLKDGEIVDSFSTFVDPKVNIPYKITELTSITQNMVNGQPTIDEVLPKFMEFVGDSVLVAHNA-AFDVGFI----KKNLMDMGKTLKNPVMDTVPLARYLYPDLKKVKLNLVAKHLGISLE--NHHRAVDDAKATAEILKFSFKKMKEEMDIHDVKTLNE--KYLSNIDVKKLPLHHII-ILAKNQTGIKNLYKLVSMAHLDYFARRPRLPKSIITEYREGLIIGSACEAGQLYKAVLEGKTDGELKEIASFYDYLEIQPIQNNEFLIRKGNVKDEEELRELNRKIYDLGKEMDKPVVATCDCHFLDPNDEVFRRIIMAGQGYGDADNQ-----------PPLYFRTTNEMMKEFEYLGEEA-CREVVIENTQKIADMVEA-VKPIPDETFPPKIEGAEEEIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSLEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPNCKKSEFFLDGSISSGADLPDKNCPDCGAKYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGKGYVFKAGTIGTVAEKTAYGFVKKYLQE-RGLVVSQAEIERLTIGCTGIKRTSGQHPGGIMVVPNDNEIYNFCPIQHPADDVNTDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDPKVISLFTSPDALGVTKEELG--CEVGSYGLPEFGTKFVRQMLVDTQPKSFADLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLMYKDLPPKTAFTIMEKVRKGKGLSEDDEALMREKNVPDWYIESCKRIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYTTYFTVRADDFDADLICKGEEAIKAKMEELNSLGNN------ISVKEKGLLTILEISYEMYKRGLNFLKVDLYKSEATKFKIEEDGIRPPLNALQGVGDNAAKSIVECRVNGEFISKEDLRLRSKVSKTVIETLDNHGCLEGMQESNQLSLF 1448
>gi|170288161|ref|YP_001738399.1| DNA polymerase III, alpha subunit [Thermotoga sp. RQ2] >gi|170175664|gb|ACB08716.1| DNA polymerase III, alpha subunit [Thermotoga sp. RQ2] (1367 aa)
Score = 2225, Expect = 0.0e+00, Identities = 493/1231 (40%), Positives = 752/1231 (61%)
  Q:   226 SDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEE------ISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNAN-DTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDE-LKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S +F   K  +++G++FKI+K+  K    +   ++TD  DS++ K          V +++++   V+ KIS+   +    D+  L+E       +  I+K  E  R DN+ +KR EL  HT  +  + + ++ E  K + E G+ +VA+TD  N Q  P FY+ AK+ + +K I+G++  ++    P++ N + D+   +AT+V+ D ETTGL P  D+IIE GA+K   G  V+     I P  +IS +   IT I+ E +++   I+E L +   F+ +S+++AHN   FD  FL   +++      + P IDTL +++++  ++  +SL  +  K  +     + HRA  DA     ++ R +E  K   I  L+EI  NL++       +    T+  +N+  ++NLYKL+S S    F G P++      E     +V ++   GE+  AA+        + I   YD+I +   +    D   E   R  +++  +R+ +IA K NK VV T D ++L+  D         A +L  + NR F+        P  Y RTT+E L+       D  +  ++V+ N N IA +I+  ++P+++ LH P IE A + ++ L  +++Y I+GD +   V+ R+++E++++I++GYA++Y  +  LV++S+ DGYVVGSRGSVGSS+ A L+ ITEVNPL PHY C  CKYF    +    +G+DLP+  CP C + LK DGH+IPFETFMGF+GDK+PDIDLNFS  YQ +AH F++ +FG++ V+RAGTI+T AEK+A GYV+SY E++ K   R AE+ R+      VKRTTGQHPGG++++P  K+VYDFTP  YPA+D+    FTTH A+E++HD L+K D LGHD+PT +KML + T ++  TIP  D + + +F+S   L +    +      G+ GIPEFGT FV+ ML+ T+P+ F++L+RISGLSHGT+VW +NA+  I      +SDVISCRDDIM +LI KG+ P +AFKIME+VRKGKG+ EE +  +    +P W+IESC +I YLFPKAHA AYV MA++IA+FK++YPL FYA+YF+I+   FD   +L G+  I  ++ E+K   A P   A  KN+    + + E+ALE++ RG+ F   D+ KS A  FL+EG+ L  PF+ + GLGDSVA SI++AREEK F+S ED  KRTKV   H+++M+ LG+   L E +Q +LF
  S:   174 SKIFEYNKKTSVKGKVFKIEKIEGKK--TVLLIYLTDGEDSLICK----------VFNDVEK---VEGKISLGDVIVATGDL--LLENGEPTLYVKGITKLPEAKRMDNSPVKRVELHAHTKFSDQDAITDVNEYVKRAKEWGFPAVALTDHGNVQAIPYFYDAAKE-AGIKPIFGIEAYLVSDVEPVIRNLSYDSSFENATFVVLDFETTGLDPQVDEIIEIGAVKIQDGQIVDEYHTLIKPSREISRRSSEITGITQEMLENKRSIEEVLPEFLGFLENSIIVAHNA-NFDYRFLRLWIKKVMGLDWERPYIDTLALAKSL-LKMRSYSLDSVVEK--LGLGPFRHHRALDDARVTAQVFLRFVEMMKKIGITKLSEI-ENLKDTIDYTALKPFHCTILVQNKKGLKNLYKLVSDSYIKYFYGVPRILKSALIENREGLLVGSACISGELGRAALEGASDSELEEIAKFYDYIEVMPLDVIAED--EEDLDRERLKEVYRRLYRIAKKLNKFVVMTGDVHFLDPED-----ARGRAALLAPQGNRNFENQ------PALYLRTTEEMLEKAMEIFEDEEIAREVVIENPNRIADMIE-EVQPLEKKLHPPIIENADEIVRNLTMKRAYEIYGDPLPEIVQKRVEKELNAIINHGYAVLYLIAQELVQKSMSDGYVVGSRGSVGSSLVANLLGITEVNPLPPHYRCPECKYFEVVEDDRYGAGYDLPDKKCPVCGAPLKKDGHDIPFETFMGFEGDKVPDIDLNFSGEYQERAHRFVEELFGKDHVYRAGTINTIAEKSAVGYVRSYEEKTGK-KLRKAEMERLVSMITGVKRTTGQHPGGLMIIPKDKEVYDFTPIQYPANDRNAGVFTTHFAYETIHDDLVKIDALGHDDPTFIKMLKDLTGIDPMTIPMDDPETLAIFSSVKPLGVDPVELES--DVGTYGIPEFGTEFVRGMLVETRPKSFAELVRISGLSHGTDVWLNNARDWINLGYAKLSDVISCRDDIMNFLIHKGMEPSLAFKIMENVRKGKGITEEMESEMRKLKVPEWFIESCKRIKYLFPKAHAVAYVSMAFRIAYFKVHYPLQFYAAYFTIKGDQFDPVLVLRGKEAIKRRLRELK---AMPAKDAQKKNE----VSVLEVALEMILRGFSFLPPDIFKSDAKKFLIEGNSLRIPFNKLPGLGDSVAESIIRAREEKPFTSVEDLMKRTKVNKNHIELMKSLGVLGDLPETEQFTLF 1367
>gi|116514304|ref|YP_813210.1| DNA polymerase III, alpha subunit ( type) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093619|gb|ABJ58772.1| DNA polymerase III, alpha subunit (gram-positive type) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (1411 aa)
Score = 2224, Expect = 0.0e+00, Identities = 506/1310 (38%), Positives = 781/1310 (59%)
  Q:   147 KKYLEHFRKFLNDYGF-SKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRK-----------SVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDV--LSELKEGVWVKAKISIQIDMYENNDITGL--IEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLE--NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGE-IRNLYKLISTS-LTSNFDG--GPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDK--YDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVD--SGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDF-LVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++ L+ F   L DYGF +   L+ + D+            ++   KN     +++    K     +Y+ R+           S   ++T+L DL  + ++A +EG +FK +    ++G  I+   +TDY+ SI  K        +++  L  +K GVW++ + S++ D Y ++ I  +  +E    + + + +   +    K  EL  HTNM+  +   ++ ++ K + + G  +VAITD    Q  P+ + EA K + +K I G++ N+++ +  +VLN    K  D  +VIFD+ETTGLS  YD IIE GA+K   G  ++    FINP   +S+    +T I++E V+ A      + +  DF G+  L  HN ++FD+ F++  L+      I  P++DTL++SR ++ +   H+L  + RKY +  +    HRA++DAE    +  ++L+  N K  +   L ++N +  N    +R R + ITV  +N+   +RNLY+L+S + +  NF G   PK         +   +  ++ ++GE+F A M   Q+  E+  K    YDF+ I  P  +   I    I     +E+ +  I K+  + NK VVATSD +Y+++ + +Y  V + A+   G  NR       N   P  +F TT E+ DEFSF+ + +   ++V++N N I ++ID  ++P+++    P I   ++++++L Y K++ ++GD + ++++AR+DRE+ ++I NGY ++Y  S +LV +SV DGY+VGSRGSVGSS+ A ++ ITE+NP+ PHY C  CK   F +N +  SGFDLP+  CP C+  +  DG NIPFETF+GF GDK+PDIDLNFS  YQ  AH+FI+ MFG    F+AGT+ T A+K A GYVK Y +E  ++   NAE+ R+A     VK TTGQHP GIVV+P  KD+Y+ TP  YP+DD +++W TTH  F  +HD+LLKFDILGH +PT+++ML + + ++  TIP  D  VM LF+S ++L +    IN   KTG+ G+PEFGT FV+ ML  TKP  F++L++ISGLSHGT+VW  NA+ LI      +  VI CRD+IM  LI  G+   +AF  ME VRKGKG+++E   VL +N NIP WYI SC KI Y+FPKAHA AY++MA ++AWFK+YYP  +YA+YFS+R    D++++  G++ +   IN IKEK     TK      E DL    EL  E + RG  F  +D+ +S AT + +V+   ++ PF+A+DGLGDS A  IV AR E  F SKED + R KV+   M   E   +   + + +Q+SLF
  S:   107 QRLLDSFSLELRDYGFFNVKLLTEVTDQSGQSDFESLAQLVEAHEKNMQEAFQQAPAKPKPAPRPSYQGRRGKKTSFGPGAISDKAEITQLKDLSEDQRSAVVEGHVFKAEMQELRSGSFIFYGEMTDYTGSISFKKFVRDSDKEEIEYLKGIKPGVWIRMQGSLKDDQYAHDLIFNIYSMELTEHVGRQEAYQGEE----KHVELHVHTNMSQLDATSDVADIIKTAKKFGQQAVAITDHAGLQALPNAF-EAGKKTGMKVIMGLEANMVEDHGLLVLNPASMKYEDQEFVIFDVETTGLSSVYDTIIEIGAVKMKNGEVIDRFDKFINPHHPLSETTINLTSITDEMVQAADDEAVVIKQFMDFYGNDPLCGHN-VQFDVGFVDAALKRCGYPEISQPVVDTLEVSRLLHPEQSRHTLDSLCRKYNVALE--HHHRANQDAEATGYLMFKLLDAFNDKYHE-DDLGKMN-DYSNGEGYKRARPTHITVLAQNQKPGLRNLYELVSLAGIKYNFKGLRTPK---SELRRLHAGLLYGSACSQGEVFIAMM---QKGYEEAKKKAEFYDFLEIQPPSNYSSLIADGLIADEAQLEEILTNIYKLGKELNKPVVATSDAHYIDKHEAIYRDVLLAAQ--RGNPNR-------NKQHPDLHFYTTQEMLDEFSFMGEDI-AKEVVISNPNKINAMIDEGVQPVQDESFPPKIPHTAERVRKLTYDKAHELYGDPLPDNIQARLDRELDAIIGNGYGVVYLISQMLVAKSVKDGYLVGSRGSVGSSLVATMMGITEINPMPPHYRCPKCKQSEFFENGEYASGFDLPDKKCPDCQVMMVKDGQNIPFETFLGFHGDKVPDIDLNFSGDYQPVAHNFIRVMFGPNHSFKAGTVGTLADKKAIGYVKHYQDEHPEIKMNNAEVDRLAIGVTGVKATTGQHPAGIVVLPDDKDIYELTPLQYPSDDISKEWKTTHFDFHQIHDNLLKFDILGHQDPTMIRMLQDLSGIDPLTIPTDDPKVMSLFSSPEALGVTPEQINS--KTGTLGLPEFGTPFVRGMLEETKPSTFAELLQISGLSHGTDVWLGNAEELINNGTCKLKSVIGCRDNIMTDLIRWGVKEEVAFSTMETVRKGKGISDENMAVLKENKNIPDWYIPSCLKIKYMFPKAHAAAYILMALRVAWFKVYYPEIYYAAYFSVRADKVDLEAMSRGKNTVVALINRIKEK-GTAATKL-----EKDLQTYMELVNEAIERGINFKMVDINESEATTYKIVDKHTILAPFNAVDGLGDSAAKQIVAARSEAPFLSKEDLQVRGKVSQKIMDFFENNNVLEGMPDQNQLSLF 1411
>gi|148269487|ref|YP_001243947.1| DNA polymerase III PolC [Thermotoga petrophila RKU-1] >gi|166217457|sp|A5IJJ8|DPO3_THEP1 DNA polymerase III polC-type (PolIII) >gi|147735031|gb|ABQ46371.1| DNA polymerase III catalytic subunit, PolC type [Thermotoga petrophila RKU-1] (1367 aa)
Score = 2223, Expect = 0.0e+00, Identities = 494/1231 (40%), Positives = 749/1231 (60%)
  Q:   226 SDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEE------ISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNAN-DTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDE-LKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S +F   K  +++G++FKI+K+  K    +   ++TD  DS++ K          V +++++   V+ KIS+   +    D+  L+E       +  I+K  E  R DN+ +KR EL  HT  +  + + ++ E  K + E G+ +VA+TD  N Q  P FY+ AK+ + +K I+G++  ++    P++ N + D+   +AT+V+ D ETTGL P  D+IIE GA+K   G  V+     I P  +IS +   IT I+ E +++   I+E L +   F+ +S+++AHN   FD  FL   +++      + P IDTL +++++  ++  +SL  +  K  +     + HRA  DA     ++ R +E  K   I  L+EI  NL++       +    T+  +N+  ++NLYKL+S S    F G P++      E     +V ++   GE+  AA+        + I   YD+I +   +    D   E   R  +++  +R+ +IA K NK VV T D ++L+  D         A +L  + NR F+        P  Y RTT+E L+       D  +  ++V+ N N IA +I+  ++P+++ LH P IE A + ++ L  +++Y I+GD +   V+ R++RE++++I++GYA++Y  +  LV++S+ DGYVVGSRGSVGSS+ A L+ ITEVNPL PHY C  CKYF    +    +G+DLP+  CP C + L+ DGH+IPFETFMGF+GDK+PDIDLNFS  YQ +AH F++ +FG++ V+RAGTI+T AEK+A GYV+SY E++ K   R AE+ R+      VKRTTGQHPGG++++P  K+VYDFTP  YPA+D+    FTTH A+E++HD L+K D LGHD+PT +KML + T ++  TIP  D D + +F+S   L +    +      G+ GIPEFGT FV+ ML+ T+P+ F++L+RISGLSHGT+VW +NA+  I      +SDVISCRDDIM +LI KG+ P +AFKIME+VRKGKG+ EE +  +    +P W+IESC +I YLFPKAHA AYV MA++IA+FK++YPL FYA+YF+I+   FD   +L G+  I  ++ E+K        K   KN+E     + E+ LE++ RG+ F   D+ KS A  FL+EG+ L  PF+ + GLGDSVA SIV+AREEK F+S ED  KRTKV   H+++M  LG+  SL E +Q +LF
  S:   174 SKIFEYNKKTSVKGKVFKIEKIEGKK--TVLLIYLTDGEDSLICK----------VFNDVEK---VEGKISLGDVIVATGDL--LLENGEPTLYVKGITKLPEAKRMDNSPVKRVELHAHTKFSDQDAITDVNEYVKRAKEWGFPAVALTDHGNVQAIPYFYDAAKE-AGIKPIFGIEAYLVSDVEPVIRNLSYDSSFENATFVVLDFETTGLDPQVDEIIEIGAVKIQDGQIVDEYHTLIKPSREISRRSSEITGITQEMLENKRSIEEVLPEFLGFLENSIIVAHNA-NFDYRFLRLWIKKVMGLDWERPYIDTLALAKSL-LKMRSYSLDSVVEK--LGLGPFRHHRALDDARVTAQVFLRFVEMMKKIGITKLSEI-ENLKDTIDYTALKPFHCTILVQNKKGLKNLYKLVSDSYIKYFYGVPRILKSALIENREGLLVGSACISGELGRAALEGASDSELEEIAKFYDYIEVMPLDVIAED--EEDLDRERLKEVYRRLYRIAKKLNKFVVMTGDVHFLDPED-----ARGRAALLAPQGNRNFENQ------PALYLRTTEEMLEKAMEIFEDEEIAREVVIENPNRIADMIE-EVQPLEKKLHPPIIENADEIVRSLTMKRAYEIYGDPLPEIVQKRVERELNAIINHGYAVLYLIAQELVQKSMSDGYVVGSRGSVGSSLVANLLGITEVNPLPPHYRCPECKYFKVVEDDRYGAGYDLPDKKCPVCGAPLRKDGHDIPFETFMGFEGDKVPDIDLNFSGEYQERAHRFVEELFGKDHVYRAGTINTIAEKSAVGYVRSYEEKTGK-KLRKAEMERLVSMITGVKRTTGQHPGGLMIIPKDKEVYDFTPIQYPANDRNAGVFTTHFAYETIHDDLVKIDALGHDDPTFIKMLKDLTGIDPMTIPMDDPDTLAIFSSVKPLGVDPVELES--DVGTYGIPEFGTEFVRGMLVETRPKSFAELVRISGLSHGTDVWLNNARDWINLGYAKLSDVISCRDDIMNFLIHKGMEPSLAFKIMENVRKGKGITEEMESEMRKLKVPEWFIESCKRIKYLFPKAHAVAYVSMAFRIAYFKVHYPLQFYAAYFTIKGDQFDPVLVLKGKEAIKRRLRELKAMTGKDVQK---KNEE----SVLEVVLEMILRGFSFLPPDIFKSDAKKFLIEGNSLRIPFNKLPGLGDSVAESIVRAREEKPFTSVEDLMKRTKVNKNHIELMRSLGVLGSLPETEQFTLF 1367
>gi|168208108|ref|ZP_02634113.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens E str. JGS1987] >gi|170660599|gb|EDT13282.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens E str. JGS1987] (1449 aa)
Score = 2223, Expect = 0.0e+00, Identities = 496/1241 (39%), Positives = 752/1241 (60%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDI---IKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI----WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++ GD   +S +       TI G++FK D   TKTG  I  +F+TDY+ SI +K     K  + VL  +K+G++ K +    +D Y   ++  +  +I+ ++K +   R D A  KR EL  HT M++ + +    ++ + +++ G+ +VAITD    Q FPD    AKK + +K IYGV+  + D   PIV+N ++    D  YV+FDIETTG S   DKIIE GA+K   G  V+S   F++P+  I  KI  +T I+   V     I E L K  +F+GDSVL+AHN   FD+ F+    ++N MD+   +KNP++DT+ ++R +   +    L ++A+   I  +    HRA  DA+    I    +K+M E   + D+KTLNE    L N  +++     +I +  KN+  I+NLYKL+S +    F   P++      E+    I+ ++   G++++A +          I   YD++ I   +     I +  +     + +  ++I  +  + +K VVAT D ++L+ +DEV+ R+ +  +  G   N+           P  YFRTT+E+  EF +L +     ++V+ N+  IA +++A +KPI +    P IEGA ++++ +   K +SI+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S++DGY+VGSRGSVGSS  A + DITEVN L PHY+C NCK   F  + ++ SG DLP+ NCP+C +K   DGH+IPFETF+GF+GDK PDIDLNFS  YQ   H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E + +    AEI R+   C  +KRT+GQHPGGI+VVP+  ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S D+L +    +    + GS G+PEFGT FV++ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ K + P  AF IME VRKGKGL+E+ + ++ + N+P WYIESC +I Y+FPK HA AYV+MA +IA++K+YYP  +Y +YF++R   FD   I  GE  I  K+ E+     N      +  KE  L+ I E++ E+  RG  F  +DL KS AT F +E D + PP +A+ G+GD+ A SIV+ R    F SKED + R+KV+ T ++ ++  G    + E +Q+SLF
  S:   236 RNIQGDTIDISSIDMGSGIVTISGDVFKTDIFETKTGRIILTFFITDYTSSIAVKCFLRDKDKEHVLENVKKGLYCKVRGEATMDPYAK-EVVIMARDINKLTKIE---RMDTAEEKRVELHMHTTMSSMDAVTAASKIVERAAKFGHKAVAITDHGVVQAFPDAQIAAKK-NNIKVIYGVEGYLADNGTPIVINGHEESFDDE-YVVFDIETTGFSSKNDKIIEIGAVKLKDGEIVDSFSTFVDPKVNIPYKITELTSITQNMVNGQPTIDEVLPKFMEFVGDSVLVAHNA-AFDVGFI----KKNLMDMGKTLKNPVMDTVPLARYLYPDLKKVKLNLVAKHLGISLE--NHHRAVDDAKATAEILKFSFKKMKEEMDIHDVKTLNE--KYLSNIDVKKLPLHHII-ILAKNQTGIKNLYKLVSMAHLDYFARRPRLPKSIITEYREGLIIGSACEAGQLYKAVLEGKTDGELKEIASFYDYLEIQPIQNNEFLIRKGNVKDEDELRELNRKIYDLGKEMDKPVVATCDCHFLDPNDEVFRRIIMAGQGYGDADNQ-----------PPLYFRTTNEMMKEFEYLGEEA-CREVVIENTQKIADMVEA-VKPIPDETFPPKIEGAEEEIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSLEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPNCKKSEFFLDGSISSGADLPDKNCPECGTKYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGKGYVFKAGTIGTVAEKTAYGFVKKYLQE-RGLVVSQAEIERLTIGCTGIKRTSGQHPGGIMVVPNDNEIYNFCPIQHPADDVNTDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDPKVISLFTSPDALGVTKEELG--CEVGSYGLPEFGTKFVRQMLVDTQPKSFADLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLMYKDLPPKTAFTIMEKVRKGKGLSEDDEALMREKNVPDWYIESCKRIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYTTYFTVRADDFDADLICKGEEAIKAKMEELNSLGNN------ISVKEKGLLTILEISYEMYKRGLNFLKVDLYKSEATKFKIEEDGIRPPLNALQGVGDNAAKSIVECRINGEFISKEDLRIRSKVSKTVIETLDNHGCLEGMQESNQLSLF 1448
>gi|110801936|ref|YP_698978.1| DNA polymerase III PolC [Clostridium perfringens SM101] >gi|110682437|gb|ABG85807.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens SM101] (1449 aa)
Score = 2220, Expect = 0.0e+00, Identities = 496/1241 (39%), Positives = 751/1241 (60%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDI---IKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI----WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++ GD   +S +       TI G++FK D   TKTG  I  +F+TDY+ SI +K     K  + VL  +K+G++ K +    +D Y   ++  +  +I+ ++K +   R D A  KR EL  HT M++ + +    ++ + +++ G+ +VAITD    Q FPD    AKK + +K IYGV+  + D   PIV+N ++    D  YV+FDIETTG S   DKIIE GA+K   G  V+S   F++P+  I  KI  +T I+   V     I E L K  +F+G+SVL+AHN   FD+ F+    ++N MD+   +KNP++DT+ ++R +   +    L ++A+   I  +    HRA  DA+    I    +K+M E   + D+KTLNE    L N  +++     +I +  KN+  I+NLYKL+S +    F   P++      E+    I+ ++   G++++A +          I   YD++ I   +     I +  +     + +  ++I  +  + +K VVAT D ++L+ +DEV+ R+ +  +  G   N+           P  YFRTT+E+  EF +L +     ++V+ N+  IA +++A +KPI +    P IEGA ++++ +   K +SI+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S++DGY+VGSRGSVGSS  A + DITEVN L PHY+C NCK   F  + ++ SG DLP+ NCP C +K   DGH+IPFETF+GF+GDK PDIDLNFS  YQ   H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E + +    AEI R+   C  +KRT+GQHPGGI+VVP+  ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S D+L +    +    + GS G+PEFGT FV++ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ K + P  AF IME VRKGKGL+EE + ++ + N+P WYIESC +I Y+FPK HA AYV+MA +IA++K+YYP  +Y +YF++R   FD   I  GE  I  K+ E+     N      +  KE  L+ I E++ E+  RG  F  +DL KS AT F +E D + PP +A+ G+GD+ A SIV+ R    F SKED + R+KV+ T ++ ++  G    + E +Q+SLF
  S:   236 RNIQGDTIDISSIDMGSGIVTISGDVFKTDIFETKTGRIILTFFITDYTSSIAVKCFLRDKDKEHVLENVKKGLYCKVRGEATMDPYAK-EVVIMARDINKLTKIE---RMDTAEEKRVELHMHTTMSSMDAVTAASKIVERAAKFGHKAVAITDHGVVQAFPDAQIAAKK-NNIKVIYGVEGYLADNGTPIVINGHEESFDDE-YVVFDIETTGFSSKNDKIIEIGAVKLKDGEIVDSFSTFVDPKVNIPYKITELTSITQNMVNGQPTIDEVLPKFMEFVGNSVLVAHNA-AFDVGFI----KKNLMDMGKTLKNPVMDTVPLARYLYPDLKKVKLNLVAKHLGISLE--NHHRAVDDAKATAEILKFSFKKMKEEMDIHDVKTLNE--KYLSNIDVKKLPLHHII-ILAKNQTGIKNLYKLVSMAHLDYFARRPRLPKSIITEYREGLIIGSACEAGQLYKAVLEGKTDGELKEIASFYDYLEIQPIQNNEFLIRKGNVKDEEELRELNRKIYDLGKEMDKPVVATCDCHFLDPNDEVFRRIIMAGQGYGDADNQ-----------PPLYFRTTNEMMKEFEYLGEEA-CREVVIENTQKIADMVEA-VKPIPDETFPPKIEGAEEEIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSLEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPNCKKSEFFLDGSISSGADLPDKNCPDCGTKYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGKGYVFKAGTIGTVAEKTAYGFVKKYLQE-RGLVVSQAEIERLTIGCTGIKRTSGQHPGGIMVVPNDNEIYNFCPIQHPADDVNTDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDPKVISLFTSPDALGVTKEELG--CEVGSYGLPEFGTKFVRQMLVDTQPKSFADLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLMYKDLPPKTAFTIMEKVRKGKGLSEEDEALMREKNVPDWYIESCKRIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYTTYFTVRADDFDADLICKGEEAIKAKMEELNSLGNN------ISVKEKGLLTILEISYEMYKRGLNFLKVDLYKSEATKFKIEEDGIRPPLNALQGVGDNAAKSIVECRVNGEFISKEDLRIRSKVSKTVIETLDNHGCLEGMQESNQLSLF 1448
>gi|18310673|ref|NP_562607.1| DNA polymerase III PolC [Clostridium perfringens str. 13] >gi|168214476|ref|ZP_02640101.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens CPE str. F4969] >gi|24418366|sp|Q8XJR3|DPO3_CLOPE DNA polymerase III polC-type (PolIII) >gi|18145354|dbj|BAB81397.1| DNA polymerase III alpha subunit [Clostridium perfringens str. 13] >gi|170714031|gb|EDT26213.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens CPE str. F4969] (1449 aa)
Score = 2220, Expect = 0.0e+00, Identities = 496/1241 (39%), Positives = 751/1241 (60%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDI---IKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI----WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++ GD   +S +       TI G++FK D   TKTG  I  +F+TDY+ SI +K     K  + VL  +K+G++ K +    +D Y   ++  +  +I+ ++K +   R D A  KR EL  HT M++ + +    ++ + +++ G+ +VAITD    Q FPD    AKK + +K IYGV+  + D   PIV+N ++    D  YV+FDIETTG S   DKIIE GA+K   G  V+S   F++P+  I  KI  +T I+   V     I E L K  +F+G+SVL+AHN   FD+ F+    ++N MD+   +KNP++DT+ ++R +   +    L ++A+   I  +    HRA  DA+    I    +K+M E   + D+KTLNE    L N  +++     +I +  KN+  I+NLYKL+S +    F   P++      E+    I+ ++   G++++A +          I   YD++ I   +     I +  +     + +  ++I  +  + +K VVAT D ++L+ +DEV+ R+ +  +  G   N+           P  YFRTT+E+  EF +L +     ++V+ N+  IA +++A +KPI +    P IEGA ++++ +   K +SI+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S++DGY+VGSRGSVGSS  A + DITEVN L PHY+C NCK   F  + ++ SG DLP+ NCP C +K   DGH+IPFETF+GF+GDK PDIDLNFS  YQ   H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E + +    AEI R+   C  +KRT+GQHPGGI+VVP+  ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S D+L +    +    + GS G+PEFGT FV++ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ K + P  AF IME VRKGKGL+EE + ++ + N+P WYIESC +I Y+FPK HA AYV+MA +IA++K+YYP  +Y +YF++R   FD   I  GE  I  K+ E+     N      +  KE  L+ I E++ E+  RG  F  +DL KS AT F +E D + PP +A+ G+GD+ A SIV+ R    F SKED + R+KV+ T ++ ++  G    + E +Q+SLF
  S:   236 RNIQGDTIDISSIDMGSGIVTISGDVFKTDIFETKTGRIILTFFITDYTSSIAVKCFLRDKDKEHVLENVKKGLYCKVRGEATMDPYAK-EVVIMARDINKLTKIE---RMDTAEEKRVELHMHTTMSSMDAVTAASKIVERAAKFGHKAVAITDHGVVQAFPDAQIAAKK-NNIKVIYGVEGYLADNGTPIVINGHEESFDDE-YVVFDIETTGFSSKNDKIIEIGAVKLKDGEIVDSFSTFVDPKVNIPYKITELTSITQNMVNGQPTIDEVLPKFMEFVGNSVLVAHNA-AFDVGFI----KKNLMDMGKTLKNPVMDTVPLARYLYPDLKKVKLNLVAKHLGISLE--NHHRAVDDAKATAEILKFSFKKMKEEMDIHDVKTLNE--KYLSNIDVKKLPLHHII-ILAKNQTGIKNLYKLVSMAHLDYFARRPRLPKSIITEYREGLIIGSACEAGQLYKAVLEGKTDGELKEIASFYDYLEIQPIQNNEFLIRKGNVKDEEELRELNRKIYDLGKEMDKPVVATCDCHFLDPNDEVFRRIIMAGQGYGDADNQ-----------PPLYFRTTNEMMKEFEYLGEEA-CREVVIENTQKIADMVEA-VKPIPDETFPPKIEGAEEEIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSLEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPNCKKSEFFLDGSISSGADLPDKNCPDCGAKYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGKGYVFKAGTIGTVAEKTAYGFVKKYLQE-RGLVVSQAEIERLTIGCTGIKRTSGQHPGGIMVVPNDNEIYNFCPIQHPADDVNTDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDPKVISLFTSPDALGVTKEELG--CEVGSYGLPEFGTKFVRQMLVDTQPKSFADLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLMYKDLPPKTAFTIMEKVRKGKGLSEEDEALMREKNVPDWYIESCKRIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYTTYFTVRADDFDADLICKGEEAIKAKMEELNSLGNN------ISVKEKGLLTILEISYEMYKRGLNFLKVDLYKSEATKFKIEEDGIRPPLNALQGVGDNAAKSIVECRVNGEFISKEDLRLRSKVSKTVIETLDNHGCLEGMQESNQLSLF 1448
>gi|169342745|ref|ZP_02863785.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens C str. JGS1495] >gi|169299251|gb|EDS81321.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens C str. JGS1495] (1449 aa)
Score = 2215, Expect = 0.0e+00, Identities = 494/1241 (39%), Positives = 752/1241 (60%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDI---IKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI----WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++ GD   +S +       TI G++FK D   TKTG  I  +F+TDY+ SI +K     K  + VL  +K+G++ K +    +D Y   ++  +  +I+ ++K +   R D +  KR EL  HT M++ + +    ++ + +++ G+ +VAITD    Q FPD    AKK + +K IYGV+  + D   PIV++ ++    D  YV+FDIETTG S   DKIIE GA+K   G  V+S   F++P+  I  KI  +T I+   V     I E L K  +F+GDSVL+AHN   FD+ F+    ++N MD+   +KNP++DT+ ++R +   +    L ++A+   I  +    HRA  DA+    I    +K+M E   + D+KTLNE    L N  +++     +I +  KN+  I+NLYKL+S +    F   P++      E+    I+ ++   G++++A +          I   YD++ I   +     I +  +     + +  ++I  +  + +K VVAT D ++L+ +DEV+ R+ +  +  G   N+           P  YFRTT+E+  EF +L +     ++V+ N+  IA +++A +KPI +    P IEGA ++++ +   K +SI+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S++DGY+VGSRGSVGSS  A + DITEVN L PHY+C NCK   F  + ++ SG DLP+ NCP+C +K   DGH+IPFETF+GF+GDK PDIDLNFS  YQ   H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E + +    AEI R+   C  +KRT+GQHPGGI+VVP+  ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S D+L +    +    + GS G+PEFGT FV++ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ K + P  AF IME VRKGKGL+E+ + ++ + N+P WYIESC +I Y+FPK HA AYV+MA +IA++K+YYP  +Y +YF++R   FD   I  GE  I  K+ E+     N      +  KE  L+ I E++ E+  RG  F  +DL KS AT F +E D + PP +A+ G+GD+ A SIV+ R    F SKED + R+KV+ T ++ ++  G    + E +Q+SLF
  S:   236 RNIQGDTIDISSIDMGSGIVTISGDVFKTDIFETKTGRIILTFFITDYTSSIAVKCFLRDKDKEHVLENVKKGLYCKVRGEATMDPYAK-EVVIMARDINKLTKIE---RMDTSEEKRVELHMHTTMSSMDAVTAASKIVERAAKFGHKAVAITDHGVVQAFPDAQIAAKK-NNIKVIYGVEGYLADNGTPIVISGHEESFDDE-YVVFDIETTGFSSKNDKIIEIGAVKLKDGEIVDSFSTFVDPKVNIPYKITELTSITQNMVNGQPTIDEVLPKFMEFVGDSVLVAHNA-AFDVGFI----KKNLMDMGKTLKNPVMDTVPLARYLYPDLKKVKLNLVAKHLGISLE--NHHRAVDDAKATAEILKFSFKKMKEEMDIHDVKTLNE--KYLSNIDVKKLPLHHII-ILAKNQTGIKNLYKLVSMAHLDYFARRPRLPKSIITEYREGLIIGSACEAGQLYKAVLEGKTDGELKEIASFYDYLEIQPIQNNEFLIRKGNVKDEEELRELNRKIYDLGKEMDKPVVATCDCHFLDPNDEVFRRIIMAGQGYGDADNQ-----------PPLYFRTTNEMMKEFEYLGEEA-CREVVIENTQKIADMVEA-VKPIPDETFPPKIEGAEEEIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSLEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPNCKKSEFFLDGSISSGADLPDKNCPECGTKYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGKGYVFKAGTIGTVAEKTAYGFVKKYLQE-RGLVVSQAEIERLTIGCTGIKRTSGQHPGGIMVVPNDNEIYNFCPIQHPADDVNTDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDPKVISLFTSPDALGVTKEELG--CEVGSYGLPEFGTKFVRQMLVDTQPKSFADLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLMYKDLPPKTAFTIMEKVRKGKGLSEDDEALMREKNVPDWYIESCKRIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYTTYFTVRADDFDADLICKGEEAIKAKMEELNSLGNN------ISVKEKGLLTILEISYEMYKRGLNFLKVDLYKSEATKFKIEEDGIRPPLNALQGVGDNAAKSIVECRVNGEFISKEDLRIRSKVSKTVIETLDNHGCLEGMQESNQLSLF 1448
>gi|168216978|ref|ZP_02642603.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens NCTC 8239] >gi|182380934|gb|EDT78413.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium perfringens NCTC 8239] (1449 aa)
Score = 2214, Expect = 0.0e+00, Identities = 494/1241 (39%), Positives = 751/1241 (60%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDI---IKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI----WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +++ GD   +S +       TI G++FK D   TKTG  I  +F+TDY+ SI +K     K  + VL  +K+G++ K +    +D Y   ++  +  +I+ ++K +   R D A  KR EL  HT M++ + +    ++ + +++ G+ +VAITD    Q FPD    AKK + +K IYGV+  + D   PIV++ ++    D  YV+FDIETTG S   DKIIE GA+K   G  V+S   F++P+  I  KI  +T I+   V     I E L K  +F+GDSVL+AHN   FD+ F+    ++N MD+   +KNP++DT+ ++R +   +    L ++A+   I  +    HRA  DA+    I    +K+M E   + D+KTLNE    L N  +++     +I +  KN+  I+NLYKL+S +    F   P++      E+    I+ ++   G++++A +          I   YD++ I   +     I +  +     + +  ++I  +  + +K VVAT D ++L+ +DEV+ R+ +  +  G   N+           P  YFRTT+E+  EF +L +     ++V+ N+  IA +++A +KPI +    P IEGA ++++ +   K +SI+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S++DGY+VGSRGSVGSS  A + DITEVN L PHY+C NCK   F  + ++ SG DLP+ NCP C +K   DGH+IPFETF+GF+GDK PDIDLNFS  YQ   H + + +FG+  VF+AGTI T AEKTAYG+VK Y +E + +    AEI R+   C  +KRT+GQHPGGI+VVP+  ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S D+L +    +    + GS G+PEFGT FV++ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ K + P  AF IME VRKGKGL+E+ + ++ + N+P WYIESC +I Y+FPK HA AYV+MA +IA++K+YYP  +Y +YF++R   FD   I  GE  I  K+ E+     N      +  KE  L+ I E++ E+  RG  F  +DL KS AT F +E D + PP +A+ G+GD+ A +IV+ R    F SKED + R+KV+ T ++ ++  G    + E +Q+SLF
  S:   236 RNIQGDTIDISSIDMGSGIVTISGDVFKTDIFETKTGRIILTFFITDYTSSIAVKCFLRDKDKEHVLENVKKGLYCKVRGEATMDPYAK-EVVIMARDINKLTKIE---RMDTAEEKRVELHMHTTMSSMDAVTAASKIVERAAKFGHKAVAITDHGVVQAFPDAQIAAKK-NNIKVIYGVEGYLADNGTPIVISGHEESFDDE-YVVFDIETTGFSSKNDKIIEIGAVKLKDGEIVDSFSTFVDPKVNIPYKITELTSITQNMVNGQPTIDEVLPKFMEFVGDSVLVAHNA-AFDVGFI----KKNLMDMGKTLKNPVMDTVPLARYLYPDLKKVKLNLVAKHLGISLE--NHHRAVDDAKATAEILKFSFKKMKEEMDIHDVKTLNE--KYLSNIDVKKLPLHHII-ILAKNQTGIKNLYKLVSMAHLDYFARRPRLPKSIITEYREGLIIGSACEAGQLYKAVLEGKTDGELKEIASFYDYLEIQPIQNNEFLIRKGNVKDEDELRELNRKIYDLGKEMDKPVVATCDCHFLDPNDEVFRRIIMAGQGYGDADNQ-----------PPLYFRTTNEMMKEFEYLGEEA-CREVVIENTQKIADMVEA-VKPIPDETFPPKIEGAEEEIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSLEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPNCKKSEFFLDGSISSGADLPDKNCPDCGAKYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGKGYVFKAGTIGTVAEKTAYGFVKKYLQE-RGLVVSQAEIERLTIGCTGIKRTSGQHPGGIMVVPNDNEIYNFCPIQHPADDVNTDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDPKVISLFTSPDALGVTKEELG--CEVGSYGLPEFGTKFVRQMLVDTQPKSFADLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLMYKDLPPKTAFTIMEKVRKGKGLSEDDEALMREKNVPDWYIESCKRIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYTTYFTVRADDFDADLICKGEEAIKAKMEELNSLGNN------ISVKEKGLLTILEISYEMYKRGLNFLKVDLYKSEATKFKIEEDGIRPPLNALQGVGDNAAKTIVECRVNGEFISKEDLRLRSKVSKTVIETLDNHGCLEGMQESNQLSLF 1448
>gi|15643342|ref|NP_228386.1| DNA polymerase III PolC [Thermotoga maritima MSB8] >gi|6225287|sp|Q9ZHF6|DPO3_THEMA DNA polymerase III polC-type (PolIII) >gi|4981093|gb|AAD35661.1|AE001732_6 DNA polymerase III, alpha subunit [Thermotoga maritima MSB8] >gi|3930535|gb|AAC80438.1| DNA polymerase III; family C DNA polymerase [Thermotoga maritima] (1367 aa)
Score = 2205, Expect = 0.0e+00, Identities = 490/1231 (39%), Positives = 750/1231 (60%)
  Q:   226 SDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEE------ISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLN-ANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDE-LKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           S +F   K  +++G+IFKI+K+  K    +   ++TD  DS++ K          V +++++   V+ K+S+   +    D+  L+E       +  I+K  E  R D + +KR EL  HT  +  + + ++ E  K + E G+ ++A+TD  N Q  P FY+ AK+ + +K I+G++  ++    P++ N ++D+   DAT+V+ D ETTGL P  D+IIE GA+K   G  V+     I P  +IS K   IT I+ E +++   I+E L +   F+ DS+++AHN   FD  FL   +++      + P IDTL +++++ +    +SL  +  K  +     + HRA  DA     ++ R +E  K   I  L+E+   L++       +    T+  +N+  ++NLYKL+S S    F G P++      E     +V ++   GE+  AA+        + I   YD+I +   +    D   E   R  +++  +++ +IA K NK VV T D ++L+  D         A +L  + NR F+        P  Y RTT+E L+       D  +  ++V+ N N IA +I+  ++P+++ LH P IE A + ++ L  +++Y I+GD +   V+ R+++E++++I++GYA++Y  +  LV++S+ DGYVVGSRGSVGSS+ A L+ ITEVNPL PHY C  CKYF    +    +G+DLP  NCP+C + L+ DGH IPFETFMGF+GDK+PDIDLNFS  YQ +AH F++ +FG++ V+RAGTI+T AE++A GYV+SY E++ K   R AE+ R+      VKRTTGQHPGG++++P  K+VYDFTP  YPA+D+    FTTH A+E++HD L+K D LGHD+PT +KML + T ++  TIP  D D + +F+S   L +    +      G+ GIPEFGT FV+ ML+ T+P+ F++L+RISGLSHGT+VW +NA+  I      +S+VISCRDDIM +LI KG+ P +AFKIME+VRKGKG+ EE +  +    +P W+IESC +I YLFPKAHA AYV MA++IA+FK++YPL FYA+YF+I+   FD   +L G+  I  ++ E+K   A P   A  KN+    + + E+ALE++ RG+ F   D+ KS A  FL+EG+ L  PF+ + GLGDSVA SI++AREEK F+S ED  KRTKV   H+++M+ LG+   L E +Q +LF
  S:   174 SKIFEYNKKTSVKGKIFKIEKIEGKR--TVLLIYLTDGEDSLICK----------VFNDVEK---VEGKVSVGDVIVATGDL--LLENGEPTLYVKGITKLPEAKRMDKSPVKRVELHAHTKFSDQDAITDVNEYVKRAKEWGFPAIALTDHGNVQAIPYFYDAAKE-AGIKPIFGIEAYLVSDVEPVIRNLSDDSTFGDATFVVLDFETTGLDPQVDEIIEIGAVKIQGGQIVDEYHTLIKPSREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNA-NFDYRFLRLWIKKVMGLDWERPYIDTLALAKSLLKL-RSYSLDSVVEK--LGLGPFRHHRALDDARVTAQVFLRFVEMMKKIGITKLSEM-EKLKDTIDYTALKPFHCTILVQNKKGLKNLYKLVSDSYIKYFYGVPRILKSELIENREGLLVGSACISGELGRAALEGASDSELEEIAKFYDYIEVMPLDVIAED--EEDLDRERLKEVYRKLYRIAKKLNKFVVMTGDVHFLDPED-----ARGRAALLAPQGNRNFENQ------PALYLRTTEEMLEKAIEIFEDEEIAREVVIENPNRIADMIE-EVQPLEKKLHPPIIENADEIVRNLTMKRAYEIYGDPLPEIVQKRVEKELNAIINHGYAVLYLIAQELVQKSMSDGYVVGSRGSVGSSLVANLLGITEVNPLPPHYRCPECKYFEVVEDDRYGAGYDLPNKNCPRCGAPLRKDGHGIPFETFMGFEGDKVPDIDLNFSGEYQERAHRFVEELFGKDHVYRAGTINTIAERSAVGYVRSYEEKTGK-KLRKAEMERLVSMITGVKRTTGQHPGGLMIIPKDKEVYDFTPIQYPANDRNAGVFTTHFAYETIHDDLVKIDALGHDDPTFIKMLKDLTGIDPMTIPMDDPDTLAIFSSVKPLGVDPVELES--DVGTYGIPEFGTEFVRGMLVETRPKSFAELVRISGLSHGTDVWLNNARDWINLGYAKLSEVISCRDDIMNFLIHKGMEPSLAFKIMENVRKGKGITEEMESEMRRLKVPEWFIESCKRIKYLFPKAHAVAYVSMAFRIAYFKVHYPLQFYAAYFTIKGDQFDPVLVLRGKEAIKRRLRELK---AMPAKDAQKKNE----VSVLEVALEMILRGFSFLPPDIFKSDAKKFLIEGNSLRIPFNKLPGLGDSVAESIIRAREEKPFTSVEDLMKRTKVNKNHIELMKSLGVLGDLPETEQFTLF 1367
>gi|153954051|ref|YP_001394816.1| DNA polymerase III PolC [Clostridium kluyveri DSM 555] >gi|146346932|gb|EDK33468.1| PolC [Clostridium kluyveri DSM 555] (1439 aa)
Score = 2204, Expect = 0.0e+00, Identities = 522/1320 (39%), Positives = 785/1320 (59%)
  Q:   137 YLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDI---IKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMS-NTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKR-GWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           YLE   E+  KKY+E+  K+  D  F K              IS    KI+E       +V R  N  + +     K    V  ++  ++D+    KT  I+G+IFK + + TKTG +I  +++TDY+ SI +K     K    ++ E+KEG++   K     D+Y   ++  + ++I  I K ++    D A  KR EL  HT M+A + + +  +L K ++  G+ ++AITD    Q FP+    AKK + +K IYG++  ++D  IPI +N  D K  D T+VIFDIETTG S   D IIE GAIK  +G  V     F+NPE  I   I  +T I++E V++   IK  L K  +FI +SV++AHN   FD+ F+    ++N M++    KNP++DT+ + + +  ++    L V+A+   I  +    HRA  DA     I  R  +  K ++I +L ++N    ++   ++     + +  KN+  ++NLYK++S S  + F   P++      +     I+  +   G+++   +   +   L+DI+ D YD++ I   E  L  +   + K    ++D  +RI  +    N  V+AT D ++++  DE++ R+ +  +      N+           P  YFRTT+E+  EF +L +     ++V+ N+N IA +I+  +KPI +    P IEGA +++K +  +K +SI+GD +   V+ R+D+E++S+I+NGYA++Y  +  LV++S +DGY+VGSRGSVGSS  A + +ITEVN L PHY+C NCKY  F  + ++ SG DLP+ +CP C  KL  DGH+IPFETF+GF GDK PDIDLNFS  YQ   H + + +FG++ VFRAGTI T AEKTAYGYVK Y  E K M    AEI R+ K C  +KRTTGQHPGG++VVP   D+++FTP  +PADD + +  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  +  VM LF S ++L +    I+     G+ G+PEFGT FV++ML+ T P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+CRDDIM+YLI KG+ P  +F IME VRKGKGL EE++ ++ ++ +P WYIESC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YF++R   FD   ++ GE  I  K++E+  +  N      +  K+  L+ I EL  E+  RG KF  +DL KS A  FL+E   +  P +++ GLG++ A +IVKAREE  F SKED + R KV+ T +  +   G   +L E +Q+SLF
  S:   170 YLEK-SEREEKKYIENIFKY-RDEKFRKS-----------SGISSAAKKIEEH------KVDRKENCSERNPVIIGKAISGVPVEIVSITDI---SKTVIIKGDIFKKEIIETKTGRKIITFYITDYTSSITVKFFPRPKDVDRIIEEIKEGLYCMVKGEAINDIYAR-ELVIMAKDIVKIHKEEKI---DTAEEKRVELHLHTQMSAMDAVSSASDLIKRAALWGHKAIAITDHGVVQAFPEAMEAAKK-NNIKVIYGIEAYMVDDGIPIAING-DEKTLDDTFVIFDIETTGFSMTNDNIIEIGAIKIKEGKVVGKFSEFVNPERPIPLTITQLTGITDEMVQNCESIKYILPKFMEFIDNSVVVAHNA-NFDVGFI----KKNCMELNLKFKNPVMDTIPLCKFLFPELKRFKLNVVAKHLDISLE--NHHRAVDDAGATCEILLRCFKMLKEKNILSLGDLNKEFLSNIDVKKQPMYHLIILVKNQIGLKNLYKMVSKSNLNYFFKKPRMPKSIIIKHREGLIIGGACEAGQVYREVLGGKSDSELKDIL-DFYDYLEIQPVENNLFMVRNGLVKDIEQLKDINRRICDLGVINNIPVIATGDVHFMDPKDEIFRRIIMAGQGYSDADNQ-----------PPLYFRTTEEMLFEFEYLGEKK-AREVVIENTNKIADMIE-EVKPIPDETFPPKIEGAEEEIKNMTLKKVHSIYGDNLPEIVQERLDKELNSIINNGYAVLYLIAQKLVEKSYNDGYLVGSRGSVGSSFVATMSNITEVNGLPPHYVCPNCKYSEFFTDGSIGSGADLPDKSCPDCGEKLMKDGHDIPFETFLGFAGDKEPDIDLNFSGEYQPVVHKYTEVLFGKDHVFRAGTIGTIAEKTAYGYVKKYIAE-KNMVLPQAEIERLTKGCTGIKRTTGQHPGGVMVVPDDNDIHNFTPVQHPADDNSTEIITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLGEPKVMSLFTSPEALGVSEKEID--CSVGTYGLPEFGTKFVRQMLMDTHPKTFADLVRISGLSHGTDVWLNNAQYYIKEGYTTLQDCIACRDDIMIYLIQKGLPPKTSFTIMEMVRKGKGLKEEHEAIMREHTVPNWYIESCKKIKYMFPKGHAVAYVMMAVRIAYFKVYYPKAYYAAYFTVRANEFDADIVVQGEGAIKKKMDELYSQGNN------LTQKDKGLLTILELCYEMNKRGIKFLKVDLYKSHAIKFLIEESGIRVPMNSLAGLGENAAKNIVKAREEGEFISKEDLRIRAKVSKTVIDTLNNHGCLGNLPETNQLSLF 1438
>gi|150020931|ref|YP_001306285.1| DNA polymerase III PolC [Thermosipho melanesiensis BI429] >gi|149793452|gb|ABR30900.1| DNA polymerase III, alpha subunit [Thermosipho melanesiensis BI429] (1362 aa)
Score = 2203, Expect = 0.0e+00, Identities = 537/1364 (39%), Positives = 818/1364 (59%)
  Q:    95 FVNHNIEQKQKGTS-EKKELLYVLKYNMGIKKPI-ISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSEL-KEGVWVKAKISIQID-----MYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLN-ANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL---NCKLEENKMDIIKNPLIDTLQISRAI-NEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQN----DFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAM-SNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDEL-KDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           F   N+E + + T  E++E+L +L       K + I EN I +       +K I+K + H  K               +  KT+ +       ++E  K E  +++  +N KK D    Y F           S++    K   + G++FK+++      Y ++  ++TD  +SI+ K       N +  S L KEG W   K S+ +D      +  ND+            P    R D    KR EL  H+ M+  + +V+IKE+ +   E G+S+VAITD  N Q+ P  + EA+K + +K I+G +  ++++   IV N   D  + D TY +FD+ETTG +  +D+IIE GA+KY  G  + +   F+ P + IS+    +T I++E VKDA  I+E   +   FI  +VL+AHN   FD  F+   N +L   ++D      +DTL++S+ +   ++    LG +   +K+     + HRA +DA    +++ ++LE    + IKTL ++N NL+N      +R + + + IT+  +++  ++NLYKL+S +    F   P V  +   ++    ++      GEIF+A   S+T + + +++KD YD++ I  P   +  + RE+ K+ +     KR+ ++A + +  VV  S+ ++L   D     V ++        +     ++L     K Y RTTDE+ K+ F    D  +  +IVV N+N IA+ +  ++KPIK  LH P IEGA +K++ L  +++  ++GD + + ++ R+++E+ S+I +GYA++Y  +HL+VK++ +DGYVVGSRGSVGSS  A+L+ ITEVNPL PHY+C  CKY  F K++ SG+DLP   CPKC +KL+  G +IPFE FMGFKGDK+PDIDLNFS  YQ +AH +I  +FG++ V RAGTIST AEK+A GYVKSY  E K      AE  R+A+    VKRTTGQHPGG+++VP    VYDFTP  YPA+ K  +  TTH A+ES+HD L+K D LGHD+PT+LK+L E T V+   +P  D   +++F+S   LK+K   +   +  G+ GIPEFGTNFV+EML  T+P+ F++L+RISGLSHGT+VW +NA+ +I+    T+S+VISCRDDIM+YLI+ G+    AFKIME+VRKGKG++E+ +K++ + N+P W+I+SC KI YLFPKAHA AYV MA++IA+FK++YPL +YA+YFSI+   F I++IL G   I  K+ E+  +M   K     KN+E     + E ALE+  RGY F   D+ KS    F++EG+ L  P + I G+GD+VA SI++AR EK F+S +D KKRTK++  H+  M +L I   L E DQ +LF+F
  S:    60 FFGVNVEIEYEVTELEREEILGILNGTAPYVKDVEIFENEILIRTFGEFAKKKIEKEINHIEK---------------VTGKTVKV-----EIVEETFKIEPPKIE--NNLKKFDEDKKYYFP----------SNIPLNAKRVFLRGKVFKLEQ-----QYGVFSVYITDRKESILGKIF----DNANEFSTLIKEGNWYYFKGSMGVDKRGGYYFAINDV---------FKDPSPIERKDTYEEKRVELHIHSKMSDLDAIVDIKEVVRKVKEWGWSAVAITDHGNVQSIPYLFEEAEK-NGIKPIFGTEMYVLNEMGDIVKNLVEDKMLDDVTYTVFDLETTGTNAKFDEIIEIGAVKYRDGKVINTFSSFVKPTKSISEFTQKLTGITDEMVKDAKSIEEVFPEFLKFIDGTVLVAHNA-DFDYGFIREVNRRLYNKELDF---AYLDTLKLSKVLLRGKVKSFGLGKLVEYFKLG--PFKHHRAFEDASVTADLFGKLLELLLKRGIKTLGQVN-NLKNTSSISTIRTKKQFNHITILVRDKVGLKNLYKLVSDAHVKYFKYVPFVPKKELIKYREGLLLGTGCESGEIFQALTGSSTDEEILEMLKD-YDYVEI-FPLDTIVSVEREVAKQVY-----KRLYELAKRLDLPVVMVSNAHFLEPEDIKARHVLLSPIEKSNPHD-----DDLRDKDAKLYLRTTDEMMKEAFEIFEDEKIAYEIVVENTNKIANNMIEDVKPIKRKLHPPIIEGADEKVRSLSIKRAKELYGDPLPDVIEKRLEKELESIIGHGYAVLYEIAHLIVKKANEDGYVVGSRGSVGSSFVAYLMGITEVNPLPPHYLCPKCKYLEFSKDMGSGYDLPNKLCPKCGTKLEKTGQDIPFEVFMGFKGDKVPDIDLNFSGEYQERAHSYIVELFGKDNVLRAGTISTIAEKSAIGYVKSYM-EVKGETLHQAEQIRLAEMVAGVKRTTGQHPGGLMIVPKDMTVYDFTPIQYPANKKDSEMCTTHFAYESIHDDLVKLDALGHDDPTMLKLLYEYTGVDPTKVPMDDKKTLEIFSSLKPLKVKAEELG--IDVGTIGIPEFGTNFVQEMLKETRPKTFAELVRISGLSHGTDVWLNNAQDIIKSGNATLSEVISCRDDIMIYLINAGVEESRAFKIMENVRKGKGISEDDEKLMREKNVPEWFIQSCKKIKYLFPKAHAVAYVSMAFRIAYFKVHYPLAYYAAYFSIKGDEFSIETILRGIKSIKKKLAELNAQM---KKDVKEKNEE----KVLEAALEMYLRGYSFLPPDILKSDYRRFIIEGNELRIPLNKIPGVGDNVALSIIQARMEKPFTSIDDLKKRTKLSKAHINTMRKLRILEDLPETDQSTLFDF 1362
>gi|15829146|ref|NP_326506.1| DNA polymerase III PolC [Mycoplasma pulmonis UAB CTIP] >gi|14424449|sp|P47729|DPO3_MYCPU DNA polymerase III polC-type (PolIII) >gi|14090090|emb|CAC13848.1| DNA POLYMERASE III, ALPHA CHAIN POLC-TYPE (POLIII) [Mycoplasma pulmonis] (1435 aa)
Score = 2202, Expect = 0.0e+00, Identities = 518/1326 (39%), Positives = 793/1326 (59%)
  Q:   130 ENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFR--KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNA-----NDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYN-ELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN--VDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKIL--KTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD--YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISL 1455
           +  IFL           K ++E   K +  +GF    L   L++  I+I ++    +   I +++     S N     S+F  K R  +    ++ K  ++F      ++ G +FK + + T +  +I+K  +TD+ ++   +     + ++++   ++   WV     IQ++          IE+I  I  P +  R DN   KR EL   + M+  +G+++  ++ K + +  +SS+AI D  + Q FPDF+N   K    K IYG+  ++I K   I +        D KI D  YV++DIETTGLSP  +++I+FGA     G  +E+   FI P+ K+      +T I+ E ++   +++EAL KI       +++AHN   FD  FL  K  +N ++  +   IDTL +++ +N     + LG +A K  + YD + AHRAD D+  L NI+   + + K + I    E+NS L ++    +     I++  KN+  ++ L+K+ S  LT  +   PK++WE+     N  I S       I +   S  + VL +I  DKYD+I I SP  F H      +    I+  ++++IK A + NK +VA  +  Y  +  ++   +Y+N+  +    + LF    +++T  P+  ++TT+E+K EFSFL DP L+ +IVV N N I+S I+  I+ IK+ L++P  + +  KLK+L+Y+ ++  +G  +   ++ RI++E++ +++ G+ +IYW S +LV++S+ DGY+VGSRGS+GSS+ A L  ITEVNPL PHYIC+ C+YF   K+   +SGFDL +  CPKC S L  DG  IPFETF+GFK DK+PDIDLNFS  YQGK HD +K +FG +  FRAGTIST AEKTAYGY+K Y E +  ++  +  +  + +K   VKRTTGQHPGGI+++P   DV DFTP N+PA+D    W TTH  F ++HD++LK DILGHD+PT LKML + T VN   IP  D  ++ +F S  +L I +    +IL  KTG+ GIPEFGTNFV++ML   KP+ F+DL+ ISGLSHGT+VW +NA Y+I+  G T+  VISCRDDIMV LI KG+   ++F IME VRKGKGL+ E ++ L ++ I  WYIES  KI Y+FPKAHATAYV+MAW++A++K+YYPL +YA+YFS R + FDI+ +   +  + +KI E+  +  N +    +  KE + +P   +A E+  RG+   NI+LK SLA D++++ +   LIPPF+ IDGLG+++A  IV +R EK F S EDF  RT + +T ++  + +GI   + E +QI L
  S:   117 DGKIFLTAHSKHSFDLYKDFVEFANKKMQSFGFENFLLKLELNQ--IEITNNQP--LVSSINSQVKTQASSENQSFKKSNFYNKKRHIQLSLKELIKTQEMF-----VSVVGMVFKKEIITTNSKTKIFKISITDFQEATRAQKFSYLEKDQEIFDSIQINDWVNVCGEIQLEKMSLKQFIK-IEKIEKIRSPIK-DRQDNEKEKRIELSFRSKMSTMDGILSPLDIVKQAKKFNHSSIAILDHNSVQAFPDFHNLTYKDKDFKVIYGMTLSVISKRNKIFVEPLKDKFFDYKILDQEYVVYDIETTGLSPMLNELIQFGASVIKNGRIIETHHFFIKPKSKLDSFTTKLTGITQEHLEKGYELQEALEKISSIFKARIMVAHNA-AFDHNFLKQKFIDNNIEFEEMISIDTLNLAKVLNPIYRSYRLGEVASKLSVVYDPSIAHRADYDSSVLTNIFILQMSHLKEKGINLFKELNS-LSSEKFYSKMFAKDISIIAKNQAGLKELFKINSDVLTKYYFANPKMFWEDIKRSKNLLIGSGGLNSPLIDKLLFSTQEDVLNEI--DKYDYIEIPSPNNFSH-FWTTKFSDQQIKIQLQKLIKWAKEKNKIIVAIGEPRYNEKWQKIIHEIYINSTGIENSLHPLFIIKKDMDTFYPEQIYKTTNEMKQEFSFLYDPELIEEIVVKNPNLISSQIE-KIQVIKDKLYTPKFDDSHIKLKKLVYENAWKKYGKNLPEIIEQRIEKELTPILNYGFDVIYWISSILVQKSLSDGYLVGSRGSIGSSLVATLSGITEVNPLAPHYICSKCQYFELVKDPMTNSGFDLDDKKCPKCNSFLDKDGQTIPFETFLGFKADKVPDIDLNFSGEYQGKIHDEVKRLFGSKHTFRAGTISTVAEKTAYGYIKKYLE-TASLDYSDNFVDFLTEKSTGVKRTTGQHPGGIIIIPKEFDVEDFTPVNFPANDTESSWKTTHFDFHAIHDNVLKLDILGHDDPTALKMLEKLTGVNVKDIPKKDEKIISIFTSPKALGISS---EEILGEKTGALGIPEFGTNFVRQMLSEAKPKTFADLVSISGLSHGTDVWINNAHYIIQSLGKTLDQVISCRDDIMVDLIKKGVPIDLSFTIMEQVRKGKGLSLEQKRKLIEHGIENWYIESMEKIKYMFPKAHATAYVLMAWRVAFYKVYYPLEYYATYFSTRTEFFDIEIMSKDKLTLESKIKELAYR-ENLRNDNQLTTKEKNTLPTLYIANEMKARGFNIQNINLKISLANDWIIDKNSKSLIPPFNVIDGLGETLAQKIVDSRNEKEFLSVEDFINRTGINSTLVEKFKSMGIFEQIPETNQIFL 1434
>gi|182417583|ref|ZP_02948906.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium butyricum 5521] >gi|182378596|gb|EDT76124.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium butyricum 5521] (1450 aa)
Score = 2195, Expect = 0.0e+00, Identities = 497/1270 (39%), Positives = 740/1270 (58%)
  Q:   187 QEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISI----ISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDA----EYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           Q + K E    KR+   + T      K       + T + D+        I G++FK + + TKTG  I+ + +TDY+ SI +K     +  + VL E+K+G + K +     D Y          E+ I    I++ K+  + D A  KR EL  HT M++ +G+    +L   ++  G+ ++AITD    Q +P+  + AKK+  +K +YGV+  ++D  +PIVLN     + D TYV+FDIETTG SP  DKIIE GA+K   G  +++   F+NPE  I   I  +T I+N+ V+DA  I+  L K  +F  DSVL+AHN   FD  F+     +  +D     ++DT+ ++R +   +    L ++A+   I  D    HRA  DA    E LL  +  + E+  +  +K LN++     ++F  ++       +  K +  ++NLYK+IST+   NF   P+       E     I+ ++   GE+++A +          I + YD++ I      L  I + + K    ++   K+I  I  + +K  VAT D ++++  DE + R+ +  +       +           P  YFRTT+E+  EF++L   +  N++V+ N+N IA  ID  IKPI +    P IEGA + ++ +   K +SI+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S DDGY+VGSRGSVGSS  A + DITEVN L PHY+C NCK   F  + ++ SG DL + +CP+C +  K DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+   F+AGTI T AEKTAYGYVK Y +E + +    AE+ R+   C  +KRTTGQHPGGI+VVP   ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S ++L +    +    + GS G+PEFGT FV++ML+ T+P+ FSDL+RISGLSHGT+VW +NA+Y I+E   T+ + I+ RDDIMVYL+ K I P  AF IME VRKGKGL+E+ + ++  +N+P WYI SC KI Y+FPK HA AYV+MA +IA+FK+YYP  +YA+YF++R   FD   I  GE  +  K+ E+     N    A VK+K   +I + EL  E   RG  F  +DL KS A  F++E   L PP +AI G+ D+ A  IV+AR+   F SKED + R  V+ T ++ +   G    ++E +Q+SLF
  S:   215 QPEKKREFQTYKRAPKDENTIMGGAIKM------ETTNICDIDERSGYVAIIGDVFKTEIIETKTGKIIFTFCITDYTSSISVKCFLRPQDTEAVLDEVKKGFYCKVRGEAVYDTYS--------REVVIMGRDINRMKKIEKMDGAPKKRVELHLHTTMSSMDGMTAPGKLIGRAASWGHPAIAITDHGGVQAYPEAQSAAKKHG-IKVLYGVEAYLVDDGVPIVLNEKGDSLDD-TYVVFDIETTGFSPVNDKIIEIGAVKIKNGEVIDNFSHFVNPERSIPYVITELTSINNDMVRDAETIEILLPKFMEFCADSVLVAHNA-AFDTGFIKKNCRDLGIDF-NYSIMDTVPLARFLCPDLKKVKLNLVAKHLGISLD--NHHRAVDDAKCTAEILLKFFTMLKEDHSINTLKQLNDL---FVSNFDIKKQPTYHAIILAKTQAGLKNLYKMISTAHIDNFQRRPRTPKSLIAEMREGLIIGSACEAGEVYKAVLDGKSDEELKAIMEFYDYLEIQPIANNLFLIEKGMVKDENELKTINKKIYDIGKECDKMTVATCDVHFMDPKDEAFRRILMAGQGFKDADKQ-----------PPLYFRTTEEMLKEFAYLGSEI-ANEVVIENTNKIADSIDI-IKPIPDETFPPKIEGAEEDIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSNDDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPNCKKSEFFMDGSISSGADLDDKDCPECGTPYKKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHRYCEVLFGKGHTFKAGTIGTVAEKTAYGYVKKYLDE-RGIVVPQAEVDRLTIGCTGIKRTTGQHPGGIMVVPADNEIYNFCPIQHPADDNDTDVITTHFDYHSISGRLLKLDILGHDDPTVLRMLQDITGLDPKTIPLNDKKVLSLFTSPEALGVTKEELE--CEVGSYGLPEFGTKFVRQMLVDTQPKTFSDLVRISGLSHGTDVWLNNAQYYIKEGFTTLRECIATRDDIMVYLMYKDIPPKTAFTIMEKVRKGKGLSEDDETLMKKHNVPEWYIGSCKKIKYMFPKGHAVAYVMMAVRIAYFKVYYPQAYYATYFTVRADDFDANLICLGEGAVHAKLQELYALGNN----ASVKDK--GMITVLELCFEAYKRGVNFLRVDLYKSDAVKFIIEDGNLRPPLNAIPGIADNAAKGIVEARKNGEFISKEDLRIRAGVSKTAIEGLTSHGCLEGMSETNQLSLF 1450
>gi|146297347|ref|YP_001181118.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410923|gb|ABP67927.1| DNA polymerase III catalytic subunit, PolC type [Caldicellulosiruptor saccharolyticus DSM 8903] (1402 aa)
Score = 2190, Expect = 0.0e+00, Identities = 486/1220 (39%), Positives = 746/1220 (61%)
  Q:   237 IEGEIFKIDKVVTKT-GYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI------KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           IEGE+F I+   TK     IYK +VTDY+ S  +K +  KK N    + +  G ++K + +++ D +E   +    + ++   KP+   R D A +KR EL  HT M+  + + + +EL K +++ G+ ++AITD    Q FP+   E  K   LK IYG++  +ID  +P+V N  + +  D T+V+ DIETTG     D+IIE GA+K   G  V+    F++PE KI  +I  +T I    V +A K+ +A+++ + F   ++L+AHN  +FD+ FL    +E  + I     IDTL++SR +   +  H L  +A    I+      HRAD DAE    I+  ++E  K +  K L E+N+   N     ++     T+  KN+  ++NLYKL+S S    F   P++      +  +  I+ ++   GE+F A M        + I   YDF+ I   E      +  + + G+++D        K+I ++  K NK VVATSD +Y +    +  ++         K N+ +   E +   P  YFRTTDE+  EF +L       ++VV N+N IA +I+ ++KPI +    P IEGA +++  +  ++++ I+G+ +   VK R+++E++S+I NG+A++Y  +  LV +S+ DGY+VGSRGSVGSS+ A +  ITEVNPL PHY+C NCKY  F  +  V  G+DL + +CP+C +KLK DGH+IPFETF+GF GDK PDIDLNFS  YQ  AH F +++FG+  VFRAGTIST AEKTA+G+V  Y EE K ++   AE+ R+++ C  VKRTTGQHPGG+++VP  K+++DFTP  +PAD + +   TTH  + ++   LLK DILGHD+PT+++ML + T V+  +IP  D   + +F ST++L +    I+   + G+ GIPEFGT FV++ML+ TKP+ F++L+RISGLSHGTNVW +NA+ L+     T+ +VIS RDDIM+YLI KG+ P  +F+IMEDVRKGKGL  E +++L    +P WYIESC KI+Y+FPKAHA AYV+MA++IA+FK++Y   FYA+YF++R   FD  +IL G   I  KI +++ +M +      +  K+ +L+ + E+A E+L RG KF  +DL +S A  F+++   L+ PF+A+  +G + A +IV+AR+E  F S ED ++R K+    ++I+ +  +   L +  Q+S F
  S:   213 IEGEVFNIEIKETKNQNILIYKLYVTDYNTSTYVK-IVAKKDNTP--TSISVGDYIKVEGNVEFDEFEKAIVVN-AKNVNRAVKPE---RLDTADVKRVELHAHTKMSTMDAVCSAEELIKTAAKWGHRAIAITDHGVVQAFPE-AQEVSKSEGLKVIYGMECYLIDDGVPVVYNPKENQSLDTTFVVVDIETTGFDNQKDRIIEIGAVKIENGEIVDRFSTFVDPEGKIPIRISELTGIYQNMVDNAPKLSDAILEFEKFCSGAILVAHNA-QFDIGFLKRSYQECGL-IFDYTYIDTLELSRRVLTDLSSHKLNKVAEFLNIEL--KHHHRADSDAETTAKIFISLIEKLKSRGYKYLKELNTIETNTKADLKSHSYHATILVKNQQGLKNLYKLVSYSHLEYFYKRPRIPKSVLIQLKDGLILGSACESGEVFRAIMEGKSDDELEKIVSLYDFLEIMPVEN-----NSFLIREGYLKDEEQLRQINKKIYQLGKKLNKLVVATSDAHYCHPHQRILRQIL--------KHNQGYDDVEND---PYLYFRTTDEMLKEFEYLGKEA-AYEVVVENTNKIADMIE-DVKPIPDETFPPKIEGAEEEIYNMTMKRAHEIYGEPLPEIVKQRLEKELNSIIKNGFAVMYLIAQKLVSKSLSDGYLVGSRGSVGSSLVATMCGITEVNPLPPHYVCPNCKYSEFVTDGTVGCGYDLEDKDCPRCGTKLKKDGHDIPFETFLGFDGDKEPDIDLNFSGEYQPIAHKFTEDLFGQGYVFRAGTISTVAEKTAHGFVTKYAEE-KGLSLHPAEVLRLSQGCTGVKRTTGQHPGGLMIVPKDKEIFDFTPIQHPADSEDKSVITTHFDYHAISGRLLKLDILGHDDPTVIRMLQDLTGVDPRSIPLDDKATLSIFTSTEALGVSPEDID--CEVGTFGIPEFGTRFVRQMLIETKPKSFAELVRISGLSHGTNVWTNNAQDLVRNGIATLKEVISTRDDIMLYLIQKGVPPKDSFRIMEDVRKGKGLKPEDEELLRSYGVPEWYIESCKKITYMFPKAHAAAYVMMAFRIAYFKVHYKEAFYATYFTVRADDFDYATILKGREFIRQKIRDMENRMNS------LSQKDKNLLTVLEIANEMLARGLKFYPVDLNESDAEKFIIKDGGLLIPFNALPNVGIAAARNIVEARKEGKFLSIEDLQRRAKLNKQVIEILTQYKVLKDLPQTSQLSFF 1402
>gi|116617801|ref|YP_818172.1| DNA polymerase III catalytic subunit, PolC type [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096648|gb|ABJ61799.1| DNA polymerase III catalytic subunit, PolC type [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (1437 aa)
Score = 2188, Expect = 0.0e+00, Identities = 501/1301 (38%), Positives = 757/1301 (58%)
  Q:   158 NDYGFSKHHLSYILDEK----TIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGD--VTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKI--SDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSK-LKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           + +G  K  L+  LDE+      + ++ H  + +E ++  I      S  K +    +    + +  D  +T+L  +  E     IEG IF  +    ++G ++    +TDYS SI  K     + ++ V   LK G+WV+   +IQ D Y    +  + +   +    ++ +       K  EL  HTNM+A + + +   + K +   G +++A+TD  N Q FP+  + A   + LK IYG++ N+++   PI  N + T++   D  +V FD+ETTGLS   D+IIE  A+K   G  +E    +INP   +S+    +T I++  V ++   +  + + +++ G++VL+ HN + FD+ F+N         II N +IDTL  +R +      + LG IA+++ I+ +  QAHRA  DAE   +I W+ + E  +  ++   NE+N  +      +  R    T+  +N   ++NLYKL+S S    F   P++      ++    +V    T G++  + +    Q  E      YDFI I     +   I    I     ++  +K ++ I +K  K VV T D  Y N  D++Y  + + A   G  +NR        T LP   F+TT EL D+++F+    L   +V+ N++ +A++++ +I+P+K   + P+I GA D+L +  Y+ +   +G+ +  +++ARID+E+ ++I NG+A  Y  +  LV +SV DGY+VGSRGSVGSS  A +  ITEVNPL PHY   +  YF     K  +SG+DLPE   P    + L GDG NIPFETFMGF G+K+PDIDLNFS  YQ  AH+++K +FGE  V+RAGTI+T AEKTA+GYVK+Y E     + R AEI R+A+    VKRTTGQHPGGI++VP   +VYDFTP  YPADD+   W TTH+ + S+HD+LLK DILGHD+PT+++ L + + ++  +IP  D  V+ LF ST++L +    I     TG+ G+PEFGTNFV+ ML  T+P  +S+L++ISGLSHGT+VW  NA  LIE    TI  VI  RD IM  LI+ G+    AF IME VRKGKG+ EEYQK L +  IP WYI+S  KI Y+FP+AHA AYV+MA +IA+FK+Y+P  +YA+YFS+R   FDI ++  G+      I ++K  + N  T   V +K  +L+ + E+A E L R   FA +DL KS A +++++GD LIPPF ++ GLGD+VA  IV AR EK F SKED KKR KV+ T ++ M    +   L +++Q+SLF+F
  S:   152 HSFGLPKIKLTPKLDEQLEQEIQENVAQHHARAREDLQKAIV-ANEQSKPKVSSEGVSLALGRKIPADAEITRLDSIDGEENRVVIEGYIFAEEIRELRSGRKLLTLKLTDYSSSISAKKFSNNENDEAVFDGLKSGLWVRLSGNIQEDQYARELVMNIYDLQVVDHANRQEVYQGEE--KHIELHAHTNMSAMDAVTDFSGVAKLAKSWGQTALAVTDTGNVQGFPE-ASAAGAKNGLKMIYGMEANLVEDGEPIGFNLDQTELLNKDTIFVAFDLETTGLSAVTDRIIELSAVKMQLGNVIEKFSEYINPGFPLSEFTTKLTSITDAMVANSDTEENIIKRFREWSGNAVLVGHN-VTFDVGFMNAAYTRYNQPIITNAIIDTLPFTRWLYPDYKSYRLGTIAKRFNINLE--QAHRAIFDAETTGHIAWRLIKEAHERYNLNRHNELNDRMTEGDAWKHGRPVHATLLVQNATGLKNLYKLVSRSNIEFFARVPRIPRSILEQYREGLLVGTGDTSGDVIISLIEKGIQEAEKKAA-YYDFIEIQPTANYQPMIESGLIATEEKLQSILKDMVAIGDKLKKPVVVTEDVKYTNPEDKIYRNILI-ATQPGNPQNR--------TALPDLNFKTTQELLDDYAFMGAD-LAKKLVIDNTHLVANMLE-DIEPLKSGSYPPNIPGAGDELTERTYRTAKQWYGEPIPKEIQARIDQELKAIIGNGFAPHYIIAQRLVAKSVKDGYLVGSRGSVGSSFVATMSGITEVNPLPPHYRSAHGDYFELVDPKEYESGYDLPEKEDPNHPGEFLIGDGQNIPFETFMGFTGNKVPDIDLNFSGDYQPIAHNYMKVLFGEHNVYRAGTIATVAEKTAFGYVKAY-EREHDQHYRGAEIERLAQGMTGVKRTTGQHPGGILIVPREYEVYDFTPIQYPADDQKSLWQTTHMDYHSIHDNLLKMDILGHDDPTMVRTLKDMSGIDPQSIPANDPGVLSLFTSTEALGVTPEQI--FSNTGTLGLPEFGTNFVRGMLTETQPHTYSELLQISGLSHGTDVWVGNANELIENGTATIGTVIGTRDKIMTDLINWGVPAADAFNIMEKVRKGKGITEEYQKQLREEKIPEWYIQSMLKIKYMFPRAHAAAYVLMALRIAYFKVYFPTIYYATYFSVRADAFDIVAMSRGKDATKAAIQKLKS-LGNDAT---VGDK--NLLTVLEMANEALERNITFAMVDLNKSEALEWVIDGDTLIPPFVSLPGLGDNVAKQIVAARTEKPFISKEDLKKRGKVSQTIIEFMTLHSVLDGLPDENQLSLFDF 1437
>gi|150390440|ref|YP_001320489.1| DNA polymerase III, alpha subunit [Alkaliphilus metalliredigens QYMF] >gi|149950302|gb|ABR48830.1| DNA polymerase III, alpha subunit [Alkaliphilus metalliredigens QYMF] (1432 aa)
Score = 2187, Expect = 0.0e+00, Identities = 492/1286 (38%), Positives = 772/1286 (60%)
  Q:   171 LDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYK-----------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMD-IIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIG--SPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           LDEK+   + D++++ +++    + E+ ++S   +  +S   K             +  +G++ KL+DL  E+ T  +EGE+F ++    K G ++    +TDYS+SI +K    KK  KD+     +G +++ K  +  D +   ++   +    +++ P+E  R DNA  KR E   HT M++ +G+ +  EL K +++ G+ ++AITD    Q FP+  +  KK+  +K IYG++  +I+    I+ NA    + D  Y++FDIETTGLS   D+I E GA+K      ++     +NPE KI  KI  +T I+++ V D   I   L     FIG S ++AHN   FD+ F+  +   N+++  I+N +IDTL++SR +  Q+  H L  IA++  +  +    HRA  DA+    I+ + +E  K +++ TL E+N+ L  D   ++     I +Y KN+  ++NLY++IS S    F   P+V      ++    ++  +   GE++++ + N  +   +     YD++ I   S   FL +    +     +++  K+I+ + NK N  V+AT D ++L+ +DEV+ ++ +  +      N+              Y +TTDE+ DEF +L       D+VV N   +   I+  I PI +    P IEG+ ++L+++ Y+K+  I+G+ +   VK R+D+E++S+I NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS AA + DITEVNPL PHY+C  C+Y  F  + +  SG DLP+  CP+C  +L  DGH IPFE F+GF+GDK PDIDLNF+  YQ +AH + + +FG+ +V+RAGTI T A+KTAYG+VK Y EE +++   +AE+ R+   C  VKRT+GQHPGG+++VP   DV++F+P  YPA+D T    T H  + S+   LLK DILGHD PTI+KML + T +NA  IP  D   + LF +T +L I    +    + G+ GIPEFGT FV++MLL TKP  F +L+RISGLSHGT+VW +NA+ L+      + DVIS RDDIM YL+ KG+ P  AFKIME+VRKGKGL  E ++++ +NN+P WYI+SC KI Y+FPKAHA AYV+M+++IA+ K++YP  FYA+YF+ + + FD   I  G++ + +KI+E+ E M N  T      K+ + + + E+ALEL  R  +  ++D+ KS    F +    L+PP  A+ G+G + A +I K RE   F SKED ++R KVT T ++ +   G  + L + +Q+SLF
  S:   164 LDEKSAFHVDDYESQKEKESMQFVQEINKASQNSEMVTSNKGKRVTVVDDDSILIGRKFSGEIIKLTDLKNELGTVIVEGEVFNLECRELKGGKKLLSLQITDYSNSITVKIFERKKQVKDLEELFHKGQYIRVKGDMTFDKFMRENV---LMASDVVNMPQEKGRWDNAPEKRIEFHMHTKMSSMDGVSSTSELVKRAADWGHEAIAITDHGVVQAFPEAMDAGKKHG-IKVIYGMEGYLINDEAKIIPNATLYSLDDE-YIVFDIETTGLSNRNDRITEIGAVKIKDSQVIDKFSALVNPEMKIPSKIVELTGITDDMVVDKQTIDVILPGFLAFIGSSPVVAHNS-DFDMGFI--RENANRIERTIENQVIDTLKLSRILLPQLKRHRLNSIAKELNVSLE--NHHRAVDDAQATAEIFVKFIELLKQKEVYTLEEVNTKLVKDVDYKKLDTYHIMIYAKNQKGLKNLYQIISESHLEYFYKKPRVPKSILTKYREGLLIGTACEAGELYKSILGNKPESDIEKTASYYDYLEIQPISNNQFLLE-KGMVNTTEELQNINKKIVALGNKINLPVIATGDVHFLDPNDEVFRKILMAGQGFTDADNQ-----------APLYLKTTDEMLDEFRYLGSKT-AKDVVVNNPRKLNEEIEKLI-PIPDGTFPPEIEGSDEELRRMCYEKAERIYGNPIPEIVKTRLDKELNSIISNGYAVMYIIAQKLVTKSLRDGYLVGSRGSVGSSFAATMSDITEVNPLAPHYVCPECRYSEFITDGSYGSGADLPDKKCPECHGQLIKDGHEIPFEVFLGFEGDKEPDIDLNFAGEYQSEAHHYTEELFGKGKVYRAGTIGTIADKTAYGFVKKYLEE-RELYYTSAEVNRLTMGCTGVKRTSGQHPGGVMIVPANLDVHEFSPIQYPANDSTSGVITMHFDYHSISGRLLKLDILGHDVPTIIKMLEDLTGINAQEIPLDDEKTISLFTTTKNLGIDPKELG--CEVGTLGIPEFGTKFVRQMLLDTKPSTFGELVRISGLSHGTDVWLNNAQDLVRNNIAELKDVISTRDDIMNYLMLKGLPPKSAFKIMENVRKGKGLKPEEEQLMKENNVPEWYIDSCKKIKYMFPKAHAAAYVMMSFRIAYCKVHYPQAFYATYFTTKAEDFDAHLIGKGKAVVKSKIDEL-ELMGNDLTA-----KDKNFLTVLEVALELYCRNIELLSVDVYKSDPDKFTIIDGKLLPPLRALQGVGQNAARNIAKVREAGEFLSKEDLRERAKVTKTVIEALTNHGCIADLPDTNQLSLF 1432
>gi|487436|gb|AAA18178.1| DNA polymerase III [Mycoplasma pulmonis] >gi|1090178|prf||2018296A DNA polymerase III (1435 aa)
Score = 2180, Expect = 0.0e+00, Identities = 518/1326 (39%), Positives = 794/1326 (59%)
  Q:   130 ENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFR--KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNA-----NDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYN-ELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN--VDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKIL--KTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN-EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD--YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISL 1455
           +  IFL           K ++E   K +  +GF    L   L++  I+I ++    +   I +++     S N     S+F  K R  +    ++ K  ++F      ++ G +FK + + T +  +I+K  +TD+ ++   +     + ++++   ++   WV     IQ++          IE+I  I  P +  R DN   KR EL   + M+  +G+++  ++ K + +  +SS+AI D  + Q FPDF+N   K    K IYG+  ++I K   I +        D KI D  YV++DIETTGLSP  +++I+FGA     G  +E+   FI P+ K+      +T I+ E ++   +++EAL KI       +++AHN   FD  FL  K  +N ++  +   IDTL +++ +N     + LG +A K  + YD + AHRAD D+  L NI+   + + K + I    E+NS L ++    +     I++  KN+  ++ L+K+ S  LT  +   PK++WE+     N  I S       I +   S  + VL +I  DKYD+I I SP  F H      +    I+  ++++IK A + NK +VA  +  Y  +  ++   +Y+N+  +    + LF    +++T  P+  ++TT+E+K EFSFL DP L+ +IVV  SN I+S I+  I+ IK+ L++P  + +  KLK+L+Y+ ++  +G  +   ++ RI++E++ +++ G+ +IYW S +LV++S+ DGY+VGSRGS+GSS+ A L  ITEVNPL PHYIC+ C+YF   K+   +SGFDL +  CPKC S L  DG  IPFETF+GFK DK+PDIDLNFS  YQGK HD +K +FG +  FRAGTIST AEKTAYGY+K Y  E+  ++  +  +  + +K   VKRTTGQHPGGI+++P   DV DFTP N+PA+D    W TTH  F ++HD++LK DILGHD+PT LKML + T VN   IP  D  ++ +F S  +L I +    +IL  KTG+ GIPEFGTNFV++ML   KP+ F+DL+ ISGLSHGT+VW +NA Y+I+  G T+  VISCRDDIMV LI KG+   ++F IME VRKGKGL+ E+ ++ L ++ I  WYIES  KI Y+FPKAHATAYV+MAW++A++K+YYPL +YA+YFS R + FDI+ +   +  + +KI E+  +  N +    +  KE + +P   +A E+  RG+   NI+LK SLA D++++ +   LIPPF+ IDGLG+++A  IV +R EK F S EDF  RT + +T ++  + +GI   + E +QI L
  S:   117 DGKIFLTAHSKHSFDLYKDFVEFANKKMQSFGFENFLLKLELNQ--IEITNNQP--LVSSINSQVKTQASSENQSFKKSNFYNKKRHIQLSLKELIKTQEMF-----VSVVGMVFKKEIITTNSKTKIFKISITDFQEATRAQKFSYLEKDQEIFDSIQINDWVNVCGEIQLEKMSLKQFIK-IEKIEKIRSPIK-DRQDNEKEKRIELSFRSKMSTMDGILSPLDIVKQAKKFNHSSIAILDHNSVQAFPDFHNLTYKDKDFKVIYGMTLSVISKRNKIFVEPLKDKFFDYKILDQEYVVYDIETTGLSPMLNELIQFGASVIKNGRIIETHHFFIKPKSKLDSFTTKLTGITQEHLEKGYELQEALEKISSIFKARIMVAHNA-AFDHNFLKQKFIDNNIEFEEMISIDTLNLAKVLNPIYRSYRLGEVASKLSVVYDPSIAHRADYDSSVLTNIFILQMSHLKEKGINLFKELNS-LSSEKFYSKMFAKDISIIAKNQAGLKELFKINSDVLTKYYFANPKMFWEDIKRSKNLLIGSGGLNSPLIDKLLFSTQEDVLNEI--DKYDYIEIPSPNNFSH-FWTTKFSDQQIKIQLQKLIKWAKEKNKIIVAIGEPRYNEKWQKIIHEIYINSTGIENSLHPLFIIKKDMDTFYPEQIYKTTNEMKQEFSFLYDPELIEEIVV-KSNLISSQIE-KIQVIKDKLYTPKFDDSHIKLKKLVYENAWKKYGKNLPEIIEQRIEKELTPILNYGFDVIYWISSILVQKSLSDGYLVGSRGSIGSSLVATLSGITEVNPLAPHYICSKCQYFELVKDPMTNSGFDLDDKKCPKCNSFLDKDGQTIPFETFLGFKADKVPDIDLNFSGEYQGKIHDEVKRLFGSKHTFRAGTISTVAEKTAYGYIKKYL-ETASLDYSDNFVDFLTEKSTGVKRTTGQHPGGIIIIPKEFDVEDFTPVNFPANDTESSWKTTHFDFHAIHDNVLKLDILGHDDPTALKMLEKLTGVNVKDIPKKDEKIISIFTSPKALGISS---EEILGEKTGALGIPEFGTNFVRQMLSEAKPKTFADLVSISGLSHGTDVWINNAHYIIQSLGKTLDQVISCRDDIMVDLIKKGVPIDLSFTIMEQVRKGKGLSLEQKKEKLIEHGIENWYIESMEKIKYMFPKAHATAYVLMAWRVAFYKVYYPLEYYATYFSTRTEFFDIEIMSKDKLTLESKIKELAYR-ENLRNDNQLTTKEKNTLPTLYIANEMKARGFNIQNINLKISLANDWIIDKNSKSLIPPFNVIDGLGETLAQKIVDSRNEKEFLSVEDFINRTGINSTLVEKFKSMGIFEQIPETNQIFL 1434
>gi|15896683|ref|NP_350032.1| DNA polymerase III (alpha subunit) [Clostridium acetobutylicum ATCC 824] >gi|15026532|gb|AAK81372.1|AE007841_7 DNA polymerase III (alpha subunit) [Clostridium acetobutylicum ATCC 824] (1452 aa)
Score = 2178, Expect = 0.0e+00, Identities = 505/1237 (40%), Positives = 750/1237 (60%)
  Q:   221 DVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVK-------AKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNE-AKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLIT----VYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAM-SNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF-EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNE-----EYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKE--KMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKA-REEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           +V K++D+  +     IEGEI  I+    K+G  +  + + D S S+  K+      + +V+S LK+   V+       +K S +++M     I  +I E   I + K   R DNA  KR EL  HT M+  + + +  +L K +   G  S+AITD    Q FP+ +    +    +K IYGV+  +     P V NA D  I D TY + D+ETTG SP  +KI E G +KY  G  ++   +F+NPE+ I  ++  +T I+++ VK+A  I +   K+ +FI  SVL+AHN   FD+ FL  N K+   + D      +DTL +++A+  Q   + LG IA+   I  +   AHRA  D +  + ++K MLE  K +  KTL +++    ++  ++     L T    +  KN   ++NLYKL+S S  + F   P++    + +++   I+ ++ +EGE+F+A +     + +EDI +D YD++ I   G+ +  + +   ++  +  I+D  ++II++  K NK VVAT D ++++  DE+Y R+    +      N+              Y RTT+E+  EFS+L       ++VVTN+N I+ + +  I PI      PHI+G    +K + Y+K++ ++GD +   V+ R+D+E+ S+I NG++++Y  +  LV +S +DGY+VGSRGSVGSS  A +  ITEVN L PHY C  CKY +F +  V +GFDLP+  CP C   L  DG +IPFETF+GF GDK PDIDLNFS  YQ KAH + + +FG+   F+AGTI T AEKTA+GYVK Y+EE K +    AEI RI++ C  +KRTTGQHPGGI+VVP G+++++F P  +PADD   D  TTH  + S+  +LLK DILGHD+PT+++ML + T +N   IP  D + M LF+ST +L +    IN   K G+ GIPEFGT FV+ MLL T P+ FSDLI ISGLSHGT+VW  NAK LI++  +T+S+ +  RDDIM+YLI KG+ P  AFKIME VRKGK L +     EY+ ++ ++ +P WYI+SC KI Y+FPKAHA AYV+MA++IAWFK++ P  +YA+YFSIR K FD + ++ G+ ++  K+ EI+     A PK K        D+    E+ LE+  RG+ F  ID+ KS AT FLVE D L PP ++I G+G+  A  I  A +EEK  SS +D KKR K+  + +  + + G    L E DQ+S F+
  S:   229 NVIKITDITPDEGRVAIEGEISNIEAKELKSGKTLVSFDLYDGSSSMTCKSFLKPGEDGEVISRLKKAKGVRLSGIAGYSKFSGEVEM-----IANVILETEGIRRAK---RQDNAKEKRVELHMHTKMSQMDAMTSATDLIKRAMSWGMKSIAITDHGVVQAFPEAHKLLGRDNPDMKIIYGVEAYLAPDKKPSVTNAKDQSI-DTTYCVLDLETTGFSPKTEKITEIGIMKYENGKVIDKFSLFVNPEKPIPARVVEVTNITDDMVKNAETIDKVFPKMLEFIKGSVLVAHNA-SFDIGFLKHNAKVLGYEFDFT---YLDTLSLAQAVFPQYKSYKLGRIAKNLGIKVE--VAHRALDDVDTTVKVFKVMLEILKERGAKTLEDVDIYSVDEESKKEEYKKLRTYHAIILAKNYVGLKNLYKLVSYSHLNYFYKRPRILKSLYKKYSEGLILGSACSEGELFQAILLGKPDEEVEDIARD-YDYLEIQPLGNDDYLIRN--GQVPNKEAIKDINRKIIELGEKLNKPVVATGDVHFIDPEDEIYRRILEAGQGFKDADNQ-----------APLYLRTTEEMLQEFSYLGREK-AYEVVVTNTNKISDMCE-QISPISPEKCPPHIDGCEQTIKDIAYEKAHELYGDPLPEIVQQRLDKELESIIKNGFSVMYIIAQKLVWKSNEDGYLVGSRGSVGSSFVANMTGITEVNSLPPHYRCPKCKYSDFSDYGVKNGFDLPDKTCPVCGEPLTKDGIDIPFETFLGFNGDKEPDIDLNFSGEYQAKAHRYTEVIFGKGTTFKAGTIGTIAEKTAFGYVKKYYEE-KSIPVNKAEIIRISRGCTGIKRTTGQHPGGIIVVPKGREIFEFCPVQHPADDPNSDIITTHFDYHSIDQNLLKLDILGHDDPTVIRMLQDITGINPHEIPMDDKETMSLFSSTKALGVTPEQINS--KVGTFGIPEFGTKFVRGMLLDTMPKTFSDLICISGLSHGTDVWLGNAKDLIDQGIVTLSEAVCTRDDIMIYLIKKGLPPNTAFKIMELVRKGKALKDPKKWAEYEALMREHEVPEWYIDSCRKIKYMFPKAHAAAYVMMAFRIAWFKVHIPKAYYAAYFSIRAKAFDAEFMIFGKEKVKQKMKEIQMMGNEAGPKDK--------DMYDDLEIVLEMYERGFNFLPIDIYKSHATKFLVEEDGLRPPINSISGMGNVAAEGIYNAMQEEKPISSIQDLKKRAKIGNSAIDSLRKFGCLKGLPESDQLSFFD 1450
>gi|154250388|ref|YP_001411213.1| DNA polymerase III PolC [Fervidobacterium nodosum Rt17-B1] >gi|154154324|gb|ABS61556.1| DNA polymerase III, alpha subunit [Fervidobacterium nodosum Rt17-B1] (1390 aa)
Score = 2175, Expect = 0.0e+00, Identities = 492/1220 (40%), Positives = 747/1220 (61%)
  Q:   237 IEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAI-NEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQN--DFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDE-FSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARN----AEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + G++FK +K+      ++   ++TD  DS ++K    +K+   V  ++  G W      +  D  +NN     +E I+ I       R DNA+ KR EL  HT M+  + +++I E    + + G+ ++AITD  N Q  P+F++ AK  + LK I+G +  + +    I++N  +  + D TYV+ D+ETTGL+P  D+I+E GA+K   G  ++    F+ P  K++ K   IT I+ + +KDA  I + L K+ +FI DS+L+AHN   FD+ FL   L ++ ++    P IDTL++S+A+   +I   SL  +   + +     Q HRA  DA   +N++ +++E  K + I T  ++N  ++N    ++       +TV  +N+  ++NLYKLIS + T  F   P+V      +     ++       EIFE A+      L + +K  YD+I I      L  I+ E + R   ++A K + ++  + N  VV  S+ ++++  D            +  ++  L   + +      YY RTT E+ D       D  +  ++VV N   IA++ID  I+P+++ LH P IEGA +KL+ + Y+K+Y ++G+ +   V+ RI++E++S+I +GYA++Y  +HL+VK++ +DGYVVGSRGSVGSS+ A LV ITEVNPL  HY C +CKYF   +   SG+DLP+  CPKC +KL+  G +IPFE FMGF+GDK+PDIDLNFS  YQ +AH FI+ +FG+ +VFRAGTIST A+++A GYVK+Y E+ K  N  N    AE  R+      VKRTTGQHPGG+++VP+  ++YDFTPF +PA+DK    +TTH A+E +HD L+K D LGHD+PT++++L E + ++  TIP  D   + +F+ST +L +    +      G+ GIPEFGT+FV  ML  T+P+ F++L+RISGLSHGT+VW  NA+ LI +K  T+SDVISCRDDIM+YLI KG+    AFKIME+VRKGKGL EE   ++ ++N+P W+IESC KI YLFPKAHA AYV MA++IA+FK++YPL FYA+YFS +   FD + IL G+  I  ++ E+   M   K     KN+E     + + ALE+L RGY F   DLK+S A  F+++G  L+ PF+ I G+G++VA SIV+ R EK ++S ED   R +VT   +++++ +G+   L E DQ  LF
  S:   211 VYGKVFKFEKI----NDDLSTIYITDKKDSTILKVFDSRKLA--VEEKVNVGSWYIFTGKVLTD--KNNSPFLKVENITEIP---SLDRVDNAVEKRVELHAHTKMSDLDSVMDISEYVSTAKKWGWEAIAITDHGNVQAIPEFFDIAKS-AGLKPIFGSELYLANDPKRIMMNEIEGNVDDYTYVVLDLETTGLNPRSDEIMEIGAVKTRDGKVIDEFHTFVRPN-KLNKKSLNITGITEDMLKDAPDIMQVLPKLLEFIKDSILVAHNA-DFDMTFLKNILSKSGIEF-NPPYIDTLRLSQALLRNKIKSFSLDKLVDHFGLG--AFQHHRALDDARVTVNVFWKLIELAKKKSITTFEKLNKLVENINPLVKHPQH---VTVLVRNKTGLKNLYKLISKAHTETFFVVPQVLKSELEKHREGLLIGTGCANSEIFELALQRDTGALTEALK-FYDYIEIMP----LDTINSEEFTREEAKEAYKLLYQVGKELNMPVVMVSNAHFIDPED------------IKARKVLLAPQSNIEDEEANYYLRTTQEMIDAALEIFEDEQIAKEVVVDNPKKIANMIDT-IQPLEKKLHPPKIEGAEEKLRTMTYEKAYQLYGNPLPEIVEKRIEKELNSIIGHGYAVLYMIAHLIVKKAGEDGYVVGSRGSVGSSLVAHLVGITEVNPLPAHYRCPDCKYFELHEEFGSGYDLPDKLCPKCGAKLEKVGQDIPFEVFMGFEGDKVPDIDLNFSGEYQERAHKFIEELFGKSKVFRAGTISTIADRSAIGYVKAYMED-KNGNIVNPLNPAEQERLTMYVTGVKRTTGQHPGGLMIVPNEYEIYDFTPFQHPANDKKSGVYTTHFAYEFIHDDLIKLDALGHDDPTMIRLLYEYSGIDPMTIPMDDKKTISIFSSTKALGVDPEELGT--DVGTIGIPEFGTDFVMGMLRETRPKTFAELVRISGLSHGTDVWLGNAQTLINKKIATLSDVISCRDDIMIYLIHKGVPHSNAFKIMENVRKGKGLKEEEINIMKEHNVPDWFIESCQKIKYLFPKAHAVAYVSMAFRIAYFKVHYPLAFYAAYFSTKGDEFDAELILKGKEAIKKRLVELAASM---KKDVKEKNEE----KVLQAALEMLLRGYGFKKPDLKRSDAKRFIIDGKDLLIPFNKIHGIGENVANSIVEKRAEKPYTSIEDLMNRARVTKAQVEVLKRIGVLDGLPETDQAMLF 1390
>gi|148377333|ref|YP_001256209.1| DNA polymerase III PolC [Mycoplasma agalactiae PG2] >gi|148291379|emb|CAL58763.1| DNA polymerase III alpha subunit [Mycoplasma agalactiae PG2] (1459 aa)
Score = 2173, Expect = 0.0e+00, Identities = 544/1420 (38%), Positives = 819/1420 (57%)
  Q:    37 NKQNDSINIKISFNKVLPADILIPFVDSLNLVDDSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIIS--DHKNKIQEKIKNEI----TEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLS--DLFFEMKTATIE--GEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGV-------WVKAKISI-QIDMYENNDITGLIEEISIISKP---KEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDK-NIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQV-ESIQMFINPEEKISDKIFAITKISNEDV-KDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSAT-EGEIFEAAMSNTQQVLEDIIKD--KYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYN---ELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEK--NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDY--LIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +  N+ + I+  F   +  + +      + L  D +  + V + D+YN+  IL Y+   +            +K     + + N   K  +   +      ++ D E      L      L +YGF   + SY   + + +  S  +   K  EKIK E+     E+  SS+   + +S   K +++     T  S  DL        +E  G +F   K  +K      ++ V+D+  ++         ++ D LS  ++ +       WVK K SI   +  + N+    ++ + +   P   KE I  ++   KR E    T M   +GL N  +  + +      +V I D    Q +P  +N+AKK + +KAIYG  F  I+K N  I+ N  +    D +YV FDIETTGLSP + +IIEFGA+  ++ ++V E  Q FI P+ KI      +T I+ + +  + L IK+ L +I D +   V IAHN  KFD  FL  +   N +      +IDTL  SR        H L  +  +  + YD   AHR D DA+ L N+W  ++     ++I T  ++ +   ND   + +   + T+   N+G ++  ++LI+  LT  F  GP  + E+F   + S ++  S T +G + +    ++    +D IK+   YDFI I +P+CF H I         + D +  II  A K++K  +AT+D  YL+  D+  F   V AK +   R+ LF Y    E   V+P   F TTDE+ ++F+FLND  L  +IV+ N+  IA++ + NI+ IK  L +P  + +  KL  L+Y+ +++ +G+ +   ++ RID E++ +I  G+ +IYW S+ LVK S+D G++VGSRGS+GSS  A L+ I+EVNPL PHY C  CK+F       + SG+DLP+  CP+C +K+KGDG +IPFETF+GF  DK+PDIDLNF+  +QG  H+ I  +FGE   FRAGTIS  AEKTA+GYVKSY E++++ N     +  +A + ++VKRTTGQHPGGI+++P   D++DFTP NYPA+D++  W TTH  ++++HD++LKFDILGHDNPT +K+L + T +N   +P  D  V+ LF+ST+ + IK   I+   KTG+ G+PEFGT+FV++ML   KP+  +DLI ISGLSHGTNVW +NA  L+ EKG  +++V+ CRDDIM  LI KGI P+++F +ME VRKGKGL+ E   +L  +N+P W I+S  KI YLFPKAHATAYV MA  IAWFK+Y PL FYASYF+   K  DI+++++  + I     ++ +++   K      NKE DLI ++E+A EL  RG+  +N+D+ KS A  +L++ +   LIPPFS I+ LG   A  IV AR EK F SKEDFK RT V+ T    M  + I  SLN+ DQ++LF
  S:    38 DNSNEKLKIEFRFKNPISYETIKKIKSFIRLNKDRLDVSFVVSNDSYNKNSILQYVYQII------------DKTRFKTLNQINWENKFYVDDNHTGHFENIDRDFENQYGILLSKLLNKLKEYGFVLLNFSYDYIQSSPESYSKSEEAAKQNEKIKQELLKKMIELDSSSDKYDSYNSNPLKVKRNFNKSYTTYSIKDLATAPNRINVEFVGLLFASKKSFSKNKKLTIQFKVSDFQSAVNCTWF----LDTDWLSNEQKNLINPDNQSWVKVKGSIPSAEKIKGNNFFIYVDSLELTDSPLNIKEDIVSEDR--KRVEFHISTKMNTMDGLFNADDFVERAKRWKMPAVGIMDTDGAQGYPKLFNKAKK-AGIKAIYGTAFTTINKANEAILGNVPNGNFKDYSYVSFDIETTGLSPKFHEIIEFGAVDINQDLKVGEVTQFFIKPQAKIGAFTTELTGITQQMLDSEGLSIKDGLQRIYDCLDGKVAIAHNA-KFDFNFLKEQFRLNNVPFPNVTVIDTLIASRIGFPNYKRHKLEDVTSRLGVVYDPNVAHRGDYDAKVLANVWVNIISELNSKNIFTFEDLGNFTSNDLYAKMHGYEVSTIALNNKG-LKKQFELITDCLTKKFINGPITFKEDFVNLDRSDVLVGSGTLKGLLIDKYFYSSH---DDFIKELKHYDFIEIPAPQCFEHWIKYGFITTKQLHDGLSEIISEAKKHSKICIATADVKYLDPWDKEIFMSLVYAKGIKNARHYLFDYKKAEEGKLVIPNQRFLTTDEMLEQFAFLNDKKLAEEIVIDNTQKIANMAE-NIEVIKTGLFTPEFDDSKKKLHDLVYKNAHAKYGENLPELIQKRIDSELNPIIKYGFDVIYWISYKLVKLSIDQGFIVGSRGSIGSSFVASLIGISEVNPLVPHYCCPKCKHFEIANVSGITSGYDLPDKTCPQCHTKIKGDGQSIPFETFLGFNADKVPDIDLNFTGEFQGVVHEEILKLFGESHTFRAGTISKVAEKTAFGYVKSYAEQTRQ-NIPQIFVEFLANRIKDVKRTTGQHPGGIIIIPKQFDIFDFTPINYPANDQSSSWLTTHFDYKAIHDNVLKFDILGHDNPTSIKLLEQYTGINIYDVPKNDESVIKLFSSTEPMGIKPDQISN-EKTGAIGLPEFGTSFVRQMLNDIKPKTVADLISISGLSHGTNVWINNADELVLEKGRKLNEVVCCRDDIMPMLIAKGIEPLMSFTLMEKVRKGKGLSNEEVGLLEKHNVPDWLIKSMQKIEYLFPKAHATAYVTMALWIAWFKLYEPLAFYASYFTAHSKADDIENMIDKPNGI-----KVSKRLYELKKTEDRSNKENDLIGVFEVAEELYARGFYISNVDIDKSQAEKWLIDKERGCLIPPFSTIESLGSVKANDIVNARAEKAFLSKEDFKIRTGVSKTVFDTMNRMKILDSLNDSDQLTLF 1459
>gi|164688523|ref|ZP_02212551.1| hypothetical protein CLOBAR_02168 [Clostridium bartlettii DSM 16795] >gi|164602936|gb|EDQ96401.1| hypothetical protein CLOBAR_02168 [Clostridium bartlettii DSM 16795] (1432 aa)
Score = 2172, Expect = 0.0e+00, Identities = 513/1232 (41%), Positives = 763/1232 (61%)
  Q:   225 LSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKD-VLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQN-DFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI------KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTN--CKYFNFEK--NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD-YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + D+    KT  I GEIF I+    K G  +    VTD + SI  K LF   +N+D VLS++ EG  V+ K  +  D ++  ++T  I  I +  K     R D A  KR EL  HT M++ + L   K+L K +S+ G+ ++AITD    Q FP+   +A K + +K +YGV+  +++ N PI+  AND  +S  T+V+FD+ETTG S   DKI E GA+K      V+     INPE+ IS K+  +T I+N+ +KD   I+E L K  +F+GDSVL+AHN  +FD+ F+N K +E  ++  KN  +DTL ++R +   +    L  + ++  +       HRA  DA     I+ + L+  + +  K L+++N  L   D+ + + +   IT+  +N   ++NLYK++S +  ++F   P++      E     IV ++   GE+F+A   N        I D YD+I     E    D +R + + G ++D        +R+I+IA K+ K  VAT D +++++ + V+ RV         K ++ F  ++  T L   +FRTTDE+ +EF +L +  L  ++VV N+N +A +++ +  PI      P IEG+  +L+++ Y K+  I+GD M   VK R+DRE++S+I NGYA++Y  +  LV +S+ DGY+VGSRGSVGSS+AA + DITEVNPL  HYIC N  CKY  F       SG DLP+ +CPKC  KLK DGH+IPFE F+GF+GDK PDIDLNFS  YQ   H + + +FGE  V+RAGTI T A+KTAYGY K Y EE+  ++  +AE+ R+AK C  VKRT+GQHPGG++V+P+ K+VYD TP  YPA+D      TTH  + S+   +LK DILGHD PTI++M+ + T ++A TIP  D + M +F ST++L +    IN     GS  IPEFGT+FV++MLL TKP  F++L+RISGLSHGT+VW +NA+ L+ +K +   DVIS RDDIM YL+ KG+ P +AF IME+VRKGKGL  E+ + +N +++P WY++SC KI Y+FPKAHA AYV+M++++A++K++YP  FYA+YF+ + + FD   I+ G   I  KINEI E + N  T      K+  ++ + E+ALE+  R  K   +D+ KS AT F+V  D  ++PP  A+ G+G++ A +I K RE   F SKED +KRTK++ T ++ +   G  + ++E +Q+SLF
  S:   228 ICDIDKNAKTVCIVGEIFNIETKELKNGKILLIADVTDNTSSISCK-LFLNDLNQDKVLSKISEGTNVRIKGDVIYDTFKR-ELTMTISGIRLEDKKP---RVDKADKKRVELHAHTQMSSMDALCQTKKLVKQASQWGHKAIAITDHGVVQAFPEAM-DAGKANGIKILYGVEGYLVEDNAPIIREANDKDLSQ-TFVVFDLETTGFSNKNDKITEIGAVKVKNFEIVDRFNELINPEKDISYKVQELTGITNDLIKDKPTIEEILPKFMEFVGDSVLVAHNA-EFDIGFINQKCKEMNIEF-KNKSVDTLMLARILLPHLKRFKLNNLTKELGVPLH--NHHRAVDDAAATAQIFIKFLDMLQKKGAKKLSDVNEVLGGIDYTKLKTKH--ITLIAQNLVGVKNLYKIVSDAHVNHFYRAPRILKSVLLEHKEGIIVGSACEAGEVFQAVKQNKNDDEIKEIIDLYDYI-----EVMPIDNNRFMIRNGEVKDEDELRDLNRRMIEIAKKFGKIPVATGDVHFIDKHEAVFRRVL--------KYSQGFSLDDEETYL---HFRTTDEMLEEFKYLGEE-LAYEVVVENTNKVADMVE-DFLPIPNETFPPVIEGSDTELREMCYNKAKRIYGDPMPEVVKKRLDRELNSIISNGYAVMYIIAQKLVTKSLADGYLVGSRGSVGSSLAATMSDITEVNPLPAHYICENEDCKYSYFYAVGEWGSGVDLPDKDCPKCGRKLKKDGHDIPFEVFLGFEGDKEPDIDLNFSGSYQPVIHKYTEELFGEGHVYRAGTIGTVADKTAYGYAKKYVEEND-LDVPSAEVLRLAKGCTGVKRTSGQHPGGVMVIPNYKEVYDITPIQYPANDVNCGVITTHFDYHSISGRILKLDILGHDVPTIIRMIEDITGLDATTIPLDDKETMSIFTSTEALGVTPEEIN--CPIGSLAIPEFGTSFVRQMLLDTKPTTFAELVRISGLSHGTDVWLNNAQDLVVDKVVEFKDVISTRDDIMNYLLFKGLPPKMAFTIMENVRKGKGLKPEFIEEMNKHDVPQWYVDSCQKIKYMFPKAHAVAYVMMSFRLAYYKVHYPAAFYATYFTTKAQDFDADLIVGGLDSIKQKINEIHE-LGNDATA-----KDKTMLTVLEVALEMYARKIKIIPVDIYKSDATKFIVVDDSTILPPMIALQGVGENAAINIQKERESGEFISKEDLRKRTKISKTVVETLSNHGSLNDMSEKNQLSLF 1432
>gi|109648713|ref|ZP_01372612.1| DNA polymerase III, alpha subunit [Desulfitobacterium hafniense DCB-2] >gi|109640010|gb|EAT49566.1| DNA polymerase III, alpha subunit [Desulfitobacterium hafniense DCB-2] (1447 aa)
Score = 2171, Expect = 0.0e+00, Identities = 486/1260 (38%), Positives = 751/1260 (59%)
  Q:   199 RSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNE-AKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLIT----VYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF-EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNE----EYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKE--KMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           ++ + KK+D         ++   V K++D+  +     ++GE+  I+    K+G  +  + + D S SI  K+      + +V+S L++   VK   +     + + +I  +   I      K++IR D A  KR EL  HT M+  + +    +L K +   G  ++AITD    Q+FP+ +    +    +K IYGV+  +     P V +     I D TY + D+ETTG S   +KI E G +K   G  ++    F+NPE+ I  ++  +T I+++ V+DA  I +   KI +FI  SVL+AHN   FD+ FL  N K+     D      +DTL +++ +      + LG IA+   I  +   AHRA  D    + ++  M++  K + ++TL +I+    ++  R+     L T    +  K+   ++NLYKL+S S    F   P++    + +++   I+ ++ +EGE+++A +    +   + I ++YD++ I   G+ +  +     ++  + ++ +  ++I+ +  K NK VVAT D ++L+  DE+Y R+         +  + FK  +     P  Y +TT+E+ +EFS+L +     ++VVTN+N IA L +  I PI     +PHIEG  + +K++ + K++ ++G+ + + V+ R+DRE+ S+I NG++++Y  +  LV +S +DGY+VGSRGSVGSSVAA++  ITEVN L PHY C +CKY +F +     GFDLP+  CP C ++L  DG +IPFETF+GF GDK PDIDLNFS  YQ KAH + + +FG+   F+AGTI T A+KTA+GYV+ YFEE K   A  AEI RI+K C  +KRT+GQHPGGI+VVP G+++++F P  +PADD   D  TTH  + S+  +LLK DILGHD+PT+++ML + T V+  TIP  D   M LF+ST++L +    IN   K G+ GIPEFGT FV+ MLL T P+ F DLI ISGLSHGT+VW  NAK LI+   +T+S+ +  RD+IM YLI KG+ P  AFKIME VRKGK L E    EY+ ++ ++++P WYI+SC KI Y+FPKAHA AYV+MA++IAWFK++ PL +YA+YF+IR K FD + ++ G+ ++  K+ EI+     A PK K        D+    E+ LE+  RG+ F  ID+  S AT F VEG+ L PP ++I G+G   A  +  A +EK F+S ED KKR K+  + M+++ +      + E DQIS F+ 
  S:   203 KADDGKKSDPQLILGRNAAIKDKVIKVTDITPDEGKIALQGELSNIEAKELKSGKTLVSFDLYDGSSSITCKSFLKPGEDSEVVSRLQKAKGVKLSGNAGFSKF-SGEIEVIAHTIVETEGVKKYIRQDLAKAKRVELHLHTQMSQMDAMSGATDLIKRAMNWGMKAIAITDHGVVQSFPEAHKLLGRDNPNMKVIYGVEAYLAPDKKPSVTHPKGQSI-DTTYCVLDLETTGFSAATEKITEIGIMKIQGGKIIDQFGCFVNPEKPIPARVVEVTNITDDMVRDAETIDQVFPKILNFIEGSVLVAHNA-DFDMGFLKHNAKVLGYDFDYT---YLDTLSLAKELFPDYKTYKLGRIAKNLGIKVE--VAHRALDDVGTTVKVFNIMVDMLKERGVETLEDIDLKAADEAARKDEYKKLKTYHAIILAKDYTGLKNLYKLVSYSHLDYFYKKPRILKSLYKKYSEGLILGSACSEGELYQAILLGRSEEEIESIAEEYDYLEIQPLGNNDYLIRT--EQVPGKDYLMEINRKIVALGEKLNKPVVATGDVHFLDPEDEIYRRIL--------EAGQGFKDADQQ---PPLYLKTTEEMLEEFSYLGEDK-AYEVVVTNTNLIADLCEP-ISPISSEKATPHIEGCEETIKEIAFGKAHELYGNPLPDIVQQRLDRELDSIIKNGFSVMYIIAQKLVWKSNEDGYLVGSRGSVGSSVAAYMTGITEVNALPPHYRCPSCKYSDFSDHGPKIGFDLPDRECPVCGTQLDKDGIDIPFETFLGFNGDKEPDIDLNFSGEYQAKAHKYTEVIFGKGTTFKAGTIGTIADKTAFGYVRKYFEE-KNRTANKAEIIRISKGCTGIKRTSGQHPGGIIVVPKGREIFEFCPVQHPADDPNSDIITTHFDYHSIDQNLLKLDILGHDDPTVIRMLQDITGVDPKTIPMDDKKTMSLFSSTEALGVTPEQINS--KVGTFGIPEFGTRFVRGMLLDTLPKAFEDLICISGLSHGTDVWLGNAKDLIDAGTVTLSEAVCTRDEIMTYLIRKGLPPNTAFKIMEIVRKGKALKEPKWPEYETLMREHDVPEWYIDSCRKIKYMFPKAHAAAYVMMAFRIAWFKVHIPLAYYAAYFTIRAKAFDAEFMIFGKEKVKAKMKEIEALGNQAAPKDK--------DMYDDLEIVLEMYERGFSFLPIDIYASHATKFQVEGNALRPPLNSISGMGTIAAEGLYNAAQEKPFNSLEDVKKRGKIGNSTMELLSKFDCLKGIPESDQISFFDL 1445
>gi|89897057|ref|YP_520544.1| hypothetical protein DSY4311 [Desulfitobacterium hafniense Y51] >gi|89336505|dbj|BAE86100.1| hypothetical protein [Desulfitobacterium hafniense Y51] (1447 aa)
Score = 2168, Expect = 0.0e+00, Identities = 485/1260 (38%), Positives = 751/1260 (59%)
  Q:   199 RSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNE-AKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLIT----VYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF-EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNE----EYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKE--KMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           ++ + KK+D         ++   V K++D+  +     ++GE+  I+    K+G  +  + + D S SI  K+      + +V+S L++   VK   +     + + +I  +   I      K++IR D A  KR EL  HT M+  + +    +L K +   G  ++AITD    Q+FP+ +    +    +K IYGV+  +     P V +     I D TY + D+ETTG S   +KI E G +K   G  ++    F+NPE+ I  ++  +T I+++ V+DA  I +   KI +FI  SVL+AHN   FD+ FL  N K+     D      +DTL +++ +      + LG IA+   I  +   AHRA  D    + ++  M++  K + ++TL +I+    ++  R+     L T    +  K+   ++NLYKL+S S    F   P++    + +++   I+ ++ +EGE+++A +    +   + I ++YD++ I   G+ +  +     ++  + ++ +  ++I+ +  K NK VVAT D ++L+  DE+Y R+         +  + FK  +     P  Y +TT+E+ +EF++L +     ++VVTN+N IA L +  I PI     +PHIEG  + +K++ + K++ ++G+ + + V+ R+DRE+ S+I NG++++Y  +  LV +S +DGY+VGSRGSVGSSVAA++  ITEVN L PHY C +CKY +F +     GFDLP+  CP C ++L  DG +IPFETF+GF GDK PDIDLNFS  YQ KAH + + +FG+   F+AGTI T A+KTA+GYV+ YFEE K   A  AEI RI+K C  +KRT+GQHPGGI+VVP G+++++F P  +PADD   D  TTH  + S+  +LLK DILGHD+PT+++ML + T V+  TIP  D   M LF+ST++L +    IN   K G+ GIPEFGT FV+ MLL T P+ F DLI ISGLSHGT+VW  NAK LI+   +T+S+ +  RD+IM YLI KG+ P  AFKIME VRKGK L E    EY+ ++ ++++P WYI+SC KI Y+FPKAHA AYV+MA++IAWFK++ PL +YA+YF+IR K FD + ++ G+ ++  K+ EI+     A PK K        D+    E+ LE+  RG+ F  ID+  S AT F VEG+ L PP ++I G+G   A  +  A +EK F+S ED KKR K+  + M+++ +      + E DQIS F+ 
  S:   203 KADDGKKSDPQLILGRNAAIKDKVIKVTDITPDEGKIALQGELSNIEAKELKSGKTLVSFDLYDGSSSITCKSFLKPGEDSEVVSRLQKAKGVKLSGNAGFSKF-SGEIEVIAHTIVETEGVKKYIRQDLAKAKRVELHLHTQMSQMDAMSGATDLIKRAMNWGMKAIAITDHGVVQSFPEAHKLLGRDNPNMKVIYGVEAYLAPDKKPSVTHPKGQSI-DTTYCVLDLETTGFSAATEKITEIGIMKIQGGKIIDQFGCFVNPEKPIPARVVEVTNITDDMVRDAETIDQVFPKILNFIEGSVLVAHNA-DFDMGFLKHNAKVLGYDFDYT---YLDTLSLAKELFPDYKTYKLGRIAKNLGIKVE--VAHRALDDVGTTVKVFNIMVDMLKERGVETLEDIDLKAADEAARKDEYKKLKTYHAIILAKDYTGLKNLYKLVSYSHLDYFYKKPRILKSLYKKYSEGLILGSACSEGELYQAILLGRSEEEIESIAEEYDYLEIQPLGNNDYLIRT--EQVPGKDYLMEINRKIVALGEKLNKPVVATGDVHFLDPEDEIYRRIL--------EAGQGFKDADQQ---PPLYLKTTEEMLEEFAYLGEDK-AYEVVVTNTNLIADLCEP-ISPISSEKATPHIEGCEETIKEIAFGKAHELYGNPLPDIVQQRLDRELDSIIKNGFSVMYIIAQKLVWKSNEDGYLVGSRGSVGSSVAAYMTGITEVNALPPHYRCPSCKYSDFSDHGPKIGFDLPDRECPVCGTQLDKDGIDIPFETFLGFNGDKEPDIDLNFSGEYQAKAHKYTEVIFGKGTTFKAGTIGTIADKTAFGYVRKYFEE-KNRTANKAEIIRISKGCTGIKRTSGQHPGGIIVVPKGREIFEFCPVQHPADDPNSDIITTHFDYHSIDQNLLKLDILGHDDPTVIRMLQDITGVDPKTIPMDDKKTMSLFSSTEALGVTPEQINS--KVGTFGIPEFGTRFVRGMLLDTLPKAFEDLICISGLSHGTDVWLGNAKDLIDAGTVTLSEAVCTRDEIMTYLIRKGLPPNTAFKIMEIVRKGKALKEPKWPEYETLMREHDVPEWYIDSCRKIKYMFPKAHAAAYVMMAFRIAWFKVHIPLAYYAAYFTIRAKAFDAEFMIFGKEKVKAKMKEIEALGNQAAPKDK--------DMYDDLEIVLEMYERGFSFLPIDIYASHATKFQVEGNALRPPLNSISGMGTIAAEGLYNAAQEKPFNSLEDVKKRGKIGNSTMELLSKFDCLKGIPESDQISFFDL 1445
>gi|118443832|ref|YP_878213.1| DNA polymerase III PolC [Clostridium novyi NT] >gi|118134288|gb|ABK61332.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium novyi NT] (1444 aa)
Score = 2167, Expect = 0.0e+00, Identities = 493/1243 (39%), Positives = 754/1243 (60%)
  Q:   214 FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKN-PLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMS-NTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIR-IKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           F + V G++  + ++        I G+IFK++ + TK+G +I  +F+TDY+ SI +K     K   ++L E+K G+  K +     D +   ++  +  +I   SK ++    D    KR EL  HT M+A +GL +   L + +++ G+ +VAITD    Q FP+  + AKK++ +K IYGV+  +++  +PI  N  +  I D T+V+FD+ETTG S  YDKIIEFGA+K   G  ++S   F+NPE KI  KI  +T I+N+DVKDA  I + L K   F   +VL+AHN   FD+ F+  NCK     ++I  N  ++DT+ +++ +  ++  + L  IA+   +  +    HRA  DA+   +I     +  K  +I  L+++N+    +   ++     + +  KN+  ++NLYKLIS S    F   P++      ++    I+ ++   GE+++A +   + + L++IIK  YD++ I         + + I K +  +++  ++I ++    N  VVAT D ++L+  D  +  + +  +      N+           P  Y +TT+E+  EF +L + +   ++V+ N   IA+ ++  +KPI +    P I+GA + ++ +  +K+YSI+G+ +   V  R+++E++S+I+NGYA++Y  +H LV +S++DGY+VGSRGSVGSS+ A + DITEVN L PHY+C NCK   F  + +V SG DLP   CPKC +    DGH+IPFETF+GF GDK PDIDLNFS   QG  H + + +FG+   F+AGTI T A+KTAYG+VK Y +E K M    AEI R+ + C  VKRT+GQHPGGI+VVP   ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++   IP  D  V+ LF S ++L +    +      G  GIPEFGT FV++ML+ TKP+ FSDL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ KG+ P  AF IME VRKGKGL+EE++ ++ ++ +P WYIESC KI Y+FPK HA AYV+MA +IA++K+YYP  +YA+YF++R I  FD   I+ GE  I  K++EI   + N  T+     K+  L+   ELA E+  R  KF  +D+ KS  T FL+EG+Y+  P  ++ G+G + A SI  ARE   F SKED +KR+KV+ T ++ + E G    L + +Q+SLF
  S:   230 FGRDVQGEIEDMVNINETSGVVNICGDIFKVNIIETKSGRKIITFFITDYTSSITVKCFPKPKETDELLEEIKAGLHCKVRGEAVHDSFAR-EVVIMARDIVKTSKLEKM---DTCEEKRVELHMHTQMSAMDGLSSATSLIERAAKWGHPAVAITDHGVVQAFPEAMDAAKKFN-IKVIYGVEAYLVNDGVPIATNVKNQNIDD-TFVVFDLETTGFSSQYDKIIEFGAVKIKNGNIIDSFSAFVNPEIKIPYKITELTSITNDDVKDAETIDKVLPKFIKFAEGTVLVAHNS-NFDMSFIRKNCK----DLNIECNYTVMDTIPLAKFLFPELKRYKLNTIAKHLGVSLE--NHHRAVDDAKATGDILVHCFKLLKEMNITYLDDLNNKFLGNIDVKKLPTYHLIILAKNQVGLKNLYKLISFSNLDYFYKKPRMPKSLIEQYKEGLIIGSACEAGEVYKAVLEGKSNEDLKEIIK-FYDYLEIQPIMNNEFMLRKGIVKNQDQLKEINRKIYELGINNNMPVVATGDVHFLDPKDGKFREILMAGQGFSDAENQ-----------PPLYLKTTNEMLKEFEYLGEDI-AKEVVINNPQKIANAVEF-VKPIPDETFPPKIDGAEEDIRNMTLEKAYSIYGNPLPKVVHDRLEKELNSIINNGYAVLYLIAHKLVAKSLEDGYLVGSRGSVGSSLVATMSDITEVNGLPPHYVCPNCKNSEFFTDGSVSSGADLPPKKCPKCGADYNRDGHDIPFETFLGFNGDKEPDIDLNFSGDNQGDIHKYTEVLFGKGHTFKAGTIGTIADKTAYGFVKKYLDE-KNMVVSQAEIERLTQGCTGVKRTSGQHPGGIMVVPSDNEIYNFCPIQHPADDANSDIITTHFDYHSISGRLLKLDILGHDDPTVLRMLKDITGLDPIKIPIGDEKVLSLFTSPEALGVTAEELE--CPVGCYGIPEFGTKFVRQMLVDTKPKTFSDLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLLHKGLPPKDAFTIMEKVRKGKGLSEEHEALMREHKVPDWYIESCKKIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYATYFTVRGIDDFDADLIVKGEEVIKRKMDEIN-ALGNSATQ-----KDKGLLTNLELAFEMYKRNIKFLKVDIYKSHPTKFLIEGNYIRLPIGSLSGVGLNAAKSIADAREGGEFISKEDLRKRSKVSKTVIEALSEHGCLEGLPDTNQLSLF 1444
>gi|51892650|ref|YP_075341.1| DNA polymerase III alpha subunit [Symbiobacterium thermophilum IAM 14863] >gi|51856339|dbj|BAD40497.1| DNA polymerase III alpha subunit [Symbiobacterium thermophilum IAM 14863] (1475 aa)
Score = 2160, Expect = 0.0e+00, Identities = 464/1228 (37%), Positives = 722/1228 (58%)
  Q:   231 EMKTATIEGEIFKIDKVVTKTGYEIYKYFVTD--------YSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNA-NDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLEN-QKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHR-EIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN--VDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEER-VFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTE-------QTNVNADTIPNFDNDVMDLFNSTDS--LKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEI--KEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD-YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           E     IEGE+  +D    K+G ++  + V D        + D++ +K     + + D L+ LK G WVK + ++Q+D + + ++T L +++ +  +P     ++  + KR EL  HT M+A + L++  EL K +   G+ +VAITD    Q FP   +  K     + IYG +  ++D    +V     D  ++ A +V+ DIETTG SP  D IIE GA++   G  V+S Q F+ P + +  ++  +T I+ + ++ A +  EAL     F+GD++++AHN  +FD  FL    ++   +   NP++DTL ++RA+   +  HSL  + ++ ++       HRAD DA+    +  ++LE  + ++ +  LN +   +  + LR  +     TV  K +  ++NLYKLIS S    F+  P+V      +     +V +S   G++F+A +        + +   YD++ I   +C    +   ++     +    +RI ++  K  K V A SD ++L+   +V+ R+  +      + +R F            Y RTT E+ DEF++L +     ++VV N N IA+ I+  +K + + LH P +EG+ ++ ++L ++K   ++GD +   +  R+++E++++I NG+A+ Y+ SHLLVK+S++ GY+VGSRGSVGSS  AW +DITEVN L PHYIC  CKY  +  +    SGFDLP  +CP+C + L  DG +IPFETF+GFKGDK+PDIDLNFS   Q +   + + + G E+ VF+AGT+ T AEKTA+G V+++ EES+    R A I  +A+    VKRTTGQHPGG+VV P G ++ + TP  YPADD++    TTH  + S   +L+K DILGHD+PT+LKML +         + +   +P  D  V+ LF+   +  L I++  +      G+  +PE GT FV++ML+ T P+ FSDL+RISGLSHGT+VW +NA+ L++ KG+   DVI CRDDIMV LI  G+ P  AFKIME VRKGKGL  E ++ +   N+P WYI SC +I Y+FPKAHA AYV+   +IAWFK++ PL FYA+Y S+R    D   ++ G   +   + EI  K K A PK K        D +  YEL  E   RG +F  +DL +S AT +L++G+  L+ PF+A+ GLGDS A +IV+AR +  F SKED K R ++    M+++E  G    L E +Q+ +F F
  S:   258 EENKVVIEGEVVGLDTRDLKSGRQLIAFGVCDLLRSEPGEFGDTLPVKLFRDPQKDPDYLAVLKNGTWVKVRGNVQLDKF-SGELTMLADDVVVGKRPTREDTYEGPM-KRVELHAHTTMSAMDALIDPAELVKTAVRWGHKAVAITDHGVVQAFPA-ASHVKVPDDFRVIYGCELFLVDDGTAVVQRPPKDVPLAGAEFVVLDIETTGFSPIGDDIIELGAVRCRGGEIVDSFQSFVRPTKPVPPEVQKLTNITPDMLEGAPEAAEALRAFFQFVGDAIVVAHNA-QFDYSFLRYHRQKYLGEEFANPVLDTLTLARAVLPHMRSHSLAALTKELQVPL--VDHHRADADAKTAAMVLMKLLERAEGVETVADLNRLTKGINVEQLRPYH----TTVLVKTQAGMKNLYKLISLSHIEYFNRTPRVPRSELEKHREGLLVGSSTYGGQLFDALIRGVPDEELEQMASWYDYLEILPRDCLAFLLESGQVNSEEQLLSLNRRIYELGKKLGKPVCAVSDAHFLDPHQQVFRRILKHGIGFRDEYDRPF------------YLRTTQEMLDEFAYLGEQA-AYEVVVENPNAIAAQIE-KVKVVPDKLHPPVLEGSVEETRRLSWEKVKRVYGDPVPEKIAHRLEKELNAIIGNGFAVSYYISHLLVKKSMELGYLVGSRGSVGSSFVAWAMDITEVNALPPHYICPQCKYLEWHDDGKTGSGFDLPRKDCPRCGTPLDRDGQDIPFETFLGFKGDKVPDIDLNFSGEVQNRIQKYSEELLGGEKYVFKAGTVGTIAEKTAFGMVRAWLEESRITGVREAHIGYLAQGLAGVKRTTGQHPGGMVVCPVGMEIEEVTPVQYPADDRSSGVKTTHFDYHSFEQALMKLDILGHDDPTMLKMLQDLYREKKGDPDFDVRKVPVDDPQVLALFSPGGNRVLGIEDGKLQ--FDLGTIVLPEMGTRFVRQMLMETSPRNFSDLVRISGLSHGTDVWTNNAQELVK-KGIPFQDVIGCRDDIMVQLIYWGVEPATAFKIMESVRKGKGLTPEMEETMRACNVPDWYIWSCKQIKYMFPKAHAAAYVLSCLRIAWFKVHEPLLFYAAYLSVRAGSVDANLLVAGPEAVRRYVQEIEAKGKDATPKEK--------DSLTEYELVEEAFLRGIRFNRVDLYRSEATRYLIDGENTLLCPFNALPGLGDSAAQAIVEARAQGPFHSKEDLKNRARLNKAVMELLEGHGCLEGLPEGNQL-VFGF 1475
>gi|170016990|ref|YP_001727909.1| DNA polymerase III, alpha subunit [Leuconostoc citreum KM20] >gi|169803847|gb|ACA82465.1| DNA polymerase III, alpha subunit, Gram-positive type [Leuconostoc citreum KM20] (1437 aa)
Score = 2160, Expect = 0.0e+00, Identities = 514/1422 (36%), Positives = 792/1422 (55%)
  Q:    37 NKQNDSINIKISFNKVLPADILIPFVDSL-----NLVD---DSVLFNLVFNYDTYNQEDILNYLIYFVNHNIEQKQKGTSEKKELLYVLKYNMGIKKPIISENAIFLHYLENDQEKCIKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSS-----FTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKI--SDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI-WKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKY-DFITIGSPECFLHDIHRE-IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFE--KNVDSGFDLPESNCPKCKSK-LKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           +KQ+     KI+   +LPA++ + F   L     N+     D    +   N    NQ   L      +NH   Q Q  ++    LL   +Y + +        ++F    ++  +  +  Y          +GF +  L+   DE     I D   +   K + ++ +  R+S   K  ++      T   + +   D+T+L  +  E     +EG IF  +    ++G ++    +TDYS SI  K     + ++ V  ++K G+WV+   ++Q D Y    +   I ++ +I        +     K  EL  HT M+A + + +   L K +   G  ++ + D  N Q FP+     KK + LK IYG++ N+++   PI  N     +   +  YV FD+ETTGLS   DKIIE  A+K   G  ++    +INP   +SD    +T I++  V +A   +  + + + ++ D++L+ HN + FD+ F+N          I NP+IDTL  +R +      + LG IA+++ I+ +  QAHRA  D+E   +I W+ + E      +    ++N ++      +  R    T+  +N   ++NLYKL+S S    F   P++     N+     ++    T G++    +   +  +  + K KY DFI I     +   I    I     ++  +K ++ I ++ +K VV T D  Y N  D +Y ++ +  +  G  +NR        T LP+ YFRTT +L D+F+F+ D  L   +V+ N++ IA+ ++  I P+K   + P+I  A D+L +  ++ +   +GD +   ++ARID+E+ ++I NG+A  Y  +  LV++S  DGY+VGSRGSVGSS  A +  ITEVNP  PHY   +  YF     K  +SG+DLP+   P    + L GDG NIPFETFMGFKGDK+PDIDLNFS  YQ  AH+++K +FGE  V+RAGTI+T AEKTA+GYVK  FE     N R  E+ R+A+    VKRTTGQHPGGI++VP   DVYDFTP  YPADD+   W TTH+ + ++HD+LLK DILGHD+PT+++ L + + ++  +IP  D  V+ LF STD+L +    I    KTG+ G+PEFGTNFV+ ML  T+P  +S+L++ISGLSHGT+VW  NA  LIE    TI  VI  RD IM  LI+ G     AF +ME VRKGKG+ +EYQ  L    IP WYI+S  KI Y+FP+AHA AYV+MA +IA+FK+Y+P  +YA+YFS+R   FDI ++  G+    N   E  +++      A V +K  +L+ + E+A E L RG +F+ +DL +S A++++++GD LIPPFSA+  LG++VA  I+ AR+EK F SKED KKR KV+ T +  + +  +   + +++Q+SLF+F
  S:    37 SKQDKLWTFKIALTAILPANVFVQFRQQLHTAFTNIAQIKLDITTTDRSINEIQMNQYWHLALSDSKLNHTTAQ-QLASNTSLALLDETQYTVAV-----GAESLFKALNQDVIDSIVAAY--------QTFGFPEITLTPQQDEALAQQIEDSVAQHHAKAQEDLQKAIRASEQAKPKTTAEGVALTLGRKIATDADITRLETIDSEENRVVVEGFIFANEVRELRSGRKLMTIKITDYSSSISAKKFSNNENDEAVFDQIKPGMWVRLSGNVQEDTYARELVLN-IYDLQVIDHANRAESYQGE-TKHIELHVHTAMSAMDAVTDYGALAKLAKSWGQEALGVVDTANVQGFPEAVATGKK-NDLKMIYGMEANLVEDGEPIAFNLAPVPLLGKETIYVAFDLETTGLSAVTDKIIELSAVKMQMGNVIDKFSEYINPGFPLSDFTTELTSITDAMVANADTEESIVSRFRAWVRDAILVGHN-VTFDIGFMNAAYSRYNQPDISNPIIDTLPFTRWLYPDYKSYRLGTIAKRFNINLE--QAHRAIFDSETTGHIAWRLIKEANTTYALTDHEQLNDHMTEGDAWKHGRPVHATLLVQNTVGLKNLYKLVSRSNIEFFARVPRIPRSVLNQLREGLLIGTGDTSGDVIMTLIEKGR--VAALQKAKYYDFIEIQPTANYAPMIESGLIANESQLQSILKDMVSIGDELDKTVVVTGDIKYTNPEDRIYRQILIGTQP-GNPQNR--------TALPENYFRTTQQLLDDFAFMGD-TLARQLVIDNTHKIANCLET-ITPLKSGSYPPNIPTAGDELTRRTFENAKRWYGDPLPEVIQARIDQELEAIIGNGFAPHYMIAQKLVEKSNKDGYLVGSRGSVGSSFVATMSGITEVNPFAPHYRSAHGDYFELADPKIYESGYDLPDKPDPNHPGEMLIGDGQNIPFETFMGFKGDKVPDIDLNFSGDYQPIAHNYMKVLFGEHNVYRAGTIATVAEKTAFGYVKG-FERDHDKNYRGTEVERLAQGITGVKRTTGQHPGGILIVPREYDVYDFTPVQYPADDQKSLWQTTHMDYHAIHDNLLKMDILGHDDPTMVRTLKDMSGIDPQSIPVNDPGVLSLFTSTDALGVNPEQI--FSKTGTLGLPEFGTNFVRGMLEETQPHTYSELLQISGLSHGTDVWLGNANELIENGTATIGTVIGTRDKIMTDLINWGFPAADAFNVMEKVRKGKGITDEYQAQLRAAKIPEWYIQSMLKIKYMFPRAHAAAYVLMALRIAYFKVYFPTIYYATYFSVRADQFDIVAMSRGK----NATKEALKRLRALGNDATVGDK--NLLTVLEMANEALERGIQFSMVDLYRSEASEWVIDGDTLIPPFSAVPSLGENVAKQIIVARQEKPFLSKEDLKKRGKVSQTIIDYLSQNSVLDGMPDENQLSLFDF 1437
>gi|158320555|ref|YP_001513062.1| DNA polymerase III, alpha subunit [Alkaliphilus oremlandii OhILAs] >gi|158140754|gb|ABW19066.1| DNA polymerase III, alpha subunit [Alkaliphilus oremlandii OhILAs] (1441 aa)
Score = 2155, Expect = 0.0e+00, Identities = 496/1278 (38%), Positives = 765/1278 (59%)
  Q:   181 DHKNKI---QEKIKNEITEVKRSSNAKKTDSSFTYK-------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSEL-KEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGW-IEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           +H+N     Q KI+N +   K  + +   D SF  K         K+ +G++TKL D+  +     +EGEIF ++      G ++    +TDY++SI  K +F +K     L E+  +G   + +  +  D +   ++  L + + I    +   + D A  KR EL  HT M++ +G  +I  + K +++ G+ ++A+TD    Q FP+  +  KK+  +K IYG++  ++D  + ++ +  +  + D  ++IFDIETTGLS   D+I E GAIK      ++S    INPE  I +KI  +T IS++ VKD   I+  L +  DFIGD  ++AHN   FD  F+  K E  ++    N  IDTL+++RA+   +  H L VIA++  I  +    HRA  DA+    I+ + +E    +DI+TL +IN  L      +  +   I +  KN   + NLY+L+S S  + F   P++     N+F    I+  +   GE+F++ +S+  Q   + I   YD++ I         I + + K    +++  ++I+ +  + N  VVAT D ++L   D ++ ++ +  +      ++              YFRTTDE+ +EF +L       ++V+  +N I   I+ +I PI +    P IEG+ ++L+++ Y+K   I+G+ +   VK R+D+E++S+I NGYA++Y  +H LV +S+ DGY+VGSRGSVGSS AA + DITEVNPL PHYIC  CKY +F  + ++ SG DLP+ NCP+C   L  DGH+IPFE F+GF+GDK PDIDLNF+  YQ +AH + + +FG+ +V+RAGTI T A+KTAYG+V+ Y EE K++N   +EI R+ + C  +KRT+GQHPGG+++VP   D++ F P  YPA+D      TTH  + S+   LLK DILGHD P+I+KML + T+VNA  IP  D + +++F ST  L I    I+   + G+ GIPEFGT FV++ML+ T+P  F++L+RISGLSHGT+VW +NA+ L+      + DVIS RDDIM YLI KG+ P  AFKIME+VRKGKGL  E ++ + ++N+P WYI+SCNKI Y+FPKAHA AYV M+++ A+FK++YP  FYA+YF+ + + FD   I+ G+  +  KI E+ E M N  T      KE + + + E+ALE+  RG +   +DL  S A  F +    L+PP   + G+G++ A SIV+AREE  F S ED +KRTK+T T ++ +   G   ++ E +Q+SLF+ 
  S:   182 EHENSALVSQIKIQNPMDYGKAENVSTLKDKSFYSKTSSASVFLGKNFSGEITKLIDIRNDSGRVIVEGEIFDVEIKELNGGKKLAIINITDYTNSITAK-VFERKNQTGQLEEIFTKGKLARFRGDVIYDTFIRENVIMLTDAMEI----ERVEKMDLAENKRIELHLHTQMSSMDGTSSITNIIKKAAKWGHKAIAVTDHGVVQAFPEAMDAGKKFG-VKVIYGMEGYLVDDEVNLIDSDIEYSLEDE-FIIFDIETTGLSSKNDEITEIGAIKIKNNRIIDSFSTLINPERSIPEKIVELTGISDDMVKDQPTIEVVLPQFLDFIGDCPVVAHNS-DFDTGFIRDKAERYELSF-DNIAIDTLKLARALLPDLKKHRLNVIAKELNISLE--NHHRAVDDAKATAEIFIKFVEMMNKKDIRTLKDINDKLSKKLDYKTLKSYHIIILAKNYIGLENLYRLVSESHINYFYKKPRIPRSLLNKFREGLILGTACEAGELFQSILSSKPQSHIEKIAKYYDYLEIQPIGNNRFLIEKNLAKNEEDLKELNRKIVDLGERLNIPVVATCDVHFLENKDSIFRKILMTGQGFSDAEDQ-----------APLYFRTTDEMLEEFIYLGKEK-AEEVVIHATNRINDAIE-DIIPIPDGTFPPEIEGSEEELRRMCYEKVRRIYGEDVPELVKNRLDKELNSIISNGYAVMYIIAHKLVTKSLKDGYLVGSRGSVGSSFAATMSDITEVNPLPPHYICPTCKYSHFILDGSIGSGADLPDKNCPQCGESLMKDGHDIPFEVFLGFEGDKEPDIDLNFAGEYQSEAHKYTEELFGKGKVYRAGTIGTIADKTAYGFVRKYVEE-KQLNYNMSEINRLTQGCTGIKRTSGQHPGGVMIVPANYDIHKFCPIQYPANDPKSGVITTHFDYHSISGRLLKLDILGHDGPSIIKMLEDLTHVNALEIPLDDKETIEIFTSTRPLGITPEDIH--CEVGTLGIPEFGTKFVRQMLIDTQPTTFAELVRISGLSHGTDVWVNNAQDLVRNNIAELKDVISTRDDIMNYLILKGLPPKTAFKIMENVRKGKGLTPENEQEMKEHNVPEWYIDSCNKIKYMFPKAHAAAYVTMSFRTAYFKVHYPAAFYATYFTTKAEDFDADFIIKGKEAVRLKIKEL-EAMGNDLTA-----KEKNFLTVLEVALEMYCRGIELLPVDLYTSDADRFKIVDGKLLPPLKGLQGVGENAAKSIVEAREEGEFISVEDLRKRTKITKTVVEALVSHGCIHNMPETNQLSLFSL 1440
>gi|154502558|ref|ZP_02039618.1| hypothetical protein RUMGNA_00371 [Ruminococcus gnavus ATCC 29149] >gi|153796750|gb|EDN79170.1| hypothetical protein RUMGNA_00371 [Ruminococcus gnavus ATCC 29149] (1503 aa)
Score = 2153, Expect = 0.0e+00, Identities = 487/1252 (38%), Positives = 749/1252 (59%)
  Q:   207 DSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFI--RHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPD---FYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEIN--SNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSN-TQQVLEDIIK--DKYDFITIGSPECFL-HDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNV------DSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTE-------------QTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           D S  Y   K+   +   L  +  EM   TI G+I   D    +    I  + VTD++D+I +K         ++L ++K+G +VK K    ID ++     G    ++ I K  +F   R D + +KR EL  HT M+  +G+  +K + K + + G+ ++AITD    Q+FPD   +     K    K IYGV+  ++D    I +NA +  + D TY++FDIETTG S   DKIIE GA+K   G  VE    F+NP+  I  +I  +T I++E V DA  I+  L +  +F+GD VL+AHN   FD+ F+  NC+ +E + D +    +DT+ ++R +   +  + L ++A+   I  +    HRA  DA     I+ + +E  K ++I TL E+N   ++  + +R+     +I +  KN+    NLY+LIS S  + F   P++     N+     I+ ++   GE+++A ++  + Q +  + +  D Y+   +G+ +  +  D + +I  +  +++  + I+ +  K+ K VVAT D ++L+  DEVY R+ +  K  G    +           P  Y RTTDE+ +EFS+L       +IV+ N N I  +++  I P+      P IE +   L+ + Y K++ I+G+ +   V+ R++RE++S+I NGY+++Y  +  LV +S DDGY+VGSRGSVGSS  A +  ITEVNPL PHY C+ C Y +F+           GFD+P+ NCP C +KL   G +IPFETF+GFKGDK PDIDLNFS  YQ KAH + + +FGE   F+AGTI T A+KTA+GYVK+Y+EE +    R  EI RI + C  ++R+TGQHPGGIVV+PHG D+ +FTP  +PA+D T D  TTH  + S+  +LLK DILGHD+PT+++ L E             +   +A  IP  D  V+ LF+ T +L IK   I+     G  GIPEFGT+FV +M+    PQ  SDLIRISGLSHGTNVW  NA+ LIE    TIS  I  RDDIM+YLI++G+   ++F IME VRKGKGL  E+++ + + ++P WYI SC +ISY+FPKAHA AYV+MA++IA+ KI YPL +Y +YF IR   F  + +  G+ ++   + + K +  +      + NKE D++   ++  E+  RGY+F  +D+ K+ AT F +    L+PP S+I+G+G+  A ++ +A ++  + S +DF++RTKV+ T ++ M +LG+  +L + +Q+SLF+F
  S:   254 DPSLVYG--KNFEDEPLTLDQVVTEMGEITIHGKIISFDTREIRNEKTILMFSVTDFTDTITVKMFVRNDQLAELLGDIKKGAFVKIKGVTTIDKFDGELTIG---SVTGIKKIGDFTVSREDLSPVKRVELHCHTKMSDMDGVSEVKSIVKRAHDWGHPAIAITDHGVAQSFPDANHYIETLDKDDPFKVIYGVEGYVVDDLTEIAVNAGEQTLDD-TYIVFDIETTGFSAIKDKIIEIGAVKVKDGAIVEKFSTFVNPKRPIPFEITQLTSITDEMVLDAPDIESVLPEFLEFVGDGVLVAHNA-GFDVGFIEQNCRYQEIEPDFVS---VDTVALARVLLPTLSKYKLNIVAKALGISLE--NHHRAVDDAGATAEIFVKFVEMLKDRNITTLKEMNRFGDMNVNAIRKLPTHHII-ILVKNDIGRFNLYQLISASHLTYFARRPRIPKSLLNQHREGLIIGSACEAGELYQAILNQKSPQAVARLAEFYDYYEIQPLGNNQFMIDSDRYGDINSKEDLQNINREIVSLGEKFKKPVVATCDVHFLDPEDEVYRRIIMAGKGFGDADTQ-----------PPLYLRTTDEMLEEFSYLGS-AKAREIVIDNPNRICDMVE-KISPVNPNKCPPVIENSEQNLRDICYNKAHEIYGENLPEPVQTRLERELTSIISNGYSVMYIIAQKLVWKSNDDGYLVGSRGSVGSSFVATMAGITEVNPLSPHYYCSECHYSDFDSEEVRAFAGGCGFDMPDKNCPNCGAKLVKAGFDIPFETFLGFKGDKEPDIDLNFSGDYQAKAHRYTEVIFGEGHTFKAGTIGTLADKTAFGYVKNYYEE-RGHRKRKCEIDRILQGCTGIRRSTGQHPGGIVVLPHGHDINEFTPVQHPANDMTTDIITTHFDYHSIDHNLLKLDILGHDDPTMIRTLEEYITSDALENEYNDENPFDATKIPLDDKKVLSLFHDTSALGIKPEDIDGC-NLGCLGIPEFGTDFVIQMVQDANPQSLSDLIRISGLSHGTNVWLGNAQVLIESGKATISTAICTRDDIMIYLINQGVDSALSFTIMESVRKGKGLKPEWEETMKEKDVPDWYIWSCKQISYMFPKAHAAAYVMMAYRIAYCKINYPLAYYGAYFGIRANAFSYELMCQGKDKLNYYMKDYKRRSDS------LSNKEQDVLKDMKIVQEMYARGYEFLPLDIYKAKATKFQIIDGKLMPPLSSIEGMGEKAAEAVEEAAKDGPYLSLDDFRQRTKVSKTVIEFMSDLGLFGNLPQSNQLSLFDF 1503
>gi|153810942|ref|ZP_01963610.1| hypothetical protein RUMOBE_01332 [Ruminococcus obeum ATCC 29174] >gi|149832830|gb|EDM87913.1| hypothetical protein RUMOBE_01332 [Ruminococcus obeum ATCC 29174] (1439 aa)
Score = 2153, Expect = 0.0e+00, Identities = 488/1274 (38%), Positives = 755/1274 (59%)
  Q:   184 NKIQEKIKNEITEVKRSS--NAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPD-------FYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINS--NLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAI---KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEK------NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           NK ++K K    + +R       + DS+    + +   GD   L  +  EM    I G++  ++    +    I  + VTD++DSIVIK     +   ++   +K+G ++K K    ID +++    G I  I  I+  +   R D +  KR EL  HT M+  +G+   K+L K + E G+ ++AITD    Q FP+       +     K S  K +YG++  ++D    IV N+    I D  +V+FDIETTG SP   +IIE GA++   GV  +    F+NP+  I  +I  +T I++  V DA  I+  L +  +F   +V++AHN   FD+ F+  NCK +    +      +DT+ ++R +   ++   L  +A+   +  D    HRA  DA     I+ R +E  K +DI  ++ +N   N+  + +++      I +  +NE    NLYKL+S S    +   P+V    F E     ++ ++   GE+++A + N  +     + + YD++ I   G+    + D   +  K    ED I   K+I+K+ +++ K VVAT D ++++  DE+Y R+     ++ G       +++ +   P  Y RTT+E+ +EFS+L       ++V+TN+N IA +I+  I PI      P IE +   LK + + +++ ++G+ +   V+ R+++E+ S+I NGYA++Y  +  LV +S +DGY+VGSRGSVGSS+AA +  ITEVNPL PHY+C  CKY +F+          +G D+P+  CPKC +K+  +G +IPFETF+GFKGDK PDIDLNFS  YQ  AH + + +FG+ + F+AGTI T AEKTA+GYVK+Y+EE +  + R  EI RI + C  ++RTTGQHPGGI+V+P G ++  FTP  +PA+D+  D  TTH  + S+  +LLK DILGHD+PT+++ML + T ++A  +P    +VM LF STD+L IK   I    K G  G+PEFGT+F  +ML+ TKP+ FSDL+RI+GLSHGT+VW  NA+ LIEE   TIS  I  RDDIM+YLI  G+   +AF IME VRKGKGL EE++  + ++N+P WYI SC KI Y+FPKAHA AYV+MAW+IAWFK++ PL +YA++FSIR   F  +++  G   +   + E+++K  +  +K     KE D I    +  E+  RG +F  IDL ++ A  F +    L+P  + IDG+GD  A ++V A ++  F SK+DF+ RTKV+ T + +M++LGI   + + +Q SLF+
  S:   169 NKTEQKPKTFEKKNQRGEFYGGFRKDSNPDVIYGRDFEGDTIDLESITGEMGEVIIRGQVIDVEAREIRNEKTILIFPVTDFTDSIVIKMFLRNEQVPEITESVKKGAFLKFKGVTTIDRFDSELTIGSISGIKKIADFRS-TRMDTSPQKRVELHCHTKMSDMDGVTTAKDLVKRAYEWGHKAIAITDHGVVQAFPEANHCFDAWGGCVPKDSDFKVLYGMEAYLVDDMKGIVTNSQGQPI-DGKFVVFDIETTGFSPLTCQIIEIGAVRVENGVITDRFSTFVNPKVPIPYRIEQLTSINDSMVMDAPDIQTILPQFLEFCAGAVMVAHNA-DFDMSFIIENCKRQGLPQEYT---YVDTVGMARFLLPALNRFKLDTVAKAVGVSLD--HHHRAVDDAACTAEIFVRFVEMLKERDIFDMDTLNQQGNVSVNTIKKLPTYHAI-ILARNETGRVNLYKLVSQSHLKYYRRRPRVPKSLFLEHREGLLIGSACEAGELYQALLRNAPEPEIARLVNFYDYLEIQPLGNNAFMIADEKNDRVKSN--EDLIELNKKIVKLGDQFKKPVVATCDVHFMDPQDEIYRRI-----IMAGN-----GFSDADNQAP-LYLRTTEEMLEEFSYLGSEK-AEEVVITNTNKIADMIE-KISPIHPDKFPPVIENSDQDLKDICFNRAHEMYGENLPKIVEDRLNKELHSIISNGYAVMYIIAQKLVWKSNEDGYLVGSRGSVGSSLAATMSGITEVNPLPPHYLCPECKYSDFDSPEVKKFGGMAGCDMPDKVCPKCGAKMSKEGFDIPFETFLGFKGDKEPDIDLNFSGEYQANAHRYTEVIFGKGQTFKAGTIGTLAEKTAFGYVKNYYEE-RGQHKRYCEINRIVQGCTGIRRTTGQHPGGIIVLPVGVEIEKFTPVQHPANDENSDIITTHFDYHSIDGNLLKLDILGHDDPTMIRMLEDLTGLSARDVPLDSKEVMSLFASTDALGIKPEDIGGC-KLGCLGVPEFGTDFAMQMLIDTKPKYFSDLVRIAGLSHGTDVWLGNAQTLIEEGKATISTAICTRDDIMIYLISMGVESSLAFTIMEAVRKGKGLREEWEATMREHNVPEWYIWSCKKIKYMFPKAHAAAYVMMAWRIAWFKVFKPLAYYAAFFSIRATAFSYETMCMGRDRLDFYLAELRKK-GDAASK-----KEQDTIKDMRIVQEMYARGLEFMPIDLYRAKANRFQIIDGKLMPALNCIDGMGDKAAEAVVDAAKQGKFLSKDDFRDRTKVSKTVIDLMDDLGIFGDIPQSNQFSLFD 1435
>gi|168187912|ref|ZP_02622547.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum C str. Eklund] >gi|169294244|gb|EDS76377.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum C str. Eklund] (1441 aa)
Score = 2149, Expect = 0.0e+00, Identities = 496/1277 (38%), Positives = 766/1277 (59%)
  Q:   180 SDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKN-PLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWI--EDAIK----RIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIR-IKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + H  K   K  N     K++   K  ++ F     + V G++  + ++        I G+IFK++ + TK+G +I  +F+TDY+ SI +K     K   ++L E+K G+  K +     D +   ++  +  +I   SK ++    D    KR EL  HT M+A +GL +   L + +++ G+ +VAITD    Q FP+  + AKK++ +K IYGV+  +++  IPI  N  +  I D T+V+FD+ETTG S  YDKIIEFGA+K   G  ++S   F+NPE KI  +I  +T I+NEDVKDA  I + L K   F  D+VL+AHN   FD+ F+  NC    N ++I  N  ++DT+ +++ +  ++  + L  IA+   +  +    HRA  DA+   +I     +  K  +I +LN++N+    +   ++     + +  KN+  ++NLYKLIS S    F   P++      ++    I+ ++   GE+++A +      +ED +K+   F      +  +++    + ++G +  ED +K    +I ++    +  VVAT D ++L+  D  +  + +  +      N+           P  Y +TT E+  EF +L + +   ++V+ N   IA+ ++  +KPI +    P I+GA + ++ +  +K+Y+I+G+ +   V  R+++E++S+I+NGYA++Y  +H LV +S++DGY+VGSRGSVGSS+ A + DITEVN L PHY+C NCK   F  + +V SG DLP   CPKC ++   +GH+IPFETF+GF GDK PDIDLNFS   QG  H + + +FG+   F+AGTI T A+KTAYG+VK Y +E K M    AEI R+ + C  VKRT+GQHPGGI+VVP   ++Y+F P  +PADD   +  TTH  + S+   LLK DILGHD+PT+L+ML + T ++   IP  D  V+ LF S ++L +    +      G  GIPEFGT FV++ML+ T+P+ FSDL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ K + P  AF IME VRKGKGL+EE++ ++ ++ +P WYIESC KI Y+FPK HA AYV+MA +IA++K+YYP  +YA+YF++R I  FD   I+ GE  I  K++EI   + N  T+     K+  L+   ELA E+  R  KF  +D+ KS  T FL+EGDY+  P  ++ G+G + A SI +AR+E  F SKED +KR+KV+ T ++ + E G    L + +Q+SLF
  S:   197 NSHNKKENNKSSNRNDYYKKNHGPKNQNAIFG----RDVQGEIEDIVNINETSGVVNICGDIFKVNIIETKSGRKIVTFFITDYTSSITVKCFPKPKETDELLEEIKVGLHCKVRGEAVHDSFAR-EVVIMARDIVKTSKLEKM---DTCEEKRVELHMHTQMSAMDGLSSATSLIERAAKWGHPAVAITDHGVVQAFPEAMDAAKKFN-IKVIYGVEAYLVNDGIPIATNVENQNIDD-TFVVFDLETTGFSSQYDKIIEFGAVKIKNGNIIDSFSAFVNPEMKIPYRITELTSITNEDVKDAETIDKVLPKFMKFAEDTVLVAHNS-NFDMSFIRKNC----NDLNIECNYTVMDTIPLAKFLFPELKRYKLNTIAKHLGVSLE--NHHRAVDDAKATGDILVHCFKLLKEMEITSLNDLNNKFLGNIDVKKLPTYHLIILAKNQVGLKNLYKLISFSNLDYFYKKPRMPKSLIEQYKEGLIIGSACEAGEVYKAVLEGK---IEDELKELIKFYNYLEIQPIMNN--EFMLRKGIVKNEDQLKEINRKIYELGVNNDLPVVATGDVHFLDFKDVKFREILMTGQGFSDAANQ-----------PPLYLKTTSEMLKEFEYLGEDI-AKEVVIYNPQKIANEVEF-VKPIPDETFPPKIDGAEEDIRNMTLEKAYTIYGNPLPKVVHDRLEKELNSIINNGYAVLYLIAHKLVAKSLEDGYLVGSRGSVGSSLVATMSDITEVNGLPPHYVCPNCKNSEFFTDGSVSSGADLPPKKCPKCGTEYNRNGHDIPFETFLGFNGDKEPDIDLNFSGDNQGDIHKYTEVLFGKGHTFKAGTIGTIADKTAYGFVKKYLDE-KNMVVSQAEIERLTQGCTGVKRTSGQHPGGIMVVPSDNEIYNFCPIQHPADDSNSEIITTHFDYHSISGRLLKLDILGHDDPTVLRMLKDITGLDPIKIPIGDEKVLSLFTSPEALGVTEEELE--CPVGCYGIPEFGTKFVRQMLVDTQPKTFSDLVRISGLSHGTDVWLNNAQYFIKEGYTTLKDCIATRDDIMVYLLHKDLEPKDAFTIMEKVRKGKGLSEEHEALMREHKVPDWYIESCKKIKYMFPKGHAVAYVMMAVRIAYYKVYYPQAYYATYFTVRGIDDFDADLIVRGEDVIKRKMDEINS-LGNSATQ-----KDKGLLTNLELAFEMYKRNIKFLKVDIYKSHPTKFLIEGDYIRLPIGSLSGVGLNAAKSIAEARKEGEFISKEDLRKRSKVSKTVIEALSEHGCLEGLPDTNQLSLF 1441
>gi|187935470|ref|YP_001885466.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum B str. Eklund 17B] >gi|187723623|gb|ACD24844.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum B str. Eklund 17B] (1452 aa)
Score = 2145, Expect = 0.0e+00, Identities = 495/1241 (39%), Positives = 748/1241 (60%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISI----ISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDA----EYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI------------GS--PECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + +  + T + D+        I GEIFK D + TKTG  I  +++TDY+ SI +K     +  + VL E+K+G++ K +     D Y          E+ I    I++ K+  R D A  KR EL  HTNM++ +G+ +  +L + +++ G+ ++AITD    Q +P+    +KK +K+K +YGV+  +++  +P+V+N     + D T+V+FD+ETTG SP  DKIIE GA+K   G  ++    F+NP+  I  KI  +T I N  VKDA  I+  L K  +F  D+V++AHN   FD  F+  NC+    + DI   P++DT+ + R +  ++    L ++A+   I  +    HRA  DA    + LL  ++++ E+ ++ D+K+LN++   L    +R++    +I +  K +  ++NLYKLIS S   NF   P+      +EF    I+ ++   GE+++A +          I + YD++ I            GS   E  L DI+R+IY+ G              + NK  VAT D ++LN +DE + ++ +  +      N+           P  Y +TT+E+  EFS+L   +   ++V+ N   I+  I   +KPI +  + P IEGA + +K +   K+++I+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S +DGY+VGSRGSVGSS  A + DITEVN L PHY+C  CK   F  + ++ SG DLP+ NCP C      DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+   F+AGTI T AEKTAYGYVK Y +E +++   +AEI R+   C  +KRTTGQHPGGI+VVP   ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S ++L +    +    + GS G+PEFGT FV+ ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ KG+ P  AF IME VRKGKGL+E+ +K++ ++ +P WYI SC KI Y+FPK HA AYV+MA +IA++K+YYP  +YA+YF++R   FD   +  G+  +  K+ E+ E   N    A VK+K   LI + EL  E   RG KF  +DL KS    F +E   L  P +++ G+ D+ A SIV+AR +  F SKED + R  V+ T ++ +   G    L+E +Q+SLF
  S:   240 RGIRMESTPIKDIDETTGYVAIIGEIFKTDIIETKTGKTILTFYITDYTSSITVKCFLKPQEKEAVLDEVKKGLYCKVRGEAVFDTYA--------REVVIMGRDIARMKKIDRMDGAREKRIELHLHTNMSSMDGITSASKLIETAAKWGHEAIAITDHGVVQAYPEAQLASKK-NKIKILYGVEGYLVNNGVPLVINEKGYTLDD-TFVVFDLETTGFSPVNDKIIEIGAVKIKSGEIIDEFSCFVNPQRDIPYKITQLTSIDNNMVKDADVIENILPKFMEFCEDTVIVAHNA-AFDTGFIKKNCRDLNIRFDI---PILDTVTLCRFLYPELKKVKLNIVAKFLGISLE--NHHRAVDDAKATADILLKSFEKIEEDFEINDLKSLNDLF--LSKVDIRKQPTYHII-ILAKTQAGLKNLYKLISKSHIDNFFRRPRTPKTLLSEFREGLIIGSACEAGEVYKAVLEGRSDDEIKEIIEFYDYVEIQPIDNNNFLIAKGSVKDEEELRDINRKIYRLG-------------KECNKPTVATGDVHFLNPNDEAFRKIIMAGQGFSDADNQ-----------PPLYLKTTEEMLKEFSYLGKDI-AREVVIDNPKKISDSIGV-LKPIPDETYPPKIEGAEEDIKNMTLNKAHAIYGEVLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSTEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPKCKKSEFFLDGSISSGADLPDKNCPDCDVPYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHRYTEVLFGKGHTFKAGTIGTIAEKTAYGYVKKYLDE-REIITSSAEIERLTLGCTGIKRTTGQHPGGIMVVPADNEIYNFCPIQHPADDNDTDVVTTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDEKVLSLFTSPEALGVTKEELE--CEVGSYGLPEFGTKFVRGMLVDTQPKTFADLVRISGLSHGTDVWLNNAQYYIKEGFTTLRDCIATRDDIMVYLMYKGLPPKSAFTIMEKVRKGKGLSEDDEKLMKEHEVPEWYIGSCKKIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYATYFTVRADDFDANLVCLGDGAVHTKLQELYELGNN----ASVKDK--GLITVLELCFEAYKRGVKFLRVDLYKSEGIKFKIEDGALRLPLNSLPGVADNAAKSIVEARVKGEFISKEDLRIRAGVSKTVIESLSNHGCLDGLSETNQLSLF 1452
>gi|167766537|ref|ZP_02438590.1| hypothetical protein CLOSS21_01043 [Clostridium sp. SS2/1] >gi|167711660|gb|EDS22239.1| hypothetical protein CLOSS21_01043 [Clostridium sp. SS2/1] (1473 aa)
Score = 2125, Expect = 0.0e+00, Identities = 496/1248 (39%), Positives = 754/1248 (60%)
  Q:   211 TYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFP---DFYNEA--KKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEIN--SNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIK---RIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFE--------KNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           T  + ++  G++ ++ D++ E+    I G+I  ++    +    I  + +TD++D+I  K     +   D+L  LK+G + + K     D +++    G +  I  I+  +E  R D ++ KR EL  HT M+  + +V IK++   + E G+ +VAITD    Q FP     Y +   K+    K IYGV+   +D    +++++    + D +YV+FDIETTG +   D+IIE GA++  +G   E+   F+NPE  I  KI  +T I+++ VKDA  I+E L +   F   SVL+AHN   FD  F+  N K      D   + ++DTL ++R +   +   +L  I +   I   ET  HRA  DA     I+   +   K +DI  L+++N  +N   D +++      I +   N G + NL +L+S S  + F+  P++     N++ +  I+ ++   GE+++A +          I   YD++ I   G+ E  +      +     IED  K   +I+ +  +++K VVAT D ++LN  D +Y  +     +L GK      + + +   P  YFRTT E+ DEF++L       ++V+TN+N I  +I+ NI PI      P I  +   L+++ Y +++ I+GD +   V +R+++E++S+I NGYA++Y  +  LV  S D GY+VGSRGSVGSS AA +  ITEVNPL  HYIC  C + +F+        K   SGFD+P++ CPKC +K+  +G +IPFETF+GFKG+K PDIDLNFS  YQGKAH +++ +FG+ + FRAGTI T AEKTAYGYV  Y EE + ++ R  EI R+A  C  VKRTTGQHPGGI+VVPH K++YDFT   +PA+D      TTH  + S+  +LLK DILGHD+P++++ + + T ++A TIP  D  VM LF+ T++L I    I+     GS G+PEFGT+FV +ML  T PQ FSDL+RISGLSHGT+VW  NA+ LIE     IS  I CRDDIMVYLI++G+    +FKIME VRKGKGL +E ++++ D+N+P WYI SC +I Y+FPKAHA AYV+MAW+IAW+K+Y+PL +YA+YFSIR K F  + +  G+  +  K++ IK     PK +  VKN +LDL+   ++A E+  RGY+F  +D+ K+ A DF V    ++P  ++IDG+G+  A  + +A + + F+S E+F+ RTK     ++ M+ELGI   L++ DQ+S F+F
  S:   234 TLLYGRNCDGELMEIKDIYDEIGEVVIHGQITFLETREIRNEKTIIIFHITDFTDTISCKVFVRNEQLPDILDGLKKGGFYRIKAVAMYDKFDHEISLGSVAGIKAITDFRE-KRQDTSMEKRVELHLHTVMSDNDSVVQIKDIVNRAYEWGHPAVAITDHGVLQGFPIARHAYEDLRLKEDDPFKIIYGVEGYFVDDLGDLIIDSKGQSLMD-SYVVFDIETTGFNSVNDRIIEIGAVRVVEGEIKETFSEFVNPERPIPYKITQLTTITDDMVKDAGTIEEILPQFLKFCAGSVLVAHNA-GFDTGFIRENAKRLNLPYD---HTVVDTLGLARCLMGHLGKFTLDNICKHLNIIL-ETH-HRAVDDATATGKIFVEFISMLKEKDITDLDQVNEFANDNVDLIKKGRMYHGIILVKNNTGRV-NLNRLVSESHLNYFNRRPRMPKSLINKYRDGLIIGSACEAGELYQALLDERSDETIANIVSFYDYLEIQPVGNNEFMIGS--ERVENVNSIEDIQKFNQKIVDLGEQFHKPVVATCDVHFLNPDDAIYRSI-----LLAGK-----GFKDADQQAP-LYFRTTQEMLDEFAYLGSEK-AKEVVITNTNKINDMIE-NISPIHPDKCPPVIPDSDKTLREICYNRAHEIYGDDLPERVTSRLEKELNSIIGNGYAVMYIIAQKLVWDSNDHGYLVGSRGSVGSSFAATMSGITEVNPLPAHYICPECHFVDFDSEQVQKYAKMGMSGFDMPDAYCPKCGAKMTKEGQDIPFETFLGFKGNKEPDIDLNFSGEYQGKAHAYVEVIFGKGKAFRAGTIGTLAEKTAYGYVLKYLEE-RGISKRRCEIERLALGCTGVKRTTGQHPGGIIVVPHDKEIYDFTAVQHPANDMNTPIITTHFEYHSIDQNLLKLDILGHDDPSMIRRMEDITGIDAQTIPMDDKGVMGLFHGTETLGITPEDIDGT-PLGSLGVPEFGTDFVIQMLQDTHPQSFSDLVRISGLSHGTDVWLGNAQTLIENGDAVISTAICCRDDIMVYLINQGLEQEASFKIMEGVRKGKGLTDEQEQMMRDHNVPDWYIWSCKQIKYMFPKAHAAAYVMMAWRIAWYKVYHPLAYYAAYFSIRAKAFSYEDMCLGKERLDEKMSIIKN---TPKHE--VKNADLDLLREMKIADEMYARGYEFWPLDIYKAKAKDFQVIDGKIMPALTSIDGMGEKAAQQVEEAAKGEPFTSLENFRNRTKAPQACIEKMKELGIMGDLSDTDQLS-FDF 1472
>gi|188589600|ref|YP_001920613.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum E3 str. Alaska E43] >gi|188499881|gb|ACD53017.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium botulinum E3 str. Alaska E43] (1452 aa)
Score = 2122, Expect = 0.0e+00, Identities = 490/1241 (39%), Positives = 746/1241 (60%)
  Q:   216 KSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISI----ISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDA----EYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI------------GS--PECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKY--FNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           + +  + T + D+        I GEIFK D + TKTG  I  +++TDY+ SI +K     +  + VL E+K+G++ K +     D Y          E+ I    I++ K+  R D A  KR EL  HTNM++ +G+ +  ++ + +++ G+ ++AITD    Q +P+    +KK +K+K +YGV+  +++  +P+V+N     + D T+V+FD+ETTG SP  DKIIE GA+K   G  ++    F+NP+  I  KI  +T I N  VKDA  I+  L K  +F   +V++AHN   FD  F+  NC+      D+   P++DT+ + R +  ++    L ++A+   I  +    HRA  DA    + LL  ++++ E+ ++ D+K+LN++   L    +R++    +I +  K +  ++NLYKLIS S   NF   P+      +EF    I+ ++   GE+++A +          I + YD++ I            GS   E  L +I+R+IY+ G              + NK  VAT D ++LN +DE + ++ +  +      N+           P  Y +TT+E+  EFS+L   +   ++V+ N   I+  I   +KPI +  + P IEGA + +K +   K+++I+G+ +   V+ R+D+E++S+I+NGYA++Y  +  LV +S +DGY+VGSRGSVGSS  A + DITEVN L PHY+C  CK   F  + ++ SG DLP+ NCP C      DGH+IPFETF+GF+GDK PDIDLNFS  YQG  H + + +FG+   F+AGTI T AEKTAYGYVK Y +E +++   +AEI R+   C  +KRTTGQHPGGI+VVP   ++Y+F P  +PADD   D  TTH  + S+   LLK DILGHD+PT+L+ML + T ++  TIP  D  V+ LF S ++L +    +    + GS G+PEFGT FV+ ML+ T+P+ F+DL+RISGLSHGT+VW +NA+Y I+E   T+ D I+ RDDIMVYL+ KG+ P  AF IME VRKGKGL+E+ +K++ ++ +P WYI SC KI Y+FPK HA AYV+MA +IA++K+YYP  +YA+YF++R   FD   +  G+  +  K+ E+ E   N    A VK+K   LI + EL  E   RG KF  +DL KS    F +E   L  P +++ G+ D+ A +IV+AR +  F SKED + R  V+ T ++ +   G    L+E +Q+SLF
  S:   240 RGIRMESTSIKDIDETTGYVAIIGEIFKTDIIETKTGKTILTFYITDYTSSITVKCFLKPQEKEAVLDEVKKGLYCKVRGEAVFDTYA--------REVVIMGRDIARMKKIDRMDGAQEKRIELHLHTNMSSMDGITSASKMIETAAKWGHEAIAITDHGVVQAYPEAQLASKK-NKIKILYGVEGYLVNNGVPLVVNEKGYTLDD-TFVVFDLETTGFSPINDKIIEIGAVKIKSGEIIDKFSCFVNPKRDIPYKITQLTSIDNNMVKDADVIENILPKFMEFCEGTVVVAHNA-AFDTGFIKKNCRDLNINFDL---PILDTVTLCRFLYPELKKVKLNIVAKFLGISLE--NHHRAVDDAKATADILLKSFEKIEEDFEINDLKSLNDLF--LSKVDIRKQPTYHII-ILAKTQAGLKNLYKLISKSHIDNFFRRPRTPKTLLSEFREGLIIGSACEAGEVYKAVLEGRSDDEIKEIIEFYDYVEIQPIANNNFLIAKGSVKDEEELREINRKIYRLG-------------KECNKPTVATGDVHFLNPNDEAFRKIIMAGQGFSDADNQ-----------PPLYLKTTEEMLKEFSYLGKDI-AKEVVIDNPKKISDSIGV-LKPIPDETYPPKIEGAEEDIKNMTLNKAHAIYGEVLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSTEDGYLVGSRGSVGSSFVATMSDITEVNGLPPHYVCPKCKKSEFFLDGSISSGADLPDKNCPHCDVPYIKDGHDIPFETFLGFEGDKEPDIDLNFSGEYQGVVHRYTEVLFGKGHTFKAGTIGTIAEKTAYGYVKKYLDE-REIITSSAEIERLTLGCTGIKRTTGQHPGGIMVVPADNEIYNFCPIQHPADDNDTDVVTTHFDYHSISGRLLKLDILGHDDPTVLRMLQDLTGLDPKTIPLNDEKVLSLFTSPEALGVTKEELE--CEVGSYGLPEFGTKFVRGMLVDTQPKTFADLVRISGLSHGTDVWLNNAQYYIKEGFTTLRDCIATRDDIMVYLMYKGLPPKSAFTIMEKVRKGKGLSEDDEKLMKEHEVPEWYIGSCKKIKYMFPKGHAVAYVMMAVRIAYYKVYYPEAYYATYFTVRADDFDANLVCLGDGAVHTKLQELYELGNN----ASVKDK--GLITVLELCFEAYKRGVKFLRVDLYKSEGVKFKIEDGALRLPLNSLPGVADNAAKNIVEARVKGEFISKEDLRIRAGVSKTVIESLSNHGCLDGLSETNQLSLF 1452
>gi|150018035|ref|YP_001310289.1| DNA polymerase III, alpha subunit [Clostridium beijerinckii NCIMB 8052] >gi|149904500|gb|ABR35333.1| DNA polymerase III, alpha subunit [Clostridium beijerinckii NCIMB 8052] (1446 aa)
Score = 2119, Expect = 0.0e+00, Identities = 493/1262 (39%), Positives = 752/1262 (59%)
  Q:   196 EVKRSSNAKKTDSSFTYKFRKS-VTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKP-------KEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNE-AKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLIT----VYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEK-NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLT-ISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNE----EYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKE--KMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           EVK   + KK  + F    R + +  ++ K++D+  +     +EGEI  ++    ++G  +  + + D S+S+  K         +V S +K     KAK    + +  N   +    E+ +I+         K++ R DN+ +KR EL  HT M+  + + +  +L K +   G  S+AITD    Q+FP+ +    +    +K IYGV+  +     P V N  +  I D  Y + D+ETTG SP  +KI E G +K   G  ++    F+NP++ I  ++  +TKI+++ VK+A  I +   K+ +FI  SVL+AHN   FD+ FL  N K+   + D      IDTL +++ +      + LG IA+   I  +   AHRA  D +  + ++  ++E  K +  +TL++I+    ++  ++     + T    +  KN   ++NLYKL+S S    F   P++    F +++   I+ ++ +EGE+++A +    +   + I + YD++ I   G+ +  +     ++  + ++++  K+I+++A +  K VVAT D ++L+  DE+Y R+    +      N+              Y RTT+E+ DEFS+L       ++VVTN+N +A + +  I PI      PHIEG    +K + Y+K++ ++GD +   V+AR+D+E+ S+I NG++++Y  +  LV +S +DGY+VGSRGSVGSS  A +  ITEVN L PHY C  CKY +FE   V +GFDLP+  CP C   L  DG +IPFETF+GF GDK PDIDLNFS  YQ KAH + + +FG+   F+AGTI T AEKTA+GYVK Y+EE K +    AE  RI+  C  +KRTTGQHPGGI+VVP G+++++F P  +PADD   D  TTH  + S+  +LLK DILGHD+PT+++ML + T V+   IP  D D M LF ST +L +    IN   + G+ GIPEFGT FV+ ML+ TKP+ FSDL+ ISGLSHGT+VW  NAK LI+   +T ISD +  RDDIMVYLI KG+ P  AFKIME VRKGK L E    EY+ ++ ++++P WYIESC KI Y+FPKAHA AYV+MA++IAWFK++ P  +YA+YF+IR K FD + ++ G+ ++  K+ EI+     A PK K        D+    E+ LE+  RG+KF  IDL KS AT F +E D + PP ++I G+G+  A  I  A +EK F+S +D KKR+K+    ++++ +    + L E DQ+S F+
  S:   198 EVKAEGDGKKASNPFLILGRNANIKENIIKINDITPDEGRVALEGEISNLEAKELRSGKMLISFDLYDGSNSMTCKIFAKPNEYDEVFSRIK-----KAK---GLRLAGNAGYSNFSHEVELIANTVIETNGIKKYKRQDNSEVKRVELHMHTQMSQMDAMSSASDLIKRAMSWGMKSIAITDHGVVQSFPEAHKLLGRDNPDMKVIYGVEAYLAPDKKPSVTNVREESI-DTVYCVLDLETTGFSPQTEKITEIGVMKIKDGKVIDKFSTFVNPQKSIPMRVVEVTKITDDMVKNAETIDKVFPKLLEFIEGSVLVAHNA-DFDIGFLKHNAKVLGYEFDFT---YIDTLGLAQDVFPDYKSYKLGRIAKNLGIKVE--VAHRALDDVDTTVKVFNIIIEKLKERGAQTLSDIDLYAADEEAKKVAYKKVKTHHAIILAKNYVGLKNLYKLVSYSHLDYFYKKPRILKSMFKKYSEGLIIGSACSEGELYQAILLGKPEEQIEEIANFYDYLEIQPLGNNDYLVR--QEQVPSKEYLKEINKKIVELAERLGKPVVATGDVHFLDPEDEIYRRILEAGQGFKDADNQ-----------APLYLRTTEEMLDEFSYLGR-TKAYEVVVTNTNIVADMCE-QISPISPEKCPPHIEGCEQTIKDIAYEKAHELYGDPLPEIVQARLDKELDSIIKNGFSVMYIIAQKLVWKSNEDGYLVGSRGSVGSSFVANMTGITEVNALPPHYRCPKCKYSDFEDYGVLNGFDLPDKVCPVCGENLYKDGIDIPFETFLGFNGDKEPDIDLNFSGEYQAKAHRYTEVIFGKGTTFKAGTIGTIAEKTAFGYVKKYYEE-KNITINKAETIRISVGCTGIKRTTGQHPGGIIVVPKGREIFEFCPVQHPADDPNSDIITTHFDYHSIDQNLLKLDILGHDDPTVIRMLQDITGVDPHEIPMDDKDTMSLFFSTKALGVTPNQINS--EVGTFGIPEFGTKFVRGMLVDTKPKTFSDLLCISGLSHGTDVWLGNAKDLIDNGVITSISDAVCTRDDIMVYLIRKGLPPNTAFKIMETVRKGKALKEPKFPEYEAMMREHDVPEWYIESCKKIKYMFPKAHAAAYVMMAFRIAWFKVHIPQAYYATYFTIRAKAFDAEFMIFGKEKVKAKMQEIQALGNEAGPKDK--------DMYDDLEIVLEMYERGFKFLPIDLYKSSATKFQLEEDGIRPPLNSIAGMGNVAAEGIASAAKEKEFNSVDDVKKRSKIGNAAIELLRKFDCLNGLPESDQMSFFD 1444
>gi|154500376|ref|ZP_02038414.1| hypothetical protein BACCAP_04043 [Bacteroides capillosus ATCC 29799] >gi|150270881|gb|EDM98164.1| hypothetical protein BACCAP_04043 [Bacteroides capillosus ATCC 29799] (1390 aa)
Score = 2115, Expect = 0.0e+00, Identities = 479/1258 (38%), Positives = 735/1258 (58%)
  Q:   199 RSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKID-KVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQ-FNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDA---EYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE--IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFE--KNVDSG--FDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADT-IPNFDNDVMDLFNSTDSLK-IKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFL---VEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRT-KVTTTHMKIMEELGITSSLNEDDQISLF 1456
           +  ++KK+     +  R+ + G+ T++  L  +M T  ++G++F ++ K + K G  +  + +TDY+ SI I         K ++  +KEG+ +  +  + +D +    +   +E  +I+   KE  + DNA  KR EL  HT M++ + L   K + K +   G+ ++AITD    Q+FPD ++ AK    +K +YGV+ + I D +  +V++    +      V FDIETTGL    D IIE GA+    G   E+   F++P   +S +I  +T I+++ ++ A   +EA+    +F GD  L AHN  +FD+ F+        +   K   IDTL +++ +   +  + L ++A   ++     + HRAD DA    Y+L  + +MLE+  +  ++++N   + L+      R    LI V  KN   +RNLY LIS +   +F   P +     N++    I+ ++   GE+FEA + +        I   YDF+ I  P C    + R+  +     + D  + I+ +    +K V AT D ++L+  DE+Y  + ++ K           + + +  LP  YF+TT+E+ +EFS+L      N +VV N+N +A   D  I P+ + L +P +E ++ +L +L++ K+ S++G+ +   V  RI+ E+  ++   Y +IY  +  LV+ S++ GY+VGSRGSVGSS+ A++  ITEVN L PHY C NCK+ +FE  K + +G   D+P++ CP C ++   DG NIPFETF+GF GDK+PDIDLNFS  YQ KAH +   +FGE  VFRAGTI T AEKTA+GYVK Y E+ + ++   AE  R+A  C  VKRTTGQHPGG+VV+P  +++YDF P  +PADD   D  TTH  + S+  +LLK D+LGHD+PT+++ML + T VNA T IP  D   M LF S++ L  + +P++     TG+  IPEFGT+FV+ ML  T P +F  LIR+SG SHGT+VW  NAK LI  +G+ +   I CRDDIM++LI  G+    +FKIME VRKG+GL E  +  +    +P WYI SC KI YLFPKAHA AYV+MA++IAWFK++ PL FYA+YFSIR K FD   +  G   +  K+ EIK K  + +  A+    E D++   E+  E   RG+ F ++DL KS A +F+        LIPPFSAI GLG++ A SI++ RE K F S E+F     KV+ TH+++++  G    + +  Q++LF
  S:   153 KKPDSKKSAGKLIFG-RREIKGEATEMKALDLDMGTVIVKGDVFAVEHKELKKRGAWVIGFDMTDYTGSIHINKFCPGDEGKPIVDNVKEGMHLLVQGKLTVDRFSGEMV---LEPYAIMEGKKE-SKQDNAPEKRVELHLHTTMSSMDALTPTKAVVKRAEGWGHRAIAITDHGVAQSFPDAWHAAKN---IKVLYGVEAYYINDVDDRVVVHGEQEQDFTGEVVCFDIETTGLDNRRDVIIEIGAVILRNGEIAETFDTFVSPGRPLSREIVELTSITDKMLEGAPSQEEAIRAFLEFAGDRPLAAHNA-EFDMGFIAEGCRRYGIPFEKTS-IDTLILAQNLLPDLGKYKLDIVAEHLRLP--PFKHHRADADAGMVAYMLVPFFKMLEDLGIHTLQSINPEMTRLRVKGKARRQPKHLI-VLAKNNMGLRNLYTLISKAHLEHFKRYPIMPKSLINQYREGLILGSACEAGELFEAVVKHKDFNELKRIASWYDFLEI-QPLCNNAFMLRKGMVQSEEELRDFNRTIVALGKALDKPVCATGDVHFLDPEDEIYRHILLDTK----------GFEDCDAPLP-LYFKTTEEMMEEFSYLGKEDCYN-VVVRNTNLVADWCD-RINPLPKGLFAPKLEDSAGELSRLVWGKAKSLYGEEVPQIVSDRINAELGDILKRHYDVIYMSAQKLVQNSLEHGYLVGSRGSVGSSLVAFMSGITEVNSLPPHYRCPNCKHSDFEIAKELGAGCGADMPDAVCPVCGAQYAKDGFNIPFETFLGFGGDKVPDIDLNFSGEYQAKAHRYTFELFGETHVFRAGTIGTVAEKTAFGYVKKYLEK-RGIHVPRAEENRLAHGCTGVKRTTGQHPGGMVVIPQNREIYDFCPVQHPADDPNTDIVTTHFEYHSMESNLLKLDMLGHDDPTMIRMLEDLTGVNARTDIPLDDKKTMSLFTSSEELGFVDDPVLGP---TGAVAIPEFGTSFVRGMLEDTSPSEFDILIRLSGFSHGTDVWLGNAKDLIVNQGIPVGQAIGCRDDIMLFLISCGMPEKRSFKIMESVRKGRGLPEGAEDEMKAAGVPDWYIGSCKKIKYLFPKAHAVAYVMMAFRIAWFKVHRPLAFYAAYFSIRAKAFDETYMCRGMDVVKAKMKEIKAK--DKEATAV----EQDMLTTLEVCYEFYLRGFTFEHVDLYKSHAINFIFSKTNDKALIPPFSAIPGLGETAAWSIMEQREGKEFISVEEFSAACPKVSKTHIELLKAAGAMDGMPDTSQMTLF 1390
>gi|168334980|ref|ZP_02693097.1| DNA polymerase III, alpha subunit [Epulopiscium sp. 'N.t. morphotype B'] (1454 aa)
Score = 2112, Expect = 0.0e+00, Identities = 490/1244 (39%), Positives = 726/1244 (58%)
  Q:   214 FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEF--IRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEIN--SNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIG---SPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNV--DSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           + ++  G    + ++  E+    ++GE+  I+  V ++   I    ++DY+D+I  K     +   ++LSELK+G + K K    + +Y+  D    +  I  I K   F   R D A +KR EL  HT M+  + +V+IK + K + E G  +VAITD    Q FP   +  +K    K IYGV+   +D    IV + + T   +  +VIFD+ETTGLS   +KIIE GA+K   G  +++   F+NPE  I + I  +T I+  D+ DA  I   L +  +F   ++L+AHN   FD+ F+     +  ++  K   IDT+ ++R +   +    L  IA K K+       HRA  DA     I+ + +E    ++I+ L+++N  SN   + +++      I +  KNE    NL KL+S S    F   P++      +     I+ ++   GE+F A + ++  +  + I D YD++ I    + E  +         R  +ED  KRI+++  K  K+VVAT D ++L+  DE+Y R+ ++ K         FK  +L    P  YFRTTDE+ DEFS+L       ++VV N+N IA+ I+  I P+      P I  +  +L+++ Y K++ I+G  +   V AR++RE++S+I NGYA++Y  +  LV  S D GY+VGSRGSVGSS AA +  ITEVNPL  HYIC  C Y +F+ N    SG D+P+ NCPKC++ L  +GH+IPFETF+GF GDK PDIDLNFS  YQ KAH +++ +FGE + FRAGTI T A+KTA  YV  Y E+ ++++ R AE+ RIA  C  VKRTTGQHPGGI+VVPH +D+Y+F    +PA+D      TTH  + S+  +LLK DILGHD+PTI++ L + T +++ TI     DVM LF+ T  L I+   I+ I + GS G+PEFGT+FV +MLL  KPQ FSDL+RISGLSHGT+VW  NA+ LIEE   TIS VI  RDD M YLI  G+    AF IME VRKGKGL  E+++ + + ++P WYI SC KI Y+FPKAHA AYV+MAW+IAW+K+++PL +Y ++FSIR   F+ + +  G+ ++   +  I    + PK K   K++  D +    +  E+  RG+ F  ID+  +   DF +    ++P    IDG+GD  A  +V+A +   F S+++FK RTKV  T +  M +LG+   L E +QIS  +
  S:   231 YGRNCEGSAIXIDEVVDEIGEVVVQGELLNIETRVIRSEKTIIICDLSDYTDTITFKIFAANEEVGNILSELKKGDYYKVK---GVAVYDKFDKEVALASIRGIKKIDAFRQKRVDTAPVKRVELHLHTKMSDMDSVVDIKAMIKRAKEWGMPAVAITDHGCLQAFPIANHCIEKDDPFKIIYGVEAYFVDDCTKIV-SGDATATFEDEFVIFDLETTGLSSSSNKIIEIGAVKIRNGKIIDTFSSFVNPETDIPEHITELTGITTTDIADAPTIAAVLPQFVEFCASAILVAHNA-DFDMGFILHNTRDLAIEFNKT-YIDTVSMARILLPNLGNAKLSNIANKLKVSL--KNHHRAVDDASATAEIFLKFIEMLAQREIRNLDQLNELSNTSAEAIKKLPTYXGI-ILVKNEIGRINLNKLVSASHLDYFARRPRMPKSLIAQHREGLIIGSACEAGEVFSALLRDSNNI--ESIVDFYDYLEIQPTMNNEFMIRSDKHAATSRKDLEDYNKRIVQLGEKCGKRVVATCDVHFLDPEDEIYRRILMDYKG--------FKDADLQ---PPLYFRTTDEMLDEFSYLGS-AKAYEVVVENTNAIATQIE-KISPVLPDKCPPVIADSDKELRKICYDKAHEIYGPDLPEPVTARLERELNSIISNGYAVMYIIAQKLVWDSNDHGYLVGSRGSVGSSFAATMSGITEVNPLAAHYICPQCFYTDFDTNSAGTSGCDIPDRNCPKCQTPLNKEGHDIPFETFLGFYGDKEPDIDLNFSGEYQSKAHKYVEVLFGEGKAFRAGTIGTVADKTALMYVFKYLEK-RQLSKRRAEMRRIASGCTGVKRTTGQHPGGIIVVPHDRDIYEFCAVQHPANDVNTPXITTHYEYHSIDHNLLKLDILGHDDPTIIRRLEDITGISSATIRLDXKDVMALFHGTAVLGIQPADISGI-QLGSLGVPEFGTDFVIQMLLDAKPQNFSDLVRISGLSHGTDVWLGNAQTLIEEGKGTISTVIXTRDDXMTYLISMGLEAGTAFTIMESVRKGKGLKPEWEQAMLEKDVPDWYIWSCKKIKYMFPKAHAAAYVMMAWRIAWYKVFHPLAYYTAFFSIRASSFNYELMCFGKEKLEANMKAI---TSMPKDKQTAKDQ--DTLKDMRIVQEMYARGFSFKPIDIFTASDVDFQIIDGQIMPSLGTIDGMGDKAAAMVVEAAKNGPFLSRDEFKTRTKVNQTVIDKMYQLGMLGDLPESNQISFMD 1452
>gi|167746785|ref|ZP_02418912.1| hypothetical protein ANACAC_01497 [Anaerostipes caccae DSM 14662] >gi|167653745|gb|EDR97874.1| hypothetical protein ANACAC_01497 [Anaerostipes caccae DSM 14662] (1475 aa)
Score = 2111, Expect = 0.0e+00, Identities = 499/1222 (40%), Positives = 744/1222 (60%)
  Q:   237 IEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFP---DFYNEAK--KYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEEN--KMDIIKNP-LIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKR---MLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIK--DKYDFITI---GSPECFLHDI-HREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFE--------KNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           I G++  +D    +    I  + +TD++D+I  K     +   +VLS+LK+G + + K     D +++    G +  I  +S  +E  R D ++ KR EL  HT M+  + +V I ++ K + E G+ +VAITD    Q FP     Y + +  +    K IYGV+   +D    + + +    +    +V+FDIETTG +   D+IIE GA+K   G   E+   FINP+  I  KI  +T I++E V +A  I   L +  +F GDSVL+AHN   FD  F++    EN  ++D+  +P ++DTL +SR++   +   +L  + +   I   ET  HRA  DA     I+ +   MLE +++ D+  +NE  +    DF+++      I +   N G + NL +L+S S    F+  P++     N++    I+ ++   GE++ A +   Q+  E+I K  + YD++ I   G+ +  +    H  +     I +  ++I+++   + K V AT D ++L+  D +Y      A ++ GK    FK  +     P  YFRTT+E+  EF +L       ++V+TN N I+  I+ NI PI      P IE +   L+ + Y+K++ I+G  + + V  R+D+E++S+I NGYA++Y  +  LV  S+D GY+VGSRGSVGSS AA +  ITEVNPL  HYIC  C Y +F+        +   SG D+P++ CPKC +KL  +GH+IPFETF+GFKGDK PDIDLNFS  YQ KAH +++ +FG+ + +RAGTI T AEKTAYGYV  Y EE ++++ R  EI R+AK C  VKRTTGQHPGGI+VVPH K++YDFT    PA+D      TTH  + S+  +LLK DILGHD+P++++ L + T VNA  IP  D  VM LF+ T+ L I    I    K GS GIPEFGT+FV +MLL T PQ FSDL+RISGLSHGT+VW  NA+ LIEE   TIS  I  RDDIMVYLI++G+   ++F IME VRKGKGL  E ++ + + ++P WYI SC +I Y+FPKAHA AYV+MAW+IAWFK+++PL +YA+YFSIR K F  + +  G+ ++ N++ EI+     PK +  VKN +LDL+   ++A E+  RG++F  +D+ ++ A DF +    ++PP+SAIDG+G+  A    +A + + F+S E+F+ RTK   + +  M+ELG+   L E DQ+S FNF
  S:   262 IHGQVTTLDTREIRNEKTIIIFHITDFTDTISCKIFVRNEQLPEVLSDLKKGGFYRVKAVAMYDKFDHEISLGSVMGIKAVSDFRE-KRQDTSMDKRVELHLHTVMSDNDSVVQINDIVKRAYEWGHPAVAITDHGVLQAFPIARHAYEDLRLPQDDPFKIIYGVEAYFVDDLGDLAVRSRGQSLR-GDFVVFDIETTGFNSQTDRIIEIGAVKVIDGEITETFSEFINPQIPIPFKITQLTTITDEMVMNADTIDAVLPRFLEFCGDSVLVAHNA-GFDTGFIH----ENAKRLDLDFHPTIVDTLGLSRSLMTHLAKFTLDNLCKNLNIKL-ETH-HRAVDDATATGKIFIKFVQMLEEKEIFDLDQVNEFVAG-SEDFIKKGRTYHGIILVKNNTGRV-NLNRLVSESHVRYFNRRPRMPKSLINKYREGLIIGSACEAGELYSAIVD--QRSEEEIAKIVEFYDYLEIQPEGNNQFMIESARHENVSSFEDIRNFNRKIVELGETFRKPVAATCDVHFLDPDDSIY-----RAILMAGKG---FKDADSQ---PPLYFRTTEEMLHEFEYLGSDK-AREVVITNPNKISDQIE-NISPIHPDKCPPVIENSDRDLRDICYKKAHDIYGPNLPDIVTTRLDKELNSIIGNGYAVMYIIAQKLVWDSLDHGYLVGSRGSVGSSFAATMSGITEVNPLPAHYICPECYYVDFDSPEVKKYARMGMSGCDMPDAVCPKCGAKLNKEGHDIPFETFLGFKGDKEPDIDLNFSGEYQSKAHAYVEVIFGKGKAYRAGTIGTLAEKTAYGYVLKYLEE-REISKRKCEIERLAKGCTGVKRTTGQHPGGIIVVPHDKEIYDFTAVQRPANDVRSPIITTHYEYHSIDSNLLKLDILGHDDPSMIRRLEDLTGVNAQNIPLDDKSVMSLFHGTEVLGITPEQIGGT-KLGSLGIPEFGTDFVIQMLLDTNPQSFSDLVRISGLSHGTDVWLGNAQKLIEEGDATISTSICTRDDIMVYLINQGLDEALSFTIMESVRKGKGLKPEQEEAMREKDVPEWYIWSCKQIKYMFPKAHAVAYVMMAWRIAWFKVFHPLAYYAAYFSIRAKAFSYEDMCMGKEKLNNRMKEIQN---TPKFE--VKNADLDLLREMKIADEMYARGFEFMPLDIYRAKAKDFQIIDGKIMPPYSAIDGMGEKAAKEAAEASKGEPFTSMENFRDRTKTPKSVVDKMKELGLMGDLEESDQLS-FNF 1474
>gi|104161981|emb|CAJ75690.1| DNA polymerase III, alpha subunit [uncultured Thermotogales bacterium] (1428 aa)
Score = 2104, Expect = 0.0e+00, Identities = 478/1284 (37%), Positives = 769/1284 (59%)
  Q:   173 EKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSE-LKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIID--KNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSL----ITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSN-TQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFS-FLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF-EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           E  +DI  D  + I E++     E + + ++ + D+    +  ++V+    K+ ++        + G++F ++    K    I  + VTD++DS+ +K L G+  N   LSE L+EG  +  +  ++ D +  ++I  +  +I   + PK   R D +L KR EL  HT M+A + +V+++EL     + G+ + AITD    Q+ P+FY  AKK   +K I+G++  +I+  + I + L+  D+ + DA +++FD+ETTGL+P  D+IIE GAIK      + +   F+ PE+++S  I ++T I+ + + +A  IKE L +   F    +L+AHN   FD  F+   ++++     + P IDTL +++++      +SL  + ++ K+ + +   HRA +DA+    + K+ ++  K + ++ +NE+    +N     +N  SL    I++  KN+  + NLY+L++ S T  F   P++      +     ++ ++   GE+ +A +   +   LE+I K  YD+I +   +            R  +    +   K+  + N  VV T D ++LN  D++ FR  +NA            Y+      P  Y  TT+E+ D+ S    D ++V ++V+ NS YIASLI+  + P++  LH P IEGA ++++++  + + S++G  +   V+ R++RE+ ++I +GYA++Y  +  +VK+S +DGYVVGSRGSVGSS+ A ++ ITEVNPL PHY+C  C    F E +++ G+DLP+ NCP C  K+  +G +IPFETF+GF+GDK+PDIDLNFS  YQ +AH FI+ +FG + VFRAGTIST AE+TA+G+V++Y E+S + N R AE  RIA+    V+RTTGQHPGG+++VP   DV+ FTP  +PA+D      TTH A+E +HD L+K D LGHD+PT +KML + T V+ + IP  D + + +F+S  SL +K   +   +  G+ GIPEFGT FV+ ML  T+P  F +L+RISGLSHGT+VW +NAK +I  +  ++S+VI+CRDDIM YLI +G+ P  AFKIME VRKGKGL+EE ++ +     P W++ SC KI YLFP+AHA AYV M +++A+FK++YPL FY++YFSI+   FDI          T+  N IK+++   +       K+     + E+ +E++ RG+ F N+DL KS  T FL+EG  L  PF+ +  +G   A SI + RE+++FSS ED  +RT +  T ++++ + G    L E +QI LF
  S:   180 EVILDIRDDQNDLINEEVSKREVEKETTVSSDEVDTVLMGREIRAVS---RKMKEVLGNESDLVVRGKVFGLESRNGKIF--ILTFNVTDHTDSLTVK-LIGE--NARSLSEKLREGDEITIRGKMETDSWMKDEIL-IPRDIQRTALPK---RVDESLEKRVELHLHTKMSALDSVVDVRELVNTLKDWGHEAAAITDHGVVQSIPEFYFAAKK-KGIKPIFGMEGYMINDSQQISMNLDEEDSSLDDALFLVFDLETTGLNPKEDEIIEIGAIKMKGSEVLGTYSTFVKPEKELSAMITSLTGITEDMLSEARPIKEVLPEFTKFTEGCILVAHNA-SFDYGFVRNSVKKHFGGDWEMPCIDTLALAKSLFRS-KSYSLDNVVKRLKLGHFD--HHRAFEDAKVTAEVLKKFVQLAKKRGVQNVNELEKLRKN-----QNLDSLKPFHISILAKNKKGLENLYRLVTASHTKYFYMKPRIPKSLLADMREGLLIGSACVSGELSKAYIGGASTDELEEIAK-FYDYIEVMPLDNIDTSEGETNMSRETLAKMYREFYKVGKRLNIPVVMTGDVHFLNPHDDI-FRAAINAAQ---------DYDNFQN-QPSLYLHTTEEMLDKASEIFEDEIIVREVVIDNSRYIASLIE-EVTPVEGKLHPPVIEGADEEVRKMAIENAESLYGSPLPEIVERRLNRELEAIIGHGYAVLYLIAQKMVKKSNEDGYVVGSRGSVGSSLVANVIGITEVNPLHPHYLCPECGKSIFPETDLECGYDLPDMNCPICGKKMSKNGQSIPFETFLGFEGDKVPDIDLNFSGEYQERAHSFIEELFGRDHVFRAGTISTLAERTAFGFVRAYSEKSGR-NLRRAEQERIARGIVGVRRTTGQHPGGLMIVPKDMDVHSFTPVQHPANDTKGSTLTTHFAYEVIHDDLVKIDALGHDDPTFIKMLKDITGVDPEKIPMDDPETLSIFSSLKSLGVKYHELGTDM--GTLGIPEFGTTFVRSMLSDTRPSTFGELVRISGLSHGTDVWLNNAKDIITSRQASLSNVIACRDDIMNYLIARGMEPKDAFKIMEKVRKGKGLSEEDEREVRSCGAPEWFVNSCKKIKYLFPRAHAAAYVSMGYRVAYFKVHYPLAFYSTYFSIKGGEFDIDI-------CTSDTNSIKKEIIRLRADQDRNVKDRAKETLLEVVMEMIYRGFNFLNVDLMKSHPTRFLIEGKSLRIPFNRLQNMGYKAARSIEQEREKRVFSSVEDLVRRTSLNKTSVEMLRKYGALKGLAEKEQIRLF 1428
>gi|71894029|ref|YP_278137.1| DNA polymerase III PolC [Mycoplasma synoviae 53] >gi|71850817|gb|AAZ43426.1| DNA polymerase III alpha subunit [Mycoplasma synoviae 53] (1451 aa)
Score = 2102, Expect = 0.0e+00, Identities = 500/1311 (38%), Positives = 796/1311 (60%)
  Q:   146 IKKYLEHFRKFLNDYGFSKHHLSYILDEKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVT-----KLSDLF--FEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNII-DKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDV-KDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEIN--SNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNEL---NTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN--VDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADD-KTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSIL----NGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGD--YLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           ++K L    KFL   G     + Y   +      +  ++ I+  + N +   +         +    KFRK  + ++      +L++ F   E +  +++G I+K + +     +E +  F+TDY D+I + A    K+  + L  L+ G        +  D   N  I   I +++     +E+   D+  IKR E    +     +GL+  +E+   +   G+S+V I+D  +  +FP+FY  AK  + +K IYG  F ++ D N   +    +  +    YV+FDIETT LS Y+ +IIEF A        V+ + +FI  +EK+S     +T I+NE + +  +++KEAL KI D + ++V +AHN   FD  FL  K ++N M   K   ID+L +SR + E    H+L    R   ++YD  +AHRA  D E L + W  +    KL+DIK ++     S  ++D L  +     I    KN+  ++ L++L+S + T  F G PK++W     F N  + SN   +GE+F+  + +++Q +E  I+ K D+I I  P+ F   + R    +  + ++++ +I +A K+NK +++T++  Y ++ D   F+V  +  +   KR+ L+ Y  +   N  +P +YF TTDE+ D FSFL D  L+ DIVV N++ + +LID NI+ IK  L+ P I+ +S+ LK L+Y+ +   +G+ +   V+ RID+E+  +I+  + ++YW SH+LVK++ DDGYVVGSRGSVGSS+ A L++ITEVNPLEPHYIC NCK+F    N  + SG+DL + NCP C S +  DGH+IPFETF+GFK DK+PDIDLNFS  YQ   H++ + +FGE++ FRAGT+S+   + A+G++K Y E++    + N  I  +A+KC +VK TTG+H GGIVV+P   D+ +FTP NY +D  + ++W TTH  ++ L ++LLK D+LGH +PT ++ L + T + +  IP  D +++ LF+ST+ ++I    IN    TG+  +PEFGT F +E++  +KP  F+DLI ISGLSHG NVW +NA+ LI  +  T+++++ CRDDIM YLI KG+   ++FK+ E VRKGKG++ E  K+L+  NIP W+ +S  KI Y+FP+AHA AYVIMAW++ ++K+YYPL FYAS+FS++   FD+ +++    +G  +I NKI EI EK+     K   K KE D++    +ALE+  RG+   NID++KS A +++++ D   LIPPFSA+DG+ ++ A  I+ AR+E+ F +  DF KR+ V++T ++ ++EL +   L E +Q+SLF
  S:   135 VEKELLKLNKFLEKIGID---IIYCFIDNKDSANNSDESDIESSVLNFVQNFQEEFETNSPSTFSKNKFRKKQSREIQFFSIKELNENFSSLEKEQISVKGTIYKKELLFKNNNFEKHNLFITDYDDAIKLIASKSSKVKNEFLDNLEVGKTFIFYCYVDTDQRGNKYIQ--ITKVNTSPDLREY-STDHQKIKRIEFNCKSKNNTLDGLLTPEEIVAEAKRQGHSAVGISDYNSIFSFPEFYYAAKA-NNIKPIYGAGFAMLEDTNGAFLTEFQNQDLITGRYVVFDIETTSLSAYHGEIIEFAATIIENKAVVDKVDIFIKSKEKLSHFTTRLTSITNEMLDQKGIELKEALQKIYDVLNNNVAVAHNA-NFDYNFLIEKFDQNNMQAPKCTFIDSLVVSRILFEHRDKHNLNEFCRNLSVNYDTEKAHRALYDTEVLADAW--IEATLKLKDIKQISNFQELSEYKSDALFSKYFSLYINTVVKNQAGLKELFQLVSIANTKTFYGAPKIFWSTLKSFKNILVGSN-GVQGELFDILLLSSRQRVEKYIQ-KLDYIEIPHPDLFDSYLDRNQLTKDQLLESLQILISLAKKHNKLIISTAEPRYRHKGDREIFKVLTSFPIRD-KRHFLWNYKAVKAGNYSVPNFYFLTTDEMLDAFSFLKDKSLIEDIVVNNAHKLNNLIDENIEVIKTDLYPPSIKNSSELLKDLVYKNAKKKYGEVLPKLVQDRIDKELIPIINYKFDVVYWISHILVKKANDDGYVVGSRGSVGSSLIANLINITEVNPLEPHYICDNCKHFEVVNNDKITSGYDLDDKNCPNCDSIMDKDGHSIPFETFLGFKADKVPDIDLNFSGEYQIAIHNYTRELFGEDKTFRAGTVSSIQYRKAFGFIKKYIEDTNTFYS-NGFIDYLAEKCIDVKVTTGKHAGGIVVLPENLDIEEFTPVNYASDGLEDKEWKTTHFKYDFLKENLLKLDLLGHSDPTQIRFLEQATGLLSKNIPKKDKNLLKLFSSTEPMEIDPNDING-ETTGAIALPEFGTKFTREIIKTSKPHLFADLISISGLSHGQNVWKNNAEDLILNENKTLNEIVCCRDDIMNYLIKKGVDASLSFKVTESVRKGKGVDSEDIKILSTYNIPDWFFDSMQKIKYMFPRAHAVAYVIMAWRMGYYKLYYPLEFYASFFSVKCSKFDLSAMIDFSKDGYWKIKNKIEEI-EKLIRTNNKKDNK-KEEDILESLNVALEMYSRGFTIQNIDIEKSDAYNWIIDKDSKSLIPPFSALDGI-EAGAIKIINARKERPFKTVLDFAKRSGVSSTIVEKLKELNVFKDLPESEQLSLF 1450
>gi|118586857|ref|ZP_01544291.1| DNA polymerase III, alpha subunit [Oenococcus oeni ATCC BAA-1163] >gi|118432689|gb|EAV39421.1| DNA polymerase III, alpha subunit [Oenococcus oeni ATCC BAA-1163] (1437 aa)
Score = 2092, Expect = 0.0e+00, Identities = 501/1282 (39%), Positives = 748/1282 (58%)
  Q:   175 TIDIISDHKNKIQEKIKN-EITEVKRSSN--AKKTDSSF-TYKFRKSVTGDVTKLS--DLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEA-AMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRI--KVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           TID  S+ + +IQE+ +N +  E+  S+   A+  +  + T     +   D TKL   D   +     +EG +FK D   TK G  I    +TDY++SI  K     K + + L  +   +WVK +  + +D Y   +++  I ++  I K  +    D     R EL  HT MT    + +  ELF  ++E    ++AITD  + Q FP+    AKK + +KAIYG++ N ++    I +N N   + D  Y IFDIETTGLS   DKII+  A+K   GV +++   FINP   +S++   +T I+++ VK++    E L   + F   ++L  HN IKFD  F+N  L  +K+  I   +IDTL ++R +      ++L  +++K+ ++ +    HRA  D+     LL+I+ K   EN  +   + LNE   + ++     + R + +++  KN+  ++NLYKL+S S  +      +V      ++ N  +V +    G +F+  A     + +E      YD+I +   E +   I     K R  +E  IK+ +K+A+     +V T D +YL E D +Y  + +N+K+      R     E    L     + T  L DEF+FL       +IVV NS+ I  +ID +++P+K+ L +P IEG+ D L++  Y ++  ++G+ + + ++ R+DRE++++I NGYA+IY  S  LV +S  DGY+VGSRGSVGSS+ A ++ ITEVNPL PHY   N  Y  F  + NV SGFDLPE   P   + L GDG NIPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K MFGE  VFRAGTI T AEKTAYG VK+Y EE+  ++ R AE  R++     VKRTTGQH GGI+++P   DVYDFTP  +PADD   +W TTHL + S+HD++LK DILGHD+PT+L+ L + + ++  T+P  D  V+ LF ST +L +    I  +  TG+ GIPEFGTNFV+ ML  TKP  F +L++ISGLSHGTNVWN NA  LI+     I  VI  RD IM  L+  G+    AF+IME VRKGKG++ E+ ++L  +  +P WYI+S  KI Y+FP+AHA AYV+ A +IA+FK+Y+P  +YA++FS+R   K  D   I  G++++   +   + +  +      +  +E   + IYE+A E   RG +F  +DL KS A D+ ++G+ +I PF A+ GLGD+VA +IV AR E  F SKED  KR  V  T +  M++  +   + + +Q+ LF
  S:   161 TID--SEKQAEIQEQFENSQAAEIHESATEVAQAAEPEYHTNILLGNPIPDSTKLLPLDEVNDGDNVVVEGYLFKSDYRETKRGGAILTVEITDYTNSISAKVFSRSKKDNETLKNIPSNLWVKIRGRVAVDDYMGGELSLNINDMQTIEKESDSDPIDENQKHRIELHAHTTMTTLNAVNSASELFAQAAEWNQDALAITDNADVQAFPEASASAKK-TGVKAIYGLEANYVEDGEAIAINTNREILKDCQYTIFDIETTGLSAVNDKIIQLSAVKMKNGVVLDTFDQFINPGFPLSEQTINLTGITDDLVKNSKPEAEVLKMFQQFYAGTILAGHNVIKFDYGFVNHALAVHKLPKINTLVIDTLNLARWLYPNFGRYTLDFLSKKFSVNLE--HHHRAIDDSTATGMLLHIFLKEAEENYGVVYDEQLNEHTDDHES---WRQTRPTHLSILVKNQTGLKNLYKLVSESNINYHYRVSRVPKSLLTKYRNGLLVGSGDIGGNLFDTLAREGIDKAIELADSINYDYIEVQPLENYQPRIESGFIKDRATLEKLIKQYVKLADILELPLVVTGDVHYLTEKDRIYRTILLNSKIA-----RSAAAGETRYTLADLSMKKTQHLLDEFAFLGKEK-AYEIVVENSHKINQMID-DVQPLKKGLSTPKIEGSEDILRKKAYARAKEMYGNPLPDLIQKRLDRELNAIIGNGYAVIYVISQRLVDKSNKDGYIVGSRGSVGSSLVATMMGITEVNPLPPHYRSVNGNYTEFVEDANVSSGFDLPEKRNPVDGTILIGDGQNIPFETFLGFKGDKVPDIDLNFSGDYQPIAHNYTKVMFGENNVFRAGTIGTVAEKTAYGMVKNY-EEANDVHYRKAEEDRLSNGITGVKRTTGQHAGGIIIIPSDHDVYDFTPIQFPADDTKSNWKTTHLDYHSIHDNVLKMDILGHDDPTLLRALQDMSGIDPKTVPVNDPGVLSLFTSTKALHVTEDEI--MSNTGTLGIPEFGTNFVRGMLEQTKPHNFGELLQISGLSHGTNVWNGNADELIKNGQANIGTVIGTRDKIMTDLMSFGLESSDAFQIMEKVRKGKGISPEHMEILKAHPKVPNWYIDSMLKIQYMFPRAHAAAYVMSALRIAFFKVYFPAIYYAAFFSVRAKDKTIDAVGITQGKTKVQALVKSYRSRYND------LNKEESKTLAIYEIANEAWQRGIEFKMVDLYKSEAFDWKIDGNQIILPFVALQGLGDNVAKAIVAARAEHEFISKEDLAKRGSVNKTLIDFMDQNHMLDGMTDANQMDLF 1435
>gi|116491013|ref|YP_810557.1| DNA polymerase III, alpha subunit ( type) [Oenococcus oeni PSU-1] >gi|116091738|gb|ABJ56892.1| DNA polymerase III, alpha subunit (gram-positive type) [Oenococcus oeni PSU-1] (1437 aa)
Score = 2091, Expect = 0.0e+00, Identities = 501/1282 (39%), Positives = 748/1282 (58%)
  Q:   175 TIDIISDHKNKIQEKIKN-EITEVKRSSN--AKKTDSSF-TYKFRKSVTGDVTKLS--DLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAE---YLLNIW-KRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEA-AMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYK-RGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF--EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDN-NIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRI--KVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           TID  S+ + +IQE+ +N +  E+  S+   A+  +  + T     +   D TKL   D   +     +EG +FK D   TK G  I    +TDY++SI  K     K + + L  +   +WVK +  + +D Y   +++  I ++  I K  +    D     R EL  HT MT    + +  ELF  ++E    ++AITD  + Q FP+    AKK + +KAIYG++ N ++    I +N N   + D  Y IFDIETTGLS   DKII+  A+K   GV +++   FINP   +S++   +T I+++ VK++    E L   + F   ++L  HN IKFD  F+N  L  +K+  I   +IDTL ++R +      ++L  +++K+ ++ +    HRA  D+     LL+I+ K   EN  +   + LNE   + ++     + R + +++  KN+  ++NLYKL+S S  +      +V      ++ N  +V +    G +F+  A     + +E      YD+I +   E +   I     K R  +E  IK+ +K+A+     +V T D +YL E D +Y  + +N+K+      R     E    L     + T  L DEF+FL       +IVV NS+ I  +ID +++P+K+ L +P IEG+ D L++  Y ++  ++G+ + + ++ R+DRE++++I NGYA+IY  S  LV +S  DGY+VGSRGSVGSS+ A ++ ITEVNPL PHY   N  Y  F  + NV SGFDLPE   P   + L GDG NIPFETF+GFKGDK+PDIDLNFS  YQ  AH++ K MFGE  VFRAGTI T AEKTAYG VK+Y EE+  ++ R AE  R++     VKRTTGQH GGI+++P   DVYDFTP  +PADD   +W TTHL + S+HD++LK DILGHD+PT+L+ L + + ++  T+P  D  V+ LF ST +L +    I  +  TG+ GIPEFGTNFV+ ML  TKP  F +L++ISGLSHGTNVWN NA  LI+     I  VI  RD IM  L+  G+    AF+IME VRKGKG++ E+ ++L  +  +P WYI+S  KI Y+FP+AHA AYV+ A +IA+FK+Y+P  +YA++FS+R   K  D   I  G++++   +   + +  +      +  +E   + IYE+A E   RG +F  +DL KS A D+ ++G+ +I PF A+ GLGD+VA +IV AR E  F SKED  KR  V  T +  M++  +   + + +Q+ LF
  S:   161 TID--SEKQAEIQEQFENSQAAEIHESATEVAQAAEPEYHTNILLGNPIPDSTKLLPLDEVNDGDNVVVEGYLFKSDYRETKRGGAILTVEITDYTNSISAKVFSRSKKDNETLKNIPSNLWVKIRGRVAVDDYMGGELSLNINDMQTIEKESDSDPIDENQKHRIELHAHTTMTTLNAVNSASELFAQAAEWNQDALAITDNADVQAFPEASASAKK-TGVKAIYGLEANYVEDGEAIAINTNREILKDCQYTIFDIETTGLSAVNDKIIQLSAVKMKNGVVLDTFDQFINPGFPLSEQTINLTGITDDLVKNSKPEAEVLKMFQQFYARTILAGHNVIKFDYGFVNHALAVHKLPKINTLVIDTLNLARWLYPNFGRYTLDFLSKKFSVNLE--HHHRAIDDSTATGMLLHIFLKEAEENYGVVYDEQLNEHTDDHES---WRQTRPTHLSILVKNQTGLKNLYKLVSESNINYHYRVSRVPKSLLTKYRNGLLVGSGDIGGNLFDTLAREGIDKAIELADSINYDYIEVQPLENYQPRIESGFIKDRATLEKLIKQYVKLADILELPLVVTGDVHYLTEKDRIYRTILLNSKIA-----RSAAAGETRYTLADLSMKKTQHLLDEFAFLGKEK-AYEIVVENSHKINQMID-DVQPLKKGLSTPKIEGSEDILRKKAYARAKEMYGNPLPDLIQKRLDRELNAIIGNGYAVIYVISQRLVDKSNKDGYIVGSRGSVGSSLVATMMGITEVNPLPPHYRSVNGNYTEFVEDANVSSGFDLPEKRNPVDGTILIGDGQNIPFETFLGFKGDKVPDIDLNFSGDYQPIAHNYTKVMFGENNVFRAGTIGTVAEKTAYGMVKNY-EEANDVHYRKAEEDRLSNGITGVKRTTGQHAGGIIIIPSDHDVYDFTPIQFPADDTKSNWKTTHLDYHSIHDNVLKMDILGHDDPTLLRALQDMSGIDPKTVPVNDPGVLSLFTSTKALHVTEDEI--MSNTGTLGIPEFGTNFVRGMLEQTKPHNFGELLQISGLSHGTNVWNGNADELIKNGQANIGTVIGTRDKIMTDLMSFGLESSDAFQIMEKVRKGKGISPEHMEILKAHPKVPNWYIDSMLKIQYMFPRAHAAAYVMSALRIAFFKVYFPAIYYAAFFSVRAKDKTIDAVGITQGKTKVQALVRSYRSRYND------LNKEESKTLAIYEIANEAWQRGIEFKMVDLYKSEAFDWKIDGNQIILPFVALQGLGDNVAKAIVAARAEHEFISKEDLAKRGSVNKTLIDFMDQNHMLDGMTDANQMDLF 1435
>gi|31544298|ref|NP_852876.1| hypothetical protein MGA_0791 [Mycoplasma gallisepticum R] >gi|31541142|gb|AAP56444.1| PolC [Mycoplasma gallisepticum R] (1501 aa)
Score = 2089, Expect = 0.0e+00, Identities = 490/1182 (41%), Positives = 715/1182 (60%)
  Q:   275 KKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYN-EAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYH----------KGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFI-GDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNI------------WKRMLE--------------------NQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYN-ELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLI-DANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDSGFDLPESNCP--KCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILK--TGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGE-SEITNKINEIKE-----KMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           K +  + L   K G W+K  I +++   +++     I  I     P+           R E   HT M+  +GL ++ +L KF  E     +AITD    Q F D  + + K  S+ K  YG++ ++ D    IV N  D K+   ++VIFDIETTGL+ YY++IIE  A++            + VQ+   +  I  ++ +S     +T + + D+KDA   K  L +  +FI  D VL+AHNGI FD  ++N KL++ K+  + NP++D+L+++  +  Q   ++L  ++ K   +YD+T AHRA+ D E L               W+ +L+                    N ++ D   L++I  + +N F R R R +L  VY KN   ++ LYKL+S + T  F G  K++W +  ++ N  ++S+    G I  AA  +T + L  +IK K+ F+ +  P  F  D++++  +   + D I RII I  +       +S  +YL +  + ++   + A++ G K +  +  +   N  +P  + R  +E+  +FSF+ D  ++  ++  N   IA+L  D  + P  + LH P IEG+ DKL +L++ K+  +FGD +N  +K+RI+ E++++I NGY +IYW +HLLVK+S DDGY+VGSRGSVGSS+ A L  I+EVNPL+P+Y C  CK   F  NVD G DL    C    C  +++G+GHNIPF +FMGFKG+K PDIDLNFS+ YQ KAHD+++ +FGE    R GTIST  +KTAY   K Y E +             A +   +KRTTGQHPGGI+V P  K++ DF P NYPADDK+  W T+H  FE LHD+LLK DIL  ++PTILK L E TNV  + IPN D  V+ LFN    L+  N   N ILK  TG+ GIPEFGT   +E+L + KP   +DLIR+SGLSHGT+VW +NA  LI +K   +++VI+CRDDIM YL   GI   IAF IMEDVRKGK L  EY+K++ + N+   YI+SCNKI Y+FPKAHATAYV+MAWKIAWFK++YP  FYA+ FS ++K  DI++ +NG    IT + NEIK      K A  K++  +  K+ DL+P YEL LE+L R  K   + L+ S A  F+V+ + + PPF+ I+GLGD +A  IVK R E+ F S+ D K + K+            +   L ED++I L+
  S:   272 KHLTSEYLDNFKVGNWIK--IQLRVTSSKDDKKYTEILRIDHAELPEWLKPTPEEFTNRHEFFFHTKMSVHDGLNDVDDLKKFCEENKLKDIAITDSGVVQAFADLASWKEKTNSETKVHYGLEVDLFDDRNFIVKNNKDLKLDQLSFVIFDIETTGLNAYYEQIIEIAAVRVKAELNVTNHQLEFVQIGKFEKLIKNKKPLSKFTTQLTGLKDSDLKDAQDEKTVLEEFVNFIQKDDVLVAHNGIDFDFIWINTKLDKYKLKPLDNPMLDSLRLAYQL-YQFKRYTLENLSLKLGYEYDKTLAHRANYDTELLAKCLMIMLSQVYAKNWRSLLDLNDQEKLLNDLSEKSLKKAANLRINDEDNLDQITQSNENLFNRIRLRKAL--VYAKNAQGLKALYKLVSLASTKQFYGSQKLFWSDLEKYQNDLLISSHPINGHIVHAAKYDTNENLRKLIK-KHSFVLVPLPSLFKQDLYKKNIELTHVHDLINRIISICEQEKILYTFSSAAHYLKQEQKQFYDCLITAEITGKKLHHFYDRDLSTNQNVPDLHIRKNNEVYHDFSFIQDQEILAKLIYRNGEKIANLFNDEGLLPFPKKLHPPKIEGSDDKLIELVWNKAKELFGDEINPIIKSRIEYELNAIIKNGYGIIYWLAHLLVKKSNDDGYLVGSRGSVGSSIVALLAGISEVNPLQPYYYCKKCKKTKFVDNVDDGHDLVNKPCELLDCDGEMRGEGHNIPFASFMGFKGEKTPDIDLNFSSFYQAKAHDYVRELFGESHTTRCGTISTMQDKTAYKIAKDYLEITIGEEESERLAGWYASEMSEIKRTTGQHPGGILVFPKDKEIEDFCPVNYPADDKSSKWKTSHFKFEYLHDTLLKLDILSQEDPTILKYLYEITNVKPEEIPNNDPKVLSLFNLDHCLENVNN--NPILKDSTGALGIPEFGTKITREILKIAKPASVADLIRVSGLSHGTDVWTNNAADLIVDKHYKLNEVIACRDDIMTYLSSLGIENQIAFNIMEDVRKGKKLKPEYEKIMQEFNVSQDYIDSCNKIKYMFPKAHATAYVLMAWKIAWFKVHYPEAFYAAIFSFKVKEHDIETCINGGIRAITKRYNEIKSLINKTKFAKNKSELTLNKKDEDLMPTYELYLEMLERNIKLEQVSLEHSDALHFVVKNNKIYPPFNTINGLGDEIAKLIVKKRNEEGFKSQADLKTKCKLNKNIWNYFITYQVFGDLKEDEKIRLY 1501
>gi|160880751|ref|YP_001559719.1| DNA polymerase III, alpha subunit [Clostridium phytofermentans ISDg] >gi|160429417|gb|ABX42980.1| DNA polymerase III, alpha subunit [Clostridium phytofermentans ISDg] (1527 aa)
Score = 2087, Expect = 0.0e+00, Identities = 485/1245 (38%), Positives = 733/1245 (58%)
  Q:   214 FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYEN----NDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFP---------DFYNEAKKYSK---LKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPL----IDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEIN--SNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIK-----DKYDFITIGSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN------VDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           + +   GD   + D+  E+    I G+I   ++   +    +  + VTD++D+I  K     +  +D+  ++K+G++++ K     D Y      N I G+ +  S I K  +  R++N   KR EL  HT M+  + +V+ + L K + E G+ +VAITD    Q FP         D+ ++ +K  +    K IYG++  ++D    IV       I D T V+FDIETTG S   DKIIE GA+K   G  V+    FINPE  I   I  +T I++E V  +  I+E L +   F     L+AHN   FD+ F+  K E      +  PL    +DT+ ++R +   ++   L  +A+   I  +    HRA  DA     I+ + LE  + + I+TL +IN    +  D +++      I + C+N+    NLY+++S S  + F   P++      +     ++ ++   GE+++A + N+ +   +I++     D Y+   +G+ +  +     +I     +++  ++II +  +YNK VVAT D ++LN  DEVY R+ + AK      N+              YFRTT+E+ +EFS+L       ++V+TN+N +  +I+  I P++    +P IE +   L+ + Y+K++S++G  +   V  R++ E+ S+I+NG+A++Y  +  LV +S +DGY+VGSRGSVGSS AA +  ITEVNPL  HY C NC + +FE          SG D+P+ +CP C   L  DGHNIPFETF+GF GDK PDIDLNFS  YQ KAHD+ + +FG+ + FRAGTI T A+KTA+GY K Y+EE K ++ R AEI RI + C  V+RTTGQHPGGI+V+P G+++Y FTP   PA+D T    TTH  + S+  +LLK DILGHD+PT+++ML + T ++A TI   D  V+ LF ST+SL I+   I      GS G+PE GT+FV +ML  TKPQ FSD+IRISGLSHGT+VW +N + LI E   T+S  I  RDDIM YLI +G+   +AFKIME VRKGKGL  E ++ +  N +P WYI SC +I Y+FPKAHA AYV+MA++IA+FK+YYPL +Y +YFSIR   F+ + +  G   +   + E K +M +      +  KE D +   ++  E+  RG+ F  ID+  + A  F +    L+P  S IDGLGD  A  +V+A ++  F S++DFK R K++ T + +M +LG+   L   +QISL +F
  S:   280 YGRPFEGDSIPIKDIQEEIGEVVIRGKILFTEERELRNEKFLISFNVTDFTDTISAKIFVRTEEIEDIRGQIKKGMFIRLKGMALYDTYSREITINSIIGIKKIPSFIEKRVD--RYEN---KRVELHAHTMMSDMDAVVDPQALVKTAFEWGHKAVAITDHGVVQAFPEASHAINPKDYKDDEEKMQRAKDFKIIYGMEAYVVDDMKDIVQGECGQGIED-TCVVFDIETTGFSSVKDKIIEIGAVKIQHGTIVDRFSTFINPEVPIPYHIQKLTSITDEMVIGSRTIEEILPEFLSFCEGCYLVAHNA-SFDIGFITKKAE-----FLNIPLTVTSVDTVGLARVLLNHLNNFKLDTVAKALSISLE--NHHRAVDDAGCTAEIYLKFLEMLRERGIETLAQINRAEEVTPDVIKKMPTYHAI-ILCQNDIGRVNLYRMVSYSHINYFQRRPRIPKSVLMKHREGLLIGSACEAGELYQAILRNSSE--GEIVRLANFYDYYEIQPLGNNQFMIESEKIDISSEEELKEINRKIIALGEEYNKPVVATCDVHFLNPEDEVYRRIIMAAKGFSDADNQ-----------APLYFRTTEEMLEEFSYLGKEK-AEEVVITNTNKVCDMIE-KISPVRPDKCAPVIEDSDKTLRDICYEKAHSMYGPDLPKIVADRLEHELKSIINNGFAVMYIIAQKLVWKSNEDGYLVGSRGSVGSSFAATMSGITEVNPLPAHYYCPNCHFSDFESEEVKAFGSSSGCDMPDRDCPVCGQPLAKDGHNIPFETFLGFNGDKEPDIDLNFSGEYQSKAHDYTEVIFGKGQTFRAGTIGTLADKTAFGYAKKYYEE-KSVHKRVAEINRIVEGCVGVRRTTGQHPGGIIVLPLGEEIYSFTPVQRPANDMTTKTVTTHFDYHSIDHNLLKLDILGHDDPTMIRMLEDLTGIDAKTIRMDDQKVISLFKSTESLGIRPEDIGGC-DLGSLGLPELGTDFVMQMLRDTKPQSFSDMIRISGLSHGTDVWLNNTQTLISEGKCTLSTAICTRDDIMTYLISEGVENGLAFKIMESVRKGKGLTPEMEEAMVANGVPDWYIWSCKRIKYMFPKAHACAYVMMAFRIAYFKVYYPLAYYTAYFSIRATAFNYELMCLGRERLDYHMAEYKRRMGSNDPAQKLTKKEEDTLKDMKVVQEMYARGFDFLPIDVYTAKAHHFQIIDGKLMPALSTIDGLGDKAADQVVEAVKDGKFLSRDDFKTRCKISGTVVDLMGDLGLLGDLPMTNQISLMDF 1525
>gi|160940984|ref|ZP_02088323.1| hypothetical protein CLOBOL_05878 [Clostridium bolteae ATCC BAA-613] >gi|158436074|gb|EDP13841.1| hypothetical protein CLOBOL_05878 [Clostridium bolteae ATCC BAA-613] (1565 aa)
Score = 2083, Expect = 0.0e+00, Identities = 478/1260 (37%), Positives = 741/1260 (58%)
  Q:   199 RSSNAKKTDSSF----TYKFRKSVTGDVTKLSDLFFE-MKTATIEGEIFKID---KVVT------KTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFI--RHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNP-LIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEIN--SNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEK------NVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVN-ADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           R    +  DS F     Y  ++S   DV    D   E M+   I+GEI ++    KV+T      ++G  I  + V+D++D+I +K     +I  +V S +  G+++K K    ID ++     G    I  I K  +F   R D++L KR EL  HT M+  +G+  +K + K + + G  +VA+TD    Q FPD  +   K    K +YGV+  ++D    +V N+      D T+V+FDIETTG SP  +KIIE GA+K   G   +    F+NP+  I   I  +T I++  V    KI   L +  +F+GD+VL+AHN   FD+ F+    E  K+++  +P ++DT+ I+R +   ++   L  +A+   I       HRA  DA     I+   ++  + +D+  LN++N  S +  D +R+     +I +  KN+    N+Y+L+S S    +   P++      ++    I+ ++   GE+++A +          +   YD++ I   G+    L D    +  +  + +  K+I+++  ++NK V AT D ++L+  DEVY R+     ++ G+    FK ++    L   Y RTT+E+ +EFS+L  P   +++V+TN+  IA + +  I P++     P IE +   L ++ Y +++ ++G+ +   V  R++RE+ S+I NG+A++Y  +  LV +S +DGY+VGSRGSVGSS  A +  ITEVNPL PHY C  C+Y++F+       +  +G D+P+  CP C + L+ DG +IPFETF+GFKGDK PDIDLNFS  YQ KAHD+ + +FG+ + FRAGTI T A+KTA+GYVK Y+EE +    RN EI RI + C  V+RTTGQHPGGI+V+P G+++Y FTP  +PA+D T    TTH  + S+  +LLK DILGHD+PT+++ML +   ++    IP    +VM LF  T +L I    I      G+ G+PEFGT+F  +MLL TKP+ FSDL+RI+GL+HGT+VW  NA+ LI+E   TI   I  RDDIMVYLI +G+   ++F IME VRKGKGL  E+++ +  + +P WYI SC KI Y+FPKAHA AYV+MAW+IA+ KI+YPL +YA++FSIR   F  + +  G  ++   + + K++         +  KE D +    +  E+  RG+ F  ID+ ++ A  F +    L+P  S+IDGLG+  A ++V A ++  F S EDF  R+KV  T   +M +LG+   L + +Q+SLF+ 
  S:   308 RKGWGRDKDSGFGDDKKYSVKRSNNPDVLYGRDFEDEPMEIEKIDGEIGEVTLRGKVLTCENRELRSGKFILTFDVSDFTDTITVKMFIRPEIFDEVKSAINPGMFIKVKGVTTIDKFDGELTLG---SIVGIKKADDFTSKRMDSSLEKRVELHCHTKMSDMDGVSEVKSIIKRAKQWGMPAVAVTDHGCVQAFPDANHALDKGDTFKILYGVEGYLVDDTKQLVENSRGQDFGD-TFVVFDIETTGFSPKKNKIIEIGAVKVVDGRITDKFSTFVNPDVPIPFDIEKLTGINDSMVLPYPKIDVILPQFLEFVGDAVLVAHNA-SFDVGFIGHFAE--KLELPFDPTVLDTVAIARLLLPNLNRFKLDTVAKALNISLQ--NHHRAVDDAGATAEIFAAFVKMLRDRDVNDLNQLNALSTMDTDTIRKLPTHHVI-ILAKNDIGRVNMYRLVSWSHLEYYARRPRIPKSLLEKYREGLIIGSACEAGELYQALLRGAPDTEIARLVSFYDYLEIQPLGNNAFMLRDEKSTVKSQEDLIEINKKIVELGMQFNKLVCATCDVHFLDPQDEVYRRI-----IMAGQG---FKDSDDQAPL---YLRTTEEMLEEFSYLG-PDKAHEVVITNTRKIADMCE-KIAPVRPDKCPPVIEDSDKTLTKICYDRAHEMYGEDLPKIVVDRLERELHSIITNGFAVMYIIAQKLVWKSNEDGYLVGSRGSVGSSFVATMSGITEVNPLSPHYHCPKCRYYDFDSEEVKQFSGMAGCDMPDKECPVCGTPLEKDGFDIPFETFLGFKGDKEPDIDLNFSGEYQSKAHDYTEVIFGKGQTFRAGTIGTLADKTAFGYVKKYYEE-RGTRKRNCEINRIVQGCVGVRRTTGQHPGGIIVLPLGEEIYSFTPVQHPANDMTTSTVTTHFDYHSIDHNLLKLDILGHDDPTMIRMLQDLIGIDPVKDIPLDSREVMSLFQDTSALGIMPDDIGGC-PLGALGVPEFGTDFAMQMLLDTKPKYFSDLVRIAGLAHGTDVWLGNAQTLIQEGKATIQTAICTRDDIMVYLIAQGLEQGLSFTIMESVRKGKGLKPEWEEEMKAHGVPEWYIWSCKKIKYMFPKAHAAAYVMMAWRIAYCKIFYPLAYYAAFFSIRASAFSYEIMCQGRDKLEYYLADYKKRADT------LSKKEQDTLRDMRIVQEMYARGFDFTPIDIYRAKARHFQIIDGKLMPSLSSIDGLGEKAADAVVDAVKDGAFLSIEDFSNRSKVNGTLCSLMSDLGLLKDLPKSNQLSLFDL 1565
>gi|182419729|ref|ZP_02950970.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium butyricum 5521] >gi|182376466|gb|EDT74047.1| DNA polymerase III, alpha subunit, Gram-positive type [Clostridium butyricum 5521] (1472 aa)
Score = 2083, Expect = 0.0e+00, Identities = 496/1262 (39%), Positives = 758/1262 (60%)
  Q:   196 EVKRSSNAKKTDSSFTYKFRKS-VTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVK-------AKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNE-AKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLN--CKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLIT----VYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAM-SNTQQVLEDIIKDKYDFITI---GSPECFLHDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNF-EKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLT-ISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNE-----EYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEI--KEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSI-VKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFN 1457
           E K    + K ++ F    R S +  ++ K+ D+     T  IEGEI  I+    ++G  +  + + D S S+  K+    + + +V+S+LK+   V+       +K S +I++     I  +I E + I + K   R DN+ +KR EL  HT M+  + + +  +L K +   G  S+AITD    Q FP+ +    +    +K IYGV+  +     P V N     I D  Y + D+ETTG SP  +KI E G +K   G  ++    F+NPE+ I  ++  +T I+++ V++A  I +   K+ +FI  S+L+AHN  +FD+ FL    K+  +  D      +DTL +++ +  Q   + LG IA+   I  +   AHRA  D +  + ++  M++  K +  KTL++I +   ++  ++     L T    +  K+   ++NLYKL+S S    F   P++    F +++   I+ ++ +EGE+F++ +   + + +E+I KD YD++ I   G+ +  + +   ++  + +I++  ++II +  K  K VVAT D ++++  DE+Y R+         +  + FK  ++   L   Y +TT+E+ +EFS+L +     ++VVTN+N I+ + +  I PI      PHI+G    +K + Y K++ ++G+ +   VK R+++E+ S+I NG++++Y  +  LV +S DDGY+VGSRGSVGSSV A++  ITEVN L PHY C  CKY +F +    +GFDLP+  CP C   +  DG +IPFETF+GF GDK PDIDLNFS  YQ KAH + + +FG+   F+AGTI T AEKTA+GYVK Y+EE K      AEITRIAK C  +KRTTGQHPGGI+VVP G+++++F P  +PADD   D  TTH  + S+  +LLK DILGHD+PT+++ML + T +N  TIP  D + M LF+ST +L +    IN   K G+ GIPEFGT FV+ ML+ T P+ FSDL+ ISGLSHGT+VW  NAK LI+   +T ISD + CRDDIMVYLI   + P  AFKIME VRKG+ L       EY+ ++ +N++P WYI+SC KI Y+FPKAHA AYV+MA++IAWFK++ P  +YA+YFSIR K FD + ++ G+  +  K+ EI  +   A PK K        D+    E+ LE+  RG+KF  IDL KS AT F VE + L PP ++I G+G   A SI     E +  SS ++ KKR K+  +   ++ + G  + + E DQ+S F+
  S:   221 ESKSEGKSNKKNNPFLILGRSSNIKENIVKIIDITPYEGTVAIEGEISNIETKELRSGKILVSFDLYDGSSSMCCKSFLKPEQSDEVISKLKKAKGVRLCGNSGYSKFSGEIEI-----IANIIVETNGIKRAK---RVDNSEVKRVELHMHTKMSQMDAMSSAGDLIKRAMSWGMKSIAITDHGVVQAFPEAHKLLGRDNPDMKIIYGVEAYLAPDKKPSVKNIKGQSIDD-IYCVLDLETTGFSPKLEKITEIGIMKVKDGKVIDKFSTFVNPEKPIPPRVVEVTNITDDMVRNAETIDKVFPKMLEFIEGSILVAHNA-EFDIGFLRHYAKVLGHDFDFT---YLDTLSLAQDLFPQYKSYKLGRIAKNLGIKVE--VAHRALDDVDTTVKVFNVMIDMLKERGAKTLSDIETYACDEESKKVQYKKLRTHHAIILAKDYTGLKNLYKLVSYSHLDYFYKKPRILKSMFKKYSEGLILGSACSEGELFQSILLGKSDEEIENIAKD-YDYLEIQPIGNDDYLIRN--EQVPNKEYIKEINRKIISLGEKLGKLVVATGDVHFMDPEDEIYRRIL--------EAGQGFKDADMQAPL---YLKTTEEMLEEFSYLGEEK-AYEVVVTNTNKISEMCE-QISPISPEKCPPHIDGCEQTIKDIAYGKAHELYGENLPKIVKDRLEKELDSIIKNGFSVMYIIAQKLVWKSNDDGYLVGSRGSVGSSVVAYMTGITEVNALPPHYRCPKCKYSDFNDYGSKNGFDLPDKVCPACGENMDKDGMDIPFETFLGFNGDKEPDIDLNFSGEYQAKAHKYTEVIFGKGTTFKAGTIGTIAEKTAFGYVKKYYEE-KSQTITKAEITRIAKGCTGIKRTTGQHPGGIIVVPKGREIFEFCPVQHPADDPDSDIITTHFDYHSIDQNLLKLDILGHDDPTVIRMLQDITGINPHTIPLDDKETMSLFSSTTALGVTPEQINS--KVGTFGIPEFGTKFVRGMLVDTLPKTFSDLLCISGLSHGTDVWLGNAKDLIDTGVITSISDAVCCRDDIMVYLIKMNLPPNTAFKIMELVRKGQALKNPEKWAEYEALMRENDVPEWYIDSCKKIKYMFPKAHAAAYVMMAFRIAWFKVHIPKAYYAAYFSIRAKAFDAEFMIFGKDRVKEKMAEILAQGNDAAPKDK--------DMYDDLEIVLEMYERGFKFLPIDLYKSDATKFKVEEEGLRPPLNSIAGMGSVAAESIYATVHEIEPISSVDNLKKRAKIGNSATDLLRKFGCLNGMQESDQVSFFD 1469
>gi|153814386|ref|ZP_01967054.1| hypothetical protein RUMTOR_00596 [Ruminococcus torques ATCC 27756] >gi|145848782|gb|EDK25700.1| hypothetical protein RUMTOR_00596 [Ruminococcus torques ATCC 27756] (1459 aa)
Score = 2082, Expect = 0.0e+00, Identities = 486/1234 (39%), Positives = 733/1234 (59%)
  Q:   225 LSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFI--RHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPD---FYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSL-------ITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMS--NTQQVLEDI-IKDKYDFITIGSPECFLHDIHREIYKRGWIEDAI---KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKN-VDS-----GFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTE-------QTNVNAD------TIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           L  +  EM   T+ G+I   D    +    I  + VTD++D+I +K     +   ++L ELK+G +VK K    ID ++  ++T  I  ++ I K  +F   R D + IKR EL  HT M+  +G+  +K++ K + + G+ ++AITD    Q FPD   +     K    K +YGV+  ++D    I +NA +  + D TY++FDIETTG S   D IIE GA+K   G   +    F+NP+  I  +I  +T I++E V D+  I   L +  +F GD VL+AHN   FD+ F+  NC+      + +    +DT+ ++R +   +  + L ++A+   I  +    HRA  DAE    I+ +  E  K   + TL E+N         +RN  ++       I +  KN+    NLY+LIS S  + +   P++     NE     ++ ++   GE+++A     + QQ+       D Y+   +G+ + F+ +  R I     IED     + I+++  K+ K VVAT D ++LN  DEVY R+ +  K       +           P  + RTTDE+ +EFS+L       +IV+ N   IA +I+  I P+      P IE +  +L+ + Y+K++ ++G+ +   V AR+++E++S+I NGYA++Y  +  LV +S  DGY+VGSRGSVGSS  A +  ITEVNPL PHY C+ C Y +FE + V S     G+D+P+  CP C  +L   G +IPFETF+GFKGDK PDIDLNFS  YQ KAH + + +FGE   F+AGTI T A+KTAYG+V++Y+EE ++   R  EI R+ + C  ++R+TGQHPGGIVV+PHG D+ +FTP  +PA+D      TTH  + S+  +LLK DILGHD+PT+++ L +       +   NAD       IP  D DV++LF+ T+ L IK   I+   K GS GIPEFGT+FV +M+  TKPQ  SDLIRISGLSHGTNVW  NA+ L++    TIS  I  RDDIM+YLI+KG+   +AF IME VRKGKGL  E+++ +   ++P WYI SC KISY+FPKAHA AYV+MA++IA+ KI YPL +YA+YF IR   F    +  G+  +   I + K K         +  KE D++   ++  E+  RG++F  ID+ ++ A  F +    L+P  ++I+G+GD  A ++ +A ++  + S +DF++RTKV+ T + +M ELG+   L + +Q+SLF+F
  S:   225 LEQVITEMGEITVHGKIISFDTREIRNEKTIIIFSVTDFTDTITVKMFAKNEQLPEILGELKKGAFVKVKGVTMIDKFDG-ELT--IASVTGIKKIGDFTVQREDLSPIKRVELHCHTKMSDMDGVSEVKDIVKRAHDWGHPAIAITDHGVAQAFPDANHYIETLDKDDPFKVLYGVEGYVVDDLTEIAVNAGNQTLDD-TYIVFDIETTGFSSIKDAIIEIGAVKVTDGKITDRFSTFVNPKRPIPFEITNLTSITDEMVMDSPTIDVVLPQFLEFAGDGVLVAHNA-GFDVGFIEQNCRSLGLSDEFV---YLDTVALARVLLPTLSKYKLNIVAKALNISLE--NHHRAVDDAEATAEIFVKFTEMLKKDQVGTLKEVNR------YGDRNVNAIRKMPTHHIIILAKNDIGRYNLYQLISQSHMTYYARRPRIPKSLLNEHREGLLIGSACEAGELYQAVHEKRSAQQIARLAEFYDYYEIQPVGNNQ-FMIESER-IADVNSIEDLQNINREIVELGEKFGKPVVATCDVHFLNPDDEVYRRIIMAGKGFDDADRQ-----------PPLFLRTTDEMLEEFSYLG-AAKAREIVIDNPVKIAGMIE-KISPVNPNKCPPVIENSDQELRDICYRKAHEMYGEDLPKQVSARLEKELNSIISNGYAVMYIIAQKLVWKSNADGYLVGSRGSVGSSFVATMAGITEVNPLSPHYYCSKCHYSDFESDEVRSFAGGCGYDMPDKKCPVCGEQLVKAGFDIPFETFLGFKGDKEPDIDLNFSGDYQAKAHKYTEVLFGEGHTFKAGTIGTLADKTAYGFVRNYYEEHEQ-RKRKCEIERVTEGCTGIRRSTGQHPGGIVVLPHGHDINEFTPVQHPANDMECGITTTHFDYHSIDHNLLKLDILGHDDPTMIRTLEDYITSDAMENEYNADHPFIATEIPLDDKDVIELFHGTEVLGIKPEDIDGC-KIGSLGIPEFGTDFVIQMVQDTKPQTLSDLIRISGLSHGTNVWLGNAQELVKSGKATISTAICTRDDIMIYLINKGVESALAFTIMESVRKGKGLKPEWEEAMKAQDVPDWYIWSCKKISYMFPKAHAAAYVMMAYRIAYCKINYPLAYYAAYFGIRADAFSYALMCQGKETLNYHIKQYKSKGDQ------LSKKEQDVLKDMKIVQEMYARGFEFVPIDIYRAKAKMFQIVDGKLMPSLASIEGMGDKAAEAVEEAAKDGAYLSLDDFRQRTKVSKTVIDLMAELGLFGDLPQSNQLSLFDF 1458
>gi|19703626|ref|NP_603188.1| DNA polymerase III alpha subunit [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713736|gb|AAL94487.1| DNA polymerase III alpha subunit [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (1454 aa)
Score = 2082, Expect = 0.0e+00, Identities = 490/1284 (38%), Positives = 773/1284 (60%)
  Q:   173 EKTIDIISDHKNKIQEKIKNEITEVKRSSNAKKTDSSFTYKFRKSVTGDVTKLSDLF--FEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNEAKKYS----KLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFLNCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNF-DGGPKVYWENFNEFNNSFIVSNSATE-----GEIFEAAMSNTQQVLEDIIKDKYDFITIGSPECFLHDIHRE----IYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRV--YVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTN--CKYFNFEKNVDSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLN-----EEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLF 1456
           EK  D I+  + K+ +      T+V ++ N  K  S       + + G+   + D +  ++ +T  +EGEIF ++ +  K+G  +    VTD   S+  K      +++D   ++ EG+++K    +Q+D Y  N+ T +I  I+I+ K +   + D A  K  EL  HT M+   G+ +++++ K + E G+ ++AITD     ++P  +  AKK+S    K+KAI+G +  +ID   P+V N  D KI D  +V+FDIETTGL+ + ++IIE GA+K   G  V+     INP   I   I  IT I++E V +  KI E + K  DFIGD+VL+AHN   FD+ F+   +++      +  +IDTLQ++R +   +  + LG + +   +  +  + HRA  D++   N++   L+  K + ++ + +IN   + +  ++  +   I V  K +  ++N+Y+L+S +    F +   ++      E     I+ +S T      GE+ +  + +  + LE+  K  YD+I +     +   I ++    +     +E   K    +  +    V A+S+ +YL+E++++   +  Y +  V     +R +  N        +YFRTTDE+  EFS+L D   V ++V+TN+N IA +I++ IKPI E  + P +E A + ++ + Y+K+Y I+GD + N V AR++RE++++I+NG++++Y  +  LVK+S+D+GY+VGSRGSVGSS+ A+++ ITEVN L PHYIC N  CKY  F +    G DLP+  CPKC +KL+ DG++IPFE FMGFKGDK+PDIDLNFS  YQ + H + + +FG+E VF+AGTIST AEK A  YV+ YFE++  +NA  AEI R+ + C+  K+TTGQHPGG+V+VP G  +Y+F P   PA+D+T +  TTH  +  + + L+K DILGHD+PT +K+L E TN+    IP  D D + +F+ST+SL +    I    + G+ GIPEFGT FV++ML+ T+P  F++L+RISGLSHGTNVW +NA+  +     T+S +I+ RDDIM YLID+G+    +FKIME VRKGK        E+Y  ++ + N+P WYIESC +I Y+FPK HA AYV+MA +IA+FK++ PL FYA++ S +   FD++ +  G   I  K  +++E    PK     KN++     I E+ +EL  RG +   +D+  S    F +E   +  P   I+GLG +V  +IVK REE  F S ED K+RTK+    +  ++ +G  SSL+E +QISLF
  S:   183 EKHQDTINAEREKVVKTNSTSETQVYKAKNDFKRGSK-----TREIKGETISIKDFYDLYDGETCIVEGEIFSMEDMTLKSGKILRTIRVTDGESSLTSKIF----LDEDDKLDIHEGMFLKLSGKLQLDTYAGNEKTLMINTINILEK-ENTKKEDTAEEKMVELHAHTKMSEMVGVTDVEDIIKRAKEYGHKAIAITDYSVVHSYPAAFKTAKKFSTDEEKMKAIFGCEMYMIDDEAPMVTNPKDKKIDDEEFVVFDIETTGLNSHTNEIIEIGAVKIKAGRIVDRYSQLINPGRPIPYHITEITSITDEQVANEPKIDEVIGKFVDFIGDAVLVAHNA-PFDMGFIKRDIKKYLNIDYQCSVIDTLQMARDLFPDLKKYGLGDLNKTLGLALE--KHHRAVDDSQATANMFIIFLDKYKEKGLEYMKDINVGFEVNVKKQSLKN--IMVLVKTQDGLKNMYRLVSEAHIKYFGNKKARIPKSVLTENREGLIIGSSLTAHFMNIGELADLYLRHDLEKLEEAAK-FYDYIELLPKSTYNELIEKDGTGALGSYEEVEKMNKYFYDLGKRLGILVTASSNVHYLDENEDIIRSILLYGSGTVYN---SRQYSINN------GFYFRTTDEMLQEFSYLGDEK-VKEVVITNTNKIADMIESGIKPIPEGFYPPKMENAEEIVRTMTYEKAYRIYGDPLPNIVSARLERELNAIINNGFSVLYLSAQKLVKKSLDNGYLVGSRGSVGSSLVAFMMGITEVNALYPHYICDNSECKYSEFIEREGVGIDLPDKICPKCGAKLRKDGYSIPFEVFMGFKGDKVPDIDLNFSGEYQSEIHRYCEELFGKENVFKAGTISTLAEKNAEAYVRKYFEDN-NLNAVRAEIIRLGRLCQGAKKTTGQHPGGMVIVPQGNSIYEFCPVQRPANDETSESTTTHYDYHVMDEQLVKLDILGHDDPTTIKLLQEYTNIEIKDIPLADKDTLKIFSSTESLGVTPEQIGT--EIGTYGIPEFGTGFVRQMLIDTRPTTFAELVRISGLSHGTNVWLNNAQEFVRNGQATLSQIITVRDDIMNYLIDQGLDNSDSFKIMEFVRKGKPKKEPENWEKYSAMMKEKNVPDWYIESCRRIEYMFPKGHAVAYVMMAMRIAYFKVHQPLAFYAAFLSRKADDFDMEVMSRG---ILAK-QKLEELSKEPKLDPKKKNEQ----AICEIVVELEARGLELLPVDIYLSDGKKFTIEDGKIRIPLIGINGLGGAVIDAIVKEREEGKFISVEDLKRRTKIQQPVVDKLKNIGAISSLSETNQISLF 1454
>gi|154484752|ref|ZP_02027200.1| hypothetical protein EUBVEN_02469 [Eubacterium ventriosum ATCC 27560] >gi|149734600|gb|EDM50517.1| hypothetical protein EUBVEN_02469 [Eubacterium ventriosum ATCC 27560] (1474 aa)
Score = 2071, Expect = 0.0e+00, Identities = 491/1236 (39%), Positives = 744/1236 (60%)
  Q:   223 TKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGK-KINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPDFYNE----------AKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKNPLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKRMLENQKLQDIKTLNEIN-SNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNF-DGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFIT---IGSPECFLHDIHREIYKRG-WIEDAI-------KRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNVDS-------------------------GFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTEQTNVNAD-TIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGL------------NEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVK--AREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           T L D+F      T++G+I  +D+  TKTG  I    +TD++DSI +K       + KD   ++K+G +V+ K     D ++       ++ +  IS      R D A+ KR EL  HT M+  +G+   K++ + + E G+ ++AITD    Q FPD ++E          A +    K IYGV+  ++D    +++N     ++D  YV+FD+ETTG S   DKIIE GA+K   G  ++    F+NPE  I  +I  +T I++E V DA KI+E L +  +F  DSV++AHN   FD+ F+  NCK ++ + D     +IDT+ +SR +   +  + L  +A+   I  D    HRA  DAE    I+ ++ +  + + I  L+E+N    Q+  L ++       +  KN+    NLYKLIS S    F +  P++   ++ E +   I+ ++   GE+++A +    Q     + + YD+     IG+ E  L     EI  R  ++ D++       K+II +  K+NK  VAT D ++L+  DE+Y R+           N+              Y RTTDE+  EF +L D  L  +IV+ N   I  +I+ NI PI      P ++ + + L+ + ++K++ ++G+ +   V+ R++ E++S+I NGYA++Y  +  LV +S +DGY+VGSRGSVGSS AA +  ITEVNPL PHY CT CK   FE  V                           G DLP   CP C   +  DG  IPFETF+GF G K PDIDLNFS  YQ  AH + + MFG+   FRAGTI+  AEKTAYGYVK+Y+EE  ++  R AEI RI++ C+ ++R+TGQHPGGIV+VP  K++Y+FTP   PA+D T D  TTH  + ++  +LLK DILGHD+PT+++ L + TN N +  +P  D  VM LF   ++L I +  I+    TGS G+PE GT+FV +ML+ TKP K SDL+ ISGLSHGT+VW  NA+ LIEE   TIS  I  RDDIMVYL+ KGI P ++F+IME VRKGKGL            NEE  +V++ +N+P WYI SC KI Y+FPKAHA AY++MA ++AW+K+Y PL +YA+YF+IR K F+ +++  G+ ++   + ++K K AN +    +  K+ D +   ++  E+  RG++F  ID+ K+ A +F +  + L+P    I+GLG+  A  +V+  A +   F SK + ++++K++ T ++ M  LG+   + ED Q+S+F+F
  S:   201 TNLCDVFEGTGECTVKGQIMTMDERETKTGKFIVTLEITDFTDSIAVKMFLADGNVLKDFKQKVKKGSFVRIKGVALYDTWDKQVEISRVDGMKSISPFATEKRKDTAVDKRIELHCHTKMSDMDGVSECKKIVRRAYEWGHKAIAITDHGVVQAFPDAWHEYEAIEAECEKAGRECDFKVIYGVEAYLVDDLKDMIVNPKGQHLND-RYVVFDLETTGFSAKSDKIIEIGAVKVENGKIIDRFSTFVNPEIPIPFRIEKLTSINDEMVIDAPKIEEILPQFMEFCKDSVMVAHNS-DFDMSFIEANCKRQDLECDFT---VIDTVAMSRYLIIGLGRYKLDNVAKALGIVLD--HHHRAVDDAECTALIFLKLCKMLEGKGIDNLDELNRQGKQSKNLIDKLPAHHAIILVKNQVGRVNLYKLISKSHIETFANKRPRILKSDYLELSEGLIIGSACEAGELYQAILHGKSQQEIARLAEFYDYFEVQPIGNNEFMLKTGDPEIDDRKKFLVDSVEELQEVNKKIIDLGKKFNKMTVATCDVHFLDPEDEIYRRIIQCGNGFKDADNQ-----------APLYLRTTDEMLKEFDYL-DSDLAEEIVIKNPARINDMIE-NISPIHPDKCPPVLDNSEENLRNICFEKAHDMYGEKLPKIVEDRLEVELNSIIGNGYAVMYIMAQRLVWKSNEDGYLVGSRGSVGSSFAATMSGITEVNPLAPHYYCTECKSSFFEDEVTVPDEADKEAVKEIQDTIRQLREDGGVGLDLPPRKCPYCGKDMCRDGFEIPFETFLGFGGTKEPDIDLNFSGEYQSNAHAYTEVMFGKGHTFRAGTIAGLAEKTAYGYVKNYYEEHGQIK-RTAEIDRISRGCQGIRRSTGQHPGGIVIVPRDKEIYEFTPIQKPANDMTTDIITTHFEYHAIDANLLKLDILGHDDPTMIRRLEKLTNTNVNRDVPINDPKVMSLFTGPEALGITSDDIDGC-PTGSLGLPELGTDFVIQMLVDTKPTKISDLVNISGLSHGTDVWLGNAQTLIEEGRCTISTAICTRDDIMVYLMHKGIEPQVSFQIMEHVRKGKGLQIYKDKKSGKEINEE--EVMHQHNVPDWYIGSCKKIKYMFPKAHAAAYIMMALRVAWYKVYIPLAYYAAYFAIRAKAFNYETMCRGKEKLEYYMADLKRKKANHE----IAKKDEDALGDMKVVQEMYARGFEFMPIDIYKAKAHEFQIIDNKLMPSLDTIEGLGEKAADGLVEAVANQSGPFVSKNELREKSKLSKTVIETMSSLGLLEGMPEDSQLSIFDF 1474
>gi|167759386|ref|ZP_02431513.1| hypothetical protein CLOSCI_01733 [Clostridium scindens ATCC 35704] >gi|167662943|gb|EDS07073.1| hypothetical protein CLOSCI_01733 [Clostridium scindens ATCC 35704] (1499 aa)
Score = 2069, Expect = 0.0e+00, Identities = 492/1286 (38%), Positives = 755/1286 (58%)
  Q:   173 EKTIDIISDHKNKIQEK--IKNEITEVKRSSNAKKTDSS---------------------FTYK---------FRKSVTGDVTKLSDLFFEMKTATIEGEIFKIDKVVTKTGYEIYKYFVTDYSDSIVIKALFGKKINKDVLSELKEGVWVKAKISIQIDMYENNDITGLIEEISIISKPKEFIRHDNALIKRTELVNHTNMTAFEGLVNIKELFKFSSEMGYSSVAITDKFNCQNFPD---FYNEAKKYSKLKAIYGVQFNIIDKNIPIVLNANDTKISDATYVIFDIETTGLSPYYDKIIEFGAIKYHKGVQVESIQMFINPEEKISDKIFAITKISNEDVKDALKIKEALVKIKDFIGDSVLIAHNGIKFDLPFL--NCKLEENKMDIIKN-PLIDTLQISRAINEQIHGHSLGVIARKYKIDYDETQAHRADKDAEYLLNIWKR---MLENQKLQDIKTLNEINSNLQNDFLRERNRGSLITVYCKNEGEIRNLYKLISTSLTSNFDGGPKVYWENFNEFNNSFIVSNSATEGEIFEAAMSNTQQVLEDIIKDKYDFITI---GSPECFL-HDIHREIYKRGWIEDAIKRIIKIANKYNKKVVATSDTYYLNESDEVYFRVYVNAKVLGGKRNRLFKYNELNTVLPKYYFRTTDELKDEFSFLNDPVLVNDIVVTNSNYIASLIDANIKPIKETLHSPHIEGASDKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEVNPLEPHYICTNCKYFNFEKNV------DSGFDLPESNCPKCKSKLKGDGHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAYGYVKSYFEESKKMNARNAEITRIAKKCENVKRTTGQHPGGIVVVPHGKDVYDFTPFNYPADDKTQDWFTTHLAFESLHDSLLKFDILGHDNPTILKMLTE--------------QTNVNADTIPNFDNDVMDLFNSTDSLKIKNPMINKILKTGSSGIPEFGTNFVKEMLLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEEKGLTISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKGKGLNEEYQKVLNDNNIPTWYIESCNKISYLFPKAHATAYVIMAWKIAWFKIYYPLHFYASYFSIRIKVFDIKSILNGESEITNKINEIKEKMANPKTKALVKNKELDLIPIYELALELLGRGYKFANIDLKKSLATDFLVEGDYLIPPFSAIDGLGDSVATSIVKAREEKMFSSKEDFKKRTKVTTTHMKIMEELGITSSLNEDDQISLFNF 1458
           ++ +D I +H   +QE+  +K +  + K  +++K T S                      F+YK         F +    +  +L  L  EM   TI G++   D    +    I  Y VTD++D+I++K     +   D+L+++K+G ++K K    ID ++     G I  I  I+   E  R D A  KR EL  HT M+  +G+  +K+L K + + G+ ++AITD    Q FPD   +     K    K IYGV+  ++D    + L      + D  YV+FD+ETTG SP  DKIIE GA+K   G   E    F+NP+  I  +I  +T I+++ V DA  I   L +  +FIGD+VL+AHN   FD+ F+  NC+ +    DI+ N   +DT+ ++R +   +    L V+A    I  +    HRA  DA     I+ +   ML+ + + D+  LN+  SN   D +++     +I +     G + NLY LIS S    +   P++     +++    +V ++   GE+++A ++   +     I + YD++ I   G+    +  D    +     ++   K+I+ + +++NK VV T D ++++  DEVY R+ +  K  G    +              Y RTTDE+ +EF +L       +IV+ N   IA + +  I P++     P I  +   L+++ Y K++S++G+ +   V  R++RE++S+I NG+A++Y  +  LV +S +DGY+VGSRGSVGSS  A +  ITEVNPL PHY C +C Y +FE           G+D+P+ NCP C  KL  DG +IPFETF+GFKG+K PDIDLNFS  YQ  AH + + +FG  + +RAGT+ T A+KTA+GYVK+Y+EE +    RN EI RI + C  ++R+TGQHPGGI+V+P G+++  FTP  +PA+D T D  TTH  + S+  +LLK DILGHD+PT++K L E                   A  IP  D  VM LF+ T +L IK   I      G  GIPEFGT+FV +M++ T+P+  SDLIRISGLSHGT+VW +NA+ LI+    TIS  I  RDDIM YLI+KG+   ++F IME VRKGKGL ++++K + +  +P WYI SC +I Y+FPKAHA AYV+MA++IA+ KI YPL +Y +YF IR   F  + +  G+  + + I+E   +       A +  KE D +   ++  E+  RGY+F  +D+ K+ AT FL+    L+PP S+IDG+G+  A ++ +A ++  + S++DF++RTK + + +  M ELGI S L E +Q+SLF+F
  S:   181 KQEVDAILEHAEAVQEEKELKKKAQDEKEGASSKPTKSQNGNGAGKKEKKAFFGNGRRDGFSYKKNSNDPNLIFGRDFDDETIELKQLVGEMGEITIRGKVISFDTREIRNEKTIIMYAVTDFTDTIMVKMFVRNEQLPDILADVKKGAFLKIKGVTTIDKFDGELTIGSITGIRKINDFTE-SRKDTAPEKRVELHCHTKMSDMDGVSEVKDLVKRAHDWGHKAIAITDHGVVQAFPDANHYIETLDKDDPFKVIYGVEGYLVDDLTDVALGEKGQTLDD-VYVVFDLETTGFSPIKDKIIEIGAVKVENGKITERFSTFVNPKIPIPFRITQLTSITDQMVMDAPDIDTVLPQFLEFIGDAVLVAHNA-SFDVGFIEQNCRYQ----DIVPNFTSVDTVAMARILLPTLSKFKLNVVANALHISLE--NHHRAVDDAGATAEIFVKFVEMLKERNINDLARLNQFGSN-NADAIKKLPTYHVIILALNEVGRV-NLYTLISKSHLDYYARRPRIPKSELSKYREGLMVGSACEAGELYQAILNEKSEERIARIVNFYDYLEIQPLGNNRFMIASDRIENVQSEEDLKKINKKIVDLGDRFNKPVVGTCDVHFMDPEDEVYRRIIMAGKGFGDADEQ-----------APLYLRTTDEMLEEFEYLGS-TKAKEIVIDNPCKIADMAE-KITPVRPDKCPPVIPDSDKMLREICYNKAHSMYGEELPPIVTERLERELNSIISNGFAVMYIIAQKLVWKSNEDGYLVGSRGSVGSSFVATMAGITEVNPLSPHYYCKHCHYSDFESEEVRAFAGGCGWDMPDKNCPVCGEKLVKDGFDIPFETFLGFKGNKEPDIDLNFSGDYQSNAHKYTEVIFGAGQTYRAGTVGTLADKTAFGYVKNYYEE-RGQRKRNCEIDRIVQGCTGIRRSTGQHPGGIIVLPLGEEINSFTPVQHPANDMTTDIVTTHFDYHSIDHNLLKLDILGHDDPTMIKTLEEYISSPALENEYNESDNRFVATKIPLDDKGVMSLFHDTSALGIKPDDIGGC-PVGCLGIPEFGTDFVVQMVVDTQPKTLSDLIRISGLSHGTDVWLNNAQELIKSGKATISTAICTRDDIMTYLINKGMDSELSFTIMEKVRKGKGLTDDFEKSMKEAGVPDWYIWSCKQIKYMFPKAHAAAYVMMAYRIAYCKINYPLAYYGAYFGIRADAFSYEIMCRGKDVLQHYIDEYNSR------SATLSKKEQDTMKDMKIVQEMYARGYEFMPMDIYKAQATKFLIIDGKLMPPLSSIDGMGEKAAEAVAEASKDGPYLSRDDFRQRTKASKSVIDYMVELGILSDLPESNQLSLFDF 1499
>gi|148322880|gb|EDK88130.1| DNA-directed DNA polymerase III alpha subunit [Fusobacterium nucleatum subsp. polymorphu