>gi|26553545|ref|NP_757479.1| hypothetical protein MYPE920 [Mycoplasma penetrans HF-2] >gi|26453551|dbj|BAC43883.1| hypothetical protein [Mycoplasma penetrans HF-2] (240 aa)
Score = 821, Expect = 3.9e-86, Identities = 239/240 (99%), Positives = 240/240 (100%)
  Q:     1 LTKYKEINMSTSASFNKIKQILSNIKNQIDSFQDKVNNLSSDNAVIHDFKFRYNKYRRYNSVVSDFDDNNLTREEKINLFNQKRTERIEDIKKQINFVDYIFSEESNNETQASKIKTIKGVLSNKEYDLNESDINSICDAIISNDEGKKEQLLEELTHKEVSDSTTQDSLSDLILTQDFLSKLKKEGKEISTNFEIKSKENVDNECSWLDDGNLELQSNQINKNNGSIDKEDFISLLNKK 240
           +TKYKEINMSTSASFNKIKQILSNIKNQIDSFQDKVNNLSSDNAVIHDFKFRYNKYRRYNSVVSDFDDNNLTREEKINLFNQKRTERIEDIKKQINFVDYIFSEESNNETQASKIKTIKGVLSNKEYDLNESDINSICDAIISNDEGKKEQLLEELTHKEVSDSTTQDSLSDLILTQDFLSKLKKEGKEISTNFEIKSKENVDNECSWLDDGNLELQSNQINKNNGSIDKEDFISLLNKK
  S:     1 MTKYKEINMSTSASFNKIKQILSNIKNQIDSFQDKVNNLSSDNAVIHDFKFRYNKYRRYNSVVSDFDDNNLTREEKINLFNQKRTERIEDIKKQINFVDYIFSEESNNETQASKIKTIKGVLSNKEYDLNESDINSICDAIISNDEGKKEQLLEELTHKEVSDSTTQDSLSDLILTQDFLSKLKKEGKEISTNFEIKSKENVDNECSWLDDGNLELQSNQINKNNGSIDKEDFISLLNKK 240
>gi|149639729|ref|XP_001515423.1| PREDICTED: similar to Titin (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) [Ornithorhynchus anatinus] (12801 aa)
Score = 86, Expect = 6.8e-01, Identities = 24/69 (34%), Positives = 46/69 (66%)
  Q:   104 EESNNETQASKIKT-----IKGVLSNKEY---DLNESDINSICDAIISNDEGKKEQLLEELTHKEVSDSTTQDSLSD 172
           +E++ E   SK+KT     I+  LS K     ++ +S+++S+  A+I  +  KK Q+ E+++H EV   +TQ ++S+
  S: 12353 QETSREASVSKVKTSEKSAIQEKLSQKALISEEIKKSEVSSLEKAVIQEEVIKKAQVSEDISHTEVKAFSTQMNVSE 12429